BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23890_g3_i1 len=1023 path=[3559:0-510 4070:511-548 11074:549-1022]

Length=1023
                                                                      Score     E

ref|XP_004236781.1|  PREDICTED: pentatricopeptide repeat-containi...    458   2e-154   
ref|XP_009767473.1|  PREDICTED: pentatricopeptide repeat-containi...    457   7e-154   
ref|XP_006361415.1|  PREDICTED: pentatricopeptide repeat-containi...    455   4e-153   
emb|CDO99996.1|  unnamed protein product                                447   2e-152   
ref|XP_009612667.1|  PREDICTED: pentatricopeptide repeat-containi...    452   6e-152   
ref|XP_008218329.1|  PREDICTED: pentatricopeptide repeat-containi...    449   1e-150   
ref|XP_009343763.1|  PREDICTED: pentatricopeptide repeat-containi...    449   2e-150   
ref|XP_004304772.1|  PREDICTED: pentatricopeptide repeat-containi...    443   1e-148   
ref|XP_007030407.1|  Pentatricopeptide repeat (PPR-like) superfam...    439   5e-147   
ref|XP_008370748.1|  PREDICTED: pentatricopeptide repeat-containi...    440   1e-146   
ref|XP_010265021.1|  PREDICTED: pentatricopeptide repeat-containi...    436   1e-145   
ref|XP_010660210.1|  PREDICTED: pentatricopeptide repeat-containi...    434   8e-145   
ref|XP_002266822.2|  PREDICTED: pentatricopeptide repeat-containi...    432   4e-144   Vitis vinifera
ref|XP_011076945.1|  PREDICTED: pentatricopeptide repeat-containi...    430   2e-143   
emb|CAN67401.1|  hypothetical protein VITISV_025967                     427   3e-142   Vitis vinifera
gb|KDP23717.1|  hypothetical protein JCGZ_23550                         427   5e-142   
ref|XP_010102224.1|  hypothetical protein L484_024505                   420   2e-139   
ref|XP_011038512.1|  PREDICTED: pentatricopeptide repeat-containi...    420   3e-139   
ref|XP_007205118.1|  hypothetical protein PRUPE_ppa004835mg             415   1e-138   
ref|XP_002884468.1|  pentatricopeptide repeat-containing protein        415   2e-137   
ref|XP_008443759.1|  PREDICTED: pentatricopeptide repeat-containi...    415   2e-137   
ref|XP_002521980.1|  pentatricopeptide repeat-containing protein,...    414   3e-137   Ricinus communis
ref|XP_009124196.1|  PREDICTED: pentatricopeptide repeat-containi...    414   3e-137   
ref|XP_010485860.1|  PREDICTED: pentatricopeptide repeat-containi...    414   8e-137   
ref|XP_010463963.1|  PREDICTED: pentatricopeptide repeat-containi...    414   1e-136   
emb|CDY50755.1|  BnaAnng10620D                                          412   1e-136   
emb|CDY41899.1|  BnaC05g47050D                                          412   2e-136   
ref|XP_009379757.1|  PREDICTED: pentatricopeptide repeat-containi...    416   3e-136   
ref|XP_006296608.1|  hypothetical protein CARUB_v10013258mg             412   3e-136   
ref|XP_004142590.1|  PREDICTED: pentatricopeptide repeat-containi...    409   4e-135   
ref|XP_010523366.1|  PREDICTED: pentatricopeptide repeat-containi...    407   1e-134   
ref|NP_566237.1|  pentatricopeptide repeat-containing protein           408   2e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418757.1|  PREDICTED: pentatricopeptide repeat-containi...    407   3e-134   
ref|XP_006371094.1|  hypothetical protein POPTR_0019s03630g             405   7e-134   
dbj|BAD95034.1|  hypothetical protein                                   404   4e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010024947.1|  PREDICTED: pentatricopeptide repeat-containi...    402   1e-132   
ref|XP_010694937.1|  PREDICTED: pentatricopeptide repeat-containi...    402   2e-132   
ref|XP_011036314.1|  PREDICTED: pentatricopeptide repeat-containi...    399   3e-131   
ref|XP_010523367.1|  PREDICTED: pentatricopeptide repeat-containi...    393   3e-129   
ref|XP_003590960.1|  Pentatricopeptide repeat-containing protein        392   1e-128   
gb|KFK37890.1|  hypothetical protein AALP_AA3G042500                    388   4e-128   
ref|XP_006487702.1|  PREDICTED: pentatricopeptide repeat-containi...    390   1e-127   
ref|XP_008389018.1|  PREDICTED: pentatricopeptide repeat-containi...    392   2e-127   
ref|XP_006442665.1|  hypothetical protein CICLE_v10019446mg             389   3e-127   
ref|XP_009420922.1|  PREDICTED: pentatricopeptide repeat-containi...    399   2e-126   
ref|XP_007144014.1|  hypothetical protein PHAVU_007G121900g             386   2e-126   
ref|XP_006375855.1|  pentatricopeptide repeat-containing family p...    380   4e-125   
gb|EYU19809.1|  hypothetical protein MIMGU_mgv1a005320mg                378   2e-124   
gb|EPS74045.1|  hypothetical protein M569_00706                         373   4e-122   
ref|XP_003555568.1|  PREDICTED: pentatricopeptide repeat-containi...    371   2e-120   
ref|XP_009612668.1|  PREDICTED: pentatricopeptide repeat-containi...    366   3e-120   
ref|XP_006589209.1|  PREDICTED: pentatricopeptide repeat-containi...    370   3e-120   
ref|XP_003521773.1|  PREDICTED: pentatricopeptide repeat-containi...    367   6e-119   
gb|KDO44558.1|  hypothetical protein CISIN_1g047017mg                   360   1e-116   
ref|XP_006857320.1|  hypothetical protein AMTR_s00067p00076830          355   6e-114   
ref|XP_006408151.1|  hypothetical protein EUTSA_v10022408mg             345   4e-112   
emb|CBI22375.3|  unnamed protein product                                343   8e-112   
gb|KHN04951.1|  Pentatricopeptide repeat-containing protein, chlo...    345   1e-111   
ref|XP_004494750.1|  PREDICTED: pentatricopeptide repeat-containi...    342   3e-109   
ref|XP_009364581.1|  PREDICTED: pentatricopeptide repeat-containi...    320   1e-102   
ref|XP_006360522.1|  PREDICTED: pentatricopeptide repeat-containi...    276   7e-85    
ref|XP_006856585.1|  hypothetical protein AMTR_s00046p00202770          277   4e-84    
ref|XP_010104578.1|  hypothetical protein L484_025557                   278   5e-84    
ref|XP_010544054.1|  PREDICTED: pentatricopeptide repeat-containi...    277   5e-84    
emb|CAN61988.1|  hypothetical protein VITISV_026694                     275   9e-84    Vitis vinifera
ref|XP_006364562.1|  PREDICTED: pentatricopeptide repeat-containi...    276   2e-83    
ref|XP_010321813.1|  PREDICTED: pentatricopeptide repeat-containi...    276   2e-83    
ref|XP_008444958.1|  PREDICTED: pentatricopeptide repeat-containi...    276   2e-83    
ref|XP_002285611.1|  PREDICTED: pentatricopeptide repeat-containi...    276   3e-83    Vitis vinifera
ref|XP_011071341.1|  PREDICTED: pentatricopeptide repeat-containi...    275   3e-83    
ref|XP_006472405.1|  PREDICTED: pentatricopeptide repeat-containi...    275   4e-83    
ref|XP_010671063.1|  PREDICTED: pentatricopeptide repeat-containi...    275   5e-83    
gb|KDO81276.1|  hypothetical protein CISIN_1g043144mg                   274   6e-83    
ref|XP_006433766.1|  hypothetical protein CICLE_v10000605mg             274   2e-82    
ref|XP_009800134.1|  PREDICTED: pentatricopeptide repeat-containi...    273   2e-82    
ref|XP_007018302.1|  Pentatricopeptide repeat (PPR-like) superfam...    273   2e-82    
ref|XP_011016979.1|  PREDICTED: pentatricopeptide repeat-containi...    272   4e-82    
ref|XP_010254618.1|  PREDICTED: pentatricopeptide repeat-containi...    273   4e-82    
ref|XP_004288876.1|  PREDICTED: pentatricopeptide repeat-containi...    272   5e-82    
ref|XP_009595574.1|  PREDICTED: pentatricopeptide repeat-containi...    271   1e-81    
ref|XP_002302359.2|  hypothetical protein POPTR_0002s11020g             272   1e-81    Populus trichocarpa [western balsam poplar]
ref|XP_010917143.1|  PREDICTED: pentatricopeptide repeat-containi...    270   2e-81    
emb|CDX94933.1|  BnaC05g07380D                                          270   3e-81    
gb|KFK43289.1|  hypothetical protein AALP_AA1G104700                    270   3e-81    
ref|XP_003523769.1|  PREDICTED: pentatricopeptide repeat-containi...    270   4e-81    
ref|XP_008378619.1|  PREDICTED: pentatricopeptide repeat-containi...    270   5e-81    
gb|KHN09027.1|  Pentatricopeptide repeat-containing protein             267   6e-81    
ref|XP_004170776.1|  PREDICTED: pentatricopeptide repeat-containi...    271   6e-81    
ref|XP_008338987.1|  PREDICTED: pentatricopeptide repeat-containi...    269   7e-81    
ref|XP_009366374.1|  PREDICTED: pentatricopeptide repeat-containi...    269   8e-81    
ref|XP_009148305.1|  PREDICTED: pentatricopeptide repeat-containi...    268   1e-80    
ref|XP_010061566.1|  PREDICTED: pentatricopeptide repeat-containi...    269   1e-80    
ref|NP_172461.1|  pentatricopeptide repeat-containing protein           268   2e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDX93465.1|  BnaA06g05830D                                          268   2e-80    
ref|XP_002889775.1|  pentatricopeptide repeat-containing protein        268   2e-80    
ref|XP_003527866.1|  PREDICTED: pentatricopeptide repeat-containi...    268   3e-80    
ref|XP_004501057.1|  PREDICTED: pentatricopeptide repeat-containi...    267   4e-80    
ref|XP_008219211.1|  PREDICTED: pentatricopeptide repeat-containi...    267   6e-80    
ref|XP_009402131.1|  PREDICTED: pentatricopeptide repeat-containi...    266   6e-80    
ref|XP_010490447.1|  PREDICTED: pentatricopeptide repeat-containi...    266   1e-79    
ref|XP_007137661.1|  hypothetical protein PHAVU_009G145100g             266   1e-79    
emb|CDP00950.1|  unnamed protein product                                265   5e-79    
gb|KHN08231.1|  Pentatricopeptide repeat-containing protein             260   9e-79    
ref|XP_006596395.1|  PREDICTED: pentatricopeptide repeat-containi...    249   3e-75    
ref|XP_007141295.1|  hypothetical protein PHAVU_008G183900g             249   2e-73    
ref|XP_006596392.1|  PREDICTED: pentatricopeptide repeat-containi...    249   2e-73    
gb|EPS61251.1|  hypothetical protein M569_13548                         246   5e-73    
gb|KHN39972.1|  Pentatricopeptide repeat-containing protein             247   2e-72    
ref|XP_007141297.1|  hypothetical protein PHAVU_008G184000g             242   2e-70    
ref|XP_004490467.1|  PREDICTED: pentatricopeptide repeat-containi...    240   5e-70    
ref|XP_006306156.1|  hypothetical protein CARUB_v10011677mg             238   4e-69    
dbj|BAD15828.1|  putative pentatricopeptide (PPR) repeat-containi...    237   5e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003575182.1|  PREDICTED: pentatricopeptide repeat-containi...    236   9e-69    
ref|XP_006575366.1|  PREDICTED: pentatricopeptide repeat-containi...    236   2e-68    
gb|AFK46081.1|  unknown                                                 228   3e-68    
gb|EYU45465.1|  hypothetical protein MIMGU_mgv1a003559mg                233   2e-67    
ref|XP_006647398.1|  PREDICTED: pentatricopeptide repeat-containi...    230   2e-66    
dbj|BAK03057.1|  predicted protein                                      228   2e-65    
ref|XP_004488838.1|  PREDICTED: pentatricopeptide repeat-containi...    228   2e-65    
ref|NP_001141010.1|  hypothetical protein                               227   3e-65    Zea mays [maize]
emb|CDM84445.1|  unnamed protein product                                229   5e-65    
dbj|BAJ91202.1|  predicted protein                                      228   8e-65    
gb|EAY86332.1|  hypothetical protein OsI_07707                          226   8e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_004952727.1|  PREDICTED: pentatricopeptide repeat-containi...    224   3e-64    
gb|EAZ23484.1|  hypothetical protein OsJ_07180                          221   6e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007222300.1|  hypothetical protein PRUPE_ppa003362mg             224   7e-64    
ref|XP_002986246.1|  hypothetical protein SELMODRAFT_123660             224   7e-63    
ref|XP_002456450.1|  hypothetical protein SORBIDRAFT_03g036550          220   6e-62    Sorghum bicolor [broomcorn]
ref|XP_011030727.1|  PREDICTED: pentatricopeptide repeat-containi...    217   2e-61    
ref|XP_002317023.2|  hypothetical protein POPTR_0011s14750g             217   2e-61    Populus trichocarpa [western balsam poplar]
ref|XP_003564359.1|  PREDICTED: pentatricopeptide repeat-containi...    216   1e-60    
ref|XP_010062706.1|  PREDICTED: pentatricopeptide repeat-containi...    214   2e-60    
ref|XP_008657162.1|  PREDICTED: pentatricopeptide repeat-containi...    215   5e-60    
ref|NP_001044451.1|  Os01g0783100                                       214   1e-59    Oryza sativa Japonica Group [Japonica rice]
gb|EAY76069.1|  hypothetical protein OsI_03997                          214   1e-59    Oryza sativa Indica Group [Indian rice]
ref|XP_006585428.1|  PREDICTED: pentatricopeptide repeat-containi...    208   1e-59    
ref|XP_010667980.1|  PREDICTED: pentatricopeptide repeat-containi...    212   1e-59    
gb|KEH38355.1|  PPR containing plant-like protein                       211   4e-59    
ref|XP_002513427.1|  pentatricopeptide repeat-containing protein,...    211   5e-59    Ricinus communis
gb|EAZ13767.1|  hypothetical protein OsJ_03693                          213   5e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008645840.1|  PREDICTED: pentatricopeptide repeat-containi...    213   5e-59    
gb|AFW71875.1|  hypothetical protein ZEAMMB73_225396                    213   9e-59    
ref|XP_004972201.1|  PREDICTED: pentatricopeptide repeat-containi...    211   1e-58    
ref|XP_010246803.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-58    
ref|XP_006598186.1|  PREDICTED: pentatricopeptide repeat-containi...    208   3e-58    
ref|XP_002527349.1|  pentatricopeptide repeat-containing protein,...    205   4e-58    Ricinus communis
ref|XP_003531505.1|  PREDICTED: pentatricopeptide repeat-containi...    208   4e-58    
gb|KDP25129.1|  hypothetical protein JCGZ_22664                         207   9e-58    
ref|XP_009361764.1|  PREDICTED: pentatricopeptide repeat-containi...    207   1e-57    
ref|XP_006441032.1|  hypothetical protein CICLE_v10019503mg             207   1e-57    
ref|XP_010904671.1|  PREDICTED: pentatricopeptide repeat-containi...    207   1e-57    
ref|XP_009397366.1|  PREDICTED: pentatricopeptide repeat-containi...    207   1e-57    
ref|XP_006836423.1|  hypothetical protein AMTR_s00092p00157010          204   2e-57    
ref|XP_009371377.1|  PREDICTED: pentatricopeptide repeat-containi...    206   2e-57    
ref|XP_008444287.1|  PREDICTED: pentatricopeptide repeat-containi...    206   2e-57    
ref|XP_008809744.1|  PREDICTED: pentatricopeptide repeat-containi...    206   3e-57    
ref|XP_004294203.1|  PREDICTED: pentatricopeptide repeat-containi...    206   3e-57    
ref|XP_008383030.1|  PREDICTED: pentatricopeptide repeat-containi...    206   3e-57    
ref|XP_006478018.1|  PREDICTED: pentatricopeptide repeat-containi...    205   4e-57    
ref|XP_006828897.1|  hypothetical protein AMTR_s00001p00191590          204   5e-57    
ref|XP_008226294.1|  PREDICTED: pentatricopeptide repeat-containi...    205   5e-57    
ref|XP_006382761.1|  hypothetical protein POPTR_0005s05170g             204   5e-57    
ref|XP_010099594.1|  hypothetical protein L484_004026                   205   5e-57    
gb|KDO53403.1|  hypothetical protein CISIN_1g041458mg                   204   7e-57    
ref|XP_007149272.1|  hypothetical protein PHAVU_005G056300g             204   8e-57    
ref|XP_011014088.1|  PREDICTED: pentatricopeptide repeat-containi...    204   1e-56    
emb|CDP13612.1|  unnamed protein product                                203   2e-56    
ref|XP_007022279.1|  Pentatricopeptide repeat (PPR) superfamily p...    203   2e-56    
gb|KGN62769.1|  hypothetical protein Csa_2G372160                       202   3e-56    
ref|XP_011095678.1|  PREDICTED: pentatricopeptide repeat-containi...    203   3e-56    
ref|XP_006487703.1|  PREDICTED: pentatricopeptide repeat-containi...    202   1e-55    
ref|XP_009627086.1|  PREDICTED: pentatricopeptide repeat-containi...    202   1e-55    
ref|XP_002300545.1|  pentatricopeptide repeat-containing family p...    201   1e-55    Populus trichocarpa [western balsam poplar]
ref|XP_010235562.1|  PREDICTED: pentatricopeptide repeat-containi...    204   1e-55    
ref|XP_006346048.1|  PREDICTED: pentatricopeptide repeat-containi...    201   1e-55    
ref|XP_004952738.1|  PREDICTED: pentatricopeptide repeat-containi...    203   2e-55    
ref|XP_006382765.1|  hypothetical protein POPTR_0005s05210g             199   3e-55    
ref|XP_009764172.1|  PREDICTED: pentatricopeptide repeat-containi...    200   4e-55    
ref|XP_011032465.1|  PREDICTED: putative pentatricopeptide repeat...    200   5e-55    
gb|AGT16467.1|  pentatricopeptide repeat-containing protein             200   7e-55    
ref|XP_004243988.1|  PREDICTED: pentatricopeptide repeat-containi...    199   1e-54    
gb|KDO44556.1|  hypothetical protein CISIN_1g008129mg                   199   1e-54    
ref|XP_004162287.1|  PREDICTED: pentatricopeptide repeat-containi...    199   1e-54    
ref|XP_004144640.1|  PREDICTED: pentatricopeptide repeat-containi...    198   1e-54    
ref|XP_002454021.1|  hypothetical protein SORBIDRAFT_04g023230          200   2e-54    Sorghum bicolor [broomcorn]
gb|EAY94297.1|  hypothetical protein OsI_16066                          198   4e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_008364411.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    197   5e-54    
ref|XP_006442666.1|  hypothetical protein CICLE_v10019470mg             197   7e-54    
ref|XP_011003803.1|  PREDICTED: putative pentatricopeptide repeat...    197   7e-54    
ref|XP_006387304.1|  hypothetical protein POPTR_1306s00200g             196   9e-54    
ref|XP_002269984.1|  PREDICTED: pentatricopeptide repeat-containi...    196   1e-53    Vitis vinifera
ref|XP_009406725.1|  PREDICTED: pentatricopeptide repeat-containi...    196   1e-53    
gb|ABR17050.1|  unknown                                                 192   1e-53    Picea sitchensis
gb|EPS64127.1|  hypothetical protein M569_10653                         196   1e-53    
ref|XP_011032466.1|  PREDICTED: putative pentatricopeptide repeat...    197   2e-53    
ref|XP_009333596.1|  PREDICTED: uncharacterized protein LOC103926525    198   2e-53    
gb|EYU27532.1|  hypothetical protein MIMGU_mgv1a003642mg                195   2e-53    
ref|XP_006382722.1|  helicase domain-containing family protein          195   3e-53    
ref|XP_008380490.1|  PREDICTED: pentatricopeptide repeat-containi...    196   5e-53    
ref|XP_007031097.1|  ATP binding,nucleic acid binding,helicases, ...    194   9e-53    
ref|XP_011032541.1|  PREDICTED: putative pentatricopeptide repeat...    194   1e-52    
ref|XP_004975751.1|  PREDICTED: pentatricopeptide repeat-containi...    194   1e-52    
ref|XP_006382709.1|  hypothetical protein POPTR_0005s04650g             192   1e-52    
ref|XP_006856874.1|  hypothetical protein AMTR_s00055p00195550          191   2e-52    
ref|XP_002991129.1|  hypothetical protein SELMODRAFT_236212             194   2e-52    
ref|XP_006389923.1|  hypothetical protein EUTSA_v10018334mg             192   3e-52    
ref|XP_010531973.1|  PREDICTED: pentatricopeptide repeat-containi...    192   3e-52    
ref|XP_002975593.1|  hypothetical protein SELMODRAFT_103638             190   5e-52    
gb|KEH38356.1|  PPR containing plant-like protein                       189   5e-52    
ref|XP_006382719.1|  pentatricopeptide repeat-containing family p...    193   5e-52    
ref|XP_011003821.1|  PREDICTED: putative pentatricopeptide repeat...    190   5e-52    
ref|XP_002319601.2|  hypothetical protein POPTR_0013s03290g             190   5e-52    Populus trichocarpa [western balsam poplar]
ref|XP_010273577.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    193   7e-52    
emb|CAZ40335.1|  non restoring pentatricopeptide repeat                 192   8e-52    Raphanus sativus
ref|XP_002889230.1|  pentatricopeptide repeat-containing protein        191   8e-52    
ref|XP_010687866.1|  PREDICTED: pentatricopeptide repeat-containi...    193   9e-52    
gb|AAP86199.1|  pentatricopeptide repeat-containing protein             192   9e-52    Raphanus sativus
ref|XP_002976066.1|  hypothetical protein SELMODRAFT_53130              188   9e-52    
ref|NP_001140656.1|  hypothetical protein                               191   1e-51    Zea mays [maize]
ref|XP_011019656.1|  PREDICTED: putative pentatricopeptide repeat...    189   1e-51    
ref|XP_011032518.1|  PREDICTED: putative pentatricopeptide repeat...    192   1e-51    
gb|KDP42576.1|  hypothetical protein JCGZ_24350                         192   1e-51    
ref|XP_006341056.1|  PREDICTED: pentatricopeptide repeat-containi...    192   2e-51    
gb|AAC17075.1|  Contains repeats similar to RECA protein gb|L2610...    190   3e-51    Arabidopsis thaliana [mouse-ear cress]
ref|NP_178029.2|  pentatricopeptide repeat-containing protein           190   3e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008365653.1|  PREDICTED: pentatricopeptide repeat-containi...    189   3e-51    
ref|XP_006857319.1|  hypothetical protein AMTR_s00067p00076570          188   4e-51    
emb|CAZ44328.1|  restoring pentatricopeptide repeat protein homol...    191   4e-51    Raphanus sativus
ref|XP_008644688.1|  PREDICTED: pentatricopeptide repeat-containi...    190   5e-51    
ref|XP_010430360.1|  PREDICTED: pentatricopeptide repeat-containi...    189   6e-51    
ref|XP_006300886.1|  hypothetical protein CARUB_v10019976mg             189   6e-51    
ref|XP_004246460.1|  PREDICTED: pentatricopeptide repeat-containi...    191   6e-51    
ref|XP_007044407.1|  Pentatricopeptide repeat (PPR-like) superfam...    190   7e-51    
ref|XP_006389305.1|  hypothetical protein POPTR_0030s00250g             189   7e-51    
ref|XP_011032524.1|  PREDICTED: putative pentatricopeptide repeat...    188   8e-51    
ref|XP_003581269.1|  PREDICTED: pentatricopeptide repeat-containi...    188   1e-50    
ref|XP_010529844.1|  PREDICTED: pentatricopeptide repeat-containi...    190   1e-50    
ref|XP_002972555.1|  hypothetical protein SELMODRAFT_97527              187   1e-50    
gb|KDP35601.1|  hypothetical protein JCGZ_09039                         189   1e-50    
ref|XP_002984987.1|  hypothetical protein SELMODRAFT_20977              186   1e-50    
ref|XP_002968006.1|  hypothetical protein SELMODRAFT_88008              189   1e-50    
ref|XP_009759610.1|  PREDICTED: pentatricopeptide repeat-containi...    189   1e-50    
ref|XP_002992403.1|  hypothetical protein SELMODRAFT_42645              185   1e-50    
ref|XP_011003802.1|  PREDICTED: putative pentatricopeptide repeat...    188   1e-50    
ref|XP_008365654.1|  PREDICTED: pentatricopeptide repeat-containi...    187   2e-50    
ref|XP_009586919.1|  PREDICTED: pentatricopeptide repeat-containi...    189   2e-50    
ref|XP_006382763.1|  hypothetical protein POPTR_0005s05190g             187   2e-50    
ref|XP_002968311.1|  hypothetical protein SELMODRAFT_89033              187   3e-50    
ref|XP_002871729.1|  pentatricopeptide repeat-containing protein        186   3e-50    
ref|XP_002985098.1|  hypothetical protein SELMODRAFT_121399             188   3e-50    
dbj|BAC10183.1|  pentatricopeptide repeat protein-like                  187   3e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008806452.1|  PREDICTED: pentatricopeptide repeat-containi...    184   4e-50    
ref|NP_001060305.2|  Os07g0621100                                       188   4e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010906795.1|  PREDICTED: pentatricopeptide repeat-containi...    187   4e-50    
ref|XP_002985064.1|  hypothetical protein SELMODRAFT_424099             191   5e-50    
ref|XP_006382058.1|  hypothetical protein POPTR_0006s25890g             186   7e-50    
gb|KFK25885.1|  hypothetical protein AALP_AA8G174800                    184   7e-50    
ref|XP_008802693.1|  PREDICTED: pentatricopeptide repeat-containi...    182   8e-50    
ref|XP_006648752.1|  PREDICTED: pentatricopeptide repeat-containi...    186   8e-50    
ref|XP_002309564.2|  hypothetical protein POPTR_0006s25910g             186   8e-50    Populus trichocarpa [western balsam poplar]
gb|KDP42623.1|  hypothetical protein JCGZ_24397                         180   9e-50    
gb|KHN27740.1|  Pentatricopeptide repeat-containing protein, chlo...    183   9e-50    
ref|XP_011048920.1|  PREDICTED: putative pentatricopeptide repeat...    186   9e-50    
ref|XP_002466902.1|  hypothetical protein SORBIDRAFT_01g016180          186   1e-49    Sorghum bicolor [broomcorn]
gb|EEC74319.1|  hypothetical protein OsI_09597                          189   1e-49    Oryza sativa Indica Group [Indian rice]
ref|XP_006382641.1|  hypothetical protein POPTR_0005s04060g             184   1e-49    
ref|XP_006389306.1|  hypothetical protein POPTR_0030s00260g             183   1e-49    
ref|XP_006838717.1|  hypothetical protein AMTR_s00002p00251730          188   1e-49    
ref|XP_008365652.1|  PREDICTED: pentatricopeptide repeat-containi...    186   1e-49    
ref|XP_010270981.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    187   1e-49    
ref|XP_008802162.1|  PREDICTED: pentatricopeptide repeat-containi...    185   1e-49    
gb|KFK25884.1|  hypothetical protein AALP_AA8G174800                    184   1e-49    
gb|KDP42575.1|  hypothetical protein JCGZ_24349                         184   2e-49    
ref|XP_010472747.1|  PREDICTED: pentatricopeptide repeat-containi...    185   2e-49    
ref|XP_010541010.1|  PREDICTED: pentatricopeptide repeat-containi...    186   2e-49    
gb|KFK42287.1|  hypothetical protein AALP_AA2G236000                    184   2e-49    
ref|XP_010453827.1|  PREDICTED: pentatricopeptide repeat-containi...    183   3e-49    
gb|KDO44671.1|  hypothetical protein CISIN_1g038622mg                   184   3e-49    
ref|XP_006298951.1|  hypothetical protein CARUB_v10015076mg             187   3e-49    
ref|XP_010418455.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    185   3e-49    
ref|NP_001059422.1|  Os07g0300200                                       187   3e-49    
gb|EMT15761.1|  hypothetical protein F775_21658                         182   3e-49    
ref|XP_011032523.1|  PREDICTED: putative pentatricopeptide repeat...    184   3e-49    
ref|XP_010417523.1|  PREDICTED: pentatricopeptide repeat-containi...    184   3e-49    
emb|CDX87409.1|  BnaA07g34640D                                          184   4e-49    
ref|XP_009106628.1|  PREDICTED: pentatricopeptide repeat-containi...    184   4e-49    
ref|XP_010694938.1|  PREDICTED: pentatricopeptide repeat-containi...    184   4e-49    
ref|XP_008378727.1|  PREDICTED: pentatricopeptide repeat-containi...    185   4e-49    
ref|XP_010429780.1|  PREDICTED: pentatricopeptide repeat-containi...    184   4e-49    
ref|XP_006403663.1|  hypothetical protein EUTSA_v10010142mg             185   4e-49    
ref|XP_002450215.1|  hypothetical protein SORBIDRAFT_05g002040          186   4e-49    
ref|XP_002985027.1|  hypothetical protein SELMODRAFT_11856              181   4e-49    
ref|XP_006429052.1|  hypothetical protein CICLE_v10013605mg             185   5e-49    
emb|CDX88504.1|  BnaC06g39480D                                          183   5e-49    
ref|XP_006292855.1|  hypothetical protein CARUB_v10019115mg             185   5e-49    
ref|XP_010277537.1|  PREDICTED: pentatricopeptide repeat-containi...    185   5e-49    
ref|XP_009139381.1|  PREDICTED: pentatricopeptide repeat-containi...    185   5e-49    
emb|CDX76194.1|  BnaA04g04580D                                          185   5e-49    
ref|XP_007029263.1|  Tetratricopeptide repeat (TPR)-like superfam...    183   5e-49    
ref|XP_004508428.1|  PREDICTED: pentatricopeptide repeat-containi...    185   5e-49    
gb|EAY90703.1|  hypothetical protein OsI_12306                          184   6e-49    
gb|ABF97191.1|  pentatricopeptide, putative, expressed                  184   6e-49    
ref|NP_197167.1|  pentatricopeptide repeat-containing protein           182   6e-49    
ref|XP_010908081.1|  PREDICTED: pentatricopeptide repeat-containi...    181   6e-49    
ref|XP_003559952.1|  PREDICTED: pentatricopeptide repeat-containi...    184   6e-49    
gb|AGG38110.1|  maternal effect embryo arrest 40 protein                185   6e-49    
gb|AAG59660.1|AC084319_18  putative membrane-associated salt-indu...    185   6e-49    
ref|XP_002876221.1|  hypothetical protein ARALYDRAFT_906766             184   7e-49    
ref|XP_010504140.1|  PREDICTED: pentatricopeptide repeat-containi...    184   7e-49    
gb|KEH42382.1|  PPR containing plant-like protein                       184   7e-49    
ref|XP_003637510.1|  Pentatricopeptide repeat-containing protein        184   7e-49    
ref|XP_010233190.1|  PREDICTED: pentatricopeptide repeat-containi...    184   8e-49    
ref|NP_001050515.1|  Os03g0569800                                       184   8e-49    
ref|XP_006829551.1|  hypothetical protein AMTR_s00074p00172480          182   8e-49    
ref|XP_006391807.1|  hypothetical protein EUTSA_v10023351mg             184   8e-49    
dbj|BAB01462.1|  unnamed protein product                                184   9e-49    
gb|EYU28385.1|  hypothetical protein MIMGU_mgv1a003336mg                183   9e-49    
ref|NP_188886.1|  pentatricopeptide repeat-containing protein           183   9e-49    
ref|XP_007027088.1|  Pentatricopeptide repeat (PPR) superfamily p...    184   1e-48    
ref|XP_010277532.1|  PREDICTED: pentatricopeptide repeat-containi...    186   1e-48    
ref|XP_010942864.1|  PREDICTED: pentatricopeptide repeat-containi...    186   1e-48    
ref|XP_002986176.1|  hypothetical protein SELMODRAFT_182249             183   1e-48    
ref|XP_007029261.1|  Tetratricopeptide repeat-like superfamily pr...    183   1e-48    
ref|XP_002964278.1|  hypothetical protein SELMODRAFT_80975              177   1e-48    
gb|ACM24117.1|  PPR protein                                             184   1e-48    
ref|NP_001241831.1|  uncharacterized protein LOC100857030               183   1e-48    
ref|XP_006833322.1|  hypothetical protein AMTR_s00109p00063750          179   1e-48    
ref|XP_010427028.1|  PREDICTED: pentatricopeptide repeat-containi...    184   2e-48    
ref|XP_004142210.1|  PREDICTED: pentatricopeptide repeat-containi...    184   2e-48    
ref|XP_009112950.1|  PREDICTED: pentatricopeptide repeat-containi...    181   2e-48    
ref|XP_009362443.1|  PREDICTED: pentatricopeptide repeat-containi...    183   2e-48    
ref|XP_007226735.1|  hypothetical protein PRUPE_ppa019161mg             182   2e-48    
gb|KGN54231.1|  hypothetical protein Csa_4G294390                       184   2e-48    
ref|XP_006648753.1|  PREDICTED: pentatricopeptide repeat-containi...    182   2e-48    
ref|NP_190938.1|  protein MATERNAL EFFECT EMBRYO ARREST 40              183   2e-48    
emb|CDY30850.1|  BnaC04g27050D                                          183   2e-48    
gb|KDP42607.1|  hypothetical protein JCGZ_24381                         182   2e-48    
ref|XP_002985024.1|  hypothetical protein SELMODRAFT_121499             182   2e-48    
ref|XP_002964544.1|  hypothetical protein SELMODRAFT_82221              181   2e-48    
ref|XP_006836883.1|  hypothetical protein AMTR_s00099p00108770          183   2e-48    
ref|XP_008802946.1|  PREDICTED: protein Rf1, mitochondrial-like         183   2e-48    
ref|XP_006846078.1|  hypothetical protein AMTR_s00012p00087690          183   3e-48    
ref|XP_010420363.1|  PREDICTED: pentatricopeptide repeat-containi...    181   3e-48    
gb|ACJ70132.1|  restorer-of-fertility                                   182   3e-48    
ref|XP_009121467.1|  PREDICTED: pentatricopeptide repeat-containi...    180   3e-48    
gb|EAZ30880.1|  hypothetical protein OsJ_14954                          179   3e-48    
ref|XP_004982541.1|  PREDICTED: pentatricopeptide repeat-containi...    182   3e-48    
ref|XP_010492577.1|  PREDICTED: pentatricopeptide repeat-containi...    179   3e-48    
ref|NP_001047166.1|  Os02g0565400                                       177   3e-48    
ref|XP_007029262.1|  Tetratricopeptide repeat (TPR)-like superfam...    178   4e-48    
ref|XP_010265022.1|  PREDICTED: pentatricopeptide repeat-containi...    181   4e-48    
emb|CDY25519.1|  BnaC09g11440D                                          182   4e-48    
ref|XP_007031103.1|  Tetratricopeptide repeat-like superfamily pr...    181   4e-48    
ref|XP_010248027.1|  PREDICTED: pentatricopeptide repeat-containi...    181   5e-48    
ref|XP_011019664.1|  PREDICTED: pentatricopeptide repeat-containi...    181   5e-48    
ref|XP_007213918.1|  hypothetical protein PRUPE_ppa004201mg             180   5e-48    
ref|XP_010278102.1|  PREDICTED: pentatricopeptide repeat-containi...    182   5e-48    
ref|XP_010271852.1|  PREDICTED: pentatricopeptide repeat-containi...    181   5e-48    
gb|KHG06899.1|  hypothetical protein F383_33746                         180   5e-48    
gb|KDP21342.1|  hypothetical protein JCGZ_21813                         174   5e-48    
ref|XP_009405630.1|  PREDICTED: pentatricopeptide repeat-containi...    182   6e-48    
ref|XP_002438926.1|  hypothetical protein SORBIDRAFT_10g028420          183   6e-48    
ref|XP_010492576.1|  PREDICTED: pentatricopeptide repeat-containi...    179   6e-48    
emb|CDY25492.1|  BnaC09g11170D                                          179   7e-48    
ref|XP_007030314.1|  Tetratricopeptide repeat-like superfamily pr...    181   7e-48    
ref|XP_011094832.1|  PREDICTED: pentatricopeptide repeat-containi...    182   7e-48    
ref|NP_001169662.1|  uncharacterized protein LOC100383543               182   7e-48    
ref|XP_010943853.1|  PREDICTED: pentatricopeptide repeat-containi...    182   8e-48    
ref|XP_006382720.1|  hypothetical protein POPTR_0005s04760g             181   8e-48    
ref|XP_008218683.1|  PREDICTED: pentatricopeptide repeat-containi...    181   9e-48    
dbj|BAF73723.1|  pentatricopeptide repeat protein                       181   9e-48    
ref|XP_008378934.1|  PREDICTED: pentatricopeptide repeat-containi...    182   9e-48    
ref|XP_006405387.1|  hypothetical protein EUTSA_v10028208mg             178   9e-48    
tpg|DAA50096.1|  TPA: ATP binding protein                               181   1e-47    
ref|XP_004304773.1|  PREDICTED: pentatricopeptide repeat-containi...    180   1e-47    
gb|EMS45617.1|  hypothetical protein TRIUR3_15675                       179   1e-47    
gb|AAM97065.1|  putative membrane-associated salt-inducible protein     180   1e-47    
gb|EMT06711.1|  hypothetical protein F775_17669                         179   1e-47    
ref|XP_010674721.1|  PREDICTED: putative pentatricopeptide repeat...    181   1e-47    
ref|XP_002272943.1|  PREDICTED: pentatricopeptide repeat-containi...    181   1e-47    
ref|XP_011015331.1|  PREDICTED: pentatricopeptide repeat-containi...    177   1e-47    
ref|XP_002989531.1|  hypothetical protein SELMODRAFT_130008             177   1e-47    
ref|XP_002969716.1|  hypothetical protein SELMODRAFT_92207              177   1e-47    
gb|KFK34620.1|  hypothetical protein AALP_AA5G169600                    181   2e-47    
emb|CBJ23782.1|  pentatricopeptide (PPR) repeat-containing protein      180   2e-47    
ref|XP_002446553.1|  hypothetical protein SORBIDRAFT_06g018030          176   2e-47    
ref|XP_010418152.1|  PREDICTED: pentatricopeptide repeat-containi...    179   2e-47    
emb|CDY34370.1|  BnaA09g11120D                                          181   2e-47    
ref|XP_009112927.1|  PREDICTED: pentatricopeptide repeat-containi...    180   2e-47    
ref|XP_002263091.1|  PREDICTED: putative pentatricopeptide repeat...    179   2e-47    
ref|XP_010925750.1|  PREDICTED: pentatricopeptide repeat-containi...    180   2e-47    
gb|KHN05921.1|  Pentatricopeptide repeat-containing protein, chlo...    179   2e-47    
ref|NP_176522.2|  pentatricopeptide repeat-containing protein           179   2e-47    
ref|XP_002981321.1|  hypothetical protein SELMODRAFT_114398             177   2e-47    
gb|EYU41700.1|  hypothetical protein MIMGU_mgv1a001713mg                181   2e-47    
ref|XP_010674113.1|  PREDICTED: putative pentatricopeptide repeat...    179   2e-47    
emb|CAN69338.1|  hypothetical protein VITISV_032632                     179   2e-47    
ref|XP_010674115.1|  PREDICTED: putative pentatricopeptide repeat...    179   2e-47    
gb|EYU42756.1|  hypothetical protein MIMGU_mgv1a024236mg                179   2e-47    
emb|CCD31439.1|  RNA processing factor 3                                179   2e-47    
ref|XP_002970774.1|  hypothetical protein SELMODRAFT_94312              178   2e-47    
ref|XP_002962532.1|  hypothetical protein SELMODRAFT_404389             182   3e-47    
ref|XP_010450791.1|  PREDICTED: pentatricopeptide repeat-containi...    180   3e-47    
emb|CAN62673.1|  hypothetical protein VITISV_031897                     179   3e-47    
ref|XP_007207705.1|  hypothetical protein PRUPE_ppa025110mg             176   3e-47    
ref|XP_007199147.1|  hypothetical protein PRUPE_ppa019612mg             181   3e-47    
emb|CDO99995.1|  unnamed protein product                                179   3e-47    
ref|XP_002892350.1|  pentatricopeptide repeat-containing protein        177   3e-47    
ref|XP_010458709.1|  PREDICTED: pentatricopeptide repeat-containi...    179   3e-47    
dbj|BAJ86536.1|  predicted protein                                      179   3e-47    
ref|XP_002977892.1|  hypothetical protein SELMODRAFT_107734             177   3e-47    
ref|XP_010473513.1|  PREDICTED: pentatricopeptide repeat-containi...    179   3e-47    
ref|XP_007016495.1|  Pentatricopeptide repeat (PPR) superfamily p...    181   3e-47    
ref|XP_006394015.1|  hypothetical protein EUTSA_v10005373mg             178   3e-47    
ref|XP_010458708.1|  PREDICTED: pentatricopeptide repeat-containi...    179   3e-47    
ref|XP_006658827.1|  PREDICTED: pentatricopeptide repeat-containi...    178   3e-47    
ref|XP_006423034.1|  hypothetical protein CICLE_v10030202mg             180   3e-47    
gb|KCW55237.1|  hypothetical protein EUGRSUZ_I01171                     178   3e-47    
ref|XP_010100079.1|  hypothetical protein L484_005753                   178   3e-47    
gb|KDP42551.1|  hypothetical protein JCGZ_24325                         178   4e-47    
ref|XP_002962761.1|  hypothetical protein SELMODRAFT_165305             179   4e-47    
gb|KHG11326.1|  hypothetical protein F383_12865                         177   4e-47    
ref|XP_009355363.1|  PREDICTED: pentatricopeptide repeat-containi...    180   4e-47    
ref|XP_010430334.1|  PREDICTED: pentatricopeptide repeat-containi...    178   4e-47    
ref|XP_010935557.1|  PREDICTED: protein Rf1, mitochondrial-like         180   4e-47    
ref|XP_006303621.1|  hypothetical protein CARUB_v10011428mg             179   4e-47    
ref|XP_008447642.1|  PREDICTED: pentatricopeptide repeat-containi...    179   4e-47    
emb|CDP06640.1|  unnamed protein product                                179   4e-47    
ref|XP_007226363.1|  hypothetical protein PRUPE_ppa022421mg             180   5e-47    
ref|XP_002979436.1|  hypothetical protein SELMODRAFT_177686             177   5e-47    
ref|XP_002977337.1|  hypothetical protein SELMODRAFT_107186             179   5e-47    
ref|XP_008802687.1|  PREDICTED: pentatricopeptide repeat-containi...    179   5e-47    
dbj|BAF73724.1|  pentatricopeptide repeat protein                       179   6e-47    
ref|XP_009355362.1|  PREDICTED: pentatricopeptide repeat-containi...    180   6e-47    
ref|XP_002973888.1|  hypothetical protein SELMODRAFT_100264             174   6e-47    
emb|CBI16176.3|  unnamed protein product                                179   6e-47    
ref|XP_004982554.1|  PREDICTED: pentatricopeptide repeat-containi...    179   6e-47    
ref|XP_002969175.1|  hypothetical protein SELMODRAFT_90172              174   6e-47    
emb|CAD61286.1|  fertility restorer homologue                           179   6e-47    
gb|ABO70667.1|  restorer-of-fertility                                   179   6e-47    
ref|XP_010450727.1|  PREDICTED: pentatricopeptide repeat-containi...    180   6e-47    
emb|CAD61285.1|  fertility restorer                                     179   6e-47    
emb|CBI24253.3|  unnamed protein product                                178   6e-47    
ref|XP_010419462.1|  PREDICTED: pentatricopeptide repeat-containi...    171   6e-47    
ref|XP_004508746.1|  PREDICTED: putative pentatricopeptide repeat...    179   7e-47    
ref|XP_002892307.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    181   7e-47    
ref|XP_002464340.1|  hypothetical protein SORBIDRAFT_01g016560          179   7e-47    
emb|CAZ44330.1|  homologue to restoring pentatricopeptide repeat ...    179   7e-47    
ref|XP_011019662.1|  PREDICTED: pentatricopeptide repeat-containi...    178   7e-47    
ref|XP_006384120.1|  hypothetical protein POPTR_0004s07290g             177   8e-47    
ref|XP_011019661.1|  PREDICTED: pentatricopeptide repeat-containi...    178   8e-47    
ref|XP_008443760.1|  PREDICTED: pentatricopeptide repeat-containi...    177   8e-47    
gb|EAZ22991.1|  hypothetical protein OsJ_06687                          176   8e-47    
ref|XP_011019657.1|  PREDICTED: pentatricopeptide repeat-containi...    178   8e-47    
ref|XP_007029330.1|  Tetratricopeptide repeat-like superfamily pr...    179   8e-47    
gb|KHG15943.1|  hypothetical protein F383_21819                         174   8e-47    
ref|XP_004966150.1|  PREDICTED: pentatricopeptide repeat-containi...    181   9e-47    
ref|XP_010476184.1|  PREDICTED: pentatricopeptide repeat-containi...    178   9e-47    
ref|XP_010419465.1|  PREDICTED: pentatricopeptide repeat-containi...    176   9e-47    
ref|XP_006306401.1|  hypothetical protein CARUB_v10012310mg             178   9e-47    
ref|XP_008218328.1|  PREDICTED: pentatricopeptide repeat-containi...    177   1e-46    
ref|XP_006391979.1|  hypothetical protein EUTSA_v10023907mg             175   1e-46    
ref|XP_002971975.1|  hypothetical protein SELMODRAFT_96626              178   1e-46    
ref|XP_008227456.1|  PREDICTED: pentatricopeptide repeat-containi...    175   1e-46    
ref|XP_006487095.1|  PREDICTED: pentatricopeptide repeat-containi...    178   1e-46    
ref|XP_006599383.1|  PREDICTED: pentatricopeptide repeat-containi...    176   1e-46    
ref|XP_008790496.1|  PREDICTED: pentatricopeptide repeat-containi...    174   1e-46    
ref|XP_002281336.1|  PREDICTED: putative pentatricopeptide repeat...    179   1e-46    
emb|CBI19302.3|  unnamed protein product                                177   1e-46    
ref|XP_011078018.1|  PREDICTED: pentatricopeptide repeat-containi...    177   1e-46    
gb|KDP33243.1|  hypothetical protein JCGZ_13515                         177   1e-46    
gb|KEH41413.1|  pentatricopeptide (PPR) repeat protein                  176   1e-46    
ref|NP_001147073.1|  ATP binding protein                                177   1e-46    
ref|XP_009596549.1|  PREDICTED: pentatricopeptide repeat-containi...    178   1e-46    
ref|XP_010550377.1|  PREDICTED: pentatricopeptide repeat-containi...    177   2e-46    
gb|EAZ27689.1|  hypothetical protein OsJ_11637                          177   2e-46    
ref|XP_008243127.1|  PREDICTED: pentatricopeptide repeat-containi...    178   2e-46    
ref|XP_011026595.1|  PREDICTED: putative pentatricopeptide repeat...    177   2e-46    
ref|XP_008803657.1|  PREDICTED: pentatricopeptide repeat-containi...    178   2e-46    
ref|XP_009362435.1|  PREDICTED: pentatricopeptide repeat-containi...    177   2e-46    
ref|XP_010028496.1|  PREDICTED: pentatricopeptide repeat-containi...    177   2e-46    
ref|XP_010107974.1|  hypothetical protein L484_027566                   177   2e-46    
ref|XP_010541012.1|  PREDICTED: pentatricopeptide repeat-containi...    177   2e-46    
ref|XP_010450862.1|  PREDICTED: pentatricopeptide repeat-containi...    178   2e-46    
ref|XP_010674665.1|  PREDICTED: pentatricopeptide repeat-containi...    173   2e-46    
gb|KDP42582.1|  hypothetical protein JCGZ_24356                         175   2e-46    
ref|XP_006827215.1|  hypothetical protein AMTR_s00010p00259780          177   2e-46    
ref|XP_002974875.1|  hypothetical protein SELMODRAFT_150113             172   2e-46    
gb|KHN04950.1|  Pentatricopeptide repeat-containing protein             174   2e-46    
dbj|BAJ88779.1|  predicted protein                                      177   2e-46    
ref|XP_010464348.1|  PREDICTED: pentatricopeptide repeat-containi...    177   2e-46    
ref|XP_006599382.1|  PREDICTED: pentatricopeptide repeat-containi...    176   2e-46    
ref|XP_006373668.1|  hypothetical protein POPTR_0016s02630g             176   2e-46    
ref|XP_002990788.1|  hypothetical protein SELMODRAFT_132337             177   2e-46    
ref|XP_002963786.1|  hypothetical protein SELMODRAFT_79843              174   3e-46    
ref|NP_001185309.1|  pentatricopeptide repeat-containing protein        175   3e-46    
dbj|BAJ94116.1|  predicted protein                                      176   3e-46    
ref|XP_010674110.1|  PREDICTED: putative pentatricopeptide repeat...    176   3e-46    
gb|KHN48987.1|  Pentatricopeptide repeat-containing protein, chlo...    176   3e-46    
ref|XP_010674699.1|  PREDICTED: putative pentatricopeptide repeat...    176   3e-46    



>ref|XP_004236781.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Solanum lycopersicum]
Length=575

 Score =   458 bits (1178),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/343 (65%), Positives = 276/343 (80%), Gaps = 12/343 (3%)
 Frame = -1

Query  1023  VKCK-KHEFRERNLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYL  847
             V+C   +E    N++N Q VK+S+ENR        S ++ +   LN SC  GKY+ETLYL
Sbjct  30    VRCSISNEESRVNIRNPQRVKISSENRG-------SHDMKV---LNWSCKVGKYDETLYL  79

Query  846   LQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKT  667
             L+  VK GYKPDV+LCTKLIKG F+ K ++K VKVMQ+LEQFGEP+V AY AL+ GFCK 
Sbjct  80    LECKVKSGYKPDVILCTKLIKGFFNSKNSDKGVKVMQILEQFGEPDVFAYNALVSGFCKM  139

Query  666   NRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVT  487
             N++E AN VLNRM++ GF PD VTYNI+IGS+CDRGKLG AL +LDQ+KE++NCKP V+T
Sbjct  140   NKIEEANKVLNRMKTHGFPPDSVTYNILIGSLCDRGKLGSALMLLDQLKEEHNCKPTVIT  199

Query  486   YTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLP  307
             YT+LIEATI++ GI EAMKL+DEMLS GL+P++YTYNAI++G+CRE M+D+AYEFVRSLP
Sbjct  200   YTILIEATILEGGIHEAMKLLDEMLSIGLQPDMYTYNAIIRGMCREKMMDQAYEFVRSLP  259

Query  306   AMGCKPDVFSYNILLRALLDRRN-WDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKL  130
             + GCKPDV SYNILLRALL  R  W DGEKL+ EM   GCEP+  TY+I +S+LCRDGKL
Sbjct  260   SKGCKPDVISYNILLRALLHHRGKWSDGEKLMNEMLCAGCEPNVVTYSILMSALCRDGKL  319

Query  129   NKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             ++AI++LKIM +KGLTP+ FTYDPLISAFCK GRLD+AI  LD
Sbjct  320   DEAINLLKIMVDKGLTPDTFTYDPLISAFCKGGRLDMAIKFLD  362


 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/297 (32%), Positives = 173/297 (58%), Gaps = 6/297 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLL-QYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            C  GK    L LL Q   +   KP V+  T LI+         +A+K++  +   G +P+
Sbjct  172  CDRGKLGSALMLLDQLKEEHNCKPTVITYTILIEATILEGGIHEAMKLLDEMLSIGLQPD  231

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD-RGKLGLALKVL  532
            +  Y A+I G C+   ++ A   +  + S+G  PDV++YNI++ ++   RGK     K++
Sbjct  232  MYTYNAIIRGMCREKMMDQAYEFVRSLPSKGCKPDVISYNILLRALLHHRGKWSDGEKLM  291

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLC  355
            ++M     C+P+VVTY++L+ A + +DG + EA+ L+  M+ +GL P+ +TY+ ++   C
Sbjct  292  NEML-CAGCEPNVVTYSILMSA-LCRDGKLDEAINLLKIMVDKGLTPDTFTYDPLISAFC  349

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            + G +D A +F+  +   GC PD+ +YN +L  +  +   D+  ++ ++++ +GC P   
Sbjct  350  KGGRLDMAIKFLDYMITNGCLPDIVNYNTILSTMCKKGKADEAMEVFEKLAEIGCPPDVS  409

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            TYN  +S+L  +G   +A+ M+  M EKG+ P++ TY+ LIS  C++G ++ A+DLL
Sbjct  410  TYNTLMSALWNNGGRARALKMVSEMIEKGVDPDEITYNALISCLCRDGMVNEALDLL  466


 Score =   169 bits (429),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 158/293 (54%), Gaps = 5/293 (2%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G   E + LL  M+ IG +PD+     +I+G+   K  ++A + ++ L   G +P+V++Y
Sbjct  211  GGIHEAMKLLDEMLSIGLQPDMYTYNAIIRGMCREKMMDQAYEFVRSLPSKGCKPDVISY  270

Query  696  TALIGGFCKTNRVEAANG--VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
              L+      +R + ++G  ++N M   G  P+VVTY+I++ ++C  GKL  A+ +L  M
Sbjct  271  NILLRALLH-HRGKWSDGEKLMNEMLCAGCEPNVVTYSILMSALCRDGKLDEAINLLKIM  329

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGM  343
              D    PD  TY  LI A      +  A+K +D M++ G  P+I  YN IL  +C++G 
Sbjct  330  V-DKGLTPDTFTYDPLISAFCKGGRLDMAIKFLDYMITNGCLPDIVNYNTILSTMCKKGK  388

Query  342  VDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNI  163
             D A E    L  +GC PDV +YN L+ AL +        K++ EM   G +P   TYN 
Sbjct  389  ADEAMEVFEKLAEIGCPPDVSTYNTLMSALWNNGGRARALKMVSEMIEKGVDPDEITYNA  448

Query  162  FVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             +S LCRDG +N+A+ +L  M   G  P   TY+ L+   CK  R+  AI++L
Sbjct  449  LISCLCRDGMVNEALDLLGDMEGNGFPPTVITYNILLLGLCKAHRVVEAIEVL  501


 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/262 (32%), Positives = 144/262 (55%), Gaps = 2/262 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK+ +   L+  M+  G +P+VV  + L+  L    K ++A+ +++++   G  P+   Y
Sbjct  282  GKWSDGEKLMNEMLCAGCEPNVVTYSILMSALCRDGKLDEAINLLKIMVDKGLTPDTFTY  341

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  FCK  R++ A   L+ M + G  PD+V YN ++ ++C +GK   A++V +++ E
Sbjct  342  DPLISAFCKGGRLDMAIKFLDYMITNGCLPDIVNYNTILSTMCKKGKADEAMEVFEKLAE  401

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
               C PDV TY  L+ A     G + A+K+V EM+ +G++P+  TYNA++  LCR+GMV+
Sbjct  402  IG-CPPDVSTYNTLMSALWNNGGRARALKMVSEMIEKGVDPDEITYNALISCLCRDGMVN  460

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A + +  +   G  P V +YNILL  L       +  ++L EM   GC P+  TY + +
Sbjct  461  EALDLLGDMEGNGFPPTVITYNILLLGLCKAHRVVEAIEVLAEMVEKGCRPNETTYILLI  520

Query  156  SSLCRDGKLNKAISMLKIMTEK  91
              +   G+  +A+ M   +  K
Sbjct  521  EGIGFSGRRVQAMEMATAIYHK  542


 Score =   146 bits (369),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 140/275 (51%), Gaps = 3/275 (1%)
 Frame = -1

Query  825  GYKPDVVLCTKLIKGLFSVK-KAEKAVKVM-QLLEQFGEPNVLAYTALIGGFCKTNRVEA  652
            G KPDV+    L++ L   + K     K+M ++L    EPNV+ Y+ L+   C+  +++ 
Sbjct  262  GCKPDVISYNILLRALLHHRGKWSDGEKLMNEMLCAGCEPNVVTYSILMSALCRDGKLDE  321

Query  651  ANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLI  472
            A  +L  M  +G  PD  TY+ +I + C  G+L +A+K LD M   N C PD+V Y  ++
Sbjct  322  AINLLKIMVDKGLTPDTFTYDPLISAFCKGGRLDMAIKFLDYMIT-NGCLPDIVNYNTIL  380

Query  471  EATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCK  292
                 K    EAM++ +++   G  P++ TYN ++  L   G   RA + V  +   G  
Sbjct  381  STMCKKGKADEAMEVFEKLAEIGCPPDVSTYNTLMSALWNNGGRARALKMVSEMIEKGVD  440

Query  291  PDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISM  112
            PD  +YN L+  L      ++   LL +M   G  P   TYNI +  LC+  ++ +AI +
Sbjct  441  PDEITYNALISCLCRDGMVNEALDLLGDMEGNGFPPTVITYNILLLGLCKAHRVVEAIEV  500

Query  111  LKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            L  M EKG  PN+ TY  LI      GR   A+++
Sbjct  501  LAEMVEKGCRPNETTYILLIEGIGFSGRRVQAMEM  535



>ref|XP_009767473.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Nicotiana sylvestris]
Length=585

 Score =   457 bits (1175),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 231/343 (67%), Positives = 281/343 (82%), Gaps = 2/343 (1%)
 Frame = -1

Query  1023  VKCKKHEFRERNLKNLQSVKVSTENRNALIQLL-DSKEIDIRRRLNRSCGAGKYEETLYL  847
             V+C  HEF +   +N Q V+VSTENR+A +Q   D K  +  + LN SC  GKY+ETLYL
Sbjct  33    VRCSSHEFSKVKPRNNQRVRVSTENRHAYVQQSNDLKATNFLKVLNWSCKVGKYDETLYL  92

Query  846   LQYMVKI-GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCK  670
             L   VK  GYKPDV+LCTKLIKG  + K ++KA+KVMQ+LE+FGEP+V AY ALI GFCK
Sbjct  93    LDCKVKNNGYKPDVILCTKLIKGFCNSKNSDKALKVMQILEEFGEPDVFAYNALISGFCK  152

Query  669   TNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVV  490
              N++E AN VLNRM+S GF PD VTYNI+IGS+CDRGKLGLALK+LDQ+KE+ NCKP V+
Sbjct  153   MNKIEEANKVLNRMKSHGFPPDAVTYNILIGSLCDRGKLGLALKLLDQLKEERNCKPTVI  212

Query  489   TYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSL  310
             TYT+LIEATI++ GI EAMKL+DEMLS GL+P++YTYNAI++G+CRE M+D+AYEFVRSL
Sbjct  213   TYTILIEATILEGGIHEAMKLLDEMLSIGLQPDMYTYNAIIRGMCREKMMDQAYEFVRSL  272

Query  309   PAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKL  130
             P+ GCKPDV SYNILLRALL +  W DGEKL+ EM S GCEP+  TY+I +SSLCRDGKL
Sbjct  273   PSKGCKPDVISYNILLRALLHKGKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKL  332

Query  129   NKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             ++AI++LKIM +KGLTP+ FTYDPLISAFCK GRLDLAI  LD
Sbjct  333   DEAINLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLD  375


 Score =   181 bits (458),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 159/296 (54%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G   E + LL  M+ IG +PD+     +I+G+   K  ++A + ++ L   G +P+V++Y
Sbjct  225  GGIHEAMKLLDEMLSIGLQPDMYTYNAIIRGMCREKMMDQAYEFVRSLPSKGCKPDVISY  284

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       +      ++N M S G  P+VVTY+I++ S+C  GKL  A+ +L  M  
Sbjct  285  NILLRALLHKGKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKLDEAINLLKIMM-  343

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D    PD  TY  LI A      +  A+K +D M+S G  P+I  YN IL  +C++G  D
Sbjct  344  DKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMISNGCLPDIVNYNTILSTMCKKGKAD  403

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGE-----KLLKEMSSMGCEPHTFT  172
             A E    L  +GC PDV +YN ++ AL     W++GE     +L+ EM   G +P   T
Sbjct  404  EAMEVFEKLAEIGCPPDVSTYNTMMSAL-----WNNGERARALRLVSEMIEKGIDPDEIT  458

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +N+A+ +L  M   G  P   TY+ L+   CK  R+D AI++L
Sbjct  459  YNSLISCLCRDGLVNEALDLLGDMEGNGFPPTVITYNILLLGLCKAHRVDEAIEVL  514


 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 168/274 (61%), Gaps = 4/274 (1%)
 Frame = -1

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANG  643
            KP V+  T LI+         +A+K++  +   G +P++  Y A+I G C+   ++ A  
Sbjct  208  KPTVITYTILIEATILEGGIHEAMKLLDEMLSIGLQPDMYTYNAIIRGMCREKMMDQAYE  267

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
             +  + S+G  PDV++YNI++ ++  +GK     K++++M     C+P+VVTY++L+ ++
Sbjct  268  FVRSLPSKGCKPDVISYNILLRALLHKGKWSDGEKLVNEMFSAG-CEPNVVTYSILM-SS  325

Query  462  IVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPD  286
            + +DG + EA+ L+  M+ +GL P+ +TY+ ++   C+ G +D A +F+  + + GC PD
Sbjct  326  LCRDGKLDEAINLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMISNGCLPD  385

Query  285  VFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
            + +YN +L  +  +   D+  ++ ++++ +GC P   TYN  +S+L  +G+  +A+ ++ 
Sbjct  386  IVNYNTILSTMCKKGKADEAMEVFEKLAEIGCPPDVSTYNTMMSALWNNGERARALRLVS  445

Query  105  IMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             M EKG+ P++ TY+ LIS  C++G ++ A+DLL
Sbjct  446  EMIEKGIDPDEITYNSLISCLCRDGLVNEALDLL  479


 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/266 (33%), Positives = 135/266 (51%), Gaps = 2/266 (1%)
 Frame = -1

Query  825  GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAA  649
            G KPDV+    L++ L    K     K++  +   G EPNV+ Y+ L+   C+  +++ A
Sbjct  276  GCKPDVISYNILLRALLHKGKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKLDEA  335

Query  648  NGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIE  469
              +L  M  +G  PD  TY+ +I + C  G+L LA+K LD M   N C PD+V Y  ++ 
Sbjct  336  INLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMIS-NGCLPDIVNYNTILS  394

Query  468  ATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKP  289
                K    EAM++ +++   G  P++ TYN ++  L   G   RA   V  +   G  P
Sbjct  395  TMCKKGKADEAMEVFEKLAEIGCPPDVSTYNTMMSALWNNGERARALRLVSEMIEKGIDP  454

Query  288  DVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISML  109
            D  +YN L+  L      ++   LL +M   G  P   TYNI +  LC+  ++++AI +L
Sbjct  455  DEITYNSLISCLCRDGLVNEALDLLGDMEGNGFPPTVITYNILLLGLCKAHRVDEAIEVL  514

Query  108  KIMTEKGLTPNKFTYDPLISAFCKEG  31
            ++M EKG  PN+ TY  LI      G
Sbjct  515  RVMVEKGRRPNETTYILLIEGIGFSG  540


 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 142/262 (54%), Gaps = 2/262 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK+ +   L+  M   G +P+VV  + L+  L    K ++A+ +++++   G  P+   Y
Sbjct  295  GKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKLDEAINLLKIMMDKGLTPDTFTY  354

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  FCK  R++ A   L+ M S G  PD+V YN ++ ++C +GK   A++V +++ E
Sbjct  355  DPLISAFCKGGRLDLAIKFLDYMISNGCLPDIVNYNTILSTMCKKGKADEAMEVFEKLAE  414

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
               C PDV TY  ++ A       + A++LV EM+ +G++P+  TYN+++  LCR+G+V+
Sbjct  415  IG-CPPDVSTYNTMMSALWNNGERARALRLVSEMIEKGIDPDEITYNSLISCLCRDGLVN  473

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A + +  +   G  P V +YNILL  L      D+  ++L+ M   G  P+  TY + +
Sbjct  474  EALDLLGDMEGNGFPPTVITYNILLLGLCKAHRVDEAIEVLRVMVEKGRRPNETTYILLI  533

Query  156  SSLCRDGKLNKAISMLKIMTEK  91
              +   G   +A+ +   + +K
Sbjct  534  EGIGFSGWRVQAMEVASSLYQK  555



>ref|XP_006361415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Solanum tuberosum]
Length=583

 Score =   455 bits (1170),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 222/344 (65%), Positives = 273/344 (79%), Gaps = 12/344 (3%)
 Frame = -1

Query  1023  VKCKKHEFRERNLK--NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLY  850
             V+C      +  +K  N   VK+S+EN      +         + LN SC  GKY+ETLY
Sbjct  33    VRCSSSSNDQSKVKTRNPLRVKISSENYRPTHDM---------KVLNWSCKVGKYDETLY  83

Query  849   LLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCK  670
             LL+  +K GYKPDV+LCTKLIKG  + K ++K VKVMQ+LEQFGEP+V AY ALI GFCK
Sbjct  84    LLECKLKSGYKPDVILCTKLIKGFCNSKNSDKGVKVMQILEQFGEPDVFAYNALISGFCK  143

Query  669   TNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVV  490
              N++E AN VLNRM++RGF PD VTYNI+IGS+CDRGKLG ALK+LDQ+KE+NNCKP V+
Sbjct  144   MNKIEEANKVLNRMKARGFPPDSVTYNILIGSLCDRGKLGSALKLLDQLKEENNCKPTVI  203

Query  489   TYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSL  310
             TYT+LIEATI++ GI EAMKL+DEMLSRGL+P++YTYNAI++G+CRE M+D+AYEFVRSL
Sbjct  204   TYTILIEATILEGGIHEAMKLLDEMLSRGLQPDMYTYNAIIRGMCREKMMDQAYEFVRSL  263

Query  309   PAMGCKPDVFSYNILLRALLDRRN-WDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGK  133
             P+ GCKPDV SYNILLRALL  +  W DGEKL+ EM S GCEP+  TY+I +S+LCRDGK
Sbjct  264   PSKGCKPDVISYNILLRALLHHKGKWSDGEKLMNEMLSAGCEPNVVTYSILMSALCRDGK  323

Query  132   LNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             L++AI++LKIM +KGLTP+ FTYDPLISAFCK GRLDLAI  LD
Sbjct  324   LDEAINLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLD  367


 Score =   170 bits (430),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/297 (32%), Positives = 176/297 (59%), Gaps = 6/297 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLL-QYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPN  709
            C  GK    L LL Q   +   KP V+  T LI+         +A+K++ ++L +  +P+
Sbjct  177  CDRGKLGSALKLLDQLKEENNCKPTVITYTILIEATILEGGIHEAMKLLDEMLSRGLQPD  236

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD-RGKLGLALKVL  532
            +  Y A+I G C+   ++ A   +  + S+G  PDV++YNI++ ++   +GK     K++
Sbjct  237  MYTYNAIIRGMCREKMMDQAYEFVRSLPSKGCKPDVISYNILLRALLHHKGKWSDGEKLM  296

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLC  355
            ++M     C+P+VVTY++L+ A + +DG + EA+ L+  M+ +GL P+ +TY+ ++   C
Sbjct  297  NEMLS-AGCEPNVVTYSILMSA-LCRDGKLDEAINLLKIMMDKGLTPDTFTYDPLISAFC  354

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            + G +D A +F+  + + GC PD+ +YN +L  +  +   D+  ++ ++++ +GC P   
Sbjct  355  KGGRLDLAIKFLDYMISNGCLPDIVNYNTILSTMCKKGKADEAMEVFEKLAEIGCPPDVS  414

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            TYN  +S+L  +G   +A+ M+  M EKG+ P++ TY+ LIS  C++G ++ A+DLL
Sbjct  415  TYNTLMSALWNNGGRARALKMVSEMIEKGVDPDEITYNALISCLCRDGMVNEALDLL  471


 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 153/292 (52%), Gaps = 3/292 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G   E + LL  M+  G +PD+     +I+G+   K  ++A + ++ L   G +P+V++Y
Sbjct  216  GGIHEAMKLLDEMLSRGLQPDMYTYNAIIRGMCREKMMDQAYEFVRSLPSKGCKPDVISY  275

Query  696  TALIGGFCKT-NRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMK  520
              L+        +      ++N M S G  P+VVTY+I++ ++C  GKL  A+ +L  M 
Sbjct  276  NILLRALLHHKGKWSDGEKLMNEMLSAGCEPNVVTYSILMSALCRDGKLDEAINLLKIMM  335

Query  519  EDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMV  340
             D    PD  TY  LI A      +  A+K +D M+S G  P+I  YN IL  +C++G  
Sbjct  336  -DKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMISNGCLPDIVNYNTILSTMCKKGKA  394

Query  339  DRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIF  160
            D A E    L  +GC PDV +YN L+ AL +        K++ EM   G +P   TYN  
Sbjct  395  DEAMEVFEKLAEIGCPPDVSTYNTLMSALWNNGGRARALKMVSEMIEKGVDPDEITYNAL  454

Query  159  VSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +S LCRDG +N+A+ +L  M   G  P   TY+ L+   CK  R+  AI++L
Sbjct  455  ISCLCRDGMVNEALDLLGDMEGNGFPPTVITYNILLLGLCKAHRVVEAIEVL  506


 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/262 (32%), Positives = 143/262 (55%), Gaps = 2/262 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK+ +   L+  M+  G +P+VV  + L+  L    K ++A+ +++++   G  P+   Y
Sbjct  287  GKWSDGEKLMNEMLSAGCEPNVVTYSILMSALCRDGKLDEAINLLKIMMDKGLTPDTFTY  346

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  FCK  R++ A   L+ M S G  PD+V YN ++ ++C +GK   A++V +++ E
Sbjct  347  DPLISAFCKGGRLDLAIKFLDYMISNGCLPDIVNYNTILSTMCKKGKADEAMEVFEKLAE  406

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
               C PDV TY  L+ A     G + A+K+V EM+ +G++P+  TYNA++  LCR+GMV+
Sbjct  407  IG-CPPDVSTYNTLMSALWNNGGRARALKMVSEMIEKGVDPDEITYNALISCLCRDGMVN  465

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A + +  +   G  P V +YNILL  L       +  ++L EM   G  P+  TY + +
Sbjct  466  EALDLLGDMEGNGFPPTVITYNILLLGLCKAHRVVEAIEVLAEMVEKGRRPNETTYILLI  525

Query  156  SSLCRDGKLNKAISMLKIMTEK  91
              +   G+  +A+ M   +  K
Sbjct  526  EGIGFSGRRVQAMEMASAIYHK  547


 Score =   149 bits (377),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 140/275 (51%), Gaps = 3/275 (1%)
 Frame = -1

Query  825  GYKPDVVLCTKLIKGLFSVK-KAEKAVKVM-QLLEQFGEPNVLAYTALIGGFCKTNRVEA  652
            G KPDV+    L++ L   K K     K+M ++L    EPNV+ Y+ L+   C+  +++ 
Sbjct  267  GCKPDVISYNILLRALLHHKGKWSDGEKLMNEMLSAGCEPNVVTYSILMSALCRDGKLDE  326

Query  651  ANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLI  472
            A  +L  M  +G  PD  TY+ +I + C  G+L LA+K LD M   N C PD+V Y  ++
Sbjct  327  AINLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMIS-NGCLPDIVNYNTIL  385

Query  471  EATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCK  292
                 K    EAM++ +++   G  P++ TYN ++  L   G   RA + V  +   G  
Sbjct  386  STMCKKGKADEAMEVFEKLAEIGCPPDVSTYNTLMSALWNNGGRARALKMVSEMIEKGVD  445

Query  291  PDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISM  112
            PD  +YN L+  L      ++   LL +M   G  P   TYNI +  LC+  ++ +AI +
Sbjct  446  PDEITYNALISCLCRDGMVNEALDLLGDMEGNGFPPTVITYNILLLGLCKAHRVVEAIEV  505

Query  111  LKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            L  M EKG  PN+ TY  LI      GR   A+++
Sbjct  506  LAEMVEKGRRPNETTYILLIEGIGFSGRRVQAMEM  540



>emb|CDO99996.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   447 bits (1151),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/341 (62%), Positives = 271/341 (79%), Gaps = 1/341 (0%)
 Frame = -1

Query  1023  VKCKKHEFRERNLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLL  844
             V+C+ H   E   ++ Q V VSTE R+  +Q  DS E +  + L+RSC A KY E LY L
Sbjct  32    VRCRGHIPNESKSRSPQKVMVSTEARSTQLQPHDSTEPNFLKLLSRSCKAAKYNEALYFL  91

Query  843   QYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTN  664
             + MV  G KPDV+LCTKLIKGLFS+K AEKAV+VM +LEQ+GEP+V  Y A+I GFCK N
Sbjct  92    ECMVNRGLKPDVILCTKLIKGLFSLKNAEKAVRVMHILEQYGEPDVFVYNAVISGFCKVN  151

Query  663   RVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTY  484
             +  +AN VL+RMR RGF  DVVTYNIMIGS+C+RGKLGLALKV DQ+ +DN CKP VVTY
Sbjct  152   KTNSANEVLSRMRVRGFSADVVTYNIMIGSLCNRGKLGLALKVFDQLLQDN-CKPTVVTY  210

Query  483   TVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPA  304
             T+LIEAT ++ GI EAMKL+DEML +GL+P++YTYNAI++G+CR G++D+A+ FVRSLPA
Sbjct  211   TILIEATALEGGIHEAMKLLDEMLRKGLQPDMYTYNAIIRGMCRGGLIDQAFHFVRSLPA  270

Query  303   MGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNK  124
              GCKPDV SYN+LLRALL++  W DGEKL+ EM S  CEP+  TY+I +S LCRDGKL++
Sbjct  271   KGCKPDVISYNVLLRALLNQGKWKDGEKLVAEMFSRDCEPNVVTYSILISCLCRDGKLDE  330

Query  123   AISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             ++++L++M +KGL P+ +TYDPLISAFC+EGR DLA++ +D
Sbjct  331   SLNLLRVMKDKGLNPDTYTYDPLISAFCREGRTDLALEFMD  371



>ref|XP_009612667.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=586

 Score =   452 bits (1162),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 229/343 (67%), Positives = 278/343 (81%), Gaps = 2/343 (1%)
 Frame = -1

Query  1023  VKCKKHEFRERNLKNLQSVKVSTENRNALIQLL-DSKEIDIRRRLNRSCGAGKYEETLYL  847
             V+C +HE  +   +N Q VKVSTENR++ +Q   D +  +  + LN SC  GKY+ETLYL
Sbjct  33    VRCSRHESSKVKPRNNQRVKVSTENRHSYVQQSNDLRATNFLKVLNWSCKVGKYDETLYL  92

Query  846   LQYMVKI-GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCK  670
             L   VK  GYKPDV+LCTKLIKG  + K  +KA+KVMQ+LEQFGEP+V AY ALI GFCK
Sbjct  93    LDCKVKNNGYKPDVILCTKLIKGFCNSKNTDKALKVMQILEQFGEPDVFAYNALISGFCK  152

Query  669   TNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVV  490
              N++  AN VLNRM+S GF PD VTYNI+IGS+CDRGKLGLALK+LDQ+KE+ NCKP V+
Sbjct  153   MNKIVEANKVLNRMKSHGFPPDAVTYNILIGSLCDRGKLGLALKLLDQLKEEKNCKPTVI  212

Query  489   TYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSL  310
             TYT+LIEATI++ GI EAMKL+DEMLS GL+P++YTYNAI++G+CRE M D+AYEFVRSL
Sbjct  213   TYTILIEATILEGGIHEAMKLLDEMLSTGLQPDMYTYNAIIRGMCREKMTDQAYEFVRSL  272

Query  309   PAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKL  130
             P+ GCKPDV SYNILLRALL +  W DGEKL+ EM S GCEP+  TY+I +SSLCRDGKL
Sbjct  273   PSKGCKPDVISYNILLRALLHKGKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKL  332

Query  129   NKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             ++AI++LKIM +KGLTP+ FTYDPLISAFCK GRLDLAI  LD
Sbjct  333   DEAINLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLD  375


 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 158/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G   E + LL  M+  G +PD+     +I+G+   K  ++A + ++ L   G +P+V++Y
Sbjct  225  GGIHEAMKLLDEMLSTGLQPDMYTYNAIIRGMCREKMTDQAYEFVRSLPSKGCKPDVISY  284

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       +      ++N M S G  P+VVTY+I++ S+C  GKL  A+ +L  M  
Sbjct  285  NILLRALLHKGKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKLDEAINLLKIMM-  343

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D    PD  TY  LI A      +  A+K +D M+S G  P+I  YN IL  +C++G  D
Sbjct  344  DKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMISNGCLPDIVNYNTILSTMCKKGKAD  403

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
             A E    L  +GC PDV +YN ++ AL     W++GE+     L+ EM   G +P   T
Sbjct  404  EAMEVFEKLAEIGCPPDVSTYNTMMSAL-----WNNGERARALILVPEMIEKGIDPDEIT  458

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +N+A+ +L  M   G  P   TY+ L+   CK  R+D AI++L
Sbjct  459  YNSLISCLCRDGLVNEALDLLVDMEGNGFPPTVITYNILLLGLCKAHRIDEAIEVL  514


 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 168/274 (61%), Gaps = 4/274 (1%)
 Frame = -1

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNVLAYTALIGGFCKTNRVEAANG  643
            KP V+  T LI+         +A+K++ ++L    +P++  Y A+I G C+    + A  
Sbjct  208  KPTVITYTILIEATILEGGIHEAMKLLDEMLSTGLQPDMYTYNAIIRGMCREKMTDQAYE  267

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
             +  + S+G  PDV++YNI++ ++  +GK     K++++M     C+P+VVTY++L+ ++
Sbjct  268  FVRSLPSKGCKPDVISYNILLRALLHKGKWSDGEKLVNEMFSAG-CEPNVVTYSILM-SS  325

Query  462  IVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPD  286
            + +DG + EA+ L+  M+ +GL P+ +TY+ ++   C+ G +D A +F+  + + GC PD
Sbjct  326  LCRDGKLDEAINLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMISNGCLPD  385

Query  285  VFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
            + +YN +L  +  +   D+  ++ ++++ +GC P   TYN  +S+L  +G+  +A+ ++ 
Sbjct  386  IVNYNTILSTMCKKGKADEAMEVFEKLAEIGCPPDVSTYNTMMSALWNNGERARALILVP  445

Query  105  IMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             M EKG+ P++ TY+ LIS  C++G ++ A+DLL
Sbjct  446  EMIEKGIDPDEITYNSLISCLCRDGLVNEALDLL  479


 Score =   146 bits (368),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 87/266 (33%), Positives = 134/266 (50%), Gaps = 2/266 (1%)
 Frame = -1

Query  825  GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAA  649
            G KPDV+    L++ L    K     K++  +   G EPNV+ Y+ L+   C+  +++ A
Sbjct  276  GCKPDVISYNILLRALLHKGKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKLDEA  335

Query  648  NGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIE  469
              +L  M  +G  PD  TY+ +I + C  G+L LA+K LD M   N C PD+V Y  ++ 
Sbjct  336  INLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMIS-NGCLPDIVNYNTILS  394

Query  468  ATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKP  289
                K    EAM++ +++   G  P++ TYN ++  L   G   RA   V  +   G  P
Sbjct  395  TMCKKGKADEAMEVFEKLAEIGCPPDVSTYNTMMSALWNNGERARALILVPEMIEKGIDP  454

Query  288  DVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISML  109
            D  +YN L+  L      ++   LL +M   G  P   TYNI +  LC+  ++++AI +L
Sbjct  455  DEITYNSLISCLCRDGLVNEALDLLVDMEGNGFPPTVITYNILLLGLCKAHRIDEAIEVL  514

Query  108  KIMTEKGLTPNKFTYDPLISAFCKEG  31
            + M EKG  PN+ TY  LI      G
Sbjct  515  REMVEKGRRPNETTYILLIEGIGFSG  540


 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 142/262 (54%), Gaps = 2/262 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK+ +   L+  M   G +P+VV  + L+  L    K ++A+ +++++   G  P+   Y
Sbjct  295  GKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKLDEAINLLKIMMDKGLTPDTFTY  354

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  FCK  R++ A   L+ M S G  PD+V YN ++ ++C +GK   A++V +++ E
Sbjct  355  DPLISAFCKGGRLDLAIKFLDYMISNGCLPDIVNYNTILSTMCKKGKADEAMEVFEKLAE  414

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
               C PDV TY  ++ A       + A+ LV EM+ +G++P+  TYN+++  LCR+G+V+
Sbjct  415  IG-CPPDVSTYNTMMSALWNNGERARALILVPEMIEKGIDPDEITYNSLISCLCRDGLVN  473

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A + +  +   G  P V +YNILL  L      D+  ++L+EM   G  P+  TY + +
Sbjct  474  EALDLLVDMEGNGFPPTVITYNILLLGLCKAHRIDEAIEVLREMVEKGRRPNETTYILLI  533

Query  156  SSLCRDGKLNKAISMLKIMTEK  91
              +   G   +A+ +   + +K
Sbjct  534  EGIGFSGWRVQAMEVANSLYQK  555



>ref|XP_008218329.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Prunus mume]
Length=592

 Score =   449 bits (1154),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 207/328 (63%), Positives = 271/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  984  KNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVV  805
            +NL  V VS E +   +   D KE  + + L+RSC AG++ E+LY L+ MV  GYKPDV+
Sbjct  55   RNLIKVMVSAETKPTHLPNYDIKETHLIKVLSRSCKAGQFNESLYFLELMVNKGYKPDVI  114

Query  804  LCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMR  625
            LCTKLIKG F+ +  EKA++VMQ+LE++GEP++ +Y ALI GFCK NR+E+AN VL+RMR
Sbjct  115  LCTKLIKGFFNSRNIEKAIRVMQILEKYGEPDLFSYNALISGFCKANRIESANKVLDRMR  174

Query  624  SRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGI  445
            S+GF PDVVTYNIMIGS+C RGKLGLALKV+DQ+ +DN C+P V+TYT+LIEATIV  GI
Sbjct  175  SQGFSPDVVTYNIMIGSLCTRGKLGLALKVMDQLVKDN-CRPTVITYTILIEATIVDGGI  233

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
             EAMKL+DEMLSRGL+P++YTYNA+++G+CR+GM+DRA++FVRSL + GC P+V SYNIL
Sbjct  234  DEAMKLLDEMLSRGLKPDMYTYNAVIRGMCRDGMLDRAFQFVRSLDSKGCPPNVISYNIL  293

Query  264  LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
            LRALL+R  W++GEKL+  M S GCEP+  TY+I +S+LCRDGK+  A+++LKIM +KGL
Sbjct  294  LRALLNRGKWEEGEKLVTNMCSRGCEPNVVTYSILISTLCRDGKVEDAVNVLKIMKKKGL  353

Query  84   TPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TP+ ++YDPL+SAFCKEGRLDLAI+ LD
Sbjct  354  TPDAYSYDPLVSAFCKEGRLDLAIEFLD  381


 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 172/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK    L ++  +VK   +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  193  CTRGKLGLALKVMDQLVKDNCRPTVITYTILIEATIVDGGIDEAMKLLDEMLSRGLKPDM  252

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A+I G C+   ++ A   +  + S+G  P+V++YNI++ ++ +RGK     K++  
Sbjct  253  YTYNAVIRGMCRDGMLDRAFQFVRSLDSKGCPPNVISYNILLRALLNRGKWEEGEKLVTN  312

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     C+P+VVTY++LI +T+ +DG + +A+ ++  M  +GL P+ Y+Y+ ++   C+E
Sbjct  313  MCS-RGCEPNVVTYSILI-STLCRDGKVEDAVNVLKIMKKKGLTPDAYSYDPLVSAFCKE  370

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+  + + GC PD+ +YN +L AL      D   ++ + +  +GC P+  +Y
Sbjct  371  GRLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGKADQALQIFENLGEVGCPPNVSSY  430

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M  KG+ P++ TY+ LIS  C++G +D AI LL
Sbjct  431  NTMFSALWNCGDRVRALGMVSEMIGKGIKPDEITYNSLISCLCRDGMVDEAIGLL  485


 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 158/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E + LL  M+  G KPD+     +I+G+      ++A + ++ L+  G  PNV++Y
Sbjct  231  GGIDEAMKLLDEMLSRGLKPDMYTYNAVIRGMCRDGMLDRAFQFVRSLDSKGCPPNVISY  290

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++  M SRG  P+VVTY+I+I ++C  GK+  A+ VL  MK+
Sbjct  291  NILLRALLNRGKWEEGEKLVTNMCSRGCEPNVVTYSILISTLCRDGKVEDAVNVLKIMKK  350

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  L+ A   +  +  A++ +D M+S G  P+I  YN IL  LC+ G  D
Sbjct  351  -KGLTPDAYSYDPLVSAFCKEGRLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGKAD  409

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A +   +L  +GC P+V SYN +  AL     W+ G++     ++ EM   G +P   T
Sbjct  410  QALQIFENLGEVGCPPNVSSYNTMFSAL-----WNCGDRVRALGMVSEMIGKGIKPDEIT  464

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +++AI +L  M   G  P   +Y+ L+   CK  R+  AI +L
Sbjct  465  YNSLISCLCRDGMVDEAIGLLVDMETGGFQPTVISYNILLLGLCKTRRVVDAIQVL  520


 Score =   152 bits (385),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 145/271 (54%), Gaps = 6/271 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LNR    GK+EE   L+  M   G +P+VV  + LI  L    K E AV V
Sbjct  289  SYNILLRALLNR----GKWEEGEKLVTNMCSRGCEPNVVTYSILISTLCRDGKVEDAVNV  344

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++++++ G  P+  +Y  L+  FCK  R++ A   L+ M S G  PD+V YN ++ ++C 
Sbjct  345  LKIMKKKGLTPDAYSYDPLVSAFCKEGRLDLAIEFLDYMISDGCLPDIVNYNTILAALCK  404

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             GK   AL++ + + E   C P+V +Y  +  A         A+ +V EM+ +G++P+  
Sbjct  405  SGKADQALQIFENLGE-VGCPPNVSSYNTMFSALWNCGDRVRALGMVSEMIGKGIKPDEI  463

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCR+GMVD A   +  +   G +P V SYNILL  L   R   D  ++L EM
Sbjct  464  TYNSLISCLCRDGMVDEAIGLLVDMETGGFQPTVISYNILLLGLCKTRRVVDAIQVLTEM  523

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISM  112
               GC P+  TY + +  +   G   +A+ +
Sbjct  524  VEKGCRPNETTYILLIEGIGFAGWRAEAMEL  554


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 88/159 (55%), Gaps = 2/159 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNV  706
            C +GK ++ L + + + ++G  P+V     +   L++     +A+  V +++ +  +P+ 
Sbjct  403  CKSGKADQALQIFENLGEVGCPPNVSSYNTMFSALWNCGDRVRALGMVSEMIGKGIKPDE  462

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   V+ A G+L  M + GF P V++YNI++  +C   ++  A++VL +
Sbjct  463  ITYNSLISCLCRDGMVDEAIGLLVDMETGGFQPTVISYNILLLGLCKTRRVVDAIQVLTE  522

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLS  409
            M E   C+P+  TY +LIE        +EAM+L + + S
Sbjct  523  MVE-KGCRPNETTYILLIEGIGFAGWRAEAMELANSVFS  560



>ref|XP_009343763.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Pyrus x bretschneideri]
Length=633

 Score =   449 bits (1156),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 267/328 (81%), Gaps = 1/328 (0%)
 Frame = -1

Query  984  KNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVV  805
            +N      S E R   +Q  D KE  + + LNRSC AG+Y E LY L+ MV   YKPDV+
Sbjct  96   RNPSKAVASAEARPTQLQNNDVKETHLVKVLNRSCKAGQYNEALYFLELMVNKAYKPDVI  155

Query  804  LCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMR  625
            LCTKLIKG F+ +  EKAV+VMQ+LE++GEP++ +Y ALI GFCK NR++AAN VL+RMR
Sbjct  156  LCTKLIKGFFNSRNVEKAVRVMQILEKYGEPDLFSYNALISGFCKANRIDAANKVLDRMR  215

Query  624  SRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGI  445
            S+GF PDVVTYNIMIGS+C RGKLGLALKVLDQ+ +DN C+P V+TYT+LIEATI + GI
Sbjct  216  SQGFSPDVVTYNIMIGSLCGRGKLGLALKVLDQLVKDN-CRPTVITYTILIEATIPEGGI  274

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
             EAMKL+DEMLSRGL+P+++TYNA+++G+CREGM+DRA+EFVRSL + GC P+V SYNIL
Sbjct  275  DEAMKLLDEMLSRGLKPDMHTYNAVVRGMCREGMLDRAFEFVRSLDSKGCSPNVVSYNIL  334

Query  264  LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
            LRALL+R  W++GEKL+  M S GCEP+  TY+I +S+LCRDGK+  A+++LKIM +KGL
Sbjct  335  LRALLNRGKWEEGEKLVSNMCSRGCEPNVVTYSILISTLCRDGKVEDAVNVLKIMKDKGL  394

Query  84   TPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TP+ ++YDPL+SAFCKEGRLDLAI+ LD
Sbjct  395  TPDAYSYDPLVSAFCKEGRLDLAIEFLD  422


 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 172/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            CG GK    L +L  +VK   +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  234  CGRGKLGLALKVLDQLVKDNCRPTVITYTILIEATIPEGGIDEAMKLLDEMLSRGLKPDM  293

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A++ G C+   ++ A   +  + S+G  P+VV+YNI++ ++ +RGK     K++  
Sbjct  294  HTYNAVVRGMCREGMLDRAFEFVRSLDSKGCSPNVVSYNILLRALLNRGKWEEGEKLVSN  353

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     C+P+VVTY++LI +T+ +DG + +A+ ++  M  +GL P+ Y+Y+ ++   C+E
Sbjct  354  MCS-RGCEPNVVTYSILI-STLCRDGKVEDAVNVLKIMKDKGLTPDAYSYDPLVSAFCKE  411

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+  + + GC PD+ +YN +L AL      D   ++ + +  +GC P+  +Y
Sbjct  412  GRLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGKADQALQIFENLGEVGCPPNVSSY  471

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M  KG+ P+  TY+ LIS  C++G ++ AI LL
Sbjct  472  NTMFSALWNCGDRVRALQMVSEMVSKGIDPDGITYNSLISCLCRDGMMNEAIGLL  526


 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/296 (34%), Positives = 161/296 (54%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E + LL  M+  G KPD+     +++G+      ++A + ++ L+  G  PNV++Y
Sbjct  272  GGIDEAMKLLDEMLSRGLKPDMHTYNAVVRGMCREGMLDRAFEFVRSLDSKGCSPNVVSY  331

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    +++ M SRG  P+VVTY+I+I ++C  GK+  A+ VL  MK 
Sbjct  332  NILLRALLNRGKWEEGEKLVSNMCSRGCEPNVVTYSILISTLCRDGKVEDAVNVLKIMK-  390

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D    PD  +Y  L+ A   +  +  A++ +D M+S G  P+I  YN IL  LC+ G  D
Sbjct  391  DKGLTPDAYSYDPLVSAFCKEGRLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGKAD  450

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A +   +L  +GC P+V SYN +  AL     W+ G++     ++ EM S G +P   T
Sbjct  451  QALQIFENLGEVGCPPNVSSYNTMFSAL-----WNCGDRVRALQMVSEMVSKGIDPDGIT  505

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +N+AI +L  M   G  P   +Y+ ++   CK  R+  AI++L
Sbjct  506  YNSLISCLCRDGMMNEAIGLLVDMETGGFQPTVISYNIVLLGLCKTRRIVDAIEVL  561


 Score =   150 bits (378),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/286 (31%), Positives = 152/286 (53%), Gaps = 7/286 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LNR    GK+EE   L+  M   G +P+VV  + LI  L    K E AV V
Sbjct  330  SYNILLRALLNR----GKWEEGEKLVSNMCSRGCEPNVVTYSILISTLCRDGKVEDAVNV  385

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            +++++  G  P+  +Y  L+  FCK  R++ A   L+ M S G  PD+V YN ++ ++C 
Sbjct  386  LKIMKDKGLTPDAYSYDPLVSAFCKEGRLDLAIEFLDYMISDGCLPDIVNYNTILAALCK  445

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             GK   AL++ + + E   C P+V +Y  +  A         A+++V EM+S+G++P+  
Sbjct  446  SGKADQALQIFENLGEVG-CPPNVSSYNTMFSALWNCGDRVRALQMVSEMVSKGIDPDGI  504

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCR+GM++ A   +  +   G +P V SYNI+L  L   R   D  ++L  M
Sbjct  505  TYNSLISCLCRDGMMNEAIGLLVDMETGGFQPTVISYNIVLLGLCKTRRIVDAIEVLAAM  564

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK-IMTEKGLTPNKF  70
               GC P+  TY + +  +   G   +A+ +   + + + ++ + F
Sbjct  565  VEKGCRPNETTYTLLIEGIGFAGWRAEAMQLAHSVFSLRAISEDSF  610



>ref|XP_004304772.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=586

 Score =   443 bits (1140),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 205/328 (63%), Positives = 266/328 (81%), Gaps = 1/328 (0%)
 Frame = -1

Query  984  KNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVV  805
            +N   V VS E ++  +Q  D K+  + + LNRSC AG+Y E +Y L+ MV  GYKPDV+
Sbjct  49   RNPTRVSVSAEPKSTQLQNYDFKDTHLMKVLNRSCKAGQYNEAIYFLELMVNKGYKPDVI  108

Query  804  LCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMR  625
            LCTKLIKG F+ +  EKA++VMQ+LEQ+GEP++ AY ALI GFCK NR+E+AN VL+RM+
Sbjct  109  LCTKLIKGFFNSRNIEKAIRVMQILEQYGEPDLFAYNALISGFCKANRIESANKVLDRMK  168

Query  624  SRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGI  445
            S+GF PDVVTYNIMIGS+C RGKLGLAL+V+D++  DN CKP V+TYT+LIEA I+  GI
Sbjct  169  SQGFKPDVVTYNIMIGSLCSRGKLGLALQVMDRLVRDN-CKPTVITYTILIEAIILDGGI  227

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
            +EAMKL+DEMLSRGL+P++YTYNAI++G+CREGM+DRA+EFV+   A GC P+V SYNIL
Sbjct  228  NEAMKLLDEMLSRGLKPDMYTYNAIVRGMCREGMLDRAFEFVKCFDAKGCAPNVISYNIL  287

Query  264  LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
            LRALL+R  W++GE L+  M + GCEP+  TY+I +S+LCRDGK+   +++LKIM EKGL
Sbjct  288  LRALLNRGKWEEGENLVANMCARGCEPNVVTYSILISTLCRDGKVEDGMNVLKIMKEKGL  347

Query  84   TPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TP+ ++YDPLIS FCKEGRLDLAI+LLD
Sbjct  348  TPDAYSYDPLISCFCKEGRLDLAIELLD  375


 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/295 (30%), Positives = 169/295 (57%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK    L ++  +V+   KP V+  T LI+ +       +A+K++ ++L +  +P++
Sbjct  187  CSRGKLGLALQVMDRLVRDNCKPTVITYTILIEAIILDGGINEAMKLLDEMLSRGLKPDM  246

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A++ G C+   ++ A   +    ++G  P+V++YNI++ ++ +RGK      ++  
Sbjct  247  YTYNAIVRGMCREGMLDRAFEFVKCFDAKGCAPNVISYNILLRALLNRGKWEEGENLVAN  306

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     C+P+VVTY++LI +T+ +DG + + M ++  M  +GL P+ Y+Y+ ++   C+E
Sbjct  307  MCA-RGCEPNVVTYSILI-STLCRDGKVEDGMNVLKIMKEKGLTPDAYSYDPLISCFCKE  364

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A E +  + + GC PD+ +YN +L AL    + D   ++ + +  +GC P+  +Y
Sbjct  365  GRLDLAIELLDCMISDGCLPDIVNYNTVLAALCKNGSADQALEIFENLGEVGCPPNVSSY  424

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M  KG+ P++ TY+ LIS  C++G ++ AI LL
Sbjct  425  NTMFSALWNCGDRVRALGMVSDMVSKGIEPDEITYNSLISCLCRDGMVNEAIGLL  479


 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 155/296 (52%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G   E + LL  M+  G KPD+     +++G+      ++A + ++  +  G  PNV++Y
Sbjct  225  GGINEAMKLLDEMLSRGLKPDMYTYNAIVRGMCREGMLDRAFEFVKCFDAKGCAPNVISY  284

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++  M +RG  P+VVTY+I+I ++C  GK+   + VL  MKE
Sbjct  285  NILLRALLNRGKWEEGENLVANMCARGCEPNVVTYSILISTLCRDGKVEDGMNVLKIMKE  344

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI     +  +  A++L+D M+S G  P+I  YN +L  LC+ G  D
Sbjct  345  -KGLTPDAYSYDPLISCFCKEGRLDLAIELLDCMISDGCLPDIVNYNTVLAALCKNGSAD  403

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E   +L  +GC P+V SYN +  AL     W+ G++     ++ +M S G EP   T
Sbjct  404  QALEIFENLGEVGCPPNVSSYNTMFSAL-----WNCGDRVRALGMVSDMVSKGIEPDEIT  458

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +N+AI +L  M   G  P   TY+ ++    K  R+  AI++ 
Sbjct  459  YNSLISCLCRDGMVNEAIGLLVDMEAGGFQPTVITYNIVLLGLSKARRIVDAIEVF  514


 Score =   144 bits (362),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 145/273 (53%), Gaps = 6/273 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LNR    GK+EE   L+  M   G +P+VV  + LI  L    K E  + V
Sbjct  283  SYNILLRALLNR----GKWEEGENLVANMCARGCEPNVVTYSILISTLCRDGKVEDGMNV  338

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++++++ G  P+  +Y  LI  FCK  R++ A  +L+ M S G  PD+V YN ++ ++C 
Sbjct  339  LKIMKEKGLTPDAYSYDPLISCFCKEGRLDLAIELLDCMISDGCLPDIVNYNTVLAALCK  398

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             G    AL++ + + E   C P+V +Y  +  A         A+ +V +M+S+G+EP+  
Sbjct  399  NGSADQALEIFENLGEVG-CPPNVSSYNTMFSALWNCGDRVRALGMVSDMVSKGIEPDEI  457

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCR+GMV+ A   +  + A G +P V +YNI+L  L   R   D  ++   M
Sbjct  458  TYNSLISCLCRDGMVNEAIGLLVDMEAGGFQPTVITYNIVLLGLSKARRIVDAIEVFTAM  517

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
               GC P+  TY + +  +   G   +A+ + K
Sbjct  518  VEKGCRPNETTYILLIEGIGFAGWRAEAMELAK  550


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 95/192 (49%), Gaps = 2/192 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+ +  + LL  M+  G  PD+V    ++  L     A++A+++ + L + G  PNV
Sbjct  362  CKEGRLDLAIELLDCMISDGCLPDIVNYNTVLAALCKNGSADQALEIFENLGEVGCPPNV  421

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  +            A G+++ M S+G  PD +TYN +I  +C  G +  A+ +L  
Sbjct  422  SSYNTMFSALWNCGDRVRALGMVSDMVSKGIEPDEITYNSLISCLCRDGMVNEAIGLLVD  481

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E    +P V+TY +++        I +A+++   M+ +G  PN  TY  +++G+   G
Sbjct  482  M-EAGGFQPTVITYNIVLLGLSKARRIVDAIEVFTAMVEKGCRPNETTYILLIEGIGFAG  540

Query  345  MVDRAYEFVRSL  310
                A E  +S+
Sbjct  541  WRAEAMELAKSV  552


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  ++ L + + + ++G  P+V     +   L++     +A+ ++  +   G EP+ 
Sbjct  397  CKNGSADQALEIFENLGEVGCPPNVSSYNTMFSALWNCGDRVRALGMVSDMVSKGIEPDE  456

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   V  A G+L  M + GF P V+TYNI++  +    ++  A++V   
Sbjct  457  ITYNSLISCLCRDGMVNEAIGLLVDMEAGGFQPTVITYNIVLLGLSKARRIVDAIEVFTA  516

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLS  409
            M E   C+P+  TY +LIE        +EAM+L   + S
Sbjct  517  MVE-KGCRPNETTYILLIEGIGFAGWRAEAMELAKSVYS  554



>ref|XP_007030407.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
 gb|EOY10909.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
Length=586

 Score =   439 bits (1130),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 272/343 (79%), Gaps = 3/343 (1%)
 Frame = -1

Query  1023  VKCKKHEFRERNLK--NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLY  850
             V C  HE ++ + K  N Q V+VS E R   +   D KE  + + LNRSC AGKY E  Y
Sbjct  34    VSCLNHESQDSSSKSRNNQKVRVSAETRPTHLLSFDFKETHLMKLLNRSCKAGKYNEAFY  93

Query  849   LLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCK  670
              L+ MV  GYKPDVVLCTK+IKG F+ +  EKA +V+++LE++GEP+V AY A+I GFCK
Sbjct  94    FLECMVGKGYKPDVVLCTKMIKGFFNGRNVEKATRVIEILEKYGEPDVFAYNAIISGFCK  153

Query  669   TNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVV  490
              NR++ AN VL+RMRSRGF PDVVTYNIMIGS C RGKL  A KV++Q+ +DN CKP V+
Sbjct  154   MNRLDFANKVLDRMRSRGFSPDVVTYNIMIGSFCSRGKLDSAYKVINQLLKDN-CKPSVI  212

Query  489   TYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSL  310
             TYT+LIEAT+++  I+EAMKL+DEMLS+GL P+++TYNAI++G+C++GMV+RA++FVRSL
Sbjct  213   TYTILIEATMLQGEINEAMKLLDEMLSKGLRPDMFTYNAIIRGMCKDGMVNRAFKFVRSL  272

Query  309   PAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKL  130
              A GC+PDV SYNILLR LL++  W +GEKL+ EM S GCEP+  TY+I +SSLCR+GKL
Sbjct  273   KARGCQPDVISYNILLRVLLNQGKWAEGEKLVTEMVSRGCEPNVVTYSILISSLCREGKL  332

Query  129   NKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +A+++LK+M E+GLTP+ ++YDPLISAFCKEGRLDLAI+ LD
Sbjct  333   EEAVNVLKMMKERGLTPDAYSYDPLISAFCKEGRLDLAIEFLD  375


 Score =   176 bits (445),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 167/294 (57%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +    ++  ++K   KP V+  T LI+      +  +A+K++ ++L +   P++
Sbjct  187  CSRGKLDSAYKVINQLLKDNCKPSVITYTILIEATMLQGEINEAMKLLDEMLSKGLRPDM  246

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A+I G CK   V  A   +  +++RG  PDV++YNI++  + ++GK     K++ +
Sbjct  247  FTYNAIIRGMCKDGMVNRAFKFVRSLKARGCQPDVISYNILLRVLLNQGKWAEGEKLVTE  306

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C+P+VVTY++LI +   +  + EA+ ++  M  RGL P+ Y+Y+ ++   C+EG
Sbjct  307  MV-SRGCEPNVVTYSILISSLCREGKLEEAVNVLKMMKERGLTPDAYSYDPLISAFCKEG  365

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A EF+  + + GC PD+ +YN +L  L      +   ++ +++  +GC P+  +YN
Sbjct  366  RLDLAIEFLDCMISDGCLPDIVNYNTVLATLCKNGKAEQALEIFEKLREVGCPPNVSSYN  425

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               S+L   G   KA+ M+  M  K + P++ TY+ LIS  C++G +D AI+LL
Sbjct  426  TMFSALWSSGDKVKALEMISEMLSKRIGPDEITYNSLISCLCRDGMVDEAIELL  479


 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/296 (34%), Positives = 157/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G+  E + LL  M+  G +PD+     +I+G+       +A K ++ L+  G +P+V++Y
Sbjct  225  GEINEAMKLLDEMLSKGLRPDMFTYNAIIRGMCKDGMVNRAFKFVRSLKARGCQPDVISY  284

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       +      ++  M SRG  P+VVTY+I+I S+C  GKL  A+ VL  MKE
Sbjct  285  NILLRVLLNQGKWAEGEKLVTEMVSRGCEPNVVTYSILISSLCREGKLEEAVNVLKMMKE  344

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ +D M+S G  P+I  YN +L  LC+ G  +
Sbjct  345  -RGLTPDAYSYDPLISAFCKEGRLDLAIEFLDCMISDGCLPDIVNYNTVLATLCKNGKAE  403

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+V SYN +  AL     W  G+K     ++ EM S    P   T
Sbjct  404  QALEIFEKLREVGCPPNVSSYNTMFSAL-----WSSGDKVKALEMISEMLSKRIGPDEIT  458

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +++AI +L  M   G+ P   +Y+ ++   CK  R++ AI++L
Sbjct  459  YNSLISCLCRDGMVDEAIELLVDMGCSGIPPTVISYNIVLLGLCKVHRINDAIEVL  514


 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 151/294 (51%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKK-AEKAVKVMQLLEQFGEPNV  706
            C  G        ++ +   G +PDV+    L++ L +  K AE    V +++ +  EPNV
Sbjct  257  CKDGMVNRAFKFVRSLKARGCQPDVISYNILLRVLLNQGKWAEGEKLVTEMVSRGCEPNV  316

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E A  VL  M+ RG  PD  +Y+ +I + C  G+L LA++ LD 
Sbjct  317  VTYSILISSLCREGKLEEAVNVLKMMKERGLTPDAYSYDPLISAFCKEGRLDLAIEFLDC  376

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K+G +E A+++ +++   G  PN+ +YN +   L   
Sbjct  377  MISDG-CLPDIVNYNTVL-ATLCKNGKAEQALEIFEKLREVGCPPNVSSYNTMFSALWSS  434

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   +A E +  + +    PD  +YN L+  L      D+  +LL +M   G  P   +Y
Sbjct  435  GDKVKALEMISEMLSKRIGPDEITYNSLISCLCRDGMVDEAIELLVDMGCSGIPPTVISY  494

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            NI +  LC+  ++N AI +L  M +K   PN+ TY  LI      G    A++L
Sbjct  495  NIVLLGLCKVHRINDAIEVLAAMVDKRCQPNETTYILLIEGIGFAGWRSEAMEL  548


 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 83/158 (53%), Gaps = 2/158 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK E+ L + + + ++G  P+V     +   L+S     KA++++ ++L +   P+ 
Sbjct  397  CKNGKAEQALEIFEKLREVGCPPNVSSYNTMFSALWSSGDKVKALEMISEMLSKRIGPDE  456

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   V+ A  +L  M   G  P V++YNI++  +C   ++  A++VL  
Sbjct  457  ITYNSLISCLCRDGMVDEAIELLVDMGCSGIPPTVISYNIVLLGLCKVHRINDAIEVLAA  516

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEML  412
            M  D  C+P+  TY +LIE        SEAM+L + + 
Sbjct  517  MV-DKRCQPNETTYILLIEGIGFAGWRSEAMELANALF  553



>ref|XP_008370748.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Malus domestica]
 ref|XP_008355828.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Malus domestica]
Length=633

 Score =   440 bits (1131),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 204/316 (65%), Positives = 261/316 (83%), Gaps = 1/316 (0%)
 Frame = -1

Query  948  RNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSV  769
            R   +Q  D KE  + + LNRSC AG+Y E LY L+ MV  GYKPDV+LCTKLIKG F+ 
Sbjct  108  RPTQLQNNDVKETHLVKVLNRSCKAGQYNEALYFLELMVNKGYKPDVILCTKLIKGFFNS  167

Query  768  KKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYN  589
            +  EKAV+VMQ+LE++GEP++ +Y ALI GFCK NR++AAN VL+RMRS+GF PDVVTYN
Sbjct  168  RNVEKAVRVMQILEKYGEPDLFSYNALISGFCKANRIDAANKVLDRMRSQGFSPDVVTYN  227

Query  588  IMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLS  409
            IMIGS+C RGKLGLALKVLDQ+ +DN C+P V+TYT+LIEATI + GI EAMKL+D MLS
Sbjct  228  IMIGSLCGRGKLGLALKVLDQLVKDN-CRPTVITYTILIEATIPEGGIDEAMKLLDXMLS  286

Query  408  RGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDD  229
            RGL+P+++TYNA+++G+CREGM+DRA+EFVRSL + GC P+  SYNILLRALL+R  W++
Sbjct  287  RGLKPDMHTYNAVVRGMCREGMLDRAFEFVRSLDSKGCSPNXVSYNILLRALLNRGKWEE  346

Query  228  GEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLIS  49
            GEKL+  M S GCEP+  TY+I +S+LCRD K+  A+++LKIM +KGLTP+ ++YDPL+S
Sbjct  347  GEKLVXNMCSRGCEPNVVTYSILISTLCRDXKVEDAVNVLKIMKDKGLTPDAYSYDPLVS  406

Query  48   AFCKEGRLDLAIDLLD  1
            AFCKEGRLDLAI+ LD
Sbjct  407  AFCKEGRLDLAIEFLD  422


 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/294 (31%), Positives = 163/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CG GK    L +L  +VK   +P V+  T LI+        ++A+K++  +   G +P++
Sbjct  234  CGRGKLGLALKVLDQLVKDNCRPTVITYTILIEATIPEGGIDEAMKLLDXMLSRGLKPDM  293

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A++ G C+   ++ A   +  + S+G  P+ V+YNI++ ++ +RGK     K++  
Sbjct  294  HTYNAVVRGMCREGMLDRAFEFVRSLDSKGCSPNXVSYNILLRALLNRGKWEEGEKLVXN  353

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C+P+VVTY++LI        + +A+ ++  M  +GL P+ Y+Y+ ++   C+EG
Sbjct  354  MCS-RGCEPNVVTYSILISTLCRDXKVEDAVNVLKIMKDKGLTPDAYSYDPLVSAFCKEG  412

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A EF+  + + GC PD+ +YN +L AL      D   ++ + +  +GC P+  +YN
Sbjct  413  RLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGKADQALQIFENLGEVGCPPNVSSYN  472

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               S+L   G   +A+ M+  M  KG+ P+  TY+ LIS  C++G ++ AI LL
Sbjct  473  TMFSALWNCGDRVRALQMVSEMVSKGIDPDGITYNSLISCLCRDGMVNEAIGLL  526


 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 158/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E + LL  M+  G KPD+     +++G+      ++A + ++ L+  G  PN ++Y
Sbjct  272  GGIDEAMKLLDXMLSRGLKPDMHTYNAVVRGMCREGMLDRAFEFVRSLDSKGCSPNXVSY  331

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++  M SRG  P+VVTY+I+I ++C   K+  A+ VL  MK 
Sbjct  332  NILLRALLNRGKWEEGEKLVXNMCSRGCEPNVVTYSILISTLCRDXKVEDAVNVLKIMK-  390

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D    PD  +Y  L+ A   +  +  A++ +D M+S G  P+I  YN IL  LC+ G  D
Sbjct  391  DKGLTPDAYSYDPLVSAFCKEGRLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGKAD  450

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A +   +L  +GC P+V SYN +  AL     W+ G++     ++ EM S G +P   T
Sbjct  451  QALQIFENLGEVGCPPNVSSYNTMFSAL-----WNCGDRVRALQMVSEMVSKGIDPDGIT  505

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +N+AI +L  M   G  P   +Y+ ++   CK  R+  AI++L
Sbjct  506  YNSLISCLCRDGMVNEAIGLLVDMETGGFQPTVISYNIVLLGLCKTRRIVDAIEVL  561


 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 152/286 (53%), Gaps = 7/286 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LNR    GK+EE   L+  M   G +P+VV  + LI  L    K E AV V
Sbjct  330  SYNILLRALLNR----GKWEEGEKLVXNMCSRGCEPNVVTYSILISTLCRDXKVEDAVNV  385

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            +++++  G  P+  +Y  L+  FCK  R++ A   L+ M S G  PD+V YN ++ ++C 
Sbjct  386  LKIMKDKGLTPDAYSYDPLVSAFCKEGRLDLAIEFLDYMISDGCLPDIVNYNTILAALCK  445

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             GK   AL++ + + E   C P+V +Y  +  A         A+++V EM+S+G++P+  
Sbjct  446  SGKADQALQIFENLGEVG-CPPNVSSYNTMFSALWNCGDRVRALQMVSEMVSKGIDPDGI  504

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCR+GMV+ A   +  +   G +P V SYNI+L  L   R   D  ++L  M
Sbjct  505  TYNSLISCLCRDGMVNEAIGLLVDMETGGFQPTVISYNIVLLGLCKTRRIVDAIEVLAAM  564

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK-IMTEKGLTPNKF  70
               GC P+  TY + +  +   G   +A+ +   + + + ++ + F
Sbjct  565  VEKGCRPNETTYTLLIEGIGFAGWRAEAMQLAHSVFSIRAISEDSF  610



>ref|XP_010265021.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Nelumbo nucifera]
Length=582

 Score =   436 bits (1120),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 202/338 (60%), Positives = 264/338 (78%), Gaps = 1/338 (0%)
 Frame = -1

Query  1014  KKHEFRERNLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYM  835
             +  E    N++N  S + S E R    Q LD KE  + + LNRSC AGKY E+LY L+ M
Sbjct  35    RNPELDGPNIRNRLSFRASAETRTTHYQSLDIKETHLMKLLNRSCKAGKYNESLYFLECM  94

Query  834   VKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVE  655
             +  GYKPDV+LCTKLIKG F+ +K EKAV+VM++LE  GEP+  AY ALI GFCK NR++
Sbjct  95    INKGYKPDVILCTKLIKGFFNSRKGEKAVRVMEILESHGEPDAFAYNALISGFCKMNRID  154

Query  654   AANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVL  475
             +A  VL+RM+ RG  PDVVTYNI+IGS+C RGKL LALKV DQ+ +D+ C P V+TYT+L
Sbjct  155   SATKVLDRMKIRGCLPDVVTYNILIGSLCGRGKLRLALKVFDQLLKDS-CHPTVITYTIL  213

Query  474   IEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGC  295
             IEATIV+ G ++AMKL++EMLS+GL P++YTYNAI++G+CREGMVDRA+EF+RSLP+ GC
Sbjct  214   IEATIVEGGTNDAMKLLEEMLSKGLRPDMYTYNAIIRGMCREGMVDRAFEFIRSLPSQGC  273

Query  294   KPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAIS  115
             +PDV SYNILLRA L +  WDDGEKL+  M S GCEP+  TY+I ++SLC +GK+ +A+ 
Sbjct  274   EPDVVSYNILLRAFLTQGRWDDGEKLVAGMISRGCEPNLITYSILITSLCHEGKVEQALE  333

Query  114   MLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +LK+M  +G TP+ ++YDPLISAFCKEGRLDL ++LL+
Sbjct  334   VLKVMLTRGFTPDTYSYDPLISAFCKEGRLDLTLELLE  371


 Score =   178 bits (452),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/295 (31%), Positives = 165/295 (56%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNV  706
            CG GK    L +   ++K    P V+  T LI+          A+K+++ +L +   P++
Sbjct  183  CGRGKLRLALKVFDQLLKDSCHPTVITYTILIEATIVEGGTNDAMKLLEEMLSKGLRPDM  242

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A+I G C+   V+ A   +  + S+G  PDVV+YNI++ +   +G+     K++  
Sbjct  243  YTYNAIIRGMCREGMVDRAFEFIRSLPSQGCEPDVVSYNILLRAFLTQGRWDDGEKLVAG  302

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C+P+++TY++LI +   +  + +A++++  ML+RG  P+ Y+Y+ ++   C+EG
Sbjct  303  MI-SRGCEPNLITYSILITSLCHEGKVEQALEVLKVMLTRGFTPDTYSYDPLISAFCKEG  361

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D   E +  + + GC PD+ +YN ++ AL    N D   ++ +E+   GC P+  +YN
Sbjct  362  RLDLTLELLECMISNGCAPDIVNYNTIMAALCKSGNADQALEIFEELGRAGCPPNVSSYN  421

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +S L  +G   KA+ M+  M  KG+ P++ TY+ LIS  C+EG +D A+ LL+
Sbjct  422  TMISGLWNNGARLKALEMVSEMISKGMEPDEITYNSLISCLCREGMVDEAMGLLE  476


 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 160/296 (54%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G   + + LL+ M+  G +PD+     +I+G+      ++A + ++ L   G EP+V++Y
Sbjct  221  GGTNDAMKLLEEMLSKGLRPDMYTYNAIIRGMCREGMVDRAFEFIRSLPSQGCEPDVVSY  280

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+  F    R +    ++  M SRG  P+++TY+I+I S+C  GK+  AL+VL  M  
Sbjct  281  NILLRAFLTQGRWDDGEKLVAGMISRGCEPNLITYSILITSLCHEGKVEQALEVLKVML-  339

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +   ++L++ M+S G  P+I  YN I+  LC+ G  D
Sbjct  340  TRGFTPDTYSYDPLISAFCKEGRLDLTLELLECMISNGCAPDIVNYNTIMAALCKSGNAD  399

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKL-----LKEMSSMGCEPHTFT  172
            +A E    L   GC P+V SYN ++  L     W++G +L     + EM S G EP   T
Sbjct  400  QALEIFEELGRAGCPPNVSSYNTMISGL-----WNNGARLKALEMVSEMISKGMEPDEIT  454

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCR+G +++A+ +L+ M   G  P   +Y+ ++   CK  R+D AIDLL
Sbjct  455  YNSLISCLCREGMVDEAMGLLEDMEGSGFRPTVISYNTVLLGLCKAHRIDNAIDLL  510


 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/293 (30%), Positives = 148/293 (51%), Gaps = 2/293 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNV  706
            C  G  +     ++ +   G +PDVV    L++   +  + +   K V  ++ +  EPN+
Sbjct  253  CREGMVDRAFEFIRSLPSQGCEPDVVSYNILLRAFLTQGRWDDGEKLVAGMISRGCEPNL  312

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C   +VE A  VL  M +RGF PD  +Y+ +I + C  G+L L L++L+ 
Sbjct  313  ITYSILITSLCHEGKVEQALEVLKVMLTRGFTPDTYSYDPLISAFCKEGRLDLTLELLEC  372

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   N C PD+V Y  ++ A        +A+++ +E+   G  PN+ +YN ++ GL   G
Sbjct  373  MI-SNGCAPDIVNYNTIMAALCKSGNADQALEIFEELGRAGCPPNVSSYNTMISGLWNNG  431

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               +A E V  + + G +PD  +YN L+  L      D+   LL++M   G  P   +YN
Sbjct  432  ARLKALEMVSEMISKGMEPDEITYNSLISCLCREGMVDEAMGLLEDMEGSGFRPTVISYN  491

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
              +  LC+  +++ AI +L +M +KG  PN+ T   LI      G    A++L
Sbjct  492  TVLLGLCKAHRIDNAIDLLVVMVKKGCRPNETTCILLIEGIAYAGWRGEAMEL  544


 Score = 76.6 bits (187),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 84/160 (53%), Gaps = 2/160 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNV  706
            C +G  ++ L + + + + G  P+V     +I GL++     KA++ V +++ +  EP+ 
Sbjct  393  CKSGNADQALEIFEELGRAGCPPNVSSYNTMISGLWNNGARLKALEMVSEMISKGMEPDE  452

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   V+ A G+L  M   GF P V++YN ++  +C   ++  A+ +L  
Sbjct  453  ITYNSLISCLCREGMVDEAMGLLEDMEGSGFRPTVISYNTVLLGLCKAHRIDNAIDLLVV  512

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSR  406
            M +   C+P+  T  +LIE         EAM+L + + SR
Sbjct  513  MVK-KGCRPNETTCILLIEGIAYAGWRGEAMELANALFSR  551



>ref|XP_010660210.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X2 [Vitis vinifera]
Length=582

 Score =   434 bits (1115),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 263/330 (80%), Gaps = 1/330 (0%)
 Frame = -1

Query  990  NLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPD  811
            N +N   V VS E R A +Q  D +E  + + LNRSC AGK+ E+LY L+ +V  GY PD
Sbjct  43   NSRNAPKVGVSAEARPAHLQSYDFRETHLMKLLNRSCKAGKFNESLYFLECLVNKGYTPD  102

Query  810  VVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNR  631
            V+LCTKLIKG F+ K  EKA +VM++LE   EP+V AY A+I GFCK NR+EAA  VLNR
Sbjct  103  VILCTKLIKGFFNFKNIEKASRVMEILESHTEPDVFAYNAVISGFCKVNRIEAATQVLNR  162

Query  630  MRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKD  451
            M++RGF PD+VTYNIMIGS+C+R KLGLALKVLDQ+  DN C P V+TYT+LIEATIV+ 
Sbjct  163  MKARGFLPDIVTYNIMIGSLCNRRKLGLALKVLDQLLLDN-CMPTVITYTILIEATIVEG  221

Query  450  GISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
            GI+EAMKL++EML+RGL P++YTYNAI++G+C+EGMV+RA E + SL + GCKPDV SYN
Sbjct  222  GINEAMKLLEEMLARGLLPDMYTYNAIIRGMCKEGMVERAAELITSLTSKGCKPDVISYN  281

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
            ILLRA L++  WD+GEKL+ EM S GCEP+  TY+I +SSLCR G++++AIS+LK+M EK
Sbjct  282  ILLRAFLNQGKWDEGEKLVAEMFSRGCEPNKVTYSILISSLCRFGRIDEAISVLKVMIEK  341

Query  90   GLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             LTP+ ++YDPLISA CKEGRLDLAI ++D
Sbjct  342  ELTPDTYSYDPLISALCKEGRLDLAIGIMD  371


 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/330 (31%), Positives = 162/330 (49%), Gaps = 37/330 (11%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C   + E    +L  M   G+ PD+V    +I  L + +K   A+KV+ QLL     P V
Sbjct  148  CKVNRIEAATQVLNRMKARGFLPDIVTYNIMIGSLCNRRKLGLALKVLDQLLLDNCMPTV  207

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI        +  A  +L  M +RG  PD+ TYN +I  +C  G +  A +++  
Sbjct  208  ITYTILIEATIVEGGINEAMKLLEEMLARGLLPDMYTYNAIIRGMCKEGMVERAAELITS  267

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPN---------------  391
            +     CKPDV++Y +L+ A + +    E  KLV EM SRG EPN               
Sbjct  268  LT-SKGCKPDVISYNILLRAFLNQGKWDEGEKLVAEMFSRGCEPNKVTYSILISSLCRFG  326

Query  390  --------------------IYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
                                 Y+Y+ ++  LC+EG +D A   +  + + GC PD+ +YN
Sbjct  327  RIDEAISVLKVMIEKELTPDTYSYDPLISALCKEGRLDLAIGIMDYMISNGCLPDIVNYN  386

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
             +L AL    N +   ++  ++  MGC P+  +YN  +S+L   G  ++A+ M+  M  K
Sbjct  387  TILAALCKNGNANQALEIFNKLRGMGCPPNVSSYNTMISALWSCGDRSRALGMVPAMISK  446

Query  90   GLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            G+ P++ TY+ LIS  C++G ++ AI LLD
Sbjct  447  GVDPDEITYNSLISCLCRDGLVEEAIGLLD  476


 Score =   146 bits (368),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 146/295 (49%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNV  706
            C  G  E    L+  +   G KPDV+    L++   +  K ++  K V ++  +  EPN 
Sbjct  253  CKEGMVERAAELITSLTSKGCKPDVISYNILLRAFLNQGKWDEGEKLVAEMFSRGCEPNK  312

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  R++ A  VL  M  +   PD  +Y+ +I ++C  G+L LA+ ++D 
Sbjct  313  VTYSILISSLCRFGRIDEAISVLKVMIEKELTPDTYSYDPLISALCKEGRLDLAIGIMDY  372

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   N C PD+V Y  ++ A       ++A+++ +++   G  PN+ +YN ++  L   G
Sbjct  373  MI-SNGCLPDIVNYNTILAALCKNGNANQALEIFNKLRGMGCPPNVSSYNTMISALWSCG  431

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               RA   V ++ + G  PD  +YN L+  L      ++   LL +M   G  P   +YN
Sbjct  432  DRSRALGMVPAMISKGVDPDEITYNSLISCLCRDGLVEEAIGLLDDMEQSGFRPTVISYN  491

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            I +  LC+  +++ AI M   M EKG  PN+ TY  LI      G    A++L +
Sbjct  492  IVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWRTEAMELAN  546


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 94/192 (49%), Gaps = 2/192 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+ +  + ++ YM+  G  PD+V    ++  L     A +A+++   L   G  PNV
Sbjct  358  CKEGRLDLAIGIMDYMISNGCLPDIVNYNTILAALCKNGNANQALEIFNKLRGMGCPPNV  417

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  +I           A G++  M S+G  PD +TYN +I  +C  G +  A+ +LD 
Sbjct  418  SSYNTMISALWSCGDRSRALGMVPAMISKGVDPDEITYNSLISCLCRDGLVEEAIGLLDD  477

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E +  +P V++Y +++        I +A+ +  EM+ +G  PN  TY  +++G+   G
Sbjct  478  M-EQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAG  536

Query  345  MVDRAYEFVRSL  310
                A E   SL
Sbjct  537  WRTEAMELANSL  548


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 82/160 (51%), Gaps = 2/160 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G   + L +   +  +G  P+V     +I  L+S     +A+ ++  +   G +P+ 
Sbjct  393  CKNGNANQALEIFNKLRGMGCPPNVSSYNTMISALWSCGDRSRALGMVPAMISKGVDPDE  452

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   VE A G+L+ M   GF P V++YNI++  +C   ++  A+ +  +
Sbjct  453  ITYNSLISCLCRDGLVEEAIGLLDDMEQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAE  512

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSR  406
            M E   C+P+  TY +LIE        +EAM+L + + SR
Sbjct  513  MIE-KGCRPNETTYILLIEGIGFAGWRTEAMELANSLFSR  551



>ref|XP_002266822.2| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X1 [Vitis vinifera]
Length=592

 Score =   432 bits (1111),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 263/330 (80%), Gaps = 1/330 (0%)
 Frame = -1

Query  990  NLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPD  811
            N +N   V VS E R A +Q  D +E  + + LNRSC AGK+ E+LY L+ +V  GY PD
Sbjct  53   NSRNAPKVGVSAEARPAHLQSYDFRETHLMKLLNRSCKAGKFNESLYFLECLVNKGYTPD  112

Query  810  VVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNR  631
            V+LCTKLIKG F+ K  EKA +VM++LE   EP+V AY A+I GFCK NR+EAA  VLNR
Sbjct  113  VILCTKLIKGFFNFKNIEKASRVMEILESHTEPDVFAYNAVISGFCKVNRIEAATQVLNR  172

Query  630  MRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKD  451
            M++RGF PD+VTYNIMIGS+C+R KLGLALKVLDQ+  DN C P V+TYT+LIEATIV+ 
Sbjct  173  MKARGFLPDIVTYNIMIGSLCNRRKLGLALKVLDQLLLDN-CMPTVITYTILIEATIVEG  231

Query  450  GISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
            GI+EAMKL++EML+RGL P++YTYNAI++G+C+EGMV+RA E + SL + GCKPDV SYN
Sbjct  232  GINEAMKLLEEMLARGLLPDMYTYNAIIRGMCKEGMVERAAELITSLTSKGCKPDVISYN  291

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
            ILLRA L++  WD+GEKL+ EM S GCEP+  TY+I +SSLCR G++++AIS+LK+M EK
Sbjct  292  ILLRAFLNQGKWDEGEKLVAEMFSRGCEPNKVTYSILISSLCRFGRIDEAISVLKVMIEK  351

Query  90   GLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             LTP+ ++YDPLISA CKEGRLDLAI ++D
Sbjct  352  ELTPDTYSYDPLISALCKEGRLDLAIGIMD  381


 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/330 (31%), Positives = 162/330 (49%), Gaps = 37/330 (11%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C   + E    +L  M   G+ PD+V    +I  L + +K   A+KV+ QLL     P V
Sbjct  158  CKVNRIEAATQVLNRMKARGFLPDIVTYNIMIGSLCNRRKLGLALKVLDQLLLDNCMPTV  217

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI        +  A  +L  M +RG  PD+ TYN +I  +C  G +  A +++  
Sbjct  218  ITYTILIEATIVEGGINEAMKLLEEMLARGLLPDMYTYNAIIRGMCKEGMVERAAELITS  277

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPN---------------  391
            +     CKPDV++Y +L+ A + +    E  KLV EM SRG EPN               
Sbjct  278  LTS-KGCKPDVISYNILLRAFLNQGKWDEGEKLVAEMFSRGCEPNKVTYSILISSLCRFG  336

Query  390  --------------------IYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
                                 Y+Y+ ++  LC+EG +D A   +  + + GC PD+ +YN
Sbjct  337  RIDEAISVLKVMIEKELTPDTYSYDPLISALCKEGRLDLAIGIMDYMISNGCLPDIVNYN  396

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
             +L AL    N +   ++  ++  MGC P+  +YN  +S+L   G  ++A+ M+  M  K
Sbjct  397  TILAALCKNGNANQALEIFNKLRGMGCPPNVSSYNTMISALWSCGDRSRALGMVPAMISK  456

Query  90   GLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            G+ P++ TY+ LIS  C++G ++ AI LLD
Sbjct  457  GVDPDEITYNSLISCLCRDGLVEEAIGLLD  486


 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 146/295 (49%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNV  706
            C  G  E    L+  +   G KPDV+    L++   +  K ++  K V ++  +  EPN 
Sbjct  263  CKEGMVERAAELITSLTSKGCKPDVISYNILLRAFLNQGKWDEGEKLVAEMFSRGCEPNK  322

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  R++ A  VL  M  +   PD  +Y+ +I ++C  G+L LA+ ++D 
Sbjct  323  VTYSILISSLCRFGRIDEAISVLKVMIEKELTPDTYSYDPLISALCKEGRLDLAIGIMDY  382

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   N C PD+V Y  ++ A       ++A+++ +++   G  PN+ +YN ++  L   G
Sbjct  383  MIS-NGCLPDIVNYNTILAALCKNGNANQALEIFNKLRGMGCPPNVSSYNTMISALWSCG  441

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               RA   V ++ + G  PD  +YN L+  L      ++   LL +M   G  P   +YN
Sbjct  442  DRSRALGMVPAMISKGVDPDEITYNSLISCLCRDGLVEEAIGLLDDMEQSGFRPTVISYN  501

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            I +  LC+  +++ AI M   M EKG  PN+ TY  LI      G    A++L +
Sbjct  502  IVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWRTEAMELAN  556


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 94/192 (49%), Gaps = 2/192 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+ +  + ++ YM+  G  PD+V    ++  L     A +A+++   L   G  PNV
Sbjct  368  CKEGRLDLAIGIMDYMISNGCLPDIVNYNTILAALCKNGNANQALEIFNKLRGMGCPPNV  427

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  +I           A G++  M S+G  PD +TYN +I  +C  G +  A+ +LD 
Sbjct  428  SSYNTMISALWSCGDRSRALGMVPAMISKGVDPDEITYNSLISCLCRDGLVEEAIGLLDD  487

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E +  +P V++Y +++        I +A+ +  EM+ +G  PN  TY  +++G+   G
Sbjct  488  M-EQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAG  546

Query  345  MVDRAYEFVRSL  310
                A E   SL
Sbjct  547  WRTEAMELANSL  558


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 82/160 (51%), Gaps = 2/160 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G   + L +   +  +G  P+V     +I  L+S     +A+ ++  +   G +P+ 
Sbjct  403  CKNGNANQALEIFNKLRGMGCPPNVSSYNTMISALWSCGDRSRALGMVPAMISKGVDPDE  462

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   VE A G+L+ M   GF P V++YNI++  +C   ++  A+ +  +
Sbjct  463  ITYNSLISCLCRDGLVEEAIGLLDDMEQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAE  522

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSR  406
            M E   C+P+  TY +LIE        +EAM+L + + SR
Sbjct  523  MIE-KGCRPNETTYILLIEGIGFAGWRTEAMELANSLFSR  561



>ref|XP_011076945.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Sesamum indicum]
Length=582

 Score =   430 bits (1106),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 206/336 (61%), Positives = 266/336 (79%), Gaps = 2/336 (1%)
 Frame = -1

Query  1005  EFRERNLKNLQSVKVSTENR-NALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVK  829
             E + RN +N   VKVST+ R + L    D KE    + L+RSC AG Y+E LY L+ MV 
Sbjct  37    EPKIRNYRNPVRVKVSTDTRPHQLPSYNDFKEAHFLKLLHRSCKAGNYDEGLYFLECMVN  96

Query  828   IGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAA  649
             +G+K DV+LCTKLIKG F+ K  +KA KVM++LE++GEP++ AY A I G CK N+++ A
Sbjct  97    LGHKADVILCTKLIKGFFNSKSVDKAEKVMRILERYGEPDIFAYNAFISGLCKVNQIDTA  156

Query  648   NGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIE  469
             N VL+ MR+RGF PDVVTYNIMIGS+C+RGKL LAL++LDQ+ +DN C+P V+TYT+LIE
Sbjct  157   NEVLSSMRARGFAPDVVTYNIMIGSLCNRGKLNLALEMLDQLIKDN-CQPTVITYTILIE  215

Query  468   ATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKP  289
             ATI++ GI EAMKL DEMLSRGL+P++YTYN I++G+CR GM+D A+ FVR+L + GCKP
Sbjct  216   ATILEGGIGEAMKLFDEMLSRGLQPDMYTYNTIIRGMCRGGMMDEAFTFVRNLTSRGCKP  275

Query  288   DVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISML  109
             DV SYNILLRALL +  WDDGEKL+ EM S GCEP+  TY+I +S LCRDG+L++AI++L
Sbjct  276   DVISYNILLRALLSQGKWDDGEKLMIEMFSTGCEPNVVTYSIMISGLCRDGQLDEAINLL  335

Query  108   KIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             K+M ++GLTP+ +TYDPLISA CKEGRLDLAI  LD
Sbjct  336   KLMMDEGLTPDTYTYDPLISALCKEGRLDLAIAFLD  371


 Score =   181 bits (458),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/295 (33%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK    L +L  ++K   +P V+  T LI+         +A+K+  ++L +  +P++
Sbjct  183  CNRGKLNLALEMLDQLIKDNCQPTVITYTILIEATILEGGIGEAMKLFDEMLSRGLQPDM  242

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G C+   ++ A   +  + SRG  PDV++YNI++ ++  +GK     K++ +
Sbjct  243  YTYNTIIRGMCRGGMMDEAFTFVRNLTSRGCKPDVISYNILLRALLSQGKWDDGEKLMIE  302

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     C+P+VVTY+++I   + +DG + EA+ L+  M+  GL P+ YTY+ ++  LC+E
Sbjct  303  MFS-TGCEPNVVTYSIMISG-LCRDGQLDEAINLLKLMMDEGLTPDTYTYDPLISALCKE  360

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A  F+  + + GC PD+ +YN +L AL    N D+  ++  +++  GC P   TY
Sbjct  361  GRLDLAIAFLDYMISSGCFPDIVNYNTILSALCKNGNADEALEVFGKLAESGCPPDVSTY  420

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N  VS+L   G  ++A+ ++  M  KG+ P++ TY+ LIS  C++G +D AI+LL
Sbjct  421  NTMVSALWNSGDRSRALRLVSEMIHKGIDPDEITYNSLISCLCRDGMVDRAIELL  475


 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/292 (33%), Positives = 147/292 (50%), Gaps = 2/292 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G   E + L   M+  G +PD+     +I+G+      ++A   ++ L   G +P+V++Y
Sbjct  221  GGIGEAMKLFDEMLSRGLQPDMYTYNTIIRGMCRGGMMDEAFTFVRNLTSRGCKPDVISY  280

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + +    ++  M S G  P+VVTY+IMI  +C  G+L  A+ +L  M  
Sbjct  281  NILLRALLSQGKWDDGEKLMIEMFSTGCEPNVVTYSIMISGLCRDGQLDEAINLLKLMM-  339

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D    PD  TY  LI A   +  +  A+  +D M+S G  P+I  YN IL  LC+ G  D
Sbjct  340  DEGLTPDTYTYDPLISALCKEGRLDLAIAFLDYMISSGCFPDIVNYNTILSALCKNGNAD  399

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A E    L   GC PDV +YN ++ AL +  +     +L+ EM   G +P   TYN  +
Sbjct  400  EALEVFGKLAESGCPPDVSTYNTMVSALWNSGDRSRALRLVSEMIHKGIDPDEITYNSLI  459

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            S LCRDG +++AI +L  M      P   TY+ ++   CK  R+  AI +L+
Sbjct  460  SCLCRDGMVDRAIELLGDMKNSEFLPTVVTYNIVLLGLCKAHRIGEAISILE  511


 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 146/293 (50%), Gaps = 2/293 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +E    ++ +   G KPDV+    L++ L S  K +   K+M ++     EPNV
Sbjct  253  CRGGMMDEAFTFVRNLTSRGCKPDVISYNILLRALLSQGKWDDGEKLMIEMFSTGCEPNV  312

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ +I G C+  +++ A  +L  M   G  PD  TY+ +I ++C  G+L LA+  LD 
Sbjct  313  VTYSIMISGLCRDGQLDEAINLLKLMMDEGLTPDTYTYDPLISALCKEGRLDLAIAFLDY  372

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   + C PD+V Y  ++ A        EA+++  ++   G  P++ TYN ++  L   G
Sbjct  373  MIS-SGCFPDIVNYNTILSALCKNGNADEALEVFGKLAESGCPPDVSTYNTMVSALWNSG  431

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               RA   V  +   G  PD  +YN L+  L      D   +LL +M +    P   TYN
Sbjct  432  DRSRALRLVSEMIHKGIDPDEITYNSLISCLCRDGMVDRAIELLGDMKNSEFLPTVVTYN  491

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            I +  LC+  ++ +AIS+L+ M +KG  PN+ TY  LI      G    A++L
Sbjct  492  IVLLGLCKAHRIGEAISILEEMVKKGCQPNETTYVLLIEGIGFAGWRVEAMEL  544


 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 145/268 (54%), Gaps = 2/268 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK+++   L+  M   G +P+VV  + +I GL    + ++A+ +++L+   G  P+   Y
Sbjct  291  GKWDDGEKLMIEMFSTGCEPNVVTYSIMISGLCRDGQLDEAINLLKLMMDEGLTPDTYTY  350

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI   CK  R++ A   L+ M S G FPD+V YN ++ ++C  G    AL+V  ++ E
Sbjct  351  DPLISALCKEGRLDLAIAFLDYMISSGCFPDIVNYNTILSALCKNGNADEALEVFGKLAE  410

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
             + C PDV TY  ++ A       S A++LV EM+ +G++P+  TYN+++  LCR+GMVD
Sbjct  411  -SGCPPDVSTYNTMVSALWNSGDRSRALRLVSEMIHKGIDPDEITYNSLISCLCRDGMVD  469

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
            RA E +  +      P V +YNI+L  L       +   +L+EM   GC+P+  TY + +
Sbjct  470  RAIELLGDMKNSEFLPTVVTYNIVLLGLCKAHRIGEAISILEEMVKKGCQPNETTYVLLI  529

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNK  73
              +   G   +A+ +   + +K +   +
Sbjct  530  EGIGFAGWRVEAMELANSLYKKNVVSGQ  557



>emb|CAN67401.1| hypothetical protein VITISV_025967 [Vitis vinifera]
Length=592

 Score =   427 bits (1099),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/330 (62%), Positives = 262/330 (79%), Gaps = 1/330 (0%)
 Frame = -1

Query  990  NLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPD  811
            N +N   V VS E R A +Q  D +E  + + LNRSC AGK+ E+LY L+ +V  GY PD
Sbjct  53   NSRNSPKVGVSAEARPAHLQSYDFRETHLMKLLNRSCKAGKFNESLYFLECLVNKGYTPD  112

Query  810  VVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNR  631
            V+LCTKLIKG F+ K  EKA +VM++LE   EP+V AY A+I GFCK N++EAA  VLNR
Sbjct  113  VILCTKLIKGFFNFKNIEKASRVMEILESHTEPDVFAYNAVISGFCKVNQIEAATQVLNR  172

Query  630  MRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKD  451
            M++RGF PD+VTYNIMIGS+C+R KLGLAL VLDQ+  DN C P V+TYT+LIEATIV+ 
Sbjct  173  MKARGFLPDIVTYNIMIGSLCNRRKLGLALTVLDQLLLDN-CMPTVITYTILIEATIVEG  231

Query  450  GISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
            GI+EAMKL++EML+RGL P++YTYNAI++G+C+EGMV+RA E + SL + GC+PDV SYN
Sbjct  232  GINEAMKLLEEMLARGLLPDMYTYNAIIRGMCKEGMVERAAELITSLTSKGCEPDVISYN  291

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
            ILLRA L++  WD+GEKL+ EM S GCEP+  TY+I +SSLCR G++++AIS+LK+M EK
Sbjct  292  ILLRAFLNQGKWDEGEKLVAEMFSRGCEPNKVTYSILISSLCRFGRIDEAISVLKVMIEK  351

Query  90   GLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             LTP+ ++YDPLISA CKEGRLDLAI ++D
Sbjct  352  ELTPDTYSYDPLISALCKEGRLDLAIGIMD  381


 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 158/273 (58%), Gaps = 2/273 (1%)
 Frame = -1

Query  816  PDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNVLAYTALIGGFCKTNRVEAANGV  640
            P V+  T LI+         +A+K+++ +L +   P++  Y A+I G CK   VE A  +
Sbjct  215  PTVITYTILIEATIVEGGINEAMKLLEEMLARGLLPDMYTYNAIIRGMCKEGMVERAAEL  274

Query  639  LNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATI  460
            +  + S+G  PDV++YNI++ +  ++GK     K++ +M     C+P+ VTY++LI +  
Sbjct  275  ITSLTSKGCEPDVISYNILLRAFLNQGKWDEGEKLVAEMF-SRGCEPNKVTYSILISSLC  333

Query  459  VKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
                I EA+ ++  M+ + L P+ Y+Y+ ++  LC+EG +D A   +  + + GC PD+ 
Sbjct  334  RFGRIDEAISVLKVMIEKELTPDTYSYDPLISALCKEGRLDLAIGIMDYMISNGCLPDIV  393

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
            +YN +L AL    N +   ++  ++  MGC P+  +YN  +S+L   G  ++A+ M+  M
Sbjct  394  NYNTILAALCKNGNANQALEIFNKLRGMGCPPNVSSYNTMISALWSCGDRSRALGMVPAM  453

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              KG+ P++ TY+ LIS  C++G ++ AI LLD
Sbjct  454  ISKGIDPDEITYNSLISCLCRDGLVEEAIGLLD  486


 Score =   144 bits (363),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 146/295 (49%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNV  706
            C  G  E    L+  +   G +PDV+    L++   +  K ++  K V ++  +  EPN 
Sbjct  263  CKEGMVERAAELITSLTSKGCEPDVISYNILLRAFLNQGKWDEGEKLVAEMFSRGCEPNK  322

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  R++ A  VL  M  +   PD  +Y+ +I ++C  G+L LA+ ++D 
Sbjct  323  VTYSILISSLCRFGRIDEAISVLKVMIEKELTPDTYSYDPLISALCKEGRLDLAIGIMDY  382

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   N C PD+V Y  ++ A       ++A+++ +++   G  PN+ +YN ++  L   G
Sbjct  383  MI-SNGCLPDIVNYNTILAALCKNGNANQALEIFNKLRGMGCPPNVSSYNTMISALWSCG  441

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               RA   V ++ + G  PD  +YN L+  L      ++   LL +M   G  P   +YN
Sbjct  442  DRSRALGMVPAMISKGIDPDEITYNSLISCLCRDGLVEEAIGLLDDMEQSGFRPTVISYN  501

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            I +  LC+  +++ AI M   M EKG  PN+ TY  LI      G    A++L +
Sbjct  502  IVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWRTEAMELAN  556


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 94/192 (49%), Gaps = 2/192 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+ +  + ++ YM+  G  PD+V    ++  L     A +A+++   L   G  PNV
Sbjct  368  CKEGRLDLAIGIMDYMISNGCLPDIVNYNTILAALCKNGNANQALEIFNKLRGMGCPPNV  427

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  +I           A G++  M S+G  PD +TYN +I  +C  G +  A+ +LD 
Sbjct  428  SSYNTMISALWSCGDRSRALGMVPAMISKGIDPDEITYNSLISCLCRDGLVEEAIGLLDD  487

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E +  +P V++Y +++        I +A+ +  EM+ +G  PN  TY  +++G+   G
Sbjct  488  M-EQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAG  546

Query  345  MVDRAYEFVRSL  310
                A E   SL
Sbjct  547  WRTEAMELANSL  558


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 82/160 (51%), Gaps = 2/160 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G   + L +   +  +G  P+V     +I  L+S     +A+ ++  +   G +P+ 
Sbjct  403  CKNGNANQALEIFNKLRGMGCPPNVSSYNTMISALWSCGDRSRALGMVPAMISKGIDPDE  462

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   VE A G+L+ M   GF P V++YNI++  +C   ++  A+ +  +
Sbjct  463  ITYNSLISCLCRDGLVEEAIGLLDDMEQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAE  522

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSR  406
            M E   C+P+  TY +LIE        +EAM+L + + SR
Sbjct  523  MIE-KGCRPNETTYILLIEGIGFAGWRTEAMELANSLFSR  561



>gb|KDP23717.1| hypothetical protein JCGZ_23550 [Jatropha curcas]
Length=584

 Score =   427 bits (1097),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 199/330 (60%), Positives = 263/330 (80%), Gaps = 1/330 (0%)
 Frame = -1

Query  990  NLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPD  811
            NL+N  ++ VS E R   +  LD KEI + + LNRSC AGKY E+LY L+ MV  GYKPD
Sbjct  45   NLRNPPNLSVSAETRPTHVLSLDFKEIHLIKLLNRSCKAGKYNESLYFLECMVDKGYKPD  104

Query  810  VVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNR  631
            V++CTKLIKG F+ +K +KA++VM++LE +G+P+V AY ALI GFCK N++E AN VL+R
Sbjct  105  VIMCTKLIKGFFNSRKIDKAIRVMEILEIYGKPDVFAYNALISGFCKANQIENANRVLDR  164

Query  630  MRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKD  451
            M+SRGF PDVVTYNIMIGS C RGKL LALKV +++ +DN CKP V+TYT+LIEATI++ 
Sbjct  165  MKSRGFLPDVVTYNIMIGSFCSRGKLDLALKVFEELLKDN-CKPTVITYTILIEATILEG  223

Query  450  GISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
            GI EAMKL+DEMLSRGLEP+ +TYNAI++G+C+E MVDRA++ VR L +  C+PDV +YN
Sbjct  224  GIDEAMKLLDEMLSRGLEPDTFTYNAIIRGMCKEDMVDRAFDLVRILNSRACRPDVITYN  283

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
            IL+RALL++  W++GEKLL EM + GC+P+  T++I + +LC DGK+ +A+S+LK M EK
Sbjct  284  ILVRALLNQGKWNEGEKLLNEMIARGCKPNAVTHSILIGALCHDGKVEEAVSLLKSMKEK  343

Query  90   GLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            GL PN + YDPLI+AFC+EG L LAI+ LD
Sbjct  344  GLKPNAYCYDPLIAAFCREGNLHLAIEFLD  373


 Score =   180 bits (457),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 96/294 (33%), Positives = 170/294 (58%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L + + ++K   KP V+  T LI+        ++A+K++ ++L +  EP+ 
Sbjct  185  CSRGKLDLALKVFEELLKDNCKPTVITYTILIEATILEGGIDEAMKLLDEMLSRGLEPDT  244

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A+I G CK + V+ A  ++  + SR   PDV+TYNI++ ++ ++GK     K+L++
Sbjct  245  FTYNAIIRGMCKEDMVDRAFDLVRILNSRACRPDVITYNILVRALLNQGKWNEGEKLLNE  304

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     CKP+ VT+++LI A      + EA+ L+  M  +GL+PN Y Y+ ++   CREG
Sbjct  305  MIA-RGCKPNAVTHSILIGALCHDGKVEEAVSLLKSMKEKGLKPNAYCYDPLIAAFCREG  363

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +  A EF+  + + GC PD+ +YN ++  L  + N D   ++ ++++ +GC P   +YN
Sbjct  364  NLHLAIEFLDYMISDGCLPDIVNYNTIMAGLCKKGNADHALEVFQKLNEVGCPPTVSSYN  423

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               S+L   G   +A+ M+  M  +G+ P++ TY+ LIS  C++G ++ AI LL
Sbjct  424  TMFSALWSCGDKYRALGMILEMLNQGIDPDEITYNSLISCLCRDGMVNEAIGLL  477


 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 158/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E + LL  M+  G +PD      +I+G+      ++A  ++++L      P+V+ Y
Sbjct  223  GGIDEAMKLLDEMLSRGLEPDTFTYNAIIRGMCKEDMVDRAFDLVRILNSRACRPDVITY  282

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       +      +LN M +RG  P+ VT++I+IG++C  GK+  A+ +L  MKE
Sbjct  283  NILVRALLNQGKWNEGEKLLNEMIARGCKPNAVTHSILIGALCHDGKVEEAVSLLKSMKE  342

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                KP+   Y  LI A   +  +  A++ +D M+S G  P+I  YN I+ GLC++G  D
Sbjct  343  -KGLKPNAYCYDPLIAAFCREGNLHLAIEFLDYMISDGCLPDIVNYNTIMAGLCKKGNAD  401

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
             A E  + L  +GC P V SYN +  AL     W  G+K     ++ EM + G +P   T
Sbjct  402  HALEVFQKLNEVGCPPTVSSYNTMFSAL-----WSCGDKYRALGMILEMLNQGIDPDEIT  456

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +N+AI +L  M +    PN  +Y+ ++   CK  R++ AI++L
Sbjct  457  YNSLISCLCRDGMVNEAIGLLVDMEKSRFQPNIVSYNIILLGLCKANRVNDAIEVL  512


 Score =   138 bits (347),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 90/315 (29%), Positives = 159/315 (50%), Gaps = 22/315 (7%)
 Frame = -1

Query  939  LIQLLDSK---------EIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLI  787
            L+++L+S+          I +R  LN+    GK+ E   LL  M+  G KP+ V  + LI
Sbjct  266  LVRILNSRACRPDVITYNILVRALLNQ----GKWNEGEKLLNEMIARGCKPNAVTHSILI  321

Query  786  KGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFF  610
              L    K E+AV +++ +++ G +PN   Y  LI  FC+   +  A   L+ M S G  
Sbjct  322  GALCHDGKVEEAVSLLKSMKEKGLKPNAYCYDPLIAAFCREGNLHLAIEFLDYMISDGCL  381

Query  609  PDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMK  430
            PD+V YN ++  +C +G    AL+V  ++ E   C P V +Y  +  A         A+ 
Sbjct  382  PDIVNYNTIMAGLCKKGNADHALEVFQKLNEVG-CPPTVSSYNTMFSALWSCGDKYRALG  440

Query  429  LVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALL  250
            ++ EML++G++P+  TYN+++  LCR+GMV+ A   +  +     +P++ SYNI+L  L 
Sbjct  441  MILEMLNQGIDPDEITYNSLISCLCRDGMVNEAIGLLVDMEKSRFQPNIVSYNIILLGLC  500

Query  249  DRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDG------KLNKAISMLKIMTEKG  88
                 +D  ++L  +   GC+P+  TY + +  +   G      +L  A+  +  ++E  
Sbjct  501  KANRVNDAIEVLAAIIEKGCQPNETTYTLLIEGVGFTGLRAEAMRLANALHYMNAISEDS  560

Query  87   LTPNKFTYDPLISAF  43
                  T+ PL++ +
Sbjct  561  FKRLNRTF-PLLNVY  574



>ref|XP_010102224.1| hypothetical protein L484_024505 [Morus notabilis]
 gb|EXB93167.1| hypothetical protein L484_024505 [Morus notabilis]
Length=587

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 266/335 (79%), Gaps = 3/335 (1%)
 Frame = -1

Query  1002  FRERNLKNLQSVKVSTENRNALIQL-LDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKI  826
             +R++N K L+ V+VS E ++   Q   D  E  + + +NRSC +GKY E LY L+ MV  
Sbjct  44    YRKKNKKPLR-VRVSVETKSPNSQSNSDFSESHLLKVINRSCKSGKYNEALYFLELMVSK  102

Query  825   GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAAN  646
             G+KPDV+LCTK+++G F+ +   KA++VM++LE+ GEP++ +Y A+I GFCK NRVE AN
Sbjct  103   GFKPDVILCTKVMRGFFNSRNIPKAIRVMEILEKHGEPDLFSYNAMISGFCKANRVELAN  162

Query  645   GVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEA  466
              VL+RMR +GF PD +TYNIMIGS+C RGK+ +A KVLD++  DN CKP V+TYT+LIEA
Sbjct  163   KVLDRMRVQGFSPDTITYNIMIGSLCSRGKVDMAFKVLDELLRDN-CKPSVITYTILIEA  221

Query  465   TIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPD  286
             TI + G+ +AM++++EMLSRGL P+++TYNAI++G+CREGM+DRA+EFVRSL A GC P+
Sbjct  222   TISEGGVDKAMEVLEEMLSRGLLPDMFTYNAIVRGMCREGMLDRAFEFVRSLEAKGCSPN  281

Query  285   VFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
             V SYNILLRALL+R  W DGEK+L +M S GCEP+  TY+I +S+LCRDGK+  A+++LK
Sbjct  282   VISYNILLRALLNRGKWSDGEKILSDMVSRGCEPNVVTYSILISTLCRDGKVEDAVNVLK  341

Query  105   IMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              M EKG+TP+ ++YDPLISAFCKEGRLDLAI+ +D
Sbjct  342   AMKEKGITPDAYSYDPLISAFCKEGRLDLAIEFMD  376


 Score =   175 bits (443),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 172/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNV  706
            C  GK +    +L  +++   KP V+  T LI+   S    +KA++V++ +L +   P++
Sbjct  188  CSRGKVDMAFKVLDELLRDNCKPSVITYTILIEATISEGGVDKAMEVLEEMLSRGLLPDM  247

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A++ G C+   ++ A   +  + ++G  P+V++YNI++ ++ +RGK     K+L  
Sbjct  248  FTYNAIVRGMCREGMLDRAFEFVRSLEAKGCSPNVISYNILLRALLNRGKWSDGEKILSD  307

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     C+P+VVTY++LI +T+ +DG + +A+ ++  M  +G+ P+ Y+Y+ ++   C+E
Sbjct  308  MV-SRGCEPNVVTYSILI-STLCRDGKVEDAVNVLKAMKEKGITPDAYSYDPLISAFCKE  365

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+  + + G  PD+ +YN +L AL    N D   ++ +++  +GC P   +Y
Sbjct  366  GRLDLAIEFMDYMISDGSLPDIVNYNTILAALCKNGNADHALEIFEKLGEVGCPPTVSSY  425

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G+  KA+ M+  M  K + P++ TY+ LIS  C+EG ++ AI LL
Sbjct  426  NTMFSALWNCGERIKALEMISEMVSKRINPDEITYNSLISCLCREGMVNEAIGLL  480


 Score =   164 bits (414),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 100/296 (34%), Positives = 156/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  ++ + +L+ M+  G  PD+     +++G+      ++A + ++ LE  G  PNV++Y
Sbjct  226  GGVDKAMEVLEEMLSRGLLPDMFTYNAIVRGMCREGMLDRAFEFVRSLEAKGCSPNVISY  285

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       +      +L+ M SRG  P+VVTY+I+I ++C  GK+  A+ VL  MKE
Sbjct  286  NILLRALLNRGKWSDGEKILSDMVSRGCEPNVVTYSILISTLCRDGKVEDAVNVLKAMKE  345

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ +D M+S G  P+I  YN IL  LC+ G  D
Sbjct  346  -KGITPDAYSYDPLISAFCKEGRLDLAIEFMDYMISDGSLPDIVNYNTILAALCKNGNAD  404

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
             A E    L  +GC P V SYN +  AL     W+ GE+     ++ EM S    P   T
Sbjct  405  HALEIFEKLGEVGCPPTVSSYNTMFSAL-----WNCGERIKALEMISEMVSKRINPDEIT  459

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCR+G +N+AI +L  M   G   +  +Y+ ++   CK  R+D AI+LL
Sbjct  460  YNSLISCLCREGMVNEAIGLLIDMEAGGFKLSVISYNIVLLGLCKARRIDDAIELL  515


 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/275 (33%), Positives = 146/275 (53%), Gaps = 6/275 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LNR    GK+ +   +L  MV  G +P+VV  + LI  L    K E AV V
Sbjct  284  SYNILLRALLNR----GKWSDGEKILSDMVSRGCEPNVVTYSILISTLCRDGKVEDAVNV  339

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++ +++ G  P+  +Y  LI  FCK  R++ A   ++ M S G  PD+V YN ++ ++C 
Sbjct  340  LKAMKEKGITPDAYSYDPLISAFCKEGRLDLAIEFMDYMISDGSLPDIVNYNTILAALCK  399

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             G    AL++ +++ E   C P V +Y  +  A        +A++++ EM+S+ + P+  
Sbjct  400  NGNADHALEIFEKLGE-VGCPPTVSSYNTMFSALWNCGERIKALEMISEMVSKRINPDEI  458

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCREGMV+ A   +  + A G K  V SYNI+L  L   R  DD  +LL  M
Sbjct  459  TYNSLISCLCREGMVNEAIGLLIDMEAGGFKLSVISYNIVLLGLCKARRIDDAIELLAAM  518

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
               GC P+  TY + +  +   G   +A+ +  ++
Sbjct  519  VEKGCRPNETTYTLLIEGIGFAGWRVEAMGLANLL  553



>ref|XP_011038512.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Populus euphratica]
Length=585

 Score =   420 bits (1079),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/337 (58%), Positives = 263/337 (78%), Gaps = 1/337 (0%)
 Frame = -1

Query  1008  HEFRERNLKNLQSVK-VSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMV  832
             H    R+L N   V+ V  E R AL    D +E  + R LNRSC AGKY E+LY L+ MV
Sbjct  41    HNATIRHLGNQPKVRSVLPETRPALALSYDFEETHLMRLLNRSCKAGKYSESLYFLECMV  100

Query  831   KIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEA  652
                Y+PDV+LCTKLIKG F+ +  +KA +VM +LE+ G+P+V AY A+I GFCK NR+E+
Sbjct  101   AKDYQPDVILCTKLIKGFFNSRNIDKATRVMGILEKHGKPDVFAYNAVISGFCKANRIES  160

Query  651   ANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLI  472
             A  VL+RM+ +GF PDVVT+NIMIG+ C +GK+ LALKV +++ +DNNCKP ++TYT+LI
Sbjct  161   AKKVLDRMKRKGFLPDVVTHNIMIGTFCSKGKIDLALKVFEELLKDNNCKPTLITYTILI  220

Query  471   EATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCK  292
             EA I++ GI EA+KL+DEMLSRGLEP+ +TYN I +GLC+EG VDRA+EFVR+L + GCK
Sbjct  221   EAYILEGGIDEALKLLDEMLSRGLEPDTFTYNVITRGLCKEGKVDRAFEFVRTLNSRGCK  280

Query  291   PDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISM  112
             PDV +YNILLRALL++  WD+GEK + E+ S GCEP+  TY+I +SSLCRDGK+++++++
Sbjct  281   PDVITYNILLRALLNQGKWDEGEKWMSEIFSRGCEPNVVTYSILISSLCRDGKIDESVNL  340

Query  111   LKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +K+M EKGLTP+ + YDPLI+AFC+EG+L +AI+ LD
Sbjct  341   VKVMKEKGLTPDAYCYDPLIAAFCREGKLAMAIEFLD  377


 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 170/296 (57%), Gaps = 5/296 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGY-KPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPN  709
            C  GK +  L + + ++K    KP ++  T LI+        ++A+K++ ++L +  EP+
Sbjct  188  CSKGKIDLALKVFEELLKDNNCKPTLITYTILIEAYILEGGIDEALKLLDEMLSRGLEPD  247

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
               Y  +  G CK  +V+ A   +  + SRG  PDV+TYNI++ ++ ++GK     K + 
Sbjct  248  TFTYNVITRGLCKEGKVDRAFEFVRTLNSRGCKPDVITYNILLRALLNQGKWDEGEKWMS  307

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++     C+P+VVTY++LI +++ +DG I E++ LV  M  +GL P+ Y Y+ ++   CR
Sbjct  308  EIFS-RGCEPNVVTYSILI-SSLCRDGKIDESVNLVKVMKEKGLTPDAYCYDPLIAAFCR  365

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            EG +  A EF+  + + G  PD+ +YN ++ AL    N D   ++  ++  +GC P+  +
Sbjct  366  EGKLAMAIEFLDCMISDGFLPDIVNYNTIMAALCKNGNSDHAVEIFGKLDEVGCPPNVSS  425

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S+L   G   +A+ M+  M  KG+ P+  TY+ LIS  C++G +D AI+LL
Sbjct  426  YNTMLSALWSSGDRYRALGMISQMLSKGIDPDGITYNSLISCLCRDGMVDEAIELL  481


 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 156/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G +PD      + +GL    K ++A + ++ L   G +P+V+ Y
Sbjct  227  GGIDEALKLLDEMLSRGLEPDTFTYNVITRGLCKEGKVDRAFEFVRTLNSRGCKPDVITY  286

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + +     ++ + SRG  P+VVTY+I+I S+C  GK+  ++ ++  MKE
Sbjct  287  NILLRALLNQGKWDEGEKWMSEIFSRGCEPNVVTYSILISSLCRDGKIDESVNLVKVMKE  346

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD   Y  LI A   +  ++ A++ +D M+S G  P+I  YN I+  LC+ G  D
Sbjct  347  -KGLTPDAYCYDPLIAAFCREGKLAMAIEFLDCMISDGFLPDIVNYNTIMAALCKNGNSD  405

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
             A E    L  +GC P+V SYN +L AL     W  G++     ++ +M S G +P   T
Sbjct  406  HAVEIFGKLDEVGCPPNVSSYNTMLSAL-----WSSGDRYRALGMISQMLSKGIDPDGIT  460

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +++AI +L  M      PN  +Y  ++   CK  R+D AI++L
Sbjct  461  YNSLISCLCRDGMVDEAIELLADMLSGRFQPNIVSYKIVLLGLCKAHRIDDAIEVL  516


 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/294 (30%), Positives = 151/294 (51%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +     ++ +   G KPDV+    L++ L +  K ++  K M ++  +  EPNV
Sbjct  259  CKEGKVDRAFEFVRTLNSRGCKPDVITYNILLRALLNQGKWDEGEKWMSEIFSRGCEPNV  318

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +++ +  ++  M+ +G  PD   Y+ +I + C  GKL +A++ LD 
Sbjct  319  VTYSILISSLCRDGKIDESVNLVKVMKEKGLTPDAYCYDPLIAAFCREGKLAMAIEFLDC  378

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D    PD+V Y  ++ A + K+G S+ A+++  ++   G  PN+ +YN +L  L   
Sbjct  379  MISDGFL-PDIVNYNTIM-AALCKNGNSDHAVEIFGKLDEVGCPPNVSSYNTMLSALWSS  436

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA   +  + + G  PD  +YN L+  L      D+  +LL +M S   +P+  +Y
Sbjct  437  GDRYRALGMISQMLSKGIDPDGITYNSLISCLCRDGMVDEAIELLADMLSGRFQPNIVSY  496

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
             I +  LC+  +++ AI +L  M E G  PN+ TY  LI      G    A++L
Sbjct  497  KIVLLGLCKAHRIDDAIEVLAAMIENGCQPNETTYTLLIEGIGFSGSRAQAMEL  550


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 99/195 (51%), Gaps = 2/195 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK    +  L  M+  G+ PD+V    ++  L     ++ AV++   L++ G  PNV
Sbjct  364  CREGKLAMAIEFLDCMISDGFLPDIVNYNTIMAALCKNGNSDHAVEIFGKLDEVGCPPNV  423

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  ++     +     A G++++M S+G  PD +TYN +I  +C  G +  A+++L  
Sbjct  424  SSYNTMLSALWSSGDRYRALGMISQMLSKGIDPDGITYNSLISCLCRDGMVDEAIELLAD  483

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M      +P++V+Y +++        I +A++++  M+  G +PN  TY  +++G+   G
Sbjct  484  MLS-GRFQPNIVSYKIVLLGLCKAHRIDDAIEVLAAMIENGCQPNETTYTLLIEGIGFSG  542

Query  345  MVDRAYEFVRSLPAM  301
               +A E   SL  M
Sbjct  543  SRAQAMELANSLYIM  557



>ref|XP_007205118.1| hypothetical protein PRUPE_ppa004835mg [Prunus persica]
 gb|EMJ06317.1| hypothetical protein PRUPE_ppa004835mg [Prunus persica]
Length=489

 Score =   415 bits (1066),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 189/279 (68%), Positives = 242/279 (87%), Gaps = 1/279 (0%)
 Frame = -1

Query  837  MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRV  658
            MV  GYKPDV+LCTKLIKG F+ +  EKA++VMQ+LE++GEP++ +Y ALI GFCK NR+
Sbjct  1    MVNKGYKPDVILCTKLIKGFFNSRNIEKAIRVMQILEKYGEPDLFSYNALISGFCKANRI  60

Query  657  EAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTV  478
            E+AN VL+RMRS+GF PDVVTYNIMIGS+C RGKLGLALKV+DQ+ +DN C+P V+TYT+
Sbjct  61   ESANKVLDRMRSQGFSPDVVTYNIMIGSLCSRGKLGLALKVMDQLVKDN-CRPTVITYTI  119

Query  477  LIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMG  298
            LIEATIV  GI EAMKL+DEMLSRGL+P++YTYNA+++G+CREGM+DRA++FVRSL + G
Sbjct  120  LIEATIVDGGIDEAMKLLDEMLSRGLKPDMYTYNAVIRGMCREGMLDRAFQFVRSLDSKG  179

Query  297  CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAI  118
            C P+V SYNILLRALL+R  W++GEKL+  M S GCEP+  TY+I +S+LCRDGK+  A+
Sbjct  180  CPPNVISYNILLRALLNRGKWEEGEKLVTNMCSRGCEPNVVTYSILISTLCRDGKVEDAV  239

Query  117  SMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            ++LKIM +KGLTP+ ++YDPL+SAFCKEGRLDLAI+ LD
Sbjct  240  NVLKIMKKKGLTPDAYSYDPLVSAFCKEGRLDLAIEFLD  278


 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 172/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK    L ++  +VK   +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  90   CSRGKLGLALKVMDQLVKDNCRPTVITYTILIEATIVDGGIDEAMKLLDEMLSRGLKPDM  149

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A+I G C+   ++ A   +  + S+G  P+V++YNI++ ++ +RGK     K++  
Sbjct  150  YTYNAVIRGMCREGMLDRAFQFVRSLDSKGCPPNVISYNILLRALLNRGKWEEGEKLVTN  209

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     C+P+VVTY++LI +T+ +DG + +A+ ++  M  +GL P+ Y+Y+ ++   C+E
Sbjct  210  MCS-RGCEPNVVTYSILI-STLCRDGKVEDAVNVLKIMKKKGLTPDAYSYDPLVSAFCKE  267

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+  + + GC PD+ +YN +L AL      D   ++ + +  +GC P+  +Y
Sbjct  268  GRLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGKADQALQIFENLGEVGCPPNVSSY  327

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M  KG+ P++ TY+ LIS  C++G +D AI LL
Sbjct  328  NTMFSALWNCGDRVRALGMVSEMVGKGIKPDEITYNSLISCLCRDGMVDEAIGLL  382


 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 158/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E + LL  M+  G KPD+     +I+G+      ++A + ++ L+  G  PNV++Y
Sbjct  128  GGIDEAMKLLDEMLSRGLKPDMYTYNAVIRGMCREGMLDRAFQFVRSLDSKGCPPNVISY  187

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++  M SRG  P+VVTY+I+I ++C  GK+  A+ VL  MK+
Sbjct  188  NILLRALLNRGKWEEGEKLVTNMCSRGCEPNVVTYSILISTLCRDGKVEDAVNVLKIMKK  247

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  L+ A   +  +  A++ +D M+S G  P+I  YN IL  LC+ G  D
Sbjct  248  -KGLTPDAYSYDPLVSAFCKEGRLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGKAD  306

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A +   +L  +GC P+V SYN +  AL     W+ G++     ++ EM   G +P   T
Sbjct  307  QALQIFENLGEVGCPPNVSSYNTMFSAL-----WNCGDRVRALGMVSEMVGKGIKPDEIT  361

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +++AI +L  M   G  P   +Y+ ++   CK  R+  AI +L
Sbjct  362  YNSLISCLCRDGMVDEAIGLLVDMETGGFQPTVISYNIILLGLCKTRRVVDAIQVL  417


 Score =   151 bits (381),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 152/286 (53%), Gaps = 7/286 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LNR    GK+EE   L+  M   G +P+VV  + LI  L    K E AV V
Sbjct  186  SYNILLRALLNR----GKWEEGEKLVTNMCSRGCEPNVVTYSILISTLCRDGKVEDAVNV  241

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++++++ G  P+  +Y  L+  FCK  R++ A   L+ M S G  PD+V YN ++ ++C 
Sbjct  242  LKIMKKKGLTPDAYSYDPLVSAFCKEGRLDLAIEFLDYMISDGCLPDIVNYNTILAALCK  301

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             GK   AL++ + + E   C P+V +Y  +  A         A+ +V EM+ +G++P+  
Sbjct  302  SGKADQALQIFENLGE-VGCPPNVSSYNTMFSALWNCGDRVRALGMVSEMVGKGIKPDEI  360

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCR+GMVD A   +  +   G +P V SYNI+L  L   R   D  ++L EM
Sbjct  361  TYNSLISCLCRDGMVDEAIGLLVDMETGGFQPTVISYNIILLGLCKTRRVVDAIQVLTEM  420

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISML-KIMTEKGLTPNKF  70
               GC P+  TY + +  +   G   +A+ +   + + + ++ + F
Sbjct  421  VEKGCRPNETTYILLIEGIGFAGWRAEAMELANSVFSLRAISEDSF  466



>ref|XP_002884468.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60727.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=598

 Score =   415 bits (1067),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 266/338 (79%), Gaps = 5/338 (1%)
 Frame = -1

Query  1002  FRERNLKNLQSVK----VSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYM  835
             F     +NLQ+      + TE R    Q L  ++  + +  +RSC +G Y E+L+LL+ M
Sbjct  52    FSSSGARNLQATTTDAAIPTERRQQHSQSLGFRDTQMLKIFHRSCRSGNYIESLHLLETM  111

Query  834   VKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVE  655
             V+ GY PDV+LCTKLIKG F+++   KAV+VM++LE+FG+P+V AY ALI GFCK NR++
Sbjct  112   VRKGYNPDVILCTKLIKGFFTLRNVPKAVRVMEILEKFGQPDVFAYNALINGFCKMNRID  171

Query  654   AANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVL  475
              A  VL+RMRS+ F PD VTYNIMIGS+C RGKL LALKVLDQ+  DN C+P V+TYT+L
Sbjct  172   DATRVLDRMRSKDFSPDTVTYNIMIGSLCSRGKLDLALKVLDQLLSDN-CQPTVITYTIL  230

Query  474   IEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGC  295
             IEAT+++ G+ EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMVDRA+E +R+L   GC
Sbjct  231   IEATMLEGGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMIRNLELKGC  290

Query  294   KPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAIS  115
             +PDV SYNILLRALL++  W++GEKL+ +M S  C+P+  TY+I +++LCRDGK+ +A++
Sbjct  291   EPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEAMN  350

Query  114   MLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +LK+M EKGLTP+ ++YDPLI+AFC+EGRLD+AI+ L+
Sbjct  351   LLKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLE  388


 Score =   178 bits (451),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +L  ++    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  200  CSRGKLDLALKVLDQLLSDNCQPTVITYTILIEATMLEGGVDEALKLLDEMLSRGLKPDM  259

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   V+ A  ++  +  +G  PDV++YNI++ ++ ++GK     K++ +
Sbjct  260  FTYNTIIRGMCKEGMVDRAFEMIRNLELKGCEPDVISYNILLRALLNQGKWEEGEKLMTK  319

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C P+VVTY++LI  T+ +DG I EAM L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  320  MFSEK-CDPNVVTYSILI-TTLCRDGKIEEAMNLLKLMKEKGLTPDAYSYDPLIAAFCRE  377

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+ ++ + GC PD+ +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  378  GRLDVAIEFLETMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  437

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M   G+ P++ TY+ +IS  C+EG +D A +LL
Sbjct  438  NTMFSALWSSGDKIRALHMILEMVSNGIDPDEITYNSMISCLCREGMVDKAFELL  492


 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 160/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+      ++A ++++ LE  G EP+V++Y
Sbjct  238  GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMIRNLELKGCEPDVISY  297

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++ +M S    P+VVTY+I+I ++C  GK+  A+ +L  MKE
Sbjct  298  NILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEAMNLLKLMKE  357

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  358  -KGLTPDAYSYDPLIAAFCREGRLDVAIEFLETMISDGCLPDIVNYNTVLATLCKNGKAD  416

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM S G +P   T
Sbjct  417  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALHMILEMVSNGIDPDEIT  471

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G ++KA  +L  M      P+  TY+ ++  FCK  R++ AID+LD
Sbjct  472  YNSMISCLCREGMVDKAFELLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAIDVLD  528


 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 141/271 (52%), Gaps = 6/271 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LN+    GK+EE   L+  M      P+VV  + LI  L    K E+A+ +
Sbjct  296  SYNILLRALLNQ----GKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEAMNL  351

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++L+++ G  P+  +Y  LI  FC+  R++ A   L  M S G  PD+V YN ++ ++C 
Sbjct  352  LKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLETMISDGCLPDIVNYNTVLATLCK  411

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             GK   AL++  ++ E   C P+  +Y  +  A         A+ ++ EM+S G++P+  
Sbjct  412  NGKADQALEIFGKLGE-VGCSPNSSSYNTMFSALWSSGDKIRALHMILEMVSNGIDPDEI  470

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCREGMVD+A+E +  + +    P V +YNI+L         +D   +L  M
Sbjct  471  TYNSMISCLCREGMVDKAFELLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAIDVLDSM  530

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISM  112
               GC P+  TY + +  +   G   +A+ +
Sbjct  531  VGNGCRPNETTYTVLIEGIGFAGYRAEAMEL  561


 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 150/299 (50%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  +PNV
Sbjct  270  CKEGMVDRAFEMIRNLELKGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNV  329

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E A  +L  M+ +G  PD  +Y+ +I + C  G+L +A++ L+ 
Sbjct  330  VTYSILITTLCRDGKIEEAMNLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLET  389

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  390  MISDG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  447

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA   +  + + G  PD  +YN ++  L      D   +LL +M S    P   TY
Sbjct  448  GDKIRALHMILEMVSNGIDPDEITYNSMISCLCREGMVDKAFELLVDMRSCEFHPSVVTY  507

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI +L  M   G  PN+ TY  LI      G     ++LA DL+
Sbjct  508  NIVLLGFCKAHRIEDAIDVLDSMVGNGCRPNETTYTVLIEGIGFAGYRAEAMELANDLV  566



>ref|XP_008443759.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Cucumis melo]
Length=581

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 264/333 (79%), Gaps = 1/333 (0%)
 Frame = -1

Query  999  RERNLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGY  820
            R  N   L++V  S E+R      LD+++  + + LNRSC AGK+ E+LY L+ +V  G+
Sbjct  34   RFSNKTYLRNVTSSAESRQPHFPNLDNRDAHLMKLLNRSCRAGKHNESLYFLESVVSKGF  93

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGV  640
            KPDVVLCTKLIKG F+ +  +KAV+VM++LE +G+P+V +Y A+I GF K N++++AN V
Sbjct  94   KPDVVLCTKLIKGFFNSRNLKKAVRVMEILETYGDPDVYSYNAMISGFSKANQIDSANQV  153

Query  639  LNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATI  460
             +RMRSRGF PD+VTYNIMIGS+C RGKL LA +V+D++ +D  CKP V+TYT+LIEATI
Sbjct  154  FDRMRSRGFSPDIVTYNIMIGSLCSRGKLALAFEVMDELLKDG-CKPSVITYTILIEATI  212

Query  459  VKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
            ++  I+EA++L DE+LSRGL P++YTYNAI++G+C+EGM DRA +FVR L A GC PDV 
Sbjct  213  LEGRINEALELFDELLSRGLRPDLYTYNAIIRGICKEGMEDRAVDFVRDLSARGCNPDVV  272

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
            SYNILLR+ L++  W+DGEKL+K+M   GCEP+  T++I +SS CR+G++ +A+++L++M
Sbjct  273  SYNILLRSFLNKSRWEDGEKLMKDMVLSGCEPNVVTHSILISSFCREGRVREAVNVLEVM  332

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             EKGLTP+ ++YDPLISAFCKEGRLDLAI+ LD
Sbjct  333  KEKGLTPDAYSYDPLISAFCKEGRLDLAIEYLD  365


 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/294 (31%), Positives = 164/294 (56%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK      ++  ++K G KP V+  T LI+      +  +A+++  +LL +   P++
Sbjct  177  CSRGKLALAFEVMDELLKDGCKPSVITYTILIEATILEGRINEALELFDELLSRGLRPDL  236

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A+I G CK    + A   +  + +RG  PDVV+YNI++ S  ++ +     K++  
Sbjct  237  YTYNAIIRGICKEGMEDRAVDFVRDLSARGCNPDVVSYNILLRSFLNKSRWEDGEKLMKD  296

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   + C+P+VVT+++LI +   +  + EA+ +++ M  +GL P+ Y+Y+ ++   C+EG
Sbjct  297  MVL-SGCEPNVVTHSILISSFCREGRVREAVNVLEVMKEKGLTPDAYSYDPLISAFCKEG  355

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A E++  + + GC PD+ +YN +L  L      D    + +++  +GC P+  +YN
Sbjct  356  RLDLAIEYLDKMVSDGCLPDIVNYNTILATLCKFGCADLALDIFEKLDEVGCPPNVSSYN  415

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               S+L   G   KA+ M+  M  KG+ P++ TY+ LIS  C++G +D AI LL
Sbjct  416  TMFSALWSCGNKIKALEMISEMIRKGIDPDEITYNSLISCLCRDGLVDEAIGLL  469


 Score =   155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 151/291 (52%), Gaps = 2/291 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G+  E L L   ++  G +PD+     +I+G+      ++AV  ++ L   G  P+V++Y
Sbjct  215  GRINEALELFDELLSRGLRPDLYTYNAIIRGICKEGMEDRAVDFVRDLSARGCNPDVVSY  274

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+  F   +R E    ++  M   G  P+VVT++I+I S C  G++  A+ VL+ MKE
Sbjct  275  NILLRSFLNKSRWEDGEKLMKDMVLSGCEPNVVTHSILISSFCREGRVREAVNVLEVMKE  334

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ +D+M+S G  P+I  YN IL  LC+ G  D
Sbjct  335  -KGLTPDAYSYDPLISAFCKEGRLDLAIEYLDKMVSDGCLPDIVNYNTILATLCKFGCAD  393

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A +    L  +GC P+V SYN +  AL    N     +++ EM   G +P   TYN  +
Sbjct  394  LALDIFEKLDEVGCPPNVSSYNTMFSALWSCGNKIKALEMISEMIRKGIDPDEITYNSLI  453

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            S LCRDG +++AI +L  M      P   +++ ++   CK  R+   I+LL
Sbjct  454  SCLCRDGLVDEAIGLLVDMEATSFQPTVISFNIVLLGMCKAHRVFEGIELL  504


 Score =   143 bits (361),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 88/294 (30%), Positives = 150/294 (51%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  +  +  ++ +   G  PDVV    L++   +  + E   K+M+ +   G EPNV
Sbjct  247  CKEGMEDRAVDFVRDLSARGCNPDVVSYNILLRSFLNKSRWEDGEKLMKDMVLSGCEPNV  306

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + ++ LI  FC+  RV  A  VL  M+ +G  PD  +Y+ +I + C  G+L LA++ LD+
Sbjct  307  VTHSILISSFCREGRVREAVNVLEVMKEKGLTPDAYSYDPLISAFCKEGRLDLAIEYLDK  366

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K G ++ A+ + +++   G  PN+ +YN +   L   
Sbjct  367  MVSDG-CLPDIVNYNTIL-ATLCKFGCADLALDIFEKLDEVGCPPNVSSYNTMFSALWSC  424

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   +A E +  +   G  PD  +YN L+  L      D+   LL +M +   +P   ++
Sbjct  425  GNKIKALEMISEMIRKGIDPDEITYNSLISCLCRDGLVDEAIGLLVDMEATSFQPTVISF  484

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            NI +  +C+  ++ + I +L  M EKG  PN+ +Y  LI      G    A++L
Sbjct  485  NIVLLGMCKAHRVFEGIELLITMVEKGCPPNETSYVLLIEGIAYAGWRAEAMEL  538


 Score =   140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 151/280 (54%), Gaps = 6/280 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LN+S    ++E+   L++ MV  G +P+VV  + LI       +  +AV V
Sbjct  273  SYNILLRSFLNKS----RWEDGEKLMKDMVLSGCEPNVVTHSILISSFCREGRVREAVNV  328

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++++++ G  P+  +Y  LI  FCK  R++ A   L++M S G  PD+V YN ++ ++C 
Sbjct  329  LEVMKEKGLTPDAYSYDPLISAFCKEGRLDLAIEYLDKMVSDGCLPDIVNYNTILATLCK  388

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             G   LAL + +++ E   C P+V +Y  +  A        +A++++ EM+ +G++P+  
Sbjct  389  FGCADLALDIFEKLDE-VGCPPNVSSYNTMFSALWSCGNKIKALEMISEMIRKGIDPDEI  447

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCR+G+VD A   +  + A   +P V S+NI+L  +       +G +LL  M
Sbjct  448  TYNSLISCLCRDGLVDEAIGLLVDMEATSFQPTVISFNIVLLGMCKAHRVFEGIELLITM  507

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
               GC P+  +Y + +  +   G   +A+ +   +   G+
Sbjct  508  VEKGCPPNETSYVLLIEGIAYAGWRAEAMELANSLYRLGV  547



>ref|XP_002521980.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40384.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=584

 Score =   414 bits (1065),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 193/342 (56%), Positives = 262/342 (77%), Gaps = 2/342 (1%)
 Frame = -1

Query  1023  VKCKKHEFRERN-LKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYL  847
             V C + E  + N ++N Q V+VS E R   +   D KE+ + + LNRSC AGKY E+LY 
Sbjct  32    VSCIRPELNDANKVRNPQKVRVSAETRQTHVLSFDFKEVHLMKLLNRSCRAGKYNESLYF  91

Query  846   LQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKT  667
             L+ MV  GY PDV+LCTKLIKG F+ +   KA +VM++LE++G+P+V AY ALI GF K 
Sbjct  92    LECMVDKGYTPDVILCTKLIKGFFNSRNIGKATRVMEILERYGKPDVFAYNALISGFIKA  151

Query  666   NRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVT  487
             N++E AN VL+RM+SRGF PDVVTYNIMIGS C RGKL LAL++ +++ +DN C+P V+T
Sbjct  152   NQLENANRVLDRMKSRGFLPDVVTYNIMIGSFCSRGKLDLALEIFEELLKDN-CEPTVIT  210

Query  486   YTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLP  307
             YT+LIEATI+  GI  AMKL+DEMLS+GLEP+  TYNAI++G+C+E MVD+A+E +RSL 
Sbjct  211   YTILIEATILDGGIDVAMKLLDEMLSKGLEPDTLTYNAIIRGMCKEMMVDKAFELLRSLS  270

Query  306   AMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLN  127
             + GCKPD+ +YNILLR LL R  W +GEKL+ EM S+GC+P+  T++I + +LCRDGK+ 
Sbjct  271   SRGCKPDIITYNILLRTLLSRGKWSEGEKLISEMISIGCKPNVVTHSILIGTLCRDGKVE  330

Query  126   KAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +A+++L+ M EKGL P+ + YDPLI+ FC+EGRLDLA + L+
Sbjct  331   EAVNLLRSMKEKGLKPDAYCYDPLIAGFCREGRLDLATEFLE  372


 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/295 (34%), Positives = 174/295 (59%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L + + ++K   +P V+  T LI+        + A+K++ ++L +  EP+ 
Sbjct  184  CSRGKLDLALEIFEELLKDNCEPTVITYTILIEATILDGGIDVAMKLLDEMLSKGLEPDT  243

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L Y A+I G CK   V+ A  +L  + SRG  PD++TYNI++ ++  RGK     K++ +
Sbjct  244  LTYNAIIRGMCKEMMVDKAFELLRSLSSRGCKPDIITYNILLRTLLSRGKWSEGEKLISE  303

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     CKP+VVT+++LI  T+ +DG + EA+ L+  M  +GL+P+ Y Y+ ++ G CRE
Sbjct  304  MISIG-CKPNVVTHSILI-GTLCRDGKVEEAVNLLRSMKEKGLKPDAYCYDPLIAGFCRE  361

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+  + + GC PD+ +YN ++  L      D   ++ +++  +GC P+  +Y
Sbjct  362  GRLDLATEFLEYMISDGCLPDIVNYNTIMAGLCRTGKADQALEVFEKLDEVGCPPNVSSY  421

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  +  +G+ P++ TY+ LIS  C++G +D AI+LL
Sbjct  422  NTLFSALWSSGDRYRALEMILKLLNQGIDPDEITYNSLISCLCRDGMVDEAIELL  476


 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 103/195 (53%), Gaps = 2/195 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+ +     L+YM+  G  PD+V    ++ GL    KA++A++V + L++ G  PNV
Sbjct  359  CREGRLDLATEFLEYMISDGCLPDIVNYNTIMAGLCRTGKADQALEVFEKLDEVGCPPNV  418

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  L      +     A  ++ ++ ++G  PD +TYN +I  +C  G +  A+++L  
Sbjct  419  SSYNTLFSALWSSGDRYRALEMILKLLNQGIDPDEITYNSLISCLCRDGMVDEAIELLVD  478

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +    +P+VV+Y +++      +  ++A++++  M  +G +PN  TY  +++G+   G
Sbjct  479  M-QSGRYRPNVVSYNIILLGLCKVNRANDAIEVLAAMTEKGCQPNETTYILLIEGIGFSG  537

Query  345  MVDRAYEFVRSLPAM  301
            +   A E   SL  M
Sbjct  538  LRAEAMELANSLHGM  552



>ref|XP_009124196.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Brassica rapa]
Length=572

 Score =   414 bits (1064),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 264/327 (81%), Gaps = 5/327 (2%)
 Frame = -1

Query  981  NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVL  802
            NLQ V+ ST N +  +   D++ + I    +R+C AG Y E L+LL+ MV  GY PDV+L
Sbjct  41   NLQ-VQASTTNHSHSLGFRDTQMLKI---FHRACRAGNYIEALHLLESMVPKGYSPDVIL  96

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            CTKLIKGLF+++   KAV+VM++LE+FG+P+V AY ALI GFCK NR++ +  VL+RMRS
Sbjct  97   CTKLIKGLFNLRNVPKAVRVMEILEKFGQPDVFAYNALINGFCKMNRIDDSTKVLDRMRS  156

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
            +GF PD VTYNIMIGS+C RGKL LALKV DQ+  DN C+P V+TYT+LIEAT+++ G+ 
Sbjct  157  KGFSPDTVTYNIMIGSLCSRGKLDLALKVFDQLVNDN-CQPTVITYTILIEATMLEGGVD  215

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMV+RA+E +RSL   GC+PDV SYNILL
Sbjct  216  EALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVERAFEMIRSLEVKGCEPDVISYNILL  275

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            RALL++  W++GEKL+ +M S  CEP+  TY+I +++LCRDGK+++A+++L++M EKGLT
Sbjct  276  RALLNQGKWEEGEKLMSKMFSEECEPNVVTYSILITTLCRDGKIDEALNLLRLMKEKGLT  335

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            P+ ++YDPLI+AFC+EGRLDLAI  L+
Sbjct  336  PDAYSYDPLIAAFCREGRLDLAIKFLE  362


 Score =   177 bits (449),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +   +V    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  174  CSRGKLDLALKVFDQLVNDNCQPTVITYTILIEATMLEGGVDEALKLLDEMLSRGLKPDM  233

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   VE A  ++  +  +G  PDV++YNI++ ++ ++GK     K++ +
Sbjct  234  FTYNTIIRGMCKEGMVERAFEMIRSLEVKGCEPDVISYNILLRALLNQGKWEEGEKLMSK  293

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C+P+VVTY++LI  T+ +DG I EA+ L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  294  MFSEE-CEPNVVTYSILI-TTLCRDGKIDEALNLLRLMKEKGLTPDAYSYDPLIAAFCRE  351

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A +F+ ++ + GC PDV +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  352  GRLDLAIKFLETMISDGCLPDVVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  411

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M   G+ P++ TY+ +IS  C+EG +D A +LL
Sbjct  412  NTMFSALWSSGDKIRALQMISEMLNHGVDPDEITYNSMISCLCREGMVDEAFELL  466


 Score =   166 bits (420),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 160/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+      E+A ++++ LE  G EP+V++Y
Sbjct  212  GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVERAFEMIRSLEVKGCEPDVISY  271

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++++M S    P+VVTY+I+I ++C  GK+  AL +L  MKE
Sbjct  272  NILLRALLNQGKWEEGEKLMSKMFSEECEPNVVTYSILITTLCRDGKIDEALNLLRLMKE  331

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A+K ++ M+S G  P++  YN +L  LC+ G  D
Sbjct  332  -KGLTPDAYSYDPLIAAFCREGRLDLAIKFLETMISDGCLPDVVNYNTVLATLCKNGKAD  390

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM + G +P   T
Sbjct  391  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALQMISEMLNHGVDPDEIT  445

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G +++A  +L  M      P+  TY+ ++  +CK  R++ AI +LD
Sbjct  446  YNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTYNIVLLGYCKAHRIEDAIGVLD  502


 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/299 (31%), Positives = 152/299 (51%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  E    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  EPNV
Sbjct  244  CKEGMVERAFEMIRSLEVKGCEPDVISYNILLRALLNQGKWEEGEKLMSKMFSEECEPNV  303

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +++ A  +L  M+ +G  PD  +Y+ +I + C  G+L LA+K L+ 
Sbjct  304  VTYSILITTLCRDGKIDEALNLLRLMKEKGLTPDAYSYDPLIAAFCREGRLDLAIKFLET  363

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PDVV Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  364  MISDG-CLPDVVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  421

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA + +  +   G  PD  +YN ++  L      D+  +LL +M S    P   TY
Sbjct  422  GDKIRALQMISEMLNHGVDPDEITYNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTY  481

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI +L  M E G  PN+ TY  LI      G     ++LA DL+
Sbjct  482  NIVLLGYCKAHRIEDAIGVLDTMVENGCKPNETTYTMLIEGIGFAGYRAEAMELANDLV  540



>ref|XP_010485860.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Camelina sativa]
Length=610

 Score =   414 bits (1064),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 265/338 (78%), Gaps = 8/338 (2%)
 Frame = -1

Query  993  RNLK--NLQSVKVSTENRNALIQLLDSKEIDIR-----RRLNRSCGAGKYEETLYLLQYM  835
            RNL+    Q   V T+ R    Q   S  +  R     +  +RSC +G Y E+L+LL+ M
Sbjct  63   RNLQAATTQDATVPTDRRQQQQQQTHSHSLGFRDTQMLKIFHRSCRSGNYIESLHLLESM  122

Query  834  VKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVE  655
            V+ GY PDV+LCTKLIKG F+++   KAV+VM++LE+FG+P+V AY ALI GFCK NR++
Sbjct  123  VRKGYNPDVILCTKLIKGFFTLRNIPKAVRVMEILEKFGQPDVFAYNALINGFCKMNRID  182

Query  654  AANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVL  475
             A  VLNRMRS+GF PD VTYNIMIGS+C RGKL LALKVLDQ+  DN C+P V+TYT+L
Sbjct  183  DATRVLNRMRSKGFSPDTVTYNIMIGSLCSRGKLVLALKVLDQLLSDN-CQPTVITYTIL  241

Query  474  IEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGC  295
            IEAT+++ G+ EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMVDRA+E VR+L   GC
Sbjct  242  IEATMLEGGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELRGC  301

Query  294  KPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAIS  115
            +PDV SYNILLRALL++  W++GEKL+ +M S  C+P+  TY+I +++LCRDGK+ +A++
Sbjct  302  EPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEALN  361

Query  114  MLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +LK+M EKGL+P+ ++YDPLI+AFC+EGRLDLAI+ L+
Sbjct  362  LLKLMKEKGLSPDAYSYDPLIAAFCREGRLDLAIEFLE  399


 Score =   178 bits (452),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 170/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK    L +L  ++    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  211  CSRGKLVLALKVLDQLLSDNCQPTVITYTILIEATMLEGGVDEALKLLDEMLSRGLKPDM  270

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   V+ A  ++  +  RG  PDV++YNI++ ++ ++GK     K++ +
Sbjct  271  FTYNTIIRGMCKEGMVDRAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTK  330

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C P+VVTY++LI  T+ +DG I EA+ L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  331  MFSEK-CDPNVVTYSILI-TTLCRDGKIEEALNLLKLMKEKGLSPDAYSYDPLIAAFCRE  388

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+ ++ + GC PD+ +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  389  GRLDLAIEFLETMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  448

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M   G+ P++ TY+ +IS  C+EG +D A DLL
Sbjct  449  NTMFSALWSSGDKIRALHMISEMVTHGIDPDEITYNSMISCLCREGMVDEAYDLL  503


 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 159/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+      ++A ++++ LE  G EP+V++Y
Sbjct  249  GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELRGCEPDVISY  308

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++ +M S    P+VVTY+I+I ++C  GK+  AL +L  MKE
Sbjct  309  NILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEALNLLKLMKE  368

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  369  -KGLSPDAYSYDPLIAAFCREGRLDLAIEFLETMISDGCLPDIVNYNTVLATLCKNGKAD  427

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM + G +P   T
Sbjct  428  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALHMISEMVTHGIDPDEIT  482

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G +++A  +L  M      P+  TY+ ++  FCK  R+  AID+L+
Sbjct  483  YNSMISCLCREGMVDEAYDLLVDMRSCEFHPSVVTYNIVLLGFCKTHRIVDAIDVLE  539


 Score =   138 bits (347),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 149/299 (50%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  +PNV
Sbjct  281  CKEGMVDRAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNV  340

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E A  +L  M+ +G  PD  +Y+ +I + C  G+L LA++ L+ 
Sbjct  341  VTYSILITTLCRDGKIEEALNLLKLMKEKGLSPDAYSYDPLIAAFCREGRLDLAIEFLET  400

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  401  MISDG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  458

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA   +  +   G  PD  +YN ++  L      D+   LL +M S    P   TY
Sbjct  459  GDKIRALHMISEMVTHGIDPDEITYNSMISCLCREGMVDEAYDLLVDMRSCEFHPSVVTY  518

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI +L+ M   G  PN+ T   LI      G     ++LA DL+
Sbjct  519  NIVLLGFCKTHRIVDAIDVLESMVGNGCRPNESTSAVLIEGIGFAGYRAEAMELANDLV  577



>ref|XP_010463963.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Camelina sativa]
Length=603

 Score =   414 bits (1063),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 265/333 (80%), Gaps = 5/333 (2%)
 Frame = -1

Query  993  RNLK--NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGY  820
            RNL+    Q   V TE R      L  ++  + +  +RSC +G Y E+L+LL+ MV+ GY
Sbjct  63   RNLQAATTQDATVPTERRQQ--HSLGFRDTQMLKIFHRSCRSGNYIESLHLLESMVRKGY  120

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGV  640
             PDV+LCTKLIKG F+++   KAV+VM++LE+FG+P+V AY ALI GFCK NR++ A  V
Sbjct  121  NPDVILCTKLIKGFFTLRNIPKAVRVMEILEKFGQPDVFAYNALINGFCKMNRIDDATRV  180

Query  639  LNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATI  460
            L+RMRS+GF PD VTYNIMIGS+C RGKL LALKVLDQ+  DN C+P V+TYT+LIEAT+
Sbjct  181  LDRMRSKGFSPDTVTYNIMIGSLCSRGKLVLALKVLDQLLSDN-CQPTVITYTILIEATM  239

Query  459  VKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
            ++ G+ EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMVDRA+E VR+L   GC+PDV 
Sbjct  240  LEGGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELRGCEPDVI  299

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
            SYNILLRALL++  W++GEKL+ +M S  C+P+  TY+I +++LCRDGK+ +A+++LK+M
Sbjct  300  SYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEALNLLKLM  359

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             EKGL+P+ ++YDPLI+AFC+EGRLDLAI+ L+
Sbjct  360  KEKGLSPDAYSYDPLIAAFCREGRLDLAIEFLE  392


 Score =   179 bits (453),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 170/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK    L +L  ++    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  204  CSRGKLVLALKVLDQLLSDNCQPTVITYTILIEATMLEGGVDEALKLLDEMLSRGLKPDM  263

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   V+ A  ++  +  RG  PDV++YNI++ ++ ++GK     K++ +
Sbjct  264  FTYNTIIRGMCKEGMVDRAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTK  323

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C P+VVTY++LI  T+ +DG I EA+ L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  324  MFSEK-CDPNVVTYSILI-TTLCRDGKIEEALNLLKLMKEKGLSPDAYSYDPLIAAFCRE  381

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+ ++ + GC PD+ +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  382  GRLDLAIEFLETMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  441

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M   G+ P++ TY+ +IS  C+EG +D A DLL
Sbjct  442  NTMFSALWSSGDKIRALHMISEMVTHGIDPDEITYNSMISCLCREGMVDEAYDLL  496


 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 159/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+      ++A ++++ LE  G EP+V++Y
Sbjct  242  GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELRGCEPDVISY  301

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++ +M S    P+VVTY+I+I ++C  GK+  AL +L  MKE
Sbjct  302  NILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEALNLLKLMKE  361

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  362  -KGLSPDAYSYDPLIAAFCREGRLDLAIEFLETMISDGCLPDIVNYNTVLATLCKNGKAD  420

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM + G +P   T
Sbjct  421  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALHMISEMVTHGIDPDEIT  475

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G +++A  +L  M      P+  TY+ ++  FCK  R+  AID+L+
Sbjct  476  YNSMISCLCREGMVDEAYDLLVDMRSCEFQPSVVTYNIVLLGFCKTHRIVDAIDVLE  532


 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/299 (29%), Positives = 151/299 (51%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  +PNV
Sbjct  274  CKEGMVDRAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNV  333

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E A  +L  M+ +G  PD  +Y+ +I + C  G+L LA++ L+ 
Sbjct  334  VTYSILITTLCRDGKIEEALNLLKLMKEKGLSPDAYSYDPLIAAFCREGRLDLAIEFLET  393

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  394  MISDG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  451

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA   +  +   G  PD  +YN ++  L      D+   LL +M S   +P   TY
Sbjct  452  GDKIRALHMISEMVTHGIDPDEITYNSMISCLCREGMVDEAYDLLVDMRSCEFQPSVVTY  511

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI +L+ M   G  PN+ TY  LI      G     ++LA DL+
Sbjct  512  NIVLLGFCKTHRIVDAIDVLESMVRNGCKPNESTYTVLIEGIGFAGYRAEAMELANDLV  570



>emb|CDY50755.1| BnaAnng10620D [Brassica napus]
Length=572

 Score =   412 bits (1060),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/327 (58%), Positives = 264/327 (81%), Gaps = 5/327 (2%)
 Frame = -1

Query  981  NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVL  802
            NLQ V+ ST N +  +   D++ + I    +R+C AG Y E L+LL+ MV  GY PDV+L
Sbjct  41   NLQ-VQASTTNHSQSLGFRDTQMLKI---FHRACRAGNYIEALHLLESMVPKGYSPDVIL  96

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            CTKLIKGLF+++   KAV+VM++LE+FG+P+V AY ALI GFCK NR++ +  VL+RMRS
Sbjct  97   CTKLIKGLFNLRNVPKAVRVMEILEKFGQPDVFAYNALINGFCKMNRIDDSTKVLDRMRS  156

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
            +GF PD VTYNIMIGS+C RGKL LALKV DQ+  DN C+P V+TYT+LIEAT+++ G+ 
Sbjct  157  KGFSPDTVTYNIMIGSLCSRGKLDLALKVFDQLVNDN-CQPTVITYTILIEATMLEGGVD  215

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMV+RA+E +RSL   GC+PDV SYNILL
Sbjct  216  EALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVERAFEMIRSLEVKGCEPDVISYNILL  275

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            RALL++  W++GE+L+ +M S  CEP+  TY+I +++LCRDGK+++A+++L++M EKGLT
Sbjct  276  RALLNQGKWEEGERLMSKMFSEECEPNVVTYSILITTLCRDGKIDEALNLLRLMKEKGLT  335

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            P+ ++YDPLI+AFC+EGRLDLAI  L+
Sbjct  336  PDAYSYDPLIAAFCREGRLDLAIKFLE  362


 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +   +V    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  174  CSRGKLDLALKVFDQLVNDNCQPTVITYTILIEATMLEGGVDEALKLLDEMLSRGLKPDM  233

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   VE A  ++  +  +G  PDV++YNI++ ++ ++GK     +++ +
Sbjct  234  FTYNTIIRGMCKEGMVERAFEMIRSLEVKGCEPDVISYNILLRALLNQGKWEEGERLMSK  293

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C+P+VVTY++LI  T+ +DG I EA+ L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  294  MFSEE-CEPNVVTYSILI-TTLCRDGKIDEALNLLRLMKEKGLTPDAYSYDPLIAAFCRE  351

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A +F+ ++ + GC PDV +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  352  GRLDLAIKFLETMISDGCLPDVVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  411

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M   G+ P++ TY+ +IS  C+EG +D A +LL
Sbjct  412  NTMFSALWSSGDKIRALQMISEMLNHGVDPDEITYNSMISCLCREGMVDEAFELL  466


 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 160/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+      E+A ++++ LE  G EP+V++Y
Sbjct  212  GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVERAFEMIRSLEVKGCEPDVISY  271

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++++M S    P+VVTY+I+I ++C  GK+  AL +L  MKE
Sbjct  272  NILLRALLNQGKWEEGERLMSKMFSEECEPNVVTYSILITTLCRDGKIDEALNLLRLMKE  331

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A+K ++ M+S G  P++  YN +L  LC+ G  D
Sbjct  332  -KGLTPDAYSYDPLIAAFCREGRLDLAIKFLETMISDGCLPDVVNYNTVLATLCKNGKAD  390

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM + G +P   T
Sbjct  391  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALQMISEMLNHGVDPDEIT  445

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G +++A  +L  M      P+  TY+ ++  +CK  R++ AI +LD
Sbjct  446  YNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTYNIVLLGYCKAHRIEDAIGVLD  502


 Score =   147 bits (371),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/299 (30%), Positives = 152/299 (51%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  E    +++ +   G +PDV+    L++ L +  K E+  ++M ++  +  EPNV
Sbjct  244  CKEGMVERAFEMIRSLEVKGCEPDVISYNILLRALLNQGKWEEGERLMSKMFSEECEPNV  303

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +++ A  +L  M+ +G  PD  +Y+ +I + C  G+L LA+K L+ 
Sbjct  304  VTYSILITTLCRDGKIDEALNLLRLMKEKGLTPDAYSYDPLIAAFCREGRLDLAIKFLET  363

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PDVV Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  364  MISDG-CLPDVVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  421

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA + +  +   G  PD  +YN ++  L      D+  +LL +M S    P   TY
Sbjct  422  GDKIRALQMISEMLNHGVDPDEITYNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTY  481

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI +L  M E G  PN+ TY  LI      G     ++LA DL+
Sbjct  482  NIVLLGYCKAHRIEDAIGVLDTMVENGCKPNETTYTMLIEGIGFAGYRAEAMELANDLV  540



>emb|CDY41899.1| BnaC05g47050D [Brassica napus]
Length=574

 Score =   412 bits (1058),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/327 (57%), Positives = 261/327 (80%), Gaps = 3/327 (1%)
 Frame = -1

Query  981  NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVL  802
            NLQ+   +T+ R      L  ++    +  +RSC +G Y E L+LL+ MV  GY PDV+L
Sbjct  41   NLQAS--TTDARQTHSHSLGFRDTQTLKIFHRSCRSGNYTEALHLLESMVPKGYSPDVIL  98

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            CTKLIKGLF+++   KAV+VM++LE+FG+P+V AY ALI GFCK NR++ +  VL+RMRS
Sbjct  99   CTKLIKGLFNLRNVPKAVRVMEILEKFGQPDVFAYNALINGFCKVNRIDDSTKVLDRMRS  158

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
            +GF PD VTYNIMIGS+C RGKL LALKV DQ+  DN C+P V+TYT+LIEAT+++ G+ 
Sbjct  159  KGFSPDTVTYNIMIGSLCSRGKLDLALKVFDQLVNDN-CQPTVITYTILIEATMLEGGVD  217

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMV+RA+E +RSL   GC+PDV SYNILL
Sbjct  218  EALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVERAFEMIRSLEVKGCEPDVISYNILL  277

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            RALL++  W++GEKL+ +M S  CEP+  TY+I +++LCRDGK+++A+++L++M EKGLT
Sbjct  278  RALLNQGKWEEGEKLMSKMFSEKCEPNVVTYSILITTLCRDGKIDEALNLLRLMKEKGLT  337

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            P+ ++YDPLI+AFC+EGRLDLAI  L+
Sbjct  338  PDAYSYDPLIAAFCREGRLDLAIKFLE  364


 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +   +V    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  176  CSRGKLDLALKVFDQLVNDNCQPTVITYTILIEATMLEGGVDEALKLLDEMLSRGLKPDM  235

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   VE A  ++  +  +G  PDV++YNI++ ++ ++GK     K++ +
Sbjct  236  FTYNTIIRGMCKEGMVERAFEMIRSLEVKGCEPDVISYNILLRALLNQGKWEEGEKLMSK  295

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C+P+VVTY++LI  T+ +DG I EA+ L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  296  MFSEK-CEPNVVTYSILI-TTLCRDGKIDEALNLLRLMKEKGLTPDAYSYDPLIAAFCRE  353

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A +F+ ++ + GC PDV +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  354  GRLDLAIKFLETMISDGCLPDVVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  413

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M   G+ P++ TY+ +IS  C+EG +D A +LL
Sbjct  414  NTMFSALWSSGDKIRALQMISEMLSDGVDPDEITYNSMISCLCREGMVDEAFELL  468


 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 160/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+      E+A ++++ LE  G EP+V++Y
Sbjct  214  GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVERAFEMIRSLEVKGCEPDVISY  273

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++++M S    P+VVTY+I+I ++C  GK+  AL +L  MKE
Sbjct  274  NILLRALLNQGKWEEGEKLMSKMFSEKCEPNVVTYSILITTLCRDGKIDEALNLLRLMKE  333

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A+K ++ M+S G  P++  YN +L  LC+ G  D
Sbjct  334  -KGLTPDAYSYDPLIAAFCREGRLDLAIKFLETMISDGCLPDVVNYNTVLATLCKNGKAD  392

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM S G +P   T
Sbjct  393  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALQMISEMLSDGVDPDEIT  447

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G +++A  +L  M      P+  TY+ ++  +CK  R+D AI +LD
Sbjct  448  YNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTYNIVLLGYCKAHRIDDAIGVLD  504


 Score =   149 bits (376),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 92/299 (31%), Positives = 154/299 (52%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  E    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  EPNV
Sbjct  246  CKEGMVERAFEMIRSLEVKGCEPDVISYNILLRALLNQGKWEEGEKLMSKMFSEKCEPNV  305

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +++ A  +L  M+ +G  PD  +Y+ +I + C  G+L LA+K L+ 
Sbjct  306  VTYSILITTLCRDGKIDEALNLLRLMKEKGLTPDAYSYDPLIAAFCREGRLDLAIKFLET  365

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PDVV Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  366  MISDG-CLPDVVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  423

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA + +  + + G  PD  +YN ++  L      D+  +LL +M S    P   TY
Sbjct  424  GDKIRALQMISEMLSDGVDPDEITYNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTY  483

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  +++ AI +L  M E G  PN+ TY  LI      G     ++LA DL+
Sbjct  484  NIVLLGYCKAHRIDDAIGVLDTMVEDGCKPNETTYTMLIEGIGFAGYRAEAMELANDLV  542



>ref|XP_009379757.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Pyrus x bretschneideri]
Length=705

 Score =   416 bits (1068),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 249/298 (84%), Gaps = 1/298 (0%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE  715
            LNRSC AG+Y E LY L+ MV  GY+PDV+LCTKLIKG F+ +  EKAV+VMQ+LE++GE
Sbjct  198  LNRSCKAGQYNEALYFLELMVNKGYRPDVLLCTKLIKGFFNSRNVEKAVRVMQILEKYGE  257

Query  714  PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKV  535
            P++  Y ALI  FCK NR+++AN +L+RMRSRGF PDVVTYNIMIGS+C RGKLGLALKV
Sbjct  258  PDLFPYNALISRFCKANRIDSANKLLDRMRSRGFSPDVVTYNIMIGSLCGRGKLGLALKV  317

Query  534  LDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLC  355
            LDQ+ +DN C+P V+TY +LIEA I++ GI EA+KL+D+MLSRGL+P++ TYNA+++G+C
Sbjct  318  LDQLVKDN-CRPTVITYMILIEAMILEGGIDEAVKLLDDMLSRGLKPDMNTYNAVVRGMC  376

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            REGM+DR ++ VRSL + GC P+V SYNILLRALL+R  W++GEKL+  M S GCE +  
Sbjct  377  REGMLDRVFDLVRSLDSKGCSPNVVSYNILLRALLNRGKWEEGEKLVSNMRSRGCELNVV  436

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TY+I +S+LCRDGK+  A+++LKIM +KGLTP+ ++YDPL+SAFCKEGRLDLAI+ LD
Sbjct  437  TYSILISTLCRDGKVEDAVNVLKIMKDKGLTPDVYSYDPLVSAFCKEGRLDLAIEFLD  494


 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/295 (31%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNV  706
            CG GK    L +L  +VK   +P V+    LI+ +      ++AVK++  +L +  +P++
Sbjct  306  CGRGKLGLALKVLDQLVKDNCRPTVITYMILIEAMILEGGIDEAVKLLDDMLSRGLKPDM  365

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A++ G C+   ++    ++  + S+G  P+VV+YNI++ ++ +RGK     K++  
Sbjct  366  NTYNAVVRGMCREGMLDRVFDLVRSLDSKGCSPNVVSYNILLRALLNRGKWEEGEKLVSN  425

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M+    C+ +VVTY++LI +T+ +DG + +A+ ++  M  +GL P++Y+Y+ ++   C+E
Sbjct  426  MRS-RGCELNVVTYSILI-STLCRDGKVEDAVNVLKIMKDKGLTPDVYSYDPLVSAFCKE  483

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+  + + GC PD+ +YN +L AL    N D   ++ + +  +GC P+  +Y
Sbjct  484  GRLDLAIEFLDDMISDGCLPDIVNYNTILAALCKSGNADQALEIFENLGEVGCPPNVSSY  543

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   + + M+  M  KG+ P++ T + LIS  C++  ++ AI LL
Sbjct  544  NKMFSALWNCGDRVRVLQMVSEMVSKGIDPDEITCNSLISCLCRDRMVNEAIGLL  598


 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 159/296 (54%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E + LL  M+  G KPD+     +++G+      ++   +++ L+  G  PNV++Y
Sbjct  344  GGIDEAVKLLDDMLSRGLKPDMNTYNAVVRGMCREGMLDRVFDLVRSLDSKGCSPNVVSY  403

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    +++ MRSRG   +VVTY+I+I ++C  GK+  A+ VL  MK 
Sbjct  404  NILLRALLNRGKWEEGEKLVSNMRSRGCELNVVTYSILISTLCRDGKVEDAVNVLKIMK-  462

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D    PDV +Y  L+ A   +  +  A++ +D+M+S G  P+I  YN IL  LC+ G  D
Sbjct  463  DKGLTPDVYSYDPLVSAFCKEGRLDLAIEFLDDMISDGCLPDIVNYNTILAALCKSGNAD  522

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E   +L  +GC P+V SYN +  AL     W+ G++     ++ EM S G +P   T
Sbjct  523  QALEIFENLGEVGCPPNVSSYNKMFSAL-----WNCGDRVRVLQMVSEMVSKGIDPDEIT  577

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             N  +S LCRD  +N+AI +L  M   G  P   +Y+ ++   CK  R+  AI +L
Sbjct  578  CNSLISCLCRDRMVNEAIGLLVDMESGGFQPTVISYNTILLGLCKTRRIVDAIGVL  633


 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/293 (30%), Positives = 144/293 (49%), Gaps = 2/293 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  +    L++ +   G  P+VV    L++ L +  K E+  K++  +   G E NV
Sbjct  376  CREGMLDRVFDLVRSLDSKGCSPNVVSYNILLRALLNRGKWEEGEKLVSNMRSRGCELNV  435

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +VE A  VL  M+ +G  PDV +Y+ ++ + C  G+L LA++ LD 
Sbjct  436  VTYSILISTLCRDGKVEDAVNVLKIMKDKGLTPDVYSYDPLVSAFCKEGRLDLAIEFLDD  495

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M  D  C PD+V Y  ++ A        +A+++ + +   G  PN+ +YN +   L   G
Sbjct  496  MISDG-CLPDIVNYNTILAALCKSGNADQALEIFENLGEVGCPPNVSSYNKMFSALWNCG  554

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               R  + V  + + G  PD  + N L+  L   R  ++   LL +M S G +P   +YN
Sbjct  555  DRVRVLQMVSEMVSKGIDPDEITCNSLISCLCRDRMVNEAIGLLVDMESGGFQPTVISYN  614

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
              +  LC+  ++  AI +L  M EKG   N+ T+  LI      G    A++L
Sbjct  615  TILLGLCKTRRIVDAIGVLAAMVEKGCRANETTHTLLIEGIGFAGWRAEAMEL  667


 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 90/301 (30%), Positives = 152/301 (50%), Gaps = 21/301 (7%)
 Frame = -1

Query  939  LIQLLDSK---------EIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLI  787
            L++ LDSK          I +R  LNR    GK+EE   L+  M   G + +VV  + LI
Sbjct  387  LVRSLDSKGCSPNVVSYNILLRALLNR----GKWEEGEKLVSNMRSRGCELNVVTYSILI  442

Query  786  KGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFF  610
              L    K E AV V+++++  G  P+V +Y  L+  FCK  R++ A   L+ M S G  
Sbjct  443  STLCRDGKVEDAVNVLKIMKDKGLTPDVYSYDPLVSAFCKEGRLDLAIEFLDDMISDGCL  502

Query  609  PDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMK  430
            PD+V YN ++ ++C  G    AL++ + + E   C P+V +Y  +  A          ++
Sbjct  503  PDIVNYNTILAALCKSGNADQALEIFENLGE-VGCPPNVSSYNKMFSALWNCGDRVRVLQ  561

Query  429  LVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALL  250
            +V EM+S+G++P+  T N+++  LCR+ MV+ A   +  + + G +P V SYN +L  L 
Sbjct  562  MVSEMVSKGIDPDEITCNSLISCLCRDRMVNEAIGLLVDMESGGFQPTVISYNTILLGLC  621

Query  249  DRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDG------KLNKAISMLKIMTEKG  88
              R   D   +L  M   GC  +  T+ + +  +   G      +L+ ++  L+ ++E  
Sbjct  622  KTRRIVDAIGVLAAMVEKGCRANETTHTLLIEGIGFAGWRAEAMELDNSVFSLRAISEDS  681

Query  87   L  85
            L
Sbjct  682  L  682



>ref|XP_006296608.1| hypothetical protein CARUB_v10013258mg [Capsella rubella]
 gb|EOA29506.1| hypothetical protein CARUB_v10013258mg [Capsella rubella]
Length=607

 Score =   412 bits (1060),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/335 (57%), Positives = 265/335 (79%), Gaps = 5/335 (1%)
 Frame = -1

Query  993  RNLK--NLQSVKVSTENRNALIQL--LDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKI  826
            RNL+    Q   V TE R        L  ++  + +  +RSC +G Y E+L+LL+ MV+ 
Sbjct  63   RNLQAATTQDATVPTERRQHQTHSHSLGFRDTQMLKIFHRSCRSGNYIESLHLLESMVRK  122

Query  825  GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAAN  646
            GY PDV+LCTKLIKG F+++   KAV+VM++LE+FG+P+V AY ALI GFCK NR++ A 
Sbjct  123  GYNPDVILCTKLIKGFFTLRNIPKAVRVMEILEKFGQPDVFAYNALINGFCKMNRIDDAT  182

Query  645  GVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEA  466
             VL+RMRS+GF PD VTYNIMIGS+C RGKL LALKVLDQ+  DN C+P V+TYT+LIEA
Sbjct  183  RVLDRMRSKGFSPDTVTYNIMIGSLCSRGKLVLALKVLDQLLSDN-CQPTVITYTILIEA  241

Query  465  TIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPD  286
            T+++ G+ EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMVDRA+E VR+L   GC+PD
Sbjct  242  TMLEGGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELRGCEPD  301

Query  285  VFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
            V SYNILLRALL++  W++GEKL+ +M S  C+P+  TY+I +++LCRDGK+ +A+++LK
Sbjct  302  VISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEALNLLK  361

Query  105  IMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +M EKGL+P+ ++YDPLI+AFC+EGRLDLAI+ L+
Sbjct  362  LMKEKGLSPDAYSYDPLIAAFCREGRLDLAIEFLE  396


 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK    L +L  ++    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  208  CSRGKLVLALKVLDQLLSDNCQPTVITYTILIEATMLEGGVDEALKLLDEMLSRGLKPDM  267

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   V+ A  ++  +  RG  PDV++YNI++ ++ ++GK     K++ +
Sbjct  268  FTYNTIIRGMCKEGMVDRAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTK  327

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C P+VVTY++LI  T+ +DG I EA+ L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  328  MFSEK-CDPNVVTYSILI-TTLCRDGKIEEALNLLKLMKEKGLSPDAYSYDPLIAAFCRE  385

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+ ++ + GC PD+ +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  386  GRLDLAIEFLETMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  445

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M  +G+ P++ TY+ +IS  C+EG +D A DLL
Sbjct  446  NTMFSALWSSGDKIRALHMISEMVSQGIDPDEITYNSMISCLCREGMVDEAFDLL  500


 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/297 (34%), Positives = 160/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+      ++A ++++ LE  G EP+V++Y
Sbjct  246  GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELRGCEPDVISY  305

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++ +M S    P+VVTY+I+I ++C  GK+  AL +L  MKE
Sbjct  306  NILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEALNLLKLMKE  365

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  366  -KGLSPDAYSYDPLIAAFCREGRLDLAIEFLETMISDGCLPDIVNYNTVLATLCKNGKAD  424

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM S G +P   T
Sbjct  425  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALHMISEMVSQGIDPDEIT  479

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G +++A  +L  M      P+  TY+ ++  FCK  R++ AID+L+
Sbjct  480  YNSMISCLCREGMVDEAFDLLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAIDVLE  536


 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/299 (29%), Positives = 151/299 (51%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  +PNV
Sbjct  278  CKEGMVDRAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNV  337

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E A  +L  M+ +G  PD  +Y+ +I + C  G+L LA++ L+ 
Sbjct  338  VTYSILITTLCRDGKIEEALNLLKLMKEKGLSPDAYSYDPLIAAFCREGRLDLAIEFLET  397

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  398  MISDG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  455

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA   +  + + G  PD  +YN ++  L      D+   LL +M S    P   TY
Sbjct  456  GDKIRALHMISEMVSQGIDPDEITYNSMISCLCREGMVDEAFDLLVDMRSCEFHPSVVTY  515

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI +L+ M   G  PN+ TY  LI      G     ++LA DL+
Sbjct  516  NIVLLGFCKAHRIEDAIDVLESMVGNGCRPNESTYTVLIEGIGFAGYRAEAMELANDLV  574



>ref|XP_004142590.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Cucumis sativus]
 gb|KGN66736.1| hypothetical protein Csa_1G666460 [Cucumis sativus]
Length=581

 Score =   409 bits (1050),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 264/333 (79%), Gaps = 1/333 (0%)
 Frame = -1

Query  999  RERNLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGY  820
            R  N  +L++V  S E R      LD+++  + + LNRSC AGK+ E+LY L+ +V  G+
Sbjct  34   RFSNKTHLRNVTSSAEFRQPHFPNLDNRDAHLMKLLNRSCRAGKHNESLYFLESVVSKGF  93

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGV  640
            KPDVVLCTKLIKG F+ +  +KA++VM++LE +G+P+V +Y A+I GF K N++++AN V
Sbjct  94   KPDVVLCTKLIKGFFNSRNLKKAMRVMEILETYGDPDVYSYNAMISGFSKANQIDSANQV  153

Query  639  LNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATI  460
             +RMRSRGF PDVVTYNIMIGS+C RGKL LA +V+D++ +D  CKP V+TYT+LIEATI
Sbjct  154  FDRMRSRGFSPDVVTYNIMIGSLCSRGKLELAFEVMDELLKDG-CKPSVITYTILIEATI  212

Query  459  VKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
            ++  I+EA++L DE++SRGL P++YTYNAI++G+C+EGM DRA +FVR L A GC PDV 
Sbjct  213  LEGRINEALELFDELVSRGLRPDLYTYNAIIRGICKEGMEDRALDFVRHLSARGCNPDVV  272

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
            SYNILLR+ L++  W+DGE+L+K+M   GCEP+  T++I +SS CR+G++ +A+++L++M
Sbjct  273  SYNILLRSFLNKSRWEDGERLMKDMVLSGCEPNVVTHSILISSFCREGRVREAVNVLEVM  332

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             EKGLTP+ ++YDPLISAFCKEGRLDLAI+ L+
Sbjct  333  KEKGLTPDSYSYDPLISAFCKEGRLDLAIEYLE  365


 Score =   163 bits (413),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 91/294 (31%), Positives = 161/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK E    ++  ++K G KP V+  T LI+      +  +A+++   L   G  P++
Sbjct  177  CSRGKLELAFEVMDELLKDGCKPSVITYTILIEATILEGRINEALELFDELVSRGLRPDL  236

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A+I G CK    + A   +  + +RG  PDVV+YNI++ S  ++ +     +++  
Sbjct  237  YTYNAIIRGICKEGMEDRALDFVRHLSARGCNPDVVSYNILLRSFLNKSRWEDGERLMKD  296

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   + C+P+VVT+++LI +   +  + EA+ +++ M  +GL P+ Y+Y+ ++   C+EG
Sbjct  297  MVL-SGCEPNVVTHSILISSFCREGRVREAVNVLEVMKEKGLTPDSYSYDPLISAFCKEG  355

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A E++  + + GC PD+ +YN +L  L      D    + +++  +GC P    YN
Sbjct  356  RLDLAIEYLEKMVSDGCLPDIVNYNTILATLCKFGCADLALDVFEKLDEVGCPPTVRAYN  415

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               S+L   G   KA+ M+  M  KG+ P++ TY+ LIS  C++G +D AI LL
Sbjct  416  TMFSALWSCGNKIKALEMISEMIRKGIDPDEITYNSLISCLCRDGLVDEAIGLL  469


 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/291 (32%), Positives = 150/291 (52%), Gaps = 2/291 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G+  E L L   +V  G +PD+     +I+G+      ++A+  ++ L   G  P+V++Y
Sbjct  215  GRINEALELFDELVSRGLRPDLYTYNAIIRGICKEGMEDRALDFVRHLSARGCNPDVVSY  274

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+  F   +R E    ++  M   G  P+VVT++I+I S C  G++  A+ VL+ MKE
Sbjct  275  NILLRSFLNKSRWEDGERLMKDMVLSGCEPNVVTHSILISSFCREGRVREAVNVLEVMKE  334

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ +++M+S G  P+I  YN IL  LC+ G  D
Sbjct  335  -KGLTPDSYSYDPLISAFCKEGRLDLAIEYLEKMVSDGCLPDIVNYNTILATLCKFGCAD  393

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A +    L  +GC P V +YN +  AL    N     +++ EM   G +P   TYN  +
Sbjct  394  LALDVFEKLDEVGCPPTVRAYNTMFSALWSCGNKIKALEMISEMIRKGIDPDEITYNSLI  453

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            S LCRDG +++AI +L  M      P   +++ ++   CK  R+   I+LL
Sbjct  454  SCLCRDGLVDEAIGLLVDMEATRFQPTVISFNIVLLGMCKAHRVFEGIELL  504


 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 149/294 (51%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  +  L  ++++   G  PDVV    L++   +  + E   ++M+ +   G EPNV
Sbjct  247  CKEGMEDRALDFVRHLSARGCNPDVVSYNILLRSFLNKSRWEDGERLMKDMVLSGCEPNV  306

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + ++ LI  FC+  RV  A  VL  M+ +G  PD  +Y+ +I + C  G+L LA++ L++
Sbjct  307  VTHSILISSFCREGRVREAVNVLEVMKEKGLTPDSYSYDPLISAFCKEGRLDLAIEYLEK  366

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K G ++ A+ + +++   G  P +  YN +   L   
Sbjct  367  MVSDG-CLPDIVNYNTIL-ATLCKFGCADLALDVFEKLDEVGCPPTVRAYNTMFSALWSC  424

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   +A E +  +   G  PD  +YN L+  L      D+   LL +M +   +P   ++
Sbjct  425  GNKIKALEMISEMIRKGIDPDEITYNSLISCLCRDGLVDEAIGLLVDMEATRFQPTVISF  484

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            NI +  +C+  ++ + I +L  M EKG  PN+ +Y  LI      G    A++L
Sbjct  485  NIVLLGMCKAHRVFEGIELLITMVEKGCLPNETSYVLLIEGIAYAGWRAEAMEL  538


 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/280 (30%), Positives = 148/280 (53%), Gaps = 6/280 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LN+S    ++E+   L++ MV  G +P+VV  + LI       +  +AV V
Sbjct  273  SYNILLRSFLNKS----RWEDGERLMKDMVLSGCEPNVVTHSILISSFCREGRVREAVNV  328

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++++++ G  P+  +Y  LI  FCK  R++ A   L +M S G  PD+V YN ++ ++C 
Sbjct  329  LEVMKEKGLTPDSYSYDPLISAFCKEGRLDLAIEYLEKMVSDGCLPDIVNYNTILATLCK  388

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             G   LAL V +++ E   C P V  Y  +  A        +A++++ EM+ +G++P+  
Sbjct  389  FGCADLALDVFEKLDE-VGCPPTVRAYNTMFSALWSCGNKIKALEMISEMIRKGIDPDEI  447

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCR+G+VD A   +  + A   +P V S+NI+L  +       +G +LL  M
Sbjct  448  TYNSLISCLCRDGLVDEAIGLLVDMEATRFQPTVISFNIVLLGMCKAHRVFEGIELLITM  507

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
               GC P+  +Y + +  +   G   +A+ +   +   G+
Sbjct  508  VEKGCLPNETSYVLLIEGIAYAGWRAEAMELANSLYRLGV  547



>ref|XP_010523366.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X1 [Tarenaya hassleriana]
Length=590

 Score =   407 bits (1047),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/321 (59%), Positives = 253/321 (79%), Gaps = 1/321 (0%)
 Frame = -1

Query  963  VSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIK  784
            V  E R   +      +  + +  +RSC +GKY E+LYLL+ MV+ GYKPD +LCTKLIK
Sbjct  63   VPAEQRQTQLPSFGFNDAQMLKLFHRSCKSGKYSESLYLLEKMVRKGYKPDAILCTKLIK  122

Query  783  GLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPD  604
            GLF+++   KAVKVM++LE  G+P+V AY ALI GFCK NR++ A  V++RMR++GF PD
Sbjct  123  GLFNLRNIPKAVKVMEILETHGQPDVFAYNALISGFCKMNRMDDATKVIDRMRNKGFSPD  182

Query  603  VVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLV  424
             VTYNIMIGS+C RGKL LALKVLDQ+  DN C+P V+TYT+LIEAT +  G+ EA+KL+
Sbjct  183  TVTYNIMIGSLCSRGKLDLALKVLDQLLMDN-CRPTVITYTILIEATTMDGGVDEALKLL  241

Query  423  DEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDR  244
            DEMLSRGL+P+++TYN I++G+C+EGMVDRA+  VR+L + GC+PDV SYNILLRALL++
Sbjct  242  DEMLSRGLKPDMFTYNTIMRGMCKEGMVDRAFGMVRNLESRGCEPDVISYNILLRALLNQ  301

Query  243  RNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTY  64
              WD+G+KL+ +M S GCEP+  TY+I +S+LCRDGK+ +A+++LK M  KGL P+ ++Y
Sbjct  302  GKWDEGDKLMTKMFSKGCEPNVVTYSILISTLCRDGKIEEALNLLKEMRGKGLNPDAYSY  361

Query  63   DPLISAFCKEGRLDLAIDLLD  1
            DPLI+AFC+EGRLDLAI  L+
Sbjct  362  DPLIAAFCREGRLDLAIKFLE  382


 Score =   180 bits (457),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 174/295 (59%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +L  ++    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  194  CSRGKLDLALKVLDQLLMDNCRPTVITYTILIEATTMDGGVDEALKLLDEMLSRGLKPDM  253

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  ++ G CK   V+ A G++  + SRG  PDV++YNI++ ++ ++GK     K++ +
Sbjct  254  FTYNTIMRGMCKEGMVDRAFGMVRNLESRGCEPDVISYNILLRALLNQGKWDEGDKLMTK  313

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     C+P+VVTY++LI +T+ +DG I EA+ L+ EM  +GL P+ Y+Y+ ++   CRE
Sbjct  314  MFS-KGCEPNVVTYSILI-STLCRDGKIEEALNLLKEMRGKGLNPDAYSYDPLIAAFCRE  371

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A +F+ S+ + GC PD+ +YN +L  L      D   ++  ++S +GC P+  +Y
Sbjct  372  GRLDLAIKFLESMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLSEVGCPPNASSY  431

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M    + P++ TY+ +IS  C++G +D A+ L+
Sbjct  432  NTMFSALWSSGNKARALQMISEMISHDIDPDEITYNSMISCMCRDGMVDDALGLV  486


 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/291 (33%), Positives = 158/291 (54%), Gaps = 2/291 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +++G+      ++A  +++ LE  G EP+V++Y
Sbjct  232  GGVDEALKLLDEMLSRGLKPDMFTYNTIMRGMCKEGMVDRAFGMVRNLESRGCEPDVISY  291

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + +  + ++ +M S+G  P+VVTY+I+I ++C  GK+  AL +L +M+ 
Sbjct  292  NILLRALLNQGKWDEGDKLMTKMFSKGCEPNVVTYSILISTLCRDGKIEEALNLLKEMR-  350

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A+K ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  351  GKGLNPDAYSYDPLIAAFCREGRLDLAIKFLESMISDGCLPDIVNYNTVLATLCKNGKAD  410

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
            +A E    L  +GC P+  SYN +  AL    N     +++ EM S   +P   TYN  +
Sbjct  411  QALEIFGKLSEVGCPPNASSYNTMFSALWSSGNKARALQMISEMISHDIDPDEITYNSMI  470

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            S +CRDG ++ A+ ++  M      P+  TY+ ++  FCK  R+D AID+L
Sbjct  471  SCMCRDGMVDDALGLVVDMRSSEFHPSVITYNIILLGFCKAHRVDEAIDIL  521


 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 150/294 (51%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +    +++ +   G +PDV+    L++ L +  K ++  K+M ++  +  EPNV
Sbjct  264  CKEGMVDRAFGMVRNLESRGCEPDVISYNILLRALLNQGKWDEGDKLMTKMFSKGCEPNV  323

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E A  +L  MR +G  PD  +Y+ +I + C  G+L LA+K L+ 
Sbjct  324  VTYSILISTLCRDGKIEEALNLLKEMRGKGLNPDAYSYDPLIAAFCREGRLDLAIKFLES  383

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  384  MISDG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLSEVGCPPNASSYNTMFSALWSS  441

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA + +  + +    PD  +YN ++  +      DD   L+ +M S    P   TY
Sbjct  442  GNKARALQMISEMISHDIDPDEITYNSMISCMCRDGMVDDALGLVVDMRSSEFHPSVITY  501

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            NI +   C+  ++++AI +L  M E G  PN+ T+  LI      G    A++L
Sbjct  502  NIILLGFCKAHRVDEAIDILASMVETGCRPNETTFTLLIEGIGFAGWRAEAMEL  555


 Score =   137 bits (346),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/284 (29%), Positives = 142/284 (50%), Gaps = 6/284 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LN+    GK++E   L+  M   G +P+VV  + LI  L    K E+A+ +
Sbjct  290  SYNILLRALLNQ----GKWDEGDKLMTKMFSKGCEPNVVTYSILISTLCRDGKIEEALNL  345

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++ +   G  P+  +Y  LI  FC+  R++ A   L  M S G  PD+V YN ++ ++C 
Sbjct  346  LKEMRGKGLNPDAYSYDPLIAAFCREGRLDLAIKFLESMISDGCLPDIVNYNTVLATLCK  405

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             GK   AL++  ++ E   C P+  +Y  +  A       + A++++ EM+S  ++P+  
Sbjct  406  NGKADQALEIFGKLSE-VGCPPNASSYNTMFSALWSSGNKARALQMISEMISHDIDPDEI  464

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  +CR+GMVD A   V  + +    P V +YNI+L         D+   +L  M
Sbjct  465  TYNSMISCMCRDGMVDDALGLVVDMRSSEFHPSVITYNIILLGFCKAHRVDEAIDILASM  524

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNK  73
               GC P+  T+ + +  +   G   +A+ +   +   G   +K
Sbjct  525  VETGCRPNETTFTLLIEGIGFAGWRAEAMELANSLVRLGAVSDK  568



>ref|NP_566237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SR00.1|PP213_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF04902.1|AC011437_17 hypothetical protein [Arabidopsis thaliana]
 gb|AAL07067.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91709.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74132.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=602

 Score =   408 bits (1048),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/339 (56%), Positives = 265/339 (78%), Gaps = 6/339 (2%)
 Frame = -1

Query  1002  FRERNLKNLQSVKVST-----ENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQY  838
             F     +NLQ+   +      E R    Q L  ++  + +  +RSC +G Y E+L+LL+ 
Sbjct  55    FSSSGARNLQTTTTTDATLPTERRQQHSQSLGFRDTQMLKIFHRSCRSGNYIESLHLLET  114

Query  837   MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRV  658
             MV+ GY PDV+LCTKLIKG F+++   KAV+VM++LE+FG+P+V AY ALI GFCK NR+
Sbjct  115   MVRKGYNPDVILCTKLIKGFFTLRNIPKAVRVMEILEKFGQPDVFAYNALINGFCKMNRI  174

Query  657   EAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTV  478
             + A  VL+RMRS+ F PD VTYNIMIGS+C RGKL LALKVL+Q+  DN C+P V+TYT+
Sbjct  175   DDATRVLDRMRSKDFSPDTVTYNIMIGSLCSRGKLDLALKVLNQLLSDN-CQPTVITYTI  233

Query  477   LIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMG  298
             LIEAT+++ G+ EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMVDRA+E VR+L   G
Sbjct  234   LIEATMLEGGVDEALKLMDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELKG  293

Query  297   CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAI  118
             C+PDV SYNILLRALL++  W++GEKL+ +M S  C+P+  TY+I +++LCRDGK+ +A+
Sbjct  294   CEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEAM  353

Query  117   SMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             ++LK+M EKGLTP+ ++YDPLI+AFC+EGRLD+AI+ L+
Sbjct  354   NLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLE  392


 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +L  ++    +P V+  T LI+        ++A+K+M ++L +  +P++
Sbjct  204  CSRGKLDLALKVLNQLLSDNCQPTVITYTILIEATMLEGGVDEALKLMDEMLSRGLKPDM  263

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   V+ A  ++  +  +G  PDV++YNI++ ++ ++GK     K++ +
Sbjct  264  FTYNTIIRGMCKEGMVDRAFEMVRNLELKGCEPDVISYNILLRALLNQGKWEEGEKLMTK  323

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C P+VVTY++LI  T+ +DG I EAM L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  324  MFSEK-CDPNVVTYSILI-TTLCRDGKIEEAMNLLKLMKEKGLTPDAYSYDPLIAAFCRE  381

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+ ++ + GC PD+ +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  382  GRLDVAIEFLETMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  441

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M   G+ P++ TY+ +IS  C+EG +D A +LL
Sbjct  442  NTMFSALWSSGDKIRALHMILEMMSNGIDPDEITYNSMISCLCREGMVDEAFELL  496


 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/297 (33%), Positives = 160/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L L+  M+  G KPD+     +I+G+      ++A ++++ LE  G EP+V++Y
Sbjct  242  GGVDEALKLMDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELKGCEPDVISY  301

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++ +M S    P+VVTY+I+I ++C  GK+  A+ +L  MKE
Sbjct  302  NILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEAMNLLKLMKE  361

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  362  -KGLTPDAYSYDPLIAAFCREGRLDVAIEFLETMISDGCLPDIVNYNTVLATLCKNGKAD  420

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM S G +P   T
Sbjct  421  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALHMILEMMSNGIDPDEIT  475

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G +++A  +L  M      P+  TY+ ++  FCK  R++ AI++L+
Sbjct  476  YNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAINVLE  532


 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 153/299 (51%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  +PNV
Sbjct  274  CKEGMVDRAFEMVRNLELKGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNV  333

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E A  +L  M+ +G  PD  +Y+ +I + C  G+L +A++ L+ 
Sbjct  334  VTYSILITTLCRDGKIEEAMNLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLET  393

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  394  MISDG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  451

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA   +  + + G  PD  +YN ++  L      D+  +LL +M S    P   TY
Sbjct  452  GDKIRALHMILEMMSNGIDPDEITYNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTY  511

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI++L+ M   G  PN+ TY  LI      G     ++LA DL+
Sbjct  512  NIVLLGFCKAHRIEDAINVLESMVGNGCRPNETTYTVLIEGIGFAGYRAEAMELANDLV  570



>ref|XP_010418757.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Camelina sativa]
Length=608

 Score =   407 bits (1047),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 256/309 (83%), Gaps = 1/309 (0%)
 Frame = -1

Query  927  LDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAV  748
            L  ++  + +  +RSC +G Y E+L+LL+ MV+ GY PDV+LCTKLIKG F+++   KAV
Sbjct  91   LGFRDTQMLKIFHRSCRSGNYIESLHLLESMVRKGYNPDVILCTKLIKGFFTLRNIPKAV  150

Query  747  KVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSIC  568
            +VM++LE+FG+P+V AY ALI GFCK NR++ A  VL+RMRS+GF PD VTYNIMIGS+C
Sbjct  151  RVMEILEKFGQPDVFAYNALINGFCKMNRIDDATRVLDRMRSKGFSPDTVTYNIMIGSLC  210

Query  567  DRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNI  388
             RGKL LALKVLDQ+  DN C+P V+TYT+LIEAT+++ G+ EA+KL+DEMLSRGL+P++
Sbjct  211  SRGKLVLALKVLDQLLSDN-CQPTVITYTILIEATMLEGGVDEALKLLDEMLSRGLKPDM  269

Query  387  YTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKE  208
            +TYN I++G+C+EGMV+RA+E VR+L   GC+PDV SYNILLRALL++  W++GEKL+ +
Sbjct  270  FTYNTIIRGMCKEGMVERAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTK  329

Query  207  MSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGR  28
            M S  C+P+  TY+I +++LCRDGK+ +A+++LK+M EKGL+P+ ++YDPLI+AFC+EGR
Sbjct  330  MFSEKCDPNVVTYSILITTLCRDGKIEEALNLLKLMKEKGLSPDAYSYDPLIAAFCREGR  389

Query  27   LDLAIDLLD  1
            LDLAI+ L+
Sbjct  390  LDLAIEFLE  398


 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/295 (33%), Positives = 170/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK    L +L  ++    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  210  CSRGKLVLALKVLDQLLSDNCQPTVITYTILIEATMLEGGVDEALKLLDEMLSRGLKPDM  269

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   VE A  ++  +  RG  PDV++YNI++ ++ ++GK     K++ +
Sbjct  270  FTYNTIIRGMCKEGMVERAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTK  329

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C P+VVTY++LI  T+ +DG I EA+ L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  330  MFSEK-CDPNVVTYSILI-TTLCRDGKIEEALNLLKLMKEKGLSPDAYSYDPLIAAFCRE  387

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+ ++ + GC PD+ +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  388  GRLDLAIEFLETMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  447

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M   G+ P++ TY+ +IS  C+EG +D A DLL
Sbjct  448  NTMFSALWSSGDKIRALHMISEMVTHGIDPDEITYNSMISCLCREGMVDEAYDLL  502


 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/297 (34%), Positives = 159/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+      E+A ++++ LE  G EP+V++Y
Sbjct  248  GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVERAFEMVRNLELRGCEPDVISY  307

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++ +M S    P+VVTY+I+I ++C  GK+  AL +L  MKE
Sbjct  308  NILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEALNLLKLMKE  367

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  368  -KGLSPDAYSYDPLIAAFCREGRLDLAIEFLETMISDGCLPDIVNYNTVLATLCKNGKAD  426

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM + G +P   T
Sbjct  427  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALHMISEMVTHGIDPDEIT  481

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G +++A  +L  M      P+  TY+ ++  FCK  R+  AID+L+
Sbjct  482  YNSMISCLCREGMVDEAYDLLVDMRSCEFHPSVVTYNIVLLGFCKAHRIVDAIDVLE  538


 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/299 (30%), Positives = 150/299 (50%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  E    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  +PNV
Sbjct  280  CKEGMVERAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNV  339

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E A  +L  M+ +G  PD  +Y+ +I + C  G+L LA++ L+ 
Sbjct  340  VTYSILITTLCRDGKIEEALNLLKLMKEKGLSPDAYSYDPLIAAFCREGRLDLAIEFLET  399

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  400  MISDG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  457

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA   +  +   G  PD  +YN ++  L      D+   LL +M S    P   TY
Sbjct  458  GDKIRALHMISEMVTHGIDPDEITYNSMISCLCREGMVDEAYDLLVDMRSCEFHPSVVTY  517

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI +L+ M   G  PN+ TY  LI      G     ++LA DL+
Sbjct  518  NIVLLGFCKAHRIVDAIDVLESMVGNGCRPNESTYTVLIEGIGFAGYRAEAMELANDLV  576



>ref|XP_006371094.1| hypothetical protein POPTR_0019s03630g [Populus trichocarpa]
 gb|ERP48891.1| hypothetical protein POPTR_0019s03630g [Populus trichocarpa]
Length=586

 Score =   405 bits (1042),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 258/337 (77%), Gaps = 1/337 (0%)
 Frame = -1

Query  1008  HEFRERNLKNLQSVK-VSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMV  832
             H     NL N   ++ V  E +   +   D KE  + + LNRSC AGK  E+LY L+ MV
Sbjct  41    HNDTNSNLGNPPKLRRVLPETKPTHVLSYDFKETHLMKLLNRSCKAGKCNESLYFLECMV  100

Query  831   KIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEA  652
               GY+PDV++CTKLIKG F+ +  EKA +VM++LE+ GEP+V AY A+I GFCK NR+E+
Sbjct  101   AKGYQPDVIMCTKLIKGFFNSRNIEKATRVMEILEKHGEPDVFAYNAVISGFCKANRIES  160

Query  651   ANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLI  472
             A  VL+RM+ +GF  DVVTYNIMIG+ C +GK+ LALKV +++ +DNNCKP ++TYT+LI
Sbjct  161   AKKVLDRMKRKGFSQDVVTYNIMIGTFCSKGKIDLALKVFEELLKDNNCKPTLITYTILI  220

Query  471   EATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCK  292
             EA I++ GI E +KL+DEMLSRGLEP+ +TYN I++GL +EG V++A+E VR+L + GCK
Sbjct  221   EAHILEGGIDEGLKLLDEMLSRGLEPDTFTYNVIVRGLGKEGKVNQAFELVRTLNSRGCK  280

Query  291   PDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISM  112
             PDV +YNILLRALLD+  W +GEKL+ EM S GCEP+  TY+I +SSLCRDGK+ +++++
Sbjct  281   PDVITYNILLRALLDQGKWYEGEKLMDEMFSRGCEPNVVTYSILISSLCRDGKIEESVNL  340

Query  111   LKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +K+M EKGLTP+ + YDPLI+AFC+EG+LD+AI  LD
Sbjct  341   VKVMKEKGLTPDAYCYDPLIAAFCREGKLDMAIKFLD  377


 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 170/296 (57%), Gaps = 5/296 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGY-KPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPN  709
            C  GK +  L + + ++K    KP ++  T LI+        ++ +K++ ++L +  EP+
Sbjct  188  CSKGKIDLALKVFEELLKDNNCKPTLITYTILIEAHILEGGIDEGLKLLDEMLSRGLEPD  247

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
               Y  ++ G  K  +V  A  ++  + SRG  PDV+TYNI++ ++ D+GK     K++D
Sbjct  248  TFTYNVIVRGLGKEGKVNQAFELVRTLNSRGCKPDVITYNILLRALLDQGKWYEGEKLMD  307

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            +M     C+P+VVTY++LI +++ +DG I E++ LV  M  +GL P+ Y Y+ ++   CR
Sbjct  308  EMFS-RGCEPNVVTYSILI-SSLCRDGKIEESVNLVKVMKEKGLTPDAYCYDPLIAAFCR  365

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            EG +D A +F+  + + G  PD+ +YN ++ AL    N D   ++  ++  +GC P+  +
Sbjct  366  EGKLDMAIKFLDYMISDGFLPDIVNYNTIMAALCKNGNSDHAVEIFGKLEEVGCPPNVSS  425

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S+L   G   +A+ M+  M   G+ P+  TY+ LIS  C++G +D AI LL
Sbjct  426  YNTMLSALWGSGDRYRALGMISQMLSTGIDPDGITYNSLISCLCRDGMVDEAIGLL  481


 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/296 (34%), Positives = 157/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G +PD      +++GL    K  +A ++++ L   G +P+V+ Y
Sbjct  227  GGIDEGLKLLDEMLSRGLEPDTFTYNVIVRGLGKEGKVNQAFELVRTLNSRGCKPDVITY  286

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       +      +++ M SRG  P+VVTY+I+I S+C  GK+  ++ ++  MKE
Sbjct  287  NILLRALLDQGKWYEGEKLMDEMFSRGCEPNVVTYSILISSLCRDGKIEESVNLVKVMKE  346

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD   Y  LI A   +  +  A+K +D M+S G  P+I  YN I+  LC+ G  D
Sbjct  347  -KGLTPDAYCYDPLIAAFCREGKLDMAIKFLDYMISDGFLPDIVNYNTIMAALCKNGNSD  405

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
             A E    L  +GC P+V SYN +L AL     W  G++     ++ +M S G +P   T
Sbjct  406  HAVEIFGKLEEVGCPPNVSSYNTMLSAL-----WGSGDRYRALGMISQMLSTGIDPDGIT  460

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +++AI +L  M      PN  +Y+ ++   CK  R+D AI++L
Sbjct  461  YNSLISCLCRDGMVDEAIGLLADMLSGRFQPNIVSYNIVLLGLCKVHRIDDAIEVL  516


 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 90/291 (31%), Positives = 150/291 (52%), Gaps = 4/291 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNVLAY  697
            GK  +   L++ +   G KPDV+    L++ L    K  +  K+M ++  +  EPNV+ Y
Sbjct  262  GKVNQAFELVRTLNSRGCKPDVITYNILLRALLDQGKWYEGEKLMDEMFSRGCEPNVVTY  321

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
            + LI   C+  ++E +  ++  M+ +G  PD   Y+ +I + C  GKL +A+K LD M  
Sbjct  322  SILISSLCRDGKIEESVNLVKVMKEKGLTPDAYCYDPLIAAFCREGKLDMAIKFLDYMIS  381

Query  516  DNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCREGMV  340
            D    PD+V Y  ++ A + K+G S+ A+++  ++   G  PN+ +YN +L  L   G  
Sbjct  382  DGFL-PDIVNYNTIM-AALCKNGNSDHAVEIFGKLEEVGCPPNVSSYNTMLSALWGSGDR  439

Query  339  DRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIF  160
             RA   +  + + G  PD  +YN L+  L      D+   LL +M S   +P+  +YNI 
Sbjct  440  YRALGMISQMLSTGIDPDGITYNSLISCLCRDGMVDEAIGLLADMLSGRFQPNIVSYNIV  499

Query  159  VSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            +  LC+  +++ AI +L  M E G  PN+ TY  LI      G    A++L
Sbjct  500  LLGLCKVHRIDDAIEVLTAMIENGCQPNETTYTLLIEGIGFSGSRAQAMEL  550


 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 100/195 (51%), Gaps = 2/195 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK +  +  L YM+  G+ PD+V    ++  L     ++ AV++   LE+ G  PNV
Sbjct  364  CREGKLDMAIKFLDYMISDGFLPDIVNYNTIMAALCKNGNSDHAVEIFGKLEEVGCPPNV  423

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  ++     +     A G++++M S G  PD +TYN +I  +C  G +  A+ +L  
Sbjct  424  SSYNTMLSALWGSGDRYRALGMISQMLSTGIDPDGITYNSLISCLCRDGMVDEAIGLLAD  483

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M      +P++V+Y +++        I +A++++  M+  G +PN  TY  +++G+   G
Sbjct  484  MLS-GRFQPNIVSYNIVLLGLCKVHRIDDAIEVLTAMIENGCQPNETTYTLLIEGIGFSG  542

Query  345  MVDRAYEFVRSLPAM  301
               +A E   SL +M
Sbjct  543  SRAQAMELANSLYSM  557


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 60/124 (48%), Gaps = 1/124 (1%)
 Frame = -1

Query  879  GAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNVL  703
            G+G     L ++  M+  G  PD +    LI  L      ++A+ ++  +L    +PN++
Sbjct  435  GSGDRYRALGMISQMLSTGIDPDGITYNSLISCLCRDGMVDEAIGLLADMLSGRFQPNIV  494

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
            +Y  ++ G CK +R++ A  VL  M   G  P+  TY ++I  I   G    A+++ + +
Sbjct  495  SYNIVLLGLCKVHRIDDAIEVLTAMIENGCQPNETTYTLLIEGIGFSGSRAQAMELANSL  554

Query  522  KEDN  511
               N
Sbjct  555  YSMN  558



>dbj|BAD95034.1| hypothetical protein [Arabidopsis thaliana]
Length=602

 Score =   404 bits (1039),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 188/339 (55%), Positives = 264/339 (78%), Gaps = 6/339 (2%)
 Frame = -1

Query  1002  FRERNLKNLQSVKVST-----ENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQY  838
             F     +NLQ+   +      E R    Q L  ++  + +  +RSC +G Y E+L+LL+ 
Sbjct  55    FSSSGARNLQTTTTTDATLPTERRQQHSQSLGFRDTQMLKIFHRSCRSGNYIESLHLLET  114

Query  837   MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRV  658
             MV+ GY PDV+LCTKLIKG F+++   KAV+VM++LE+FG+P+V AY ALI GFCK NR+
Sbjct  115   MVRKGYNPDVILCTKLIKGFFTLRNIPKAVRVMEILEKFGQPDVFAYNALINGFCKMNRI  174

Query  657   EAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTV  478
             + A  VL+RMRS+ F PD VTYNIMIGS+C RGKL LALKVL+Q+  DN C+P V+TYT+
Sbjct  175   DDATRVLDRMRSKDFSPDTVTYNIMIGSLCSRGKLDLALKVLNQLLSDN-CQPTVITYTI  233

Query  477   LIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMG  298
             LIEAT+++ G+ EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMVDRA+E VR+L   G
Sbjct  234   LIEATMLEGGVDEALKLMDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELKG  293

Query  297   CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAI  118
              +PDV SYNILLRALL++  W++GEKL+ +M S  C+P+  TY+I +++LCRDGK+ +A+
Sbjct  294   SEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEAM  353

Query  117   SMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             ++LK+M EKGLTP+ ++YDPLI+AFC+EGRLD+AI+ L+
Sbjct  354   NLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLE  392


 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +L  ++    +P V+  T LI+        ++A+K+M ++L +  +P++
Sbjct  204  CSRGKLDLALKVLNQLLSDNCQPTVITYTILIEATMLEGGVDEALKLMDEMLSRGLKPDM  263

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   V+ A  ++  +  +G  PDV++YNI++ ++ ++GK     K++ +
Sbjct  264  FTYNTIIRGMCKEGMVDRAFEMVRNLELKGSEPDVISYNILLRALLNQGKWEEGEKLMTK  323

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C P+VVTY++LI  T+ +DG I EAM L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  324  MFSEK-CDPNVVTYSILI-TTLCRDGKIEEAMNLLKLMKEKGLTPDAYSYDPLIAAFCRE  381

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+ ++ + GC PD+ +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  382  GRLDVAIEFLETMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  441

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M   G+ P++ TY+ +IS  C+EG +D A +LL
Sbjct  442  NTMFSALWSSGDKIRALHMILEMMSNGIDPDEITYNSMISCLCREGMVDEAFELL  496


 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/297 (33%), Positives = 160/297 (54%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L L+  M+  G KPD+     +I+G+      ++A ++++ LE  G EP+V++Y
Sbjct  242  GGVDEALKLMDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELKGSEPDVISY  301

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++ +M S    P+VVTY+I+I ++C  GK+  A+ +L  MKE
Sbjct  302  NILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEAMNLLKLMKE  361

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  362  -KGLTPDAYSYDPLIAAFCREGRLDVAIEFLETMISDGCLPDIVNYNTVLATLCKNGKAD  420

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+  SYN +  AL     W  G+K     ++ EM S G +P   T
Sbjct  421  QALEIFGKLGEVGCSPNSSSYNTMFSAL-----WSSGDKIRALHMILEMMSNGIDPDEIT  475

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G +++A  +L  M      P+  TY+ ++  FCK  R++ AI++L+
Sbjct  476  YNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAINVLE  532


 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 153/299 (51%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  +PNV
Sbjct  274  CKEGMVDRAFEMVRNLELKGSEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNV  333

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E A  +L  M+ +G  PD  +Y+ +I + C  G+L +A++ L+ 
Sbjct  334  VTYSILITTLCRDGKIEEAMNLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLET  393

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  394  MISDG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  451

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA   +  + + G  PD  +YN ++  L      D+  +LL +M S    P   TY
Sbjct  452  GDKIRALHMILEMMSNGIDPDEITYNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTY  511

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI++L+ M   G  PN+ TY  LI      G     ++LA DL+
Sbjct  512  NIVLLGFCKAHRIEDAINVLESMVGNGCRPNETTYTVLIEGIGFAGYRAEAMELANDLV  570



>ref|XP_010024947.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Eucalyptus grandis]
 gb|KCW61500.1| hypothetical protein EUGRSUZ_H04228 [Eucalyptus grandis]
Length=584

 Score =   402 bits (1034),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/327 (59%), Positives = 251/327 (77%), Gaps = 1/327 (0%)
 Frame = -1

Query  981  NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVL  802
            N   +    + R   +Q  DSK+  + +   RSC  GK+ E LY L+ MV  GYKPDV+L
Sbjct  49   NPPKISAFADTRLTHVQSPDSKDAHLIKLFGRSCKVGKFTEALYFLERMVTRGYKPDVIL  108

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            CTKLIKGLF ++  EKAV+VM++LE++G+P+V +Y A+I GFCK NRVE+AN VL RM S
Sbjct  109  CTKLIKGLFKLRNFEKAVRVMEILEKYGKPDVFSYNAVISGFCKANRVESANRVLQRMSS  168

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
            +GF PDVVTYNIMIGS+C RGKL      L      +NC+P V+T+T+LIEATI++ G+ 
Sbjct  169  QGFSPDVVTYNIMIGSLCSRGKL-DLALKLLDQLLKDNCQPSVITFTILIEATIMEGGLD  227

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            +++KL+DEMLSRGL P++YTYNAI++GLCREGMVDRA EFV+SL + GCKPDV SYNILL
Sbjct  228  KSLKLLDEMLSRGLRPDMYTYNAIIRGLCREGMVDRALEFVKSLNSRGCKPDVISYNILL  287

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            RALL++  WDDGEKL++EM   GCEP+  TY+IF+SSLCR+GK+  A+S+LK+M E  LT
Sbjct  288  RALLNQGKWDDGEKLVEEMMVEGCEPNVVTYSIFISSLCREGKIEDAMSVLKVMVENELT  347

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            P+ ++YDPLI+A CKE +LD+AI  LD
Sbjct  348  PDAYSYDPLIAALCKERKLDMAIKFLD  374


 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/296 (34%), Positives = 159/296 (54%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +++L LL  M+  G +PD+     +I+GL      ++A++ ++ L   G +P+V++Y
Sbjct  224  GGLDKSLKLLDEMLSRGLRPDMYTYNAIIRGLCREGMVDRALEFVKSLNSRGCKPDVISY  283

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + +    ++  M   G  P+VVTY+I I S+C  GK+  A+ VL  M E
Sbjct  284  NILLRALLNQGKWDDGEKLVEEMMVEGCEPNVVTYSIFISSLCREGKIEDAMSVLKVMVE  343

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
             N   PD  +Y  LI A   +  +  A+K +D+M+S G  P+I  YN IL  LC+ G  D
Sbjct  344  -NELTPDAYSYDPLIAALCKERKLDMAIKFLDQMISNGCLPDIVNYNTILATLCKNGNRD  402

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E    L  +GC P+V SYN +  AL     W  G++     ++ EM S G +P   T
Sbjct  403  QALEIFAKLDEVGCSPNVSSYNTMFSAL-----WSSGDRYRALEMISEMVSKGIDPDNIT  457

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +++A+S+L  M   G +    +Y+ +I    K  R+D AI++L
Sbjct  458  YNSLISCLCRDGMVDEALSLLVDMERSGFSSTVISYNIVILGLSKVSRIDDAIEVL  513


 Score =   167 bits (423),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 158/273 (58%), Gaps = 2/273 (1%)
 Frame = -1

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNVLAYTALIGGFCKTNRVEAANG  643
            +P V+  T LI+        +K++K++ ++L +   P++  Y A+I G C+   V+ A  
Sbjct  207  QPSVITFTILIEATIMEGGLDKSLKLLDEMLSRGLRPDMYTYNAIIRGLCREGMVDRALE  266

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
             +  + SRG  PDV++YNI++ ++ ++GK     K++++M  +  C+P+VVTY++ I + 
Sbjct  267  FVKSLNSRGCKPDVISYNILLRALLNQGKWDDGEKLVEEMMVEG-CEPNVVTYSIFISSL  325

Query  462  IVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
              +  I +AM ++  M+   L P+ Y+Y+ ++  LC+E  +D A +F+  + + GC PD+
Sbjct  326  CREGKIEDAMSVLKVMVENELTPDAYSYDPLIAALCKERKLDMAIKFLDQMISNGCLPDI  385

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +YN +L  L    N D   ++  ++  +GC P+  +YN   S+L   G   +A+ M+  
Sbjct  386  VNYNTILATLCKNGNRDQALEIFAKLDEVGCSPNVSSYNTMFSALWSSGDRYRALEMISE  445

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            M  KG+ P+  TY+ LIS  C++G +D A+ LL
Sbjct  446  MVSKGIDPDNITYNSLISCLCRDGMVDEALSLL  478


 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/294 (31%), Positives = 149/294 (51%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNV  706
            C  G  +  L  ++ +   G KPDV+    L++ L +  K +   K V +++ +  EPNV
Sbjct  256  CREGMVDRALEFVKSLNSRGCKPDVISYNILLRALLNQGKWDDGEKLVEEMMVEGCEPNV  315

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+  I   C+  ++E A  VL  M      PD  +Y+ +I ++C   KL +A+K LDQ
Sbjct  316  VTYSIFISSLCREGKIEDAMSVLKVMVENELTPDAYSYDPLIAALCKERKLDMAIKFLDQ  375

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M   N C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN+ +YN +   L   
Sbjct  376  MIS-NGCLPDIVNYNTIL-ATLCKNGNRDQALEIFAKLDEVGCSPNVSSYNTMFSALWSS  433

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA E +  + + G  PD  +YN L+  L      D+   LL +M   G      +Y
Sbjct  434  GDRYRALEMISEMVSKGIDPDNITYNSLISCLCRDGMVDEALSLLVDMERSGFSSTVISY  493

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            NI +  L +  +++ AI +L +M EKG+ PN+ T+  LI      G    A++L
Sbjct  494  NIVILGLSKVSRIDDAIEVLAVMVEKGIRPNETTFILLIEGISFAGWRAEAMEL  547


 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/276 (29%), Positives = 143/276 (52%), Gaps = 6/276 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LN+    GK+++   L++ M+  G +P+VV  +  I  L    K E A+ V
Sbjct  282  SYNILLRALLNQ----GKWDDGEKLVEEMMVEGCEPNVVTYSIFISSLCREGKIEDAMSV  337

Query  741  MQLL-EQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++++ E    P+  +Y  LI   CK  +++ A   L++M S G  PD+V YN ++ ++C 
Sbjct  338  LKVMVENELTPDAYSYDPLIAALCKERKLDMAIKFLDQMISNGCLPDIVNYNTILATLCK  397

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             G    AL++  ++ E   C P+V +Y  +  A         A++++ EM+S+G++P+  
Sbjct  398  NGNRDQALEIFAKLDE-VGCSPNVSSYNTMFSALWSSGDRYRALEMISEMVSKGIDPDNI  456

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCR+GMVD A   +  +   G    V SYNI++  L      DD  ++L  M
Sbjct  457  TYNSLISCLCRDGMVDEALSLLVDMERSGFSSTVISYNIVILGLSKVSRIDDAIEVLAVM  516

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMT  97
               G  P+  T+ + +  +   G   +A+ +   +T
Sbjct  517  VEKGIRPNETTFILLIEGISFAGWRAEAMELANSLT  552



>ref|XP_010694937.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=584

 Score =   402 bits (1032),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 257/344 (75%), Gaps = 6/344 (2%)
 Frame = -1

Query  1023  VKCKK---HEFRERNLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETL  853
             + CKK   +E   RNL  LQ+  V  E R      LD KE  + + + +S  AGK+ E  
Sbjct  32    ITCKKTISNEIYYRNLPKLQAYSV--ETRPGFFNPLDFKEPQLLKLIKKSHKAGKFNEAF  89

Query  852   YLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFC  673
             Y LQ MV  GYKPD+VLCTKLIKG F+ K+  KAV+VM++LE  GEP++ AY A+I GFC
Sbjct  90    YFLQCMVSKGYKPDLVLCTKLIKGFFNSKEINKAVEVMKILETKGEPDLFAYNAMISGFC  149

Query  672   KTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDV  493
             K NR+E AN +L+RMR +G+ PD+VTYNIMIGS+C RGKL LA KVLD++  D+ C+P V
Sbjct  150   KVNRIEDANQLLSRMRGKGYSPDIVTYNIMIGSLCSRGKLDLASKVLDKLLIDD-CQPTV  208

Query  492   VTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRS  313
             VTYT+LIEAT+++ G  EAM+L +EML RGLEP+IY YN +++G+C++G VD+A+ FVRS
Sbjct  209   VTYTILIEATLIEGGTKEAMQLFNEMLGRGLEPDIYVYNTMIRGMCKDGSVDQAFAFVRS  268

Query  312   LPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGK  133
             LP+ G  PD  SYNILLRALLDR  W+ GE+L++EM + G EP+  TY+I +++LCR  K
Sbjct  269   LPSQGSHPDAISYNILLRALLDRGKWEQGEQLVREMLARGSEPNVVTYSIIIAALCRASK  328

Query  132   LNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             + +A++MLK+M EKGL P+ ++YDPLIS FCKEG+LDLAI +LD
Sbjct  329   VEEALTMLKVMMEKGLKPDNYSYDPLISTFCKEGKLDLAIGVLD  372


 Score =   167 bits (422),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 155/277 (56%), Gaps = 6/277 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  L+R    GK+E+   L++ M+  G +P+VV  + +I  L    K E+A+ +
Sbjct  280  SYNILLRALLDR----GKWEQGEQLVREMLARGSEPNVVTYSIIIAALCRASKVEEALTM  335

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++++ + G +P+  +Y  LI  FCK  +++ A GVL+ M S G  PD+V YN ++ ++C 
Sbjct  336  LKVMMEKGLKPDNYSYDPLISTFCKEGKLDLAIGVLDLMISNGCLPDIVNYNTVLAALCK  395

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             GK  LAL++ D++  D  C PD  +Y  LI A         AMK+V+EM   G++P+  
Sbjct  396  NGKADLALEIFDKLS-DVGCNPDASSYNCLISALWNTGDRPRAMKMVEEMFKNGIDPDEI  454

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYNA+L  LCR+ MVD A + +R +   G +P V SYN++L  L   +   D  +LL  M
Sbjct  455  TYNALLSCLCRDRMVDDAMKLLRDMENYGIQPTVISYNMILLGLCKEQRLADAVELLGRM  514

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTE  94
               GC+P+  TY + +  +   G   +A+ +   + E
Sbjct  515  VEKGCQPNETTYTLLIEGIGFAGWHYEAMELANTLME  551


 Score =   161 bits (407),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 155/292 (53%), Gaps = 4/292 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNVLAY  697
            G  +E + L   M+  G +PD+ +   +I+G+      ++A   V  L  Q   P+ ++Y
Sbjct  222  GGTKEAMQLFNEMLGRGLEPDIYVYNTMIRGMCKDGSVDQAFAFVRSLPSQGSHPDAISY  281

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++  M +RG  P+VVTY+I+I ++C   K+  AL +L  M E
Sbjct  282  NILLRALLDRGKWEQGEQLVREMLARGSEPNVVTYSIIIAALCRASKVEEALTMLKVMME  341

Query  516  DNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMV  340
                KPD  +Y  LI +T  K+G +  A+ ++D M+S G  P+I  YN +L  LC+ G  
Sbjct  342  -KGLKPDNYSYDPLI-STFCKEGKLDLAIGVLDLMISNGCLPDIVNYNTVLAALCKNGKA  399

Query  339  DRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIF  160
            D A E    L  +GC PD  SYN L+ AL +  +     K+++EM   G +P   TYN  
Sbjct  400  DLALEIFDKLSDVGCNPDASSYNCLISALWNTGDRPRAMKMVEEMFKNGIDPDEITYNAL  459

Query  159  VSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +S LCRD  ++ A+ +L+ M   G+ P   +Y+ ++   CKE RL  A++LL
Sbjct  460  LSCLCRDRMVDDAMKLLRDMENYGIQPTVISYNMILLGLCKEQRLADAVELL  511


 Score =   160 bits (406),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 155/294 (53%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNV  706
            C  G  ++    ++ +   G  PD +    L++ L    K E+  + V ++L +  EPNV
Sbjct  254  CKDGSVDQAFAFVRSLPSQGSHPDAISYNILLRALLDRGKWEQGEQLVREMLARGSEPNV  313

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ +I   C+ ++VE A  +L  M  +G  PD  +Y+ +I + C  GKL LA+ VLD 
Sbjct  314  VTYSIIIAALCRASKVEEALTMLKVMMEKGLKPDNYSYDPLISTFCKEGKLDLAIGVLDL  373

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M   N C PD+V Y  ++ A + K+G ++ A+++ D++   G  P+  +YN ++  L   
Sbjct  374  MIS-NGCLPDIVNYNTVL-AALCKNGKADLALEIFDKLSDVGCNPDASSYNCLISALWNT  431

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA + V  +   G  PD  +YN LL  L   R  DD  KLL++M + G +P   +Y
Sbjct  432  GDRPRAMKMVEEMFKNGIDPDEITYNALLSCLCRDRMVDDAMKLLRDMENYGIQPTVISY  491

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            N+ +  LC++ +L  A+ +L  M EKG  PN+ TY  LI      G    A++L
Sbjct  492  NMILLGLCKEQRLADAVELLGRMVEKGCQPNETTYTLLIEGIGFAGWHYEAMEL  545


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 95/195 (49%), Gaps = 2/195 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK +  + +L  M+  G  PD+V    ++  L    KA+ A+++   L   G  P+ 
Sbjct  359  CKEGKLDLAIGVLDLMISNGCLPDIVNYNTVLAALCKNGKADLALEIFDKLSDVGCNPDA  418

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  LI     T     A  ++  M   G  PD +TYN ++  +C    +  A+K+L  
Sbjct  419  SSYNCLISALWNTGDRPRAMKMVEEMFKNGIDPDEITYNALLSCLCRDRMVDDAMKLLRD  478

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E+   +P V++Y +++     +  +++A++L+  M+ +G +PN  TY  +++G+   G
Sbjct  479  M-ENYGIQPTVISYNMILLGLCKEQRLADAVELLGRMVEKGCQPNETTYTLLIEGIGFAG  537

Query  345  MVDRAYEFVRSLPAM  301
                A E   +L  M
Sbjct  538  WHYEAMELANTLMEM  552



>ref|XP_011036314.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Populus euphratica]
Length=586

 Score =   399 bits (1025),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 245/308 (80%), Gaps = 0/308 (0%)
 Frame = -1

Query  924  DSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK  745
            D KE  + + LNRSC AGK  E+LY L+ MV  GY+PDV++CTKLIKG F+ +  EKA +
Sbjct  70   DFKETHLMKLLNRSCKAGKCNESLYFLECMVAKGYQPDVIMCTKLIKGFFNSRNIEKATR  129

Query  744  VMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            VM++LE+ GEP+V AY A+I GFCK NR+E+A  VL+RM+ +GF  DVVTYNIMIG+ C 
Sbjct  130  VMEILEKHGEPDVFAYNAVISGFCKANRIESAKKVLDRMKRKGFSQDVVTYNIMIGTFCS  189

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
            +GK+ LALKV +++ +DNNCKP ++TYT+LIEA I++ GI E +KL+DEMLS+GLEP+ +
Sbjct  190  KGKIDLALKVFEELLKDNNCKPSLITYTILIEAHILEGGIDEGLKLLDEMLSKGLEPDTF  249

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN I++GL +EG V+ A+E VR+L + GCKPDV +YNILLRALLD+  W +GEKL+ EM
Sbjct  250  TYNVIVRGLGKEGKVNHAFELVRTLNSRGCKPDVITYNILLRALLDQGKWYEGEKLMNEM  309

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
             S GCEP+  TY+I + SLC DGK+ ++++++K+M EKGLTP+ + YDPLI+AFC+EG+L
Sbjct  310  FSRGCEPNVVTYSILIGSLCHDGKIEESVNLVKVMKEKGLTPDAYCYDPLIAAFCREGKL  369

Query  24   DLAIDLLD  1
            D+AI  LD
Sbjct  370  DMAIKFLD  377


 Score =   172 bits (436),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 157/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G +PD      +++GL    K   A ++++ L   G +P+V+ Y
Sbjct  227  GGIDEGLKLLDEMLSKGLEPDTFTYNVIVRGLGKEGKVNHAFELVRTLNSRGCKPDVITY  286

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       +      ++N M SRG  P+VVTY+I+IGS+C  GK+  ++ ++  MKE
Sbjct  287  NILLRALLDQGKWYEGEKLMNEMFSRGCEPNVVTYSILIGSLCHDGKIEESVNLVKVMKE  346

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD   Y  LI A   +  +  A+K +D M+S G  P+I  YN I+  LC+ G  D
Sbjct  347  -KGLTPDAYCYDPLIAAFCREGKLDMAIKFLDYMISDGFLPDIVNYNTIMAALCKNGNSD  405

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
             A E    L  +GC P+V SYN +L AL     W  G++     ++ +M S G +P   T
Sbjct  406  HAVEIFGKLEEVGCPPNVSSYNTMLSAL-----WGSGDRYRALGMISQMLSKGIDPDGIT  460

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +++AI +L  M      PN  +Y+ ++   CK  R+D AI++L
Sbjct  461  YNSLISCLCRDGMVDEAIGLLADMLSGRFQPNIVSYNIVLLGLCKVHRIDDAIEVL  516


 Score =   169 bits (429),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 169/296 (57%), Gaps = 5/296 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGY-KPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPN  709
            C  GK +  L + + ++K    KP ++  T LI+        ++ +K++ ++L +  EP+
Sbjct  188  CSKGKIDLALKVFEELLKDNNCKPSLITYTILIEAHILEGGIDEGLKLLDEMLSKGLEPD  247

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
               Y  ++ G  K  +V  A  ++  + SRG  PDV+TYNI++ ++ D+GK     K+++
Sbjct  248  TFTYNVIVRGLGKEGKVNHAFELVRTLNSRGCKPDVITYNILLRALLDQGKWYEGEKLMN  307

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            +M     C+P+VVTY++LI  ++  DG I E++ LV  M  +GL P+ Y Y+ ++   CR
Sbjct  308  EMFS-RGCEPNVVTYSILI-GSLCHDGKIEESVNLVKVMKEKGLTPDAYCYDPLIAAFCR  365

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            EG +D A +F+  + + G  PD+ +YN ++ AL    N D   ++  ++  +GC P+  +
Sbjct  366  EGKLDMAIKFLDYMISDGFLPDIVNYNTIMAALCKNGNSDHAVEIFGKLEEVGCPPNVSS  425

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S+L   G   +A+ M+  M  KG+ P+  TY+ LIS  C++G +D AI LL
Sbjct  426  YNTMLSALWGSGDRYRALGMISQMLSKGIDPDGITYNSLISCLCRDGMVDEAIGLL  481


 Score =   145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/291 (31%), Positives = 149/291 (51%), Gaps = 4/291 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNVLAY  697
            GK      L++ +   G KPDV+    L++ L    K  +  K+M ++  +  EPNV+ Y
Sbjct  262  GKVNHAFELVRTLNSRGCKPDVITYNILLRALLDQGKWYEGEKLMNEMFSRGCEPNVVTY  321

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
            + LIG  C   ++E +  ++  M+ +G  PD   Y+ +I + C  GKL +A+K LD M  
Sbjct  322  SILIGSLCHDGKIEESVNLVKVMKEKGLTPDAYCYDPLIAAFCREGKLDMAIKFLDYMIS  381

Query  516  DNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCREGMV  340
            D    PD+V Y  ++ A + K+G S+ A+++  ++   G  PN+ +YN +L  L   G  
Sbjct  382  DGFL-PDIVNYNTIM-AALCKNGNSDHAVEIFGKLEEVGCPPNVSSYNTMLSALWGSGDR  439

Query  339  DRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIF  160
             RA   +  + + G  PD  +YN L+  L      D+   LL +M S   +P+  +YNI 
Sbjct  440  YRALGMISQMLSKGIDPDGITYNSLISCLCRDGMVDEAIGLLADMLSGRFQPNIVSYNIV  499

Query  159  VSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            +  LC+  +++ AI +L  M E G  PN+ TY  LI      G    A++L
Sbjct  500  LLGLCKVHRIDDAIEVLTAMIENGCQPNETTYTLLIEGIGFSGSRAQAMEL  550


 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 101/195 (52%), Gaps = 2/195 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK +  +  L YM+  G+ PD+V    ++  L     ++ AV++   LE+ G  PNV
Sbjct  364  CREGKLDMAIKFLDYMISDGFLPDIVNYNTIMAALCKNGNSDHAVEIFGKLEEVGCPPNV  423

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  ++     +     A G++++M S+G  PD +TYN +I  +C  G +  A+ +L  
Sbjct  424  SSYNTMLSALWGSGDRYRALGMISQMLSKGIDPDGITYNSLISCLCRDGMVDEAIGLLAD  483

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M      +P++V+Y +++        I +A++++  M+  G +PN  TY  +++G+   G
Sbjct  484  MLS-GRFQPNIVSYNIVLLGLCKVHRIDDAIEVLTAMIENGCQPNETTYTLLIEGIGFSG  542

Query  345  MVDRAYEFVRSLPAM  301
               +A E   SL +M
Sbjct  543  SRAQAMELAYSLYSM  557



>ref|XP_010523367.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X2 [Tarenaya hassleriana]
Length=563

 Score =   393 bits (1010),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/328 (56%), Positives = 251/328 (77%), Gaps = 9/328 (3%)
 Frame = -1

Query  963  VSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIK  784
            V  E R   +      +  + +  +RSC +GKY E+LYLL+ MV+ GYKPD +LCTKLIK
Sbjct  63   VPAEQRQTQLPSFGFNDAQMLKLFHRSCKSGKYSESLYLLEKMVRKGYKPDAILCTKLIK  122

Query  783  GLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPD  604
            GLF+++   KAVKVM++LE  G+P+V AY ALI GFCK NR++ A  V++RMR++GF PD
Sbjct  123  GLFNLRNIPKAVKVMEILETHGQPDVFAYNALISGFCKMNRMDDATKVIDRMRNKGFSPD  182

Query  603  VVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLV  424
             VTYNIMIGS+C RGKL LALKVLDQ+  DN C+P V+TYT+LIEAT +  G+ EA+KL+
Sbjct  183  TVTYNIMIGSLCSRGKLDLALKVLDQLLMDN-CRPTVITYTILIEATTMDGGVDEALKLL  241

Query  423  DEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDR  244
            DEMLSRGL+P+++TYN I++G+C+EGMVDRA+  VR+L + GC+PDV SYNILLRALL++
Sbjct  242  DEMLSRGLKPDMFTYNTIMRGMCKEGMVDRAFGMVRNLESRGCEPDVISYNILLRALLNQ  301

Query  243  RNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTY  64
              WD+G+KL+ +M S GCEP+  TY+I +S+LCRDGK+ +A+++LK M  KGL P+ ++Y
Sbjct  302  GKWDEGDKLMTKMFSKGCEPNVVTYSILISTLCRDGKIEEALNLLKEMRGKGLNPDAYSY  361

Query  63   DPLISAFCKE--------GRLDLAIDLL  4
            DPLI+AFC+E        G+ D A+++ 
Sbjct  362  DPLIAAFCREVLATLCKNGKADQALEIF  389


 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/303 (33%), Positives = 170/303 (56%), Gaps = 12/303 (4%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +L  ++    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  194  CSRGKLDLALKVLDQLLMDNCRPTVITYTILIEATTMDGGVDEALKLLDEMLSRGLKPDM  253

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  ++ G CK   V+ A G++  + SRG  PDV++YNI++ ++ ++GK     K++ +
Sbjct  254  FTYNTIMRGMCKEGMVDRAFGMVRNLESRGCEPDVISYNILLRALLNQGKWDEGDKLMTK  313

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     C+P+VVTY++LI +T+ +DG I EA+ L+ EM  +GL P+ Y+Y+ ++   CRE
Sbjct  314  MFS-KGCEPNVVTYSILI-STLCRDGKIEEALNLLKEMRGKGLNPDAYSYDPLIAAFCRE  371

Query  348  --------GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMG  193
                    G  D+A E    L  +GC P+  SYN +  AL    N     +++ EM S  
Sbjct  372  VLATLCKNGKADQALEIFGKLSEVGCPPNASSYNTMFSALWSSGNKARALQMISEMISHD  431

Query  192  CEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
             +P   TYN  +S +CRDG ++ A+ ++  M      P+  TY+ ++  FCK  R+D AI
Sbjct  432  IDPDEITYNSMISCMCRDGMVDDALGLVVDMRSSEFHPSVITYNIILLGFCKAHRVDEAI  491

Query  12   DLL  4
            D+L
Sbjct  492  DIL  494


 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/279 (26%), Positives = 137/279 (49%), Gaps = 10/279 (4%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +    +++ +   G +PDV+    L++ L +  K ++  K+M ++  +  EPNV
Sbjct  264  CKEGMVDRAFGMVRNLESRGCEPDVISYNILLRALLNQGKWDEGDKLMTKMFSKGCEPNV  323

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIG--------SICDRGKLG  550
            + Y+ LI   C+  ++E A  +L  MR +G  PD  +Y+ +I         ++C  GK  
Sbjct  324  VTYSILISTLCRDGKIEEALNLLKEMRGKGLNPDAYSYDPLIAAFCREVLATLCKNGKAD  383

Query  549  LALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAI  370
             AL++  ++ E   C P+  +Y  +  A       + A++++ EM+S  ++P+  TYN++
Sbjct  384  QALEIFGKLSE-VGCPPNASSYNTMFSALWSSGNKARALQMISEMISHDIDPDEITYNSM  442

Query  369  LKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGC  190
            +  +CR+GMVD A   V  + +    P V +YNI+L         D+   +L  M   GC
Sbjct  443  ISCMCRDGMVDDALGLVVDMRSSEFHPSVITYNIILLGFCKAHRVDEAIDILASMVETGC  502

Query  189  EPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNK  73
             P+  T+ + +  +   G   +A+ +   +   G   +K
Sbjct  503  RPNETTFTLLIEGIGFAGWRAEAMELANSLVRLGAVSDK  541


 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 79/148 (53%), Gaps = 1/148 (1%)
 Frame = -1

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
            SE++ L+++M+ +G +P+      ++KGL     + +A + +  L   G +PDVF+YN L
Sbjct  96   SESLYLLEKMVRKGYKPDAILCTKLIKGLFNLRNIPKAVKVMEILETHG-QPDVFAYNAL  154

Query  264  LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
            +         DD  K++  M + G  P T TYNI + SLC  GKL+ A+ +L  +     
Sbjct  155  ISGFCKMNRMDDATKVIDRMRNKGFSPDTVTYNIMIGSLCSRGKLDLALKVLDQLLMDNC  214

Query  84   TPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             P   TY  LI A   +G +D A+ LLD
Sbjct  215  RPTVITYTILIEATTMDGGVDEALKLLD  242



>ref|XP_003590960.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES61211.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=590

 Score =   392 bits (1008),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/325 (56%), Positives = 250/325 (77%), Gaps = 1/325 (0%)
 Frame = -1

Query  975  QSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCT  796
            Q  +V+        Q  D ++ +  + LNRSC + KY+E+LY LQ+MV  GYKPDV+LCT
Sbjct  57   QQFRVNETKPTKHDQDYDFRDTNFMKTLNRSCKSAKYDESLYFLQHMVNRGYKPDVILCT  116

Query  795  KLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRG  616
            KLIKG F++KK EKA++VM++LE+ G+P+V AY A+I GFCK +RV+ A+ VL+RM+ RG
Sbjct  117  KLIKGFFNMKKIEKAIQVMEILEKHGKPDVFAYNAVISGFCKADRVDHASKVLDRMKKRG  176

Query  615  FFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEA  436
            F PDVVTYNI+IG+ C RG+L LAL+V+DQ+ +DN CKP V+TYT+LIEATI + GI EA
Sbjct  177  FEPDVVTYNILIGNFCGRGRLDLALRVMDQLLKDN-CKPTVITYTILIEATITQGGIDEA  235

Query  435  MKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRA  256
            MKL+DEMLSRGL P+ YTYN ++ G+C+EGM+DRA+EF+  +   GC   V +YNILLR 
Sbjct  236  MKLLDEMLSRGLRPDRYTYNVVVNGMCKEGMLDRAFEFLSRISKNGCVAGVSTYNILLRD  295

Query  255  LLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPN  76
            LL+   W+ GEKL+ +M   GCEP+  TY+  +++LCRDGK+++A ++LK+M EK L P+
Sbjct  296  LLNEGKWEYGEKLMSDMLVKGCEPNPITYSTLITALCRDGKIDEAKNVLKVMKEKALAPD  355

Query  75   KFTYDPLISAFCKEGRLDLAIDLLD  1
             ++YDPLISA C+EG++DLAI+ LD
Sbjct  356  GYSYDPLISALCREGKVDLAIEFLD  380


 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/286 (29%), Positives = 147/286 (51%), Gaps = 7/286 (2%)
 Frame = -1

Query  951  NRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFS  772
            ++N  +  + +  I +R  LN     GK+E    L+  M+  G +P+ +  + LI  L  
Sbjct  278  SKNGCVAGVSTYNILLRDLLNE----GKWEYGEKLMSDMLVKGCEPNPITYSTLITALCR  333

Query  771  VKKAEKAVKVMQLL-EQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVT  595
              K ++A  V++++ E+   P+  +Y  LI   C+  +V+ A   L+ M S G  PD+++
Sbjct  334  DGKIDEAKNVLKVMKEKALAPDGYSYDPLISALCREGKVDLAIEFLDDMISGGHLPDILS  393

Query  594  YNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEM  415
            YN ++ S+C  G    AL + +++ E   C P+  +Y  L  A         A+ ++ EM
Sbjct  394  YNSILASLCKNGNADEALNIFEKLGE-VGCPPNAGSYNTLFGALWSSGDKIRALGMILEM  452

Query  414  LSRGLEPNIYTYNAILKGLCREGMVDRAYEF-VRSLPAMGCKPDVFSYNILLRALLDRRN  238
            LS G++P+  TYN+++  LCR+G+VD+A E  V    +  C+P V SYN +L  L   + 
Sbjct  453  LSNGIDPDEITYNSLISCLCRDGLVDQAIELLVDMFESEKCQPTVISYNTVLLGLCKVQR  512

Query  237  WDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
              D  ++L  M + GC P+  TY + +  +   G    A+ +  ++
Sbjct  513  IIDAIEVLAAMVNEGCLPNETTYTLLIQGIGFAGWRYDAMELANLL  558


 Score =   123 bits (309),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 140/286 (49%), Gaps = 5/286 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFG  718
            +N  C  G  +     L  + K G    V     L++ L +  K E   K+M  +L +  
Sbjct  258  VNGMCKEGMLDRAFEFLSRISKNGCVAGVSTYNILLRDLLNEGKWEYGEKLMSDMLVKGC  317

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            EPN + Y+ LI   C+  +++ A  VL  M+ +   PD  +Y+ +I ++C  GK+ LA++
Sbjct  318  EPNPITYSTLITALCRDGKIDEAKNVLKVMKEKALAPDGYSYDPLISALCREGKVDLAIE  377

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
             LD M    +  PD+++Y  ++ A++ K+G   EA+ + +++   G  PN  +YN +   
Sbjct  378  FLDDMISGGHL-PDILSYNSIL-ASLCKNGNADEALNIFEKLGEVGCPPNAGSYNTLFGA  435

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM-SSMGCEP  184
            L   G   RA   +  + + G  PD  +YN L+  L      D   +LL +M  S  C+P
Sbjct  436  LWSSGDKIRALGMILEMLSNGIDPDEITYNSLISCLCRDGLVDQAIELLVDMFESEKCQP  495

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISA  46
               +YN  +  LC+  ++  AI +L  M  +G  PN+ TY  LI  
Sbjct  496  TVISYNTVLLGLCKVQRIIDAIEVLAAMVNEGCLPNETTYTLLIQG  541


 Score = 85.1 bits (209),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 94/195 (48%), Gaps = 1/195 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK +  +  L  M+  G+ PD++    ++  L     A++A+ + + L + G  PN 
Sbjct  367  CREGKVDLAIEFLDDMISGGHLPDILSYNSILASLCKNGNADEALNIFEKLGEVGCPPNA  426

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  L G    +     A G++  M S G  PD +TYN +I  +C  G +  A+++L  
Sbjct  427  GSYNTLFGALWSSGDKIRALGMILEMLSNGIDPDEITYNSLISCLCRDGLVDQAIELLVD  486

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E   C+P V++Y  ++        I +A++++  M++ G  PN  TY  +++G+   G
Sbjct  487  MFESEKCQPTVISYNTVLLGLCKVQRIIDAIEVLAAMVNEGCLPNETTYTLLIQGIGFAG  546

Query  345  MVDRAYEFVRSLPAM  301
                A E    L  M
Sbjct  547  WRYDAMELANLLVNM  561



>gb|KFK37890.1| hypothetical protein AALP_AA3G042500 [Arabis alpina]
Length=489

 Score =   388 bits (996),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 175/279 (63%), Positives = 236/279 (85%), Gaps = 1/279 (0%)
 Frame = -1

Query  837  MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRV  658
            MV+ GY PDV+LCTKLIKG F++K   KAVKVM++LE+FG+P+V AY ALI GFCK NR+
Sbjct  1    MVRKGYNPDVILCTKLIKGFFNLKNIPKAVKVMEILEKFGQPDVFAYNALINGFCKMNRI  60

Query  657  EAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTV  478
            + A  VL+RMRS+GF PD VTYNIMIGS+C RGKL LA+KVLDQ+  DN C+P V+TYT+
Sbjct  61   DDATKVLDRMRSKGFSPDTVTYNIMIGSLCSRGKLDLAMKVLDQLLNDN-CQPTVITYTI  119

Query  477  LIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMG  298
            LIEAT++  G+ EA+KL+DEMLSRGL+P+++TYN I++G+C+EGMV RA+E VR+L   G
Sbjct  120  LIEATMLDGGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVHRAFEMVRNLELRG  179

Query  297  CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAI  118
            C+PDV SYNILLRA+L++  W++GEKL+ +M S  CEP+  TY+I +++LCRDGK+++A+
Sbjct  180  CEPDVISYNILLRAVLNQGKWEEGEKLMSKMISEKCEPNVVTYSILITTLCRDGKIDEAL  239

Query  117  SMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            ++LK+M EKGLTP+ ++YDPLI+AFC+EGRLDLAI+ L+
Sbjct  240  NLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDLAIEFLE  278


 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 170/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  + +L  ++    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  90   CSRGKLDLAMKVLDQLLNDNCQPTVITYTILIEATMLDGGVDEALKLLDEMLSRGLKPDM  149

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   V  A  ++  +  RG  PDV++YNI++ ++ ++GK     K++ +
Sbjct  150  FTYNTIIRGMCKEGMVHRAFEMVRNLELRGCEPDVISYNILLRAVLNQGKWEEGEKLMSK  209

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C+P+VVTY++LI  T+ +DG I EA+ L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  210  MISEK-CEPNVVTYSILI-TTLCRDGKIDEALNLLKLMKEKGLTPDAYSYDPLIAAFCRE  267

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+ ++ + GC PD+ +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  268  GRLDLAIEFLETMISEGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  327

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   + + M+  M   G+ P++ TY+ +IS  C+EG +D A +LL
Sbjct  328  NTMFSALWSSGDKMRGLQMISEMLNNGIDPDEITYNSMISCLCREGMVDEAFELL  382


 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 159/292 (54%), Gaps = 2/292 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+       +A ++++ LE  G EP+V++Y
Sbjct  128  GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVHRAFEMVRNLELRGCEPDVISY  187

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++++M S    P+VVTY+I+I ++C  GK+  AL +L  MKE
Sbjct  188  NILLRAVLNQGKWEEGEKLMSKMISEKCEPNVVTYSILITTLCRDGKIDEALNLLKLMKE  247

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  248  -KGLTPDAYSYDPLIAAFCREGRLDLAIEFLETMISEGCLPDIVNYNTVLATLCKNGKAD  306

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
            +A E    L  +GC P+  SYN +  AL    +   G +++ EM + G +P   TYN  +
Sbjct  307  QALEIFGKLGEVGCSPNSSSYNTMFSALWSSGDKMRGLQMISEMLNNGIDPDEITYNSMI  366

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            S LCR+G +++A  +L  M      P+  TY+ ++  FCK  R++ AID+L+
Sbjct  367  SCLCREGMVDEAFELLVDMRSCEFHPSVVTYNIVVLGFCKAHRIEDAIDVLE  418


 Score =   140 bits (352),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 86/299 (29%), Positives = 152/299 (51%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G       +++ +   G +PDV+    L++ + +  K E+  K+M +++ +  EPNV
Sbjct  160  CKEGMVHRAFEMVRNLELRGCEPDVISYNILLRAVLNQGKWEEGEKLMSKMISEKCEPNV  219

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +++ A  +L  M+ +G  PD  +Y+ +I + C  G+L LA++ L+ 
Sbjct  220  VTYSILITTLCRDGKIDEALNLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDLAIEFLET  279

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  280  MISEG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  337

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   R  + +  +   G  PD  +YN ++  L      D+  +LL +M S    P   TY
Sbjct  338  GDKMRGLQMISEMLNNGIDPDEITYNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTY  397

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI V   C+  ++  AI +L+ M E G  PN+ TY  +I      G     ++LA DL+
Sbjct  398  NIVVLGFCKAHRIEDAIDVLESMVENGCRPNETTYTVIIEGIGFAGYRAEAMELANDLV  456



>ref|XP_006487702.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Citrus sinensis]
Length=583

 Score =   390 bits (1001),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 255/333 (77%), Gaps = 4/333 (1%)
 Frame = -1

Query  990  NLKNLQSVKVST--ENR-NALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGY  820
            N K+ + V+VS+  E R N  +   D KE    + + +S  AGK++E+LY ++ MV  G 
Sbjct  41   NPKSNERVRVSSSAETRPNTHLLSFDVKETQFMKLIKKSFRAGKFDESLYFIESMVANGC  100

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGV  640
            KPDVV+CTKLIK  F  +K+ KAV+VM++LE++GEP+V AY ALI GFCK N++E AN V
Sbjct  101  KPDVVMCTKLIKKFFQERKSNKAVRVMEILEKYGEPDVFAYNALISGFCKANQIELANKV  160

Query  639  LNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATI  460
            L+R+RSRGF PDVVTYNIMIGS+C RG +  A KV DQ+  DN CKP V+TYT+LI+AT+
Sbjct  161  LDRLRSRGFSPDVVTYNIMIGSLCSRGMIESAFKVFDQLLRDN-CKPTVITYTILIQATM  219

Query  459  VKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
            ++    +AMKL+DEML+RGL P+++T NAI++G+C++GMV +A++FVRSL + GC+PDV 
Sbjct  220  LEGQTDKAMKLLDEMLARGLIPDMFTNNAIIRGMCKKGMVGQAFQFVRSLESRGCQPDVI  279

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
            SYN+LLR LL+   W++GEKL+ EM S G EP+  TY+I +SSLCRDGK   A+ +L+  
Sbjct  280  SYNMLLRTLLNMGKWEEGEKLMTEMISRGLEPNVVTYSILISSLCRDGKTEDAVDVLRAA  339

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             EKGLTP+ ++YDPLISA+CK+GRLDLAI+ LD
Sbjct  340  KEKGLTPDAYSYDPLISAYCKDGRLDLAIEFLD  372


 Score =   169 bits (429),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 103/297 (35%), Positives = 158/297 (53%), Gaps = 14/297 (5%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G+ ++ + LL  M+  G  PD+     +I+G+       +A + ++ LE  G +P+V++Y
Sbjct  222  GQTDKAMKLLDEMLARGLIPDMFTNNAIIRGMCKKGMVGQAFQFVRSLESRGCQPDVISY  281

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++  M SRG  P+VVTY+I+I S+C  GK   A+ VL   KE
Sbjct  282  NMLLRTLLNMGKWEEGEKLMTEMISRGLEPNVVTYSILISSLCRDGKTEDAVDVLRAAKE  341

Query  516  DNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMV  340
                 PD  +Y  LI A   KDG +  A++ +D M+S G  P+I  YN IL   C+ G  
Sbjct  342  -KGLTPDAYSYDPLISA-YCKDGRLDLAIEFLDYMISDGCLPDIVNYNTILAAFCKNGNA  399

Query  339  DRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTF  175
            D+A E    L  +GC P+V SYN +  AL     W  G+K     ++ EM S G EP   
Sbjct  400  DQALEIFEKLSDVGCPPNVSSYNTMFSAL-----WSSGDKIRALGMISEMLSKGIEPDEI  454

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            TYN  +S LCRDG +++A+ +L  M      P   +Y+ +I  FCK  R++ +I++L
Sbjct  455  TYNSLISCLCRDGMVDEAVGLLVDMESTRFRPTVISYNIIILGFCKTRRINESIEVL  511


 Score =   167 bits (422),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/295 (31%), Positives = 168/295 (57%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  E    +   +++   KP V+  T LI+      + +KA+K++ ++L +   P++
Sbjct  184  CSRGMIESAFKVFDQLLRDNCKPTVITYTILIQATMLEGQTDKAMKLLDEMLARGLIPDM  243

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
                A+I G CK   V  A   +  + SRG  PDV++YN+++ ++ + GK     K++ +
Sbjct  244  FTNNAIIRGMCKKGMVGQAFQFVRSLESRGCQPDVISYNMLLRTLLNMGKWEEGEKLMTE  303

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M      +P+VVTY++LI +++ +DG +E A+ ++     +GL P+ Y+Y+ ++   C++
Sbjct  304  MIS-RGLEPNVVTYSILI-SSLCRDGKTEDAVDVLRAAKEKGLTPDAYSYDPLISAYCKD  361

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+  + + GC PD+ +YN +L A     N D   ++ +++S +GC P+  +Y
Sbjct  362  GRLDLAIEFLDYMISDGCLPDIVNYNTILAAFCKNGNADQALEIFEKLSDVGCPPNVSSY  421

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M  KG+ P++ TY+ LIS  C++G +D A+ LL
Sbjct  422  NTMFSALWSSGDKIRALGMISEMLSKGIEPDEITYNSLISCLCRDGMVDEAVGLL  476


 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/255 (32%), Positives = 137/255 (54%), Gaps = 2/255 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK+EE   L+  M+  G +P+VV  + LI  L    K E AV V++  ++ G  P+  +Y
Sbjct  292  GKWEEGEKLMTEMISRGLEPNVVTYSILISSLCRDGKTEDAVDVLRAAKEKGLTPDAYSY  351

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  +CK  R++ A   L+ M S G  PD+V YN ++ + C  G    AL++ +++  
Sbjct  352  DPLISAYCKDGRLDLAIEFLDYMISDGCLPDIVNYNTILAAFCKNGNADQALEIFEKLS-  410

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D  C P+V +Y  +  A         A+ ++ EMLS+G+EP+  TYN+++  LCR+GMVD
Sbjct  411  DVGCPPNVSSYNTMFSALWSSGDKIRALGMISEMLSKGIEPDEITYNSLISCLCRDGMVD  470

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A   +  + +   +P V SYNI++      R  ++  ++L  M   GC+P+  TY + +
Sbjct  471  EAVGLLVDMESTRFRPTVISYNIIILGFCKTRRINESIEVLAAMFEKGCKPNETTYVLLI  530

Query  156  SSLCRDGKLNKAISM  112
              +   G   +A+ +
Sbjct  531  EGIGYGGWRAEAMEL  545


 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 84/159 (53%), Gaps = 2/159 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  ++ L + + +  +G  P+V     +   L+S     +A+ ++ ++L +  EP+ 
Sbjct  394  CKNGNADQALEIFEKLSDVGCPPNVSSYNTMFSALWSSGDKIRALGMISEMLSKGIEPDE  453

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   V+ A G+L  M S  F P V++YNI+I   C   ++  +++VL  
Sbjct  454  ITYNSLISCLCRDGMVDEAVGLLVDMESTRFRPTVISYNIIILGFCKTRRINESIEVLAA  513

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLS  409
            M E   CKP+  TY +LIE        +EAM+L + ++S
Sbjct  514  MFE-KGCKPNETTYVLLIEGIGYGGWRAEAMELANALVS  551



>ref|XP_008389018.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Malus domestica]
Length=673

 Score =   392 bits (1006),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/321 (59%), Positives = 249/321 (78%), Gaps = 1/321 (0%)
 Frame = -1

Query  963  VSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIK  784
             S E R   +Q  DSKE  + + L+RSC AG+Y E LY L+ MV  GY PDV+L TKLIK
Sbjct  143  ASAEVRATQLQNNDSKETHLMKVLBRSCKAGQYNEALYFLELMVNXGYXPDVILXTKLIK  202

Query  783  GLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPD  604
            G F+ +  EKAV+VMQ+LE++GEP++ +Y ALI GFCK NR+++AN VL+RMRS GF PD
Sbjct  203  GFFNSRNVEKAVRVMQILEKYGEPDLFSYNALISGFCKANRIDSANKVLDRMRSXGFSPD  262

Query  603  VVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLV  424
            VVTYNIMIGS+C RGKLGL LKVLDQ+ +D+ C+P V+TY +LIEA I++ GI EA+ L+
Sbjct  263  VVTYNIMIGSLCGRGKLGLXLKVLDQLVKDB-CRPTVITYMILIEAMILEGGIDEAVXLL  321

Query  423  DEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDR  244
            D+MLS  L+P++ TYNA++ G+CREGM+DRA+    SL + GC P+V S NILLRALL+R
Sbjct  322  DDMLSXXLKPDMNTYNAVVXGMCREGMLDRAFXLXXSLDSKGCSPNVVSXNILLRALLNR  381

Query  243  RNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTY  64
              W++GEKL+  M S GCEP+  TY+I +S+LCR GK+  A+++LKIM + GLTP+ ++Y
Sbjct  382  GKWEEGEKLVSNMXSRGCEPNVVTYSILISTLCRXGKVEDAVNVLKIMKDXGLTPDAYSY  441

Query  63   DPLISAFCKEGRLDLAIDLLD  1
            DPL+ AFCKEGRLDLAI+ LD
Sbjct  442  DPLVXAFCKEGRLDLAIEFLD  462


 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/294 (30%), Positives = 158/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CG GK    L +L  +VK   +P V+    LI+ +      ++AV ++  +     +P++
Sbjct  274  CGRGKLGLXLKVLDQLVKDBCRPTVITYMILIEAMILEGGIDEAVXLLDDMLSXXLKPDM  333

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A++ G C+   ++ A  +   + S+G  P+VV+ NI++ ++ +RGK     K++  
Sbjct  334  NTYNAVVXGMCREGMLDRAFXLXXSLDSKGCSPNVVSXNILLRALLNRGKWEEGEKLVSN  393

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C+P+VVTY++LI        + +A+ ++  M   GL P+ Y+Y+ ++   C+EG
Sbjct  394  MXS-RGCEPNVVTYSILISTLCRXGKVEDAVNVLKIMKDXGLTPDAYSYDPLVXAFCKEG  452

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A EF+  + + GC PD+ +YN +L AL      D   ++ +    +GC P+  +YN
Sbjct  453  RLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGXADQALEIFENXGEVGCPPNVSSYN  512

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               S+L   G   +A+ M+  M  KG  P++ TY+ LIS  C++  ++ AI LL
Sbjct  513  TMFSALWNCGDRVRALQMVSEMVSKGXDPDEITYNSLISCLCRDXMVNEAIGLL  566


 Score =   152 bits (385),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 153/296 (52%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E + LL  M+    KPD+     ++ G+      ++A  +   L+  G  PNV++ 
Sbjct  312  GGIDEAVXLLDDMLSXXLKPDMNTYNAVVXGMCREGMLDRAFXLXXSLDSKGCSPNVVSX  371

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    +++ M SRG  P+VVTY+I+I ++C  GK+  A+ VL  MK 
Sbjct  372  NILLRALLNRGKWEEGEKLVSNMXSRGCEPNVVTYSILISTLCRXGKVEDAVNVLKIMK-  430

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D    PD  +Y  L+ A   +  +  A++ +D M+S G  P+I  YN IL  LC+ G  D
Sbjct  431  DXGLTPDAYSYDPLVXAFCKEGRLDLAIEFLDYMISDGCLPDIVNYNTILAALCKSGXAD  490

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
            +A E   +   +GC P+V SYN +  AL     W+ G++     ++ EM S G +P   T
Sbjct  491  QALEIFENXGEVGCPPNVSSYNTMFSAL-----WNCGDRVRALQMVSEMVSKGXDPDEIT  545

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRD  +N+AI +L  M   G  P   +Y+ +    CK  R+  AI++L
Sbjct  546  YNSLISCLCRDXMVNEAIGLLVDMESGGFQPTVISYNIVXLGLCKTRRIVDAIEVL  601


 Score =   142 bits (357),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 89/295 (30%), Positives = 141/295 (48%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  +    L   +   G  P+VV    L++ L +  K E+  K++  +   G EPNV
Sbjct  344  CREGMLDRAFXLXXSLDSKGCSPNVVSXNILLRALLNRGKWEEGEKLVSNMXSRGCEPNV  403

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +VE A  VL  M+  G  PD  +Y+ ++ + C  G+L LA++ LD 
Sbjct  404  VTYSILISTLCRXGKVEDAVNVLKIMKDXGLTPDAYSYDPLVXAFCKEGRLDLAIEFLDY  463

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M  D  C PD+V Y  ++ A        +A+++ +     G  PN+ +YN +   L   G
Sbjct  464  MISDG-CLPDIVNYNTILAALCKSGXADQALEIFENXGEVGCPPNVSSYNTMFSALWNCG  522

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               RA + V  + + G  PD  +YN L+  L      ++   LL +M S G +P   +YN
Sbjct  523  DRVRALQMVSEMVSKGXDPDEITYNSLISCLCRDXMVNEAIGLLVDMESGGFQPTVISYN  582

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            I    LC+  ++  AI +L  M  KG  PN+ T   LI      G    A++L +
Sbjct  583  IVXLGLCKTRRIVDAIEVLAAMVXKGCRPNETTXTLLIEGIGFAGXRAEAMELAN  637


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 83/159 (52%), Gaps = 2/159 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNV  706
            C +G  ++ L + +   ++G  P+V     +   L++     +A++ V +++ +  +P+ 
Sbjct  484  CKSGXADQALEIFENXGEVGCPPNVSSYNTMFSALWNCGDRVRALQMVSEMVSKGXDPDE  543

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   V  A G+L  M S GF P V++YNI+   +C   ++  A++VL  
Sbjct  544  ITYNSLISCLCRDXMVNEAIGLLVDMESGGFQPTVISYNIVXLGLCKTRRIVDAIEVLAA  603

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLS  409
            M     C+P+  T T+LIE        +EAM+L + + S
Sbjct  604  MVX-KGCRPNETTXTLLIEGIGFAGXRAEAMELANSVFS  641



>ref|XP_006442665.1| hypothetical protein CICLE_v10019446mg [Citrus clementina]
 gb|ESR55905.1| hypothetical protein CICLE_v10019446mg [Citrus clementina]
Length=583

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/333 (56%), Positives = 253/333 (76%), Gaps = 4/333 (1%)
 Frame = -1

Query  990  NLKNLQSVKVST--ENR-NALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGY  820
            N K+ + V+VS+  E R N  +   D KE    + + RS  AGK++E+LY ++ MV  G 
Sbjct  41   NPKSNERVRVSSSAETRPNTHLLSFDVKETQFMKLIKRSFRAGKFDESLYFIESMVANGC  100

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGV  640
            KPDVV+CTKLIK  F  +K+ KAV+VM++LE++GEP+V AY ALI GFCK N++E AN V
Sbjct  101  KPDVVMCTKLIKKFFQERKSNKAVRVMEILEKYGEPDVFAYNALISGFCKANQIELANKV  160

Query  639  LNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATI  460
            L+R+RSRGF PDVVTYNIMIGS+C RG +    KV DQ+  DN CKP V+TYT+LI+AT+
Sbjct  161  LDRLRSRGFSPDVVTYNIMIGSLCSRGMIESGFKVFDQLLRDN-CKPTVITYTILIQATM  219

Query  459  VKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
            ++    +AMKL+DEM +RGL P+++T NAI++G+C++GMV +A++FVRSL + GC+PDV 
Sbjct  220  LEGQTDKAMKLLDEMFARGLIPDMFTNNAIIRGMCKKGMVGQAFQFVRSLESRGCQPDVI  279

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
            SYN+LLR LL+   W++GEKL+ EM S G EP+  TY+I +SSLCRDGK   A+ +L+  
Sbjct  280  SYNMLLRTLLNMGKWEEGEKLMTEMISRGLEPNVVTYSILISSLCRDGKTEDAVDVLRAA  339

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             EKGLTP+ ++YDPLISA+CK+GRLDLAI+ LD
Sbjct  340  KEKGLTPDAYSYDPLISAYCKDGRLDLAIEFLD  372


 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/297 (35%), Positives = 157/297 (53%), Gaps = 14/297 (5%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G+ ++ + LL  M   G  PD+     +I+G+       +A + ++ LE  G +P+V++Y
Sbjct  222  GQTDKAMKLLDEMFARGLIPDMFTNNAIIRGMCKKGMVGQAFQFVRSLESRGCQPDVISY  281

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++  M SRG  P+VVTY+I+I S+C  GK   A+ VL   KE
Sbjct  282  NMLLRTLLNMGKWEEGEKLMTEMISRGLEPNVVTYSILISSLCRDGKTEDAVDVLRAAKE  341

Query  516  DNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMV  340
                 PD  +Y  LI A   KDG +  A++ +D M+S G  P+I  YN IL   C+ G  
Sbjct  342  -KGLTPDAYSYDPLISA-YCKDGRLDLAIEFLDYMISDGCLPDIVNYNTILAAFCKNGNA  399

Query  339  DRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTF  175
            D+A E    L  +GC P+V SYN +  AL     W  G+K     ++ EM S G EP   
Sbjct  400  DQALEIFEKLSDVGCPPNVSSYNTMFSAL-----WSSGDKIRALGMISEMLSKGIEPDEI  454

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            TYN  +S LCRDG +++A+ +L  M      P   +Y+ +I  FCK  R++ AI++L
Sbjct  455  TYNSLISCLCRDGMVDEAVGLLVDMESTRFRPTVVSYNIIILGFCKTRRINEAIEVL  511


 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/297 (31%), Positives = 166/297 (56%), Gaps = 8/297 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE---P  712
            C  G  E    +   +++   KP V+  T LI+      + +KA+K++   E F     P
Sbjct  184  CSRGMIESGFKVFDQLLRDNCKPTVITYTILIQATMLEGQTDKAMKLLD--EMFARGLIP  241

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            ++    A+I G CK   V  A   +  + SRG  PDV++YN+++ ++ + GK     K++
Sbjct  242  DMFTNNAIIRGMCKKGMVGQAFQFVRSLESRGCQPDVISYNMLLRTLLNMGKWEEGEKLM  301

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLC  355
             +M      +P+VVTY++LI +++ +DG +E A+ ++     +GL P+ Y+Y+ ++   C
Sbjct  302  TEMIS-RGLEPNVVTYSILI-SSLCRDGKTEDAVDVLRAAKEKGLTPDAYSYDPLISAYC  359

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            ++G +D A EF+  + + GC PD+ +YN +L A     N D   ++ +++S +GC P+  
Sbjct  360  KDGRLDLAIEFLDYMISDGCLPDIVNYNTILAAFCKNGNADQALEIFEKLSDVGCPPNVS  419

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +YN   S+L   G   +A+ M+  M  KG+ P++ TY+ LIS  C++G +D A+ LL
Sbjct  420  SYNTMFSALWSSGDKIRALGMISEMLSKGIEPDEITYNSLISCLCRDGMVDEAVGLL  476


 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/255 (32%), Positives = 137/255 (54%), Gaps = 2/255 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK+EE   L+  M+  G +P+VV  + LI  L    K E AV V++  ++ G  P+  +Y
Sbjct  292  GKWEEGEKLMTEMISRGLEPNVVTYSILISSLCRDGKTEDAVDVLRAAKEKGLTPDAYSY  351

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  +CK  R++ A   L+ M S G  PD+V YN ++ + C  G    AL++ +++  
Sbjct  352  DPLISAYCKDGRLDLAIEFLDYMISDGCLPDIVNYNTILAAFCKNGNADQALEIFEKLS-  410

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D  C P+V +Y  +  A         A+ ++ EMLS+G+EP+  TYN+++  LCR+GMVD
Sbjct  411  DVGCPPNVSSYNTMFSALWSSGDKIRALGMISEMLSKGIEPDEITYNSLISCLCRDGMVD  470

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A   +  + +   +P V SYNI++      R  ++  ++L  M   GC+P+  TY + +
Sbjct  471  EAVGLLVDMESTRFRPTVVSYNIIILGFCKTRRINEAIEVLAAMFEKGCKPNETTYVLLI  530

Query  156  SSLCRDGKLNKAISM  112
              +   G   +A+ +
Sbjct  531  EGIGYGGWRAEAMEL  545


 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 97/195 (50%), Gaps = 2/195 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+ +  +  L YM+  G  PD+V    ++        A++A+++ + L   G  PNV
Sbjct  359  CKDGRLDLAIEFLDYMISDGCLPDIVNYNTILAAFCKNGNADQALEIFEKLSDVGCPPNV  418

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  +      +     A G+++ M S+G  PD +TYN +I  +C  G +  A+ +L  
Sbjct  419  SSYNTMFSALWSSGDKIRALGMISEMLSKGIEPDEITYNSLISCLCRDGMVDEAVGLLVD  478

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E    +P VV+Y ++I        I+EA++++  M  +G +PN  TY  +++G+   G
Sbjct  479  M-ESTRFRPTVVSYNIIILGFCKTRRINEAIEVLAAMFEKGCKPNETTYVLLIEGIGYGG  537

Query  345  MVDRAYEFVRSLPAM  301
                A E   +L +M
Sbjct  538  WRAEAMELANALVSM  552



>ref|XP_009420922.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   399 bits (1025),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 252/325 (78%), Gaps = 1/325 (0%)
 Frame = -1

Query  975  QSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCT  796
            Q  + S+  + +  Q+ DS E    + LNRSC AGK+ E+LY L+YMV  GYKPDV+LCT
Sbjct  493  QVARASSGTQASRPQIPDSGESHYVKLLNRSCKAGKFSESLYFLEYMVGKGYKPDVILCT  552

Query  795  KLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRG  616
            KLIKGLF  +K +KAV+V+ +LE  GEP+V AY ALI GFCK NR+EAA  VL RM+SRG
Sbjct  553  KLIKGLFGSRKLDKAVRVLDILEAHGEPDVFAYNALISGFCKANRIEAAIEVLGRMKSRG  612

Query  615  FFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEA  436
              PD+VTYNI+IGS+C RGKL LAL+ LD++ +D  C+P V+T+T+LIEA +++ GI +A
Sbjct  613  CPPDIVTYNILIGSLCSRGKLDLALEALDRLLDDK-CQPTVITFTILIEAALLQGGIGDA  671

Query  435  MKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRA  256
            MKL+DEM+S+GL P+ YTYNAI++G+C+EGMVD A+EF++SLP+ GC PDV SYNILLR 
Sbjct  672  MKLLDEMVSQGLRPDNYTYNAIIRGMCKEGMVDAAHEFLKSLPSRGCDPDVISYNILLRG  731

Query  255  LLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPN  76
            LL R+ W+D EKL+ EM   G +P+  TY++ ++SLC +GK+ +A  +LK M  +GL P+
Sbjct  732  LLSRKRWEDAEKLIGEMLERGLKPNNVTYSVLINSLCHEGKVERAKQLLKDMIRRGLKPD  791

Query  75   KFTYDPLISAFCKEGRLDLAIDLLD  1
             ++YDPLISA+CK+G+LDLAI+ ++
Sbjct  792  AYSYDPLISAYCKDGKLDLAIEFMN  816


 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/294 (33%), Positives = 166/294 (56%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L  L  ++    +P V+  T LI+          A+K++ +++ Q   P+ 
Sbjct  628  CSRGKLDLALEALDRLLDDKCQPTVITFTILIEAALLQGGIGDAMKLLDEMVSQGLRPDN  687

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y A+I G CK   V+AA+  L  + SRG  PDV++YNI++  +  R +   A K++ +
Sbjct  688  YTYNAIIRGMCKEGMVDAAHEFLKSLPSRGCDPDVISYNILLRGLLSRKRWEDAEKLIGE  747

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E    KP+ VTY+VLI +   +  +  A +L+ +M+ RGL+P+ Y+Y+ ++   C++G
Sbjct  748  MLE-RGLKPNNVTYSVLINSLCHEGKVERAKQLLKDMIRRGLKPDAYSYDPLISAYCKDG  806

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A EF+  + + GC PD+ +YN +L AL    N     ++L  ++  GC P+  TYN
Sbjct  807  KLDLAIEFMNYMISNGCLPDIVNYNTILSALCKSGNPYQALEVLDMLAETGCSPNVSTYN  866

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            + +  L   G  ++A+ M+  M  KG+ P++ TY+ LIS  C++G ++ AI L+
Sbjct  867  VIIGGLWNSGNRSRALEMVSEMINKGVDPDEVTYNVLISCLCRDGMVNEAIGLM  920


 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 154/297 (52%), Gaps = 6/297 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +     L+ +   G  PDV+    L++GL S K+ E A K++ ++LE+  +PN 
Sbjct  698  CKEGMVDAAHEFLKSLPSRGCDPDVISYNILLRGLLSRKRWEDAEKLIGEMLERGLKPNN  757

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C   +VE A  +L  M  RG  PD  +Y+ +I + C  GKL LA++ ++ 
Sbjct  758  VTYSVLINSLCHEGKVERAKQLLKDMIRRGLKPDAYSYDPLISAYCKDGKLDLAIEFMNY  817

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   N C PD+V Y  ++ A        +A++++D +   G  PN+ TYN I+ GL   G
Sbjct  818  MIS-NGCLPDIVNYNTILSALCKSGNPYQALEVLDMLAETGCSPNVSTYNVIIGGLWNSG  876

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               RA E V  +   G  PD  +YN+L+  L      ++   L+++M S G +P   TYN
Sbjct  877  NRSRALEMVSEMINKGVDPDEVTYNVLISCLCRDGMVNEAIGLMRDMESSGFQPMVITYN  936

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGR----LDLAIDL  7
              +  LC+  +++ AI++L  M +KG   N+ TY  L+      G     ++LA DL
Sbjct  937  TVLLGLCKVHRIDMAINILAEMMDKGCRTNETTYIILVEGIAYAGHKAEAMELAKDL  993


 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/273 (32%), Positives = 147/273 (54%), Gaps = 6/273 (2%)
 Frame = -1

Query  870   KYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYT  694
             ++E+   L+  M++ G KP+ V  + LI  L    K E+A ++++ + + G +P+  +Y 
Sbjct  737   RWEDAEKLIGEMLERGLKPNNVTYSVLINSLCHEGKVERAKQLLKDMIRRGLKPDAYSYD  796

Query  693   ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
              LI  +CK  +++ A   +N M S G  PD+V YN ++ ++C  G    AL+VLD + E 
Sbjct  797   PLISAYCKDGKLDLAIEFMNYMISNGCLPDIVNYNTILSALCKSGNPYQALEVLDMLAE-  855

Query  513   NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
               C P+V TY V+I         S A+++V EM+++G++P+  TYN ++  LCR+GMV+ 
Sbjct  856   TGCSPNVSTYNVIIGGLWNSGNRSRALEMVSEMINKGVDPDEVTYNVLISCLCRDGMVNE  915

Query  333   AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVS  154
             A   +R + + G +P V +YN +L  L      D    +L EM   GC  +  TY I V 
Sbjct  916   AIGLMRDMESSGFQPMVITYNTVLLGLCKVHRIDMAINILAEMMDKGCRTNETTYIILVE  975

Query  153   SLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPL  55
              +   G   +A+ + K +  +    N F+ D L
Sbjct  976   GIAYAGHKAEAMELAKDLAMR----NVFSEDSL  1004



>ref|XP_007144014.1| hypothetical protein PHAVU_007G121900g [Phaseolus vulgaris]
 gb|ESW16008.1| hypothetical protein PHAVU_007G121900g [Phaseolus vulgaris]
Length=570

 Score =   386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 241/308 (78%), Gaps = 4/308 (1%)
 Frame = -1

Query  924  DSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK  745
            D ++    R LNR C  GKY E LY L+ MVK GYKPDV+LCTKLIKGLF+ KK EKAV+
Sbjct  68   DFRDTHHMRALNRLCRTGKYTEALYFLEQMVKRGYKPDVILCTKLIKGLFTSKKTEKAVQ  127

Query  744  VMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            VM++LEQ G+P+  AY A+I GFC+++R +AANGVL RM++RGF PDVVTYNI+IGS+C 
Sbjct  128  VMEILEQHGDPDAFAYNAVISGFCRSDRFDAANGVLLRMKNRGFSPDVVTYNILIGSLCA  187

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
            RGKL LA+KV+DQ+ +D NC P V+TYT+LIEATI+   I +AMKL+DEM+SRGL+P++Y
Sbjct  188  RGKLDLAMKVMDQLMKD-NCNPTVITYTILIEATIIHGVIDKAMKLLDEMVSRGLQPDMY  246

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN I++G+C+ G+VDRA+EFV +L      P +  YN++L+ LL+   W  GE+L+ +M
Sbjct  247  TYNVIVRGMCKRGLVDRAFEFVCNLST---TPSLNLYNLVLKGLLNEGRWKTGERLMSDM  303

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
               GCEP+  TY++ ++SLCRDGK  +A+ +LK+M EKGL+P+ + YDPLISAFCKEG++
Sbjct  304  MVKGCEPNVVTYSVLINSLCRDGKTGEAVDLLKVMKEKGLSPDAYCYDPLISAFCKEGKV  363

Query  24   DLAIDLLD  1
            DLAI  +D
Sbjct  364  DLAIGFVD  371


 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/326 (31%), Positives = 167/326 (51%), Gaps = 34/326 (10%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C + +++    +L  M   G+ PDVV    LI  L +  K + A+KVM QL++    P V
Sbjct  151  CRSDRFDAANGVLLRMKNRGFSPDVVTYNILIGSLCARGKLDLAMKVMDQLMKDNCNPTV  210

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLAL-----  541
            + YT LI        ++ A  +L+ M SRG  PD+ TYN+++  +C RG +  A      
Sbjct  211  ITYTILIEATIIHGVIDKAMKLLDEMVSRGLQPDMYTYNVIVRGMCKRGLVDRAFEFVCN  270

Query  540  -----------------------KVLDQMKED---NNCKPDVVTYTVLIEATIVKDG-IS  442
                                   K  +++  D     C+P+VVTY+VLI  ++ +DG   
Sbjct  271  LSTTPSLNLYNLVLKGLLNEGRWKTGERLMSDMMVKGCEPNVVTYSVLIN-SLCRDGKTG  329

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            EA+ L+  M  +GL P+ Y Y+ ++   C+EG VD A  FV  + + G  PD+ +YN ++
Sbjct  330  EAVDLLKVMKEKGLSPDAYCYDPLISAFCKEGKVDLAIGFVDDMVSAGWLPDIINYNTIM  389

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
             +L  +   D+   + K++  +GC P+  +YN  + +L   G   +A+ M+  M   GL 
Sbjct  390  GSLCKKGRGDEALSIFKKLDEVGCPPNVSSYNTMLGALWSSGDKIRALRMVLEMLNNGLD  449

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLL  4
            P++ TY+ LIS  C++G +D AI LL
Sbjct  450  PDRITYNSLISCLCRDGMVDEAIGLL  475


 Score =   152 bits (384),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 153/295 (52%), Gaps = 13/295 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYT  694
            G  ++ + LL  MV  G +PD+     +++G+      ++A + +  L     P++  Y 
Sbjct  224  GVIDKAMKLLDEMVSRGLQPDMYTYNVIVRGMCKRGLVDRAFEFVCNLST--TPSLNLYN  281

Query  693  ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
             ++ G     R +    +++ M  +G  P+VVTY+++I S+C  GK G A+ +L  MKE 
Sbjct  282  LVLKGLLNEGRWKTGERLMSDMMVKGCEPNVVTYSVLINSLCRDGKTGEAVDLLKVMKE-  340

Query  513  NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
                PD   Y  LI A   +  +  A+  VD+M+S G  P+I  YN I+  LC++G  D 
Sbjct  341  KGLSPDAYCYDPLISAFCKEGKVDLAIGFVDDMVSAGWLPDIINYNTIMGSLCKKGRGDE  400

Query  333  AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFTY  169
            A    + L  +GC P+V SYN +L AL     W  G+K     ++ EM + G +P   TY
Sbjct  401  ALSIFKKLDEVGCPPNVSSYNTMLGAL-----WSSGDKIRALRMVLEMLNNGLDPDRITY  455

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N  +S LCRDG +++AI +L  M      P   +Y+ ++   CK  R+  AI++L
Sbjct  456  NSLISCLCRDGMVDEAIGLLVDMERSEWQPTVISYNIVLLGLCKAHRIVDAIEVL  510


 Score =   147 bits (371),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 143/261 (55%), Gaps = 2/261 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G+++    L+  M+  G +P+VV  + LI  L    K  +AV +++++++ G  P+   Y
Sbjct  291  GRWKTGERLMSDMMVKGCEPNVVTYSVLINSLCRDGKTGEAVDLLKVMKEKGLSPDAYCY  350

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  FCK  +V+ A G ++ M S G+ PD++ YN ++GS+C +G+   AL +  ++ E
Sbjct  351  DPLISAFCKEGKVDLAIGFVDDMVSAGWLPDIINYNTIMGSLCKKGRGDEALSIFKKLDE  410

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
               C P+V +Y  ++ A         A+++V EML+ GL+P+  TYN+++  LCR+GMVD
Sbjct  411  -VGCPPNVSSYNTMLGALWSSGDKIRALRMVLEMLNNGLDPDRITYNSLISCLCRDGMVD  469

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A   +  +     +P V SYNI+L  L       D  ++L  M   GC+P+  TY + V
Sbjct  470  EAIGLLVDMERSEWQPTVISYNIVLLGLCKAHRIVDAIEVLAVMVDNGCQPNQTTYTLLV  529

Query  156  SSLCRDGKLNKAISMLKIMTE  94
              +   G  + A+ + K ++ 
Sbjct  530  EGISYAGWPSDAVELAKSLSS  550


 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 134/281 (48%), Gaps = 2/281 (1%)
 Frame = -1

Query  846  LQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNVLAYTALIGGFCK  670
             +++  +   P + L   ++KGL +  + +   ++M  ++ +  EPNV+ Y+ LI   C+
Sbjct  265  FEFVCNLSTTPSLNLYNLVLKGLLNEGRWKTGERLMSDMMVKGCEPNVVTYSVLINSLCR  324

Query  669  TNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVV  490
              +   A  +L  M+ +G  PD   Y+ +I + C  GK+ LA+  +D M       PD++
Sbjct  325  DGKTGEAVDLLKVMKEKGLSPDAYCYDPLISAFCKEGKVDLAIGFVDDMVS-AGWLPDII  383

Query  489  TYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSL  310
             Y  ++ +   K    EA+ +  ++   G  PN+ +YN +L  L   G   RA   V  +
Sbjct  384  NYNTIMGSLCKKGRGDEALSIFKKLDEVGCPPNVSSYNTMLGALWSSGDKIRALRMVLEM  443

Query  309  PAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKL  130
               G  PD  +YN L+  L      D+   LL +M     +P   +YNI +  LC+  ++
Sbjct  444  LNNGLDPDRITYNSLISCLCRDGMVDEAIGLLVDMERSEWQPTVISYNIVLLGLCKAHRI  503

Query  129  NKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
              AI +L +M + G  PN+ TY  L+      G    A++L
Sbjct  504  VDAIEVLAVMVDNGCQPNQTTYTLLVEGISYAGWPSDAVEL  544


 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 102/196 (52%), Gaps = 4/196 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK +  +  +  MV  G+ PD++    ++  L    + ++A+ + + L++ G  PNV
Sbjct  358  CKEGKVDLAIGFVDDMVSAGWLPDIINYNTIMGSLCKKGRGDEALSIFKKLDEVGCPPNV  417

Query  705  LAYTALIGGFCKT-NRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
             +Y  ++G    + +++ A   VL  M + G  PD +TYN +I  +C  G +  A+ +L 
Sbjct  418  SSYNTMLGALWSSGDKIRALRMVL-EMLNNGLDPDRITYNSLISCLCRDGMVDEAIGLLV  476

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
             M E +  +P V++Y +++        I +A++++  M+  G +PN  TY  +++G+   
Sbjct  477  DM-ERSEWQPTVISYNIVLLGLCKAHRIVDAIEVLAVMVDNGCQPNQTTYTLLVEGISYA  535

Query  348  GMVDRAYEFVRSLPAM  301
            G    A E  +SL +M
Sbjct  536  GWPSDAVELAKSLSSM  551



>ref|XP_006375855.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP53652.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=479

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 169/279 (61%), Positives = 231/279 (83%), Gaps = 0/279 (0%)
 Frame = -1

Query  837  MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRV  658
            MV   Y+PDV+LCTKLIKG F+ +  +KA +VM +LE+ G+P+V AY A+I GFCK NR+
Sbjct  1    MVAKDYQPDVILCTKLIKGFFNSRNIDKATRVMGILEKHGKPDVFAYNAVISGFCKANRI  60

Query  657  EAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTV  478
            E+A  VL+RM+ +GF PDVVT+NIMIG+ C +GK+ LALKV +++ +DNNCKP ++TYT+
Sbjct  61   ESAKTVLDRMKRKGFSPDVVTHNIMIGTFCGKGKIDLALKVFEELLKDNNCKPTLITYTI  120

Query  477  LIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMG  298
            LIEA I++ GI EA+KL+DEMLSRGLEP+ +TYN I +GLC+EG VDRA+EFVR+L + G
Sbjct  121  LIEAYILEGGIDEALKLLDEMLSRGLEPDTFTYNVITRGLCKEGKVDRAFEFVRTLNSRG  180

Query  297  CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAI  118
            CKPDV +YNILLRALL++  WD+GEK + E+ S GCEP+  TY+I +SSLCRDGK+ +++
Sbjct  181  CKPDVITYNILLRALLNQGKWDEGEKWMSEIFSRGCEPNVVTYSILISSLCRDGKIEESV  240

Query  117  SMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +++K+M EKGLTP+ + YDPLI+AFC+EG+LD+AI+ LD
Sbjct  241  NLVKVMKEKGLTPDAYCYDPLIAAFCREGKLDMAIEFLD  279


 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 170/296 (57%), Gaps = 5/296 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGY-KPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPN  709
            CG GK +  L + + ++K    KP ++  T LI+        ++A+K++ ++L +  EP+
Sbjct  90   CGKGKIDLALKVFEELLKDNNCKPTLITYTILIEAYILEGGIDEALKLLDEMLSRGLEPD  149

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
               Y  +  G CK  +V+ A   +  + SRG  PDV+TYNI++ ++ ++GK     K + 
Sbjct  150  TFTYNVITRGLCKEGKVDRAFEFVRTLNSRGCKPDVITYNILLRALLNQGKWDEGEKWMS  209

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++     C+P+VVTY++LI +++ +DG I E++ LV  M  +GL P+ Y Y+ ++   CR
Sbjct  210  EIFS-RGCEPNVVTYSILI-SSLCRDGKIEESVNLVKVMKEKGLTPDAYCYDPLIAAFCR  267

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            EG +D A EF+  +   G  PD+ +YN ++ AL    N D   ++  ++  +GC P+  +
Sbjct  268  EGKLDMAIEFLDCMICDGFLPDIVNYNTIMAALCKNGNGDHAVEIFGKLDEVGCPPNVSS  327

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S+L   G   +A+ M+  M  KG+ P+  TY+ LIS  C++G +D AI LL
Sbjct  328  YNTMLSALWSSGDRYRALGMISQMLSKGIDPDVITYNSLISCLCRDGMVDEAIGLL  383


 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 154/296 (52%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G +PD      + +GL    K ++A + ++ L   G +P+V+ Y
Sbjct  129  GGIDEALKLLDEMLSRGLEPDTFTYNVITRGLCKEGKVDRAFEFVRTLNSRGCKPDVITY  188

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + +     ++ + SRG  P+VVTY+I+I S+C  GK+  ++ ++  MKE
Sbjct  189  NILLRALLNQGKWDEGEKWMSEIFSRGCEPNVVTYSILISSLCRDGKIEESVNLVKVMKE  248

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD   Y  LI A   +  +  A++ +D M+  G  P+I  YN I+  LC+ G  D
Sbjct  249  -KGLTPDAYCYDPLIAAFCREGKLDMAIEFLDCMICDGFLPDIVNYNTIMAALCKNGNGD  307

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
             A E    L  +GC P+V SYN +L AL     W  G++     ++ +M S G +P   T
Sbjct  308  HAVEIFGKLDEVGCPPNVSSYNTMLSAL-----WSSGDRYRALGMISQMLSKGIDPDVIT  362

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +++AI +L  M      PN  +Y  ++   CK  R+D AI++L
Sbjct  363  YNSLISCLCRDGMVDEAIGLLADMLSGRFQPNIVSYKTVLLGLCKAHRIDDAIEVL  418


 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 139/281 (49%), Gaps = 2/281 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +     ++ +   G KPDV+    L++ L +  K ++  K M ++  +  EPNV
Sbjct  161  CKEGKVDRAFEFVRTLNSRGCKPDVITYNILLRALLNQGKWDEGEKWMSEIFSRGCEPNV  220

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  ++E +  ++  M+ +G  PD   Y+ +I + C  GKL +A++ LD 
Sbjct  221  VTYSILISSLCRDGKIEESVNLVKVMKEKGLTPDAYCYDPLIAAFCREGKLDMAIEFLDC  280

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M  D    PD+V Y  ++ A         A+++  ++   G  PN+ +YN +L  L   G
Sbjct  281  MICDGFL-PDIVNYNTIMAALCKNGNGDHAVEIFGKLDEVGCPPNVSSYNTMLSALWSSG  339

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               RA   +  + + G  PDV +YN L+  L      D+   LL +M S   +P+  +Y 
Sbjct  340  DRYRALGMISQMLSKGIDPDVITYNSLISCLCRDGMVDEAIGLLADMLSGRFQPNIVSYK  399

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAF  43
              +  LC+  +++ AI +L  M E G  PN+ TY  LI   
Sbjct  400  TVLLGLCKAHRIDDAIEVLAAMIENGCQPNETTYTLLIEGI  440



>gb|EYU19809.1| hypothetical protein MIMGU_mgv1a005320mg [Erythranthe guttata]
Length=489

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/279 (62%), Positives = 233/279 (84%), Gaps = 1/279 (0%)
 Frame = -1

Query  837  MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRV  658
            M+  G+K DV+LCTKLIKG F+ K  +KAVKVM +LE++GEP++ AY A I G CK NR+
Sbjct  1    MMNSGHKADVILCTKLIKGFFNSKSVDKAVKVMDILERYGEPDIFAYNAYISGLCKVNRI  60

Query  657  EAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTV  478
            ++ANGVL+RMR+RGF PD+VTYNI+IGS+C+RGKL +AL++LDQ+ +D  C P V+TYT+
Sbjct  61   DSANGVLSRMRARGFSPDIVTYNILIGSLCNRGKLDMALEMLDQLMDDR-CLPTVITYTI  119

Query  477  LIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMG  298
            LIEATI++ GI EAMKL DE+LSRGL+P++YTYN +++G+CREG++D A++FVRSL +  
Sbjct  120  LIEATILEGGIGEAMKLFDEILSRGLKPDMYTYNTVIRGMCREGLMDEAFDFVRSLTSRN  179

Query  297  CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAI  118
            CKPDV SYNILLRALL++  WDDG +L+ EM S  CE +  TY+I +S+LCR+G+L++AI
Sbjct  180  CKPDVISYNILLRALLNQGKWDDGAELINEMFSNRCEFNVVTYSIMISALCREGQLDEAI  239

Query  117  SMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            ++LKIM ++GLTP+ +T+DPLISA C+EGRLDLAI  LD
Sbjct  240  NLLKIMIDEGLTPDTYTFDPLISALCREGRLDLAIAFLD  278


 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/294 (32%), Positives = 166/294 (56%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +L  ++     P V+  T LI+         +A+K+  ++L +  +P++
Sbjct  90   CNRGKLDMALEMLDQLMDDRCLPTVITYTILIEATILEGGIGEAMKLFDEILSRGLKPDM  149

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G C+   ++ A   +  + SR   PDV++YNI++ ++ ++GK     +++++
Sbjct  150  YTYNTVIRGMCREGLMDEAFDFVRSLTSRNCKPDVISYNILLRALLNQGKWDDGAELINE  209

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   N C+ +VVTY+++I A   +  + EA+ L+  M+  GL P+ YT++ ++  LCREG
Sbjct  210  MFS-NRCEFNVVTYSIMISALCREGQLDEAINLLKIMIDEGLTPDTYTFDPLISALCREG  268

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A  F+  + + GC PD+ +YN +L AL      ++  ++  ++   GC P   TYN
Sbjct  269  RLDLAIAFLDYMISSGCFPDIVNYNTILSALCKNGKSEEAMEVFSKLDESGCPPDVSTYN  328

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              VS+L  +G   +A  +L  M  KG++P+  TY+ LIS  C+EG +D AI+LL
Sbjct  329  TMVSALWNNGDRIRAYRLLSDMFTKGISPDGITYNSLISCLCREGMVDGAIELL  382


 Score =   145 bits (367),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 93/297 (31%), Positives = 150/297 (51%), Gaps = 12/297 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK-VMQLLEQFGEPNVLAY  697
            G   E + L   ++  G KPD+     +I+G+      ++A   V  L  +  +P+V++Y
Sbjct  128  GGIGEAMKLFDEILSRGLKPDMYTYNTVIRGMCREGLMDEAFDFVRSLTSRNCKPDVISY  187

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + +    ++N M S     +VVTY+IMI ++C  G+L  A+ +L  M  
Sbjct  188  NILLRALLNQGKWDDGAELINEMFSNRCEFNVVTYSIMISALCREGQLDEAINLLKIMI-  246

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D    PD  T+  LI A   +  +  A+  +D M+S G  P+I  YN IL  LC+ G  +
Sbjct  247  DEGLTPDTYTFDPLISALCREGRLDLAIAFLDYMISSGCFPDIVNYNTILSALCKNGKSE  306

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGE-----KLLKEMSSMGCEPHTFT  172
             A E    L   GC PDV +YN ++ AL     W++G+     +LL +M + G  P   T
Sbjct  307  EAMEVFSKLDESGCPPDVSTYNTMVSAL-----WNNGDRIRAYRLLSDMFTKGISPDGIT  361

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            YN  +S LCR+G ++ AI +L  M + G  P   TY+ ++   CK  R+  A+ +L+
Sbjct  362  YNSLISCLCREGMVDGAIELLGDMRKIGFLPTVVTYNIVLLGLCKAHRIGDAVLMLE  418


 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/284 (30%), Positives = 150/284 (53%), Gaps = 6/284 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LN+    GK+++   L+  M     + +VV  + +I  L    + ++A+ +
Sbjct  186  SYNILLRALLNQ----GKWDDGAELINEMFSNRCEFNVVTYSIMISALCREGQLDEAINL  241

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++++   G  P+   +  LI   C+  R++ A   L+ M S G FPD+V YN ++ ++C 
Sbjct  242  LKIMIDEGLTPDTYTFDPLISALCREGRLDLAIAFLDYMISSGCFPDIVNYNTILSALCK  301

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             GK   A++V  ++ E + C PDV TY  ++ A         A +L+ +M ++G+ P+  
Sbjct  302  NGKSEEAMEVFSKLDE-SGCPPDVSTYNTMVSALWNNGDRIRAYRLLSDMFTKGISPDGI  360

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCREGMVD A E +  +  +G  P V +YNI+L  L       D   +L+EM
Sbjct  361  TYNSLISCLCREGMVDGAIELLGDMRKIGFLPTVVTYNIVLLGLCKAHRIGDAVLMLEEM  420

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNK  73
               GC+P+  +Y + V  +   G   +A+ +   + EKG+  N+
Sbjct  421  VEKGCQPNETSYVLLVEGIGFAGWRVEAMELANTLCEKGVISNQ  464


 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/286 (30%), Positives = 144/286 (50%), Gaps = 4/286 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +E    ++ +     KPDV+    L++ L +  K +   +++ ++     E NV
Sbjct  160  CREGLMDEAFDFVRSLTSRNCKPDVISYNILLRALLNQGKWDDGAELINEMFSNRCEFNV  219

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ +I   C+  +++ A  +L  M   G  PD  T++ +I ++C  G+L LA+  LD 
Sbjct  220  VTYSIMISALCREGQLDEAINLLKIMIDEGLTPDTYTFDPLISALCREGRLDLAIAFLDY  279

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGIS-EAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M   + C PD+V Y  ++ A + K+G S EAM++  ++   G  P++ TYN ++  L   
Sbjct  280  MIS-SGCFPDIVNYNTILSA-LCKNGKSEEAMEVFSKLDESGCPPDVSTYNTMVSALWNN  337

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RAY  +  +   G  PD  +YN L+  L      D   +LL +M  +G  P   TY
Sbjct  338  GDRIRAYRLLSDMFTKGISPDGITYNSLISCLCREGMVDGAIELLGDMRKIGFLPTVVTY  397

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG  31
            NI +  LC+  ++  A+ ML+ M EKG  PN+ +Y  L+      G
Sbjct  398  NIVLLGLCKAHRIGDAVLMLEEMVEKGCQPNETSYVLLVEGIGFAG  443



>gb|EPS74045.1| hypothetical protein M569_00706, partial [Genlisea aurea]
Length=515

 Score =   373 bits (958),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 229/308 (74%), Gaps = 0/308 (0%)
 Frame = -1

Query  924  DSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK  745
            D  E    + L RSC +G Y+E LY L+ +V +G++ D VLCTKL+KG  S K  +KAV+
Sbjct  1    DFNETRFLKLLKRSCKSGNYDEGLYFLEKLVSLGFRADAVLCTKLVKGFLSSKSVDKAVR  60

Query  744  VMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            VM +LE+ GEP+V AY A+I G CK  R++AA GVLN MR+RG  PDVVTYNI+IGS+C 
Sbjct  61   VMGILERHGEPDVYAYNAVINGLCKAGRIDAAKGVLNAMRNRGISPDVVTYNILIGSLCS  120

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
            RGKL  A+K+LDQ+ ED  C+P VVTYT+LIEATI + GI  A+K++++M SRGL P++Y
Sbjct  121  RGKLSSAMKMLDQLTEDRFCRPTVVTYTILIEATIRETGIEGAVKVLEQMSSRGLRPDMY  180

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN +++G+CREG+V  A EFV SL   G +PDV +YN+LLRA L+R  WDDGEK+L EM
Sbjct  181  TYNTVIRGMCREGLVSEASEFVSSLKGSGIEPDVVTYNVLLRAFLNRDEWDDGEKVLSEM  240

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
             S  C P+  T++I VS LCR G L +AI +LK+M ++G TP+ +TYDPL+S  C+EGR+
Sbjct  241  FSSKCRPNVVTFSIIVSHLCRYGLLEEAIGLLKLMIDEGYTPDSYTYDPLVSGLCREGRI  300

Query  24   DLAIDLLD  1
            D AI L+D
Sbjct  301  DAAIGLMD  308


 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/336 (30%), Positives = 161/336 (48%), Gaps = 40/336 (12%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLL--EQF  721
            +N  C AG+ +    +L  M   G  PDVV    LI  L S  K   A+K++  L  ++F
Sbjct  80   INGLCKAGRIDAAKGVLNAMRNRGISPDVVTYNILIGSLCSRGKLSSAMKMLDQLTEDRF  139

Query  720  GEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLAL  541
              P V+ YT LI    +   +E A  VL +M SRG  PD+ TYN +I  +C  G +  A 
Sbjct  140  CRPTVVTYTILIEATIRETGIEGAVKVLEQMSSRGLRPDMYTYNTVIRGMCREGLVSEAS  199

Query  540  KVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
            + +  +K  +  +PDVVTY VL+ A + +D   +  K++ EM S    PN+ T++ I+  
Sbjct  200  EFVSSLK-GSGIEPDVVTYNVLLRAFLNRDEWDDGEKVLSEMFSSKCRPNVVTFSIIVSH  258

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            LCR G+++ A   ++ +   G  PD ++Y+ L+  L      D    L+  M S GC P 
Sbjct  259  LCRYGLLEEAIGLLKLMIDEGYTPDSYTYDPLVSGLCREGRIDAAIGLMDHMISNGCLPD  318

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKI----------------------------------  103
               YN  +S+LC++G   +A+ + +                                   
Sbjct  319  IVNYNAVLSALCKNGDAREALRVFRKLEAAAGPAAADVGTYNTMISALWNGGDGSAAAGL  378

Query  102  ---MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               M  +G+ P+  TY+ ++S  C+EG +D A++LL
Sbjct  379  VGEMVRRGVDPDGITYNSIVSCLCREGSVDGAMELL  414


 Score =   155 bits (391),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 99/335 (30%), Positives = 165/335 (49%), Gaps = 43/335 (13%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGY-KPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            C  GK    + +L  + +  + +P VV  T LI+        E AVKV++ +   G  P+
Sbjct  119  CSRGKLSSAMKMLDQLTEDRFCRPTVVTYTILIEATIRETGIEGAVKVLEQMSSRGLRPD  178

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            +  Y  +I G C+   V  A+  ++ ++  G  PDVVTYN+++ +  +R +     KVL 
Sbjct  179  MYTYNTVIRGMCREGLVSEASEFVSSLKGSGIEPDVVTYNVLLRAFLNRDEWDDGEKVLS  238

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M   + C+P+VVT+++++        + EA+ L+  M+  G  P+ YTY+ ++ GLCRE
Sbjct  239  EMFS-SKCRPNVVTFSIIVSHLCRYGLLEEAIGLLKLMIDEGYTPDSYTYDPLVSGLCRE  297

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALL---DRRN--------------------  238
            G +D A   +  + + GC PD+ +YN +L AL    D R                     
Sbjct  298  GRIDAAIGLMDHMISNGCLPDIVNYNAVLSALCKNGDAREALRVFRKLEAAAGPAAADVG  357

Query  237  ---------WDDGEK-----LLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
                     W+ G+      L+ EM   G +P   TYN  VS LCR+G ++ A+ +L  M
Sbjct  358  TYNTMISALWNGGDGSAAAGLVGEMVRRGVDPDGITYNSIVSCLCREGSVDGAMELLGDM  417

Query  99   TEKG---LTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               G   L P+  TY+ ++   CK  R+D A+++L
Sbjct  418  RRSGARDLRPSVVTYNAVLLGLCKAHRMDEAVEVL  452


 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/279 (29%), Positives = 142/279 (51%), Gaps = 11/279 (4%)
 Frame = -1

Query  906  IRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLE  727
            +R  LNR     ++++   +L  M     +P+VV  + ++  L      E+A+ +++L+ 
Sbjct  221  LRAFLNRD----EWDDGEKVLSEMFSSKCRPNVVTFSIIVSHLCRYGLLEEAIGLLKLMI  276

Query  726  QFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLG  550
              G  P+   Y  L+ G C+  R++AA G+++ M S G  PD+V YN ++ ++C  G   
Sbjct  277  DEGYTPDSYTYDPLVSGLCREGRIDAAIGLMDHMISNGCLPDIVNYNAVLSALCKNGDAR  336

Query  549  LALKVLDQMKEDNNCKP-DVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNA  373
             AL+V  +++        DV TY  +I A       S A  LV EM+ RG++P+  TYN+
Sbjct  337  EALRVFRKLEAAAGPAAADVGTYNTMISALWNGGDGSAAAGLVGEMVRRGVDPDGITYNS  396

Query  372  ILKGLCREGMVDRAYEFVRSLPAMGC---KPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            I+  LCREG VD A E +  +   G    +P V +YN +L  L      D+  ++L EM 
Sbjct  397  IVSCLCREGSVDGAMELLGDMRRSGARDLRPSVVTYNAVLLGLCKAHRMDEAVEVLAEMV  456

Query  201  SMG--CEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
              G  CEP+  ++ + +  +   G   +A+ +   + ++
Sbjct  457  EGGGDCEPNETSFVLLIEGIGFSGWPVEAMEIASCLHQR  495


 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 132/292 (45%), Gaps = 9/292 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G   E    +  +   G +PDVV    L++   +  + +   KV+ ++      PNV
Sbjct  190  CREGLVSEASEFVSSLKGSGIEPDVVTYNVLLRAFLNRDEWDDGEKVLSEMFSSKCRPNV  249

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + ++ ++   C+   +E A G+L  M   G+ PD  TY+ ++  +C  G++  A+ ++D 
Sbjct  250  VTFSIIVSHLCRYGLLEEAIGLLKLMIDEGYTPDSYTYDPLVSGLCREGRIDAAIGLMDH  309

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVD--EMLSRGLEPNIYTYNAILKGLCR  352
            M   N C PD+V Y  ++ A        EA+++    E  +     ++ TYN ++  L  
Sbjct  310  MIS-NGCLPDIVNYNAVLSALCKNGDAREALRVFRKLEAAAGPAAADVGTYNTMISALWN  368

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCE---PH  181
             G    A   V  +   G  PD  +YN ++  L    + D   +LL +M   G     P 
Sbjct  369  GGDGSAAAGLVGEMVRRGVDPDGITYNSIVSCLCREGSVDGAMELLGDMRRSGARDLRPS  428

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKG--LTPNKFTYDPLISAFCKEG  31
              TYN  +  LC+  ++++A+ +L  M E G    PN+ ++  LI      G
Sbjct  429  VVTYNAVLLGLCKAHRMDEAVEVLAEMVEGGGDCEPNETSFVLLIEGIGFSG  480



>ref|XP_003555568.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Glycine max]
Length=576

 Score =   371 bits (953),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 246/323 (76%), Gaps = 4/323 (1%)
 Frame = -1

Query  969  VKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKL  790
             +V++ +     Q  D ++    + LNR C  GKY E LY L+ MVK GYKPDV+LCTKL
Sbjct  59   TRVTSSDTRPQQQHYDFRDTHHMKALNRLCKTGKYTEALYFLEQMVKRGYKPDVILCTKL  118

Query  789  IKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFF  610
            IKGLF+ K+ EKAV+VM++LEQ+G+P+  AY A+I GFC+++R +AAN V+ RM+ RGF 
Sbjct  119  IKGLFTSKRTEKAVRVMEILEQYGDPDSFAYNAVISGFCRSDRFDAANRVILRMKYRGFS  178

Query  609  PDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMK  430
            PDVVTYNI+IGS+C RGKL LALKV+DQ+ ED NC P V+TYT+LIEATI+   I +AM+
Sbjct  179  PDVVTYNILIGSLCARGKLDLALKVMDQLLED-NCNPTVITYTILIEATIIHGSIDDAMR  237

Query  429  LVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALL  250
            L+DEM+SRGL+P++YTYN I++G+C+ G+VDRA+EFV +L      P +  YN+LL+ LL
Sbjct  238  LLDEMMSRGLQPDMYTYNVIVRGMCKRGLVDRAFEFVSNL---NTTPSLNLYNLLLKGLL  294

Query  249  DRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKF  70
            +   W+ GE+L+ +M   GCEP+  TY++ +SSLCRDGK  +A+ +L++M EKGL P+ +
Sbjct  295  NEGRWEAGERLMSDMIVKGCEPNIVTYSVLISSLCRDGKAGEAVDVLRVMKEKGLNPDAY  354

Query  69   TYDPLISAFCKEGRLDLAIDLLD  1
             YDPLISAFCKEG++DLAI  +D
Sbjct  355  CYDPLISAFCKEGKVDLAIGFVD  377


 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/326 (30%), Positives = 167/326 (51%), Gaps = 34/326 (10%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C + +++    ++  M   G+ PDVV    LI  L +  K + A+KVM QLLE    P V
Sbjct  157  CRSDRFDAANRVILRMKYRGFSPDVVTYNILIGSLCARGKLDLALKVMDQLLEDNCNPTV  216

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI        ++ A  +L+ M SRG  PD+ TYN+++  +C RG +  A + +  
Sbjct  217  ITYTILIEATIIHGSIDDAMRLLDEMMSRGLQPDMYTYNVIVRGMCKRGLVDRAFEFVSN  276

Query  525  MKED-------------------------------NNCKPDVVTYTVLIEATIVKDG-IS  442
            +                                    C+P++VTY+VLI +++ +DG   
Sbjct  277  LNTTPSLNLYNLLLKGLLNEGRWEAGERLMSDMIVKGCEPNIVTYSVLI-SSLCRDGKAG  335

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            EA+ ++  M  +GL P+ Y Y+ ++   C+EG VD A  FV  + + G  PD+ +YN ++
Sbjct  336  EAVDVLRVMKEKGLNPDAYCYDPLISAFCKEGKVDLAIGFVDDMISAGWLPDIVNYNTIM  395

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
             +L  +   D+   + K++  +GC P+  +YN    +L   G   +A++M+  M   G+ 
Sbjct  396  GSLCKKGRADEALNIFKKLEEVGCPPNASSYNTMFGALWSSGDKIRALTMILEMLSNGVD  455

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLL  4
            P++ TY+ LIS+ C++G +D AI LL
Sbjct  456  PDRITYNSLISSLCRDGMVDEAIGLL  481


 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 153/295 (52%), Gaps = 13/295 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYT  694
            G  ++ + LL  M+  G +PD+     +++G+      ++A + +  L     P++  Y 
Sbjct  230  GSIDDAMRLLDEMMSRGLQPDMYTYNVIVRGMCKRGLVDRAFEFVSNLNT--TPSLNLYN  287

Query  693  ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
             L+ G     R EA   +++ M  +G  P++VTY+++I S+C  GK G A+ VL  MKE 
Sbjct  288  LLLKGLLNEGRWEAGERLMSDMIVKGCEPNIVTYSVLISSLCRDGKAGEAVDVLRVMKE-  346

Query  513  NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
                PD   Y  LI A   +  +  A+  VD+M+S G  P+I  YN I+  LC++G  D 
Sbjct  347  KGLNPDAYCYDPLISAFCKEGKVDLAIGFVDDMISAGWLPDIVNYNTIMGSLCKKGRADE  406

Query  333  AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFTY  169
            A    + L  +GC P+  SYN +  AL     W  G+K     ++ EM S G +P   TY
Sbjct  407  ALNIFKKLEEVGCPPNASSYNTMFGAL-----WSSGDKIRALTMILEMLSNGVDPDRITY  461

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N  +SSLCRDG +++AI +L  M      P   +Y+ ++   CK  R+  AI++L
Sbjct  462  NSLISSLCRDGMVDEAIGLLVDMERTEWQPTVISYNIVLLGLCKAHRIVDAIEVL  516


 Score =   150 bits (379),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 140/257 (54%), Gaps = 2/257 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G++E    L+  M+  G +P++V  + LI  L    KA +AV V++++++ G  P+   Y
Sbjct  297  GRWEAGERLMSDMIVKGCEPNIVTYSVLISSLCRDGKAGEAVDVLRVMKEKGLNPDAYCY  356

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  FCK  +V+ A G ++ M S G+ PD+V YN ++GS+C +G+   AL +  ++ E
Sbjct  357  DPLISAFCKEGKVDLAIGFVDDMISAGWLPDIVNYNTIMGSLCKKGRADEALNIFKKL-E  415

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            +  C P+  +Y  +  A         A+ ++ EMLS G++P+  TYN+++  LCR+GMVD
Sbjct  416  EVGCPPNASSYNTMFGALWSSGDKIRALTMILEMLSNGVDPDRITYNSLISSLCRDGMVD  475

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A   +  +     +P V SYNI+L  L       D  ++L  M   GC+P+  TY + V
Sbjct  476  EAIGLLVDMERTEWQPTVISYNIVLLGLCKAHRIVDAIEVLAVMVDNGCQPNETTYTLLV  535

Query  156  SSLCRDGKLNKAISMLK  106
              +   G  + A+ + K
Sbjct  536  EGVGYAGWRSYAVELAK  552


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 101/196 (52%), Gaps = 4/196 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK +  +  +  M+  G+ PD+V    ++  L    +A++A+ + + LE+ G  PN 
Sbjct  364  CKEGKVDLAIGFVDDMISAGWLPDIVNYNTIMGSLCKKGRADEALNIFKKLEEVGCPPNA  423

Query  705  LAYTALIGGFCKT-NRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
             +Y  + G    + +++ A   +L  M S G  PD +TYN +I S+C  G +  A+ +L 
Sbjct  424  SSYNTMFGALWSSGDKIRALTMIL-EMLSNGVDPDRITYNSLISSLCRDGMVDEAIGLLV  482

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
             M E    +P V++Y +++        I +A++++  M+  G +PN  TY  +++G+   
Sbjct  483  DM-ERTEWQPTVISYNIVLLGLCKAHRIVDAIEVLAVMVDNGCQPNETTYTLLVEGVGYA  541

Query  348  GMVDRAYEFVRSLPAM  301
            G    A E  +SL +M
Sbjct  542  GWRSYAVELAKSLVSM  557



>ref|XP_009612668.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=458

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 213/247 (86%), Gaps = 0/247 (0%)
 Frame = -1

Query  741  MQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
            MQ+LEQFGEP+V AY ALI GFCK N++  AN VLNRM+S GF PD VTYNI+IGS+CDR
Sbjct  1    MQILEQFGEPDVFAYNALISGFCKMNKIVEANKVLNRMKSHGFPPDAVTYNILIGSLCDR  60

Query  561  GKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYT  382
            GKLGLALK+LDQ+KE+ NCKP V+TYT+LIEATI++ GI EAMKL+DEMLS GL+P++YT
Sbjct  61   GKLGLALKLLDQLKEEKNCKPTVITYTILIEATILEGGIHEAMKLLDEMLSTGLQPDMYT  120

Query  381  YNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            YNAI++G+CRE M D+AYEFVRSLP+ GCKPDV SYNILLRALL +  W DGEKL+ EM 
Sbjct  121  YNAIIRGMCREKMTDQAYEFVRSLPSKGCKPDVISYNILLRALLHKGKWSDGEKLVNEMF  180

Query  201  SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLD  22
            S GCEP+  TY+I +SSLCRDGKL++AI++LKIM +KGLTP+ FTYDPLISAFCK GRLD
Sbjct  181  SAGCEPNVVTYSILMSSLCRDGKLDEAINLLKIMMDKGLTPDTFTYDPLISAFCKGGRLD  240

Query  21   LAIDLLD  1
            LAI  LD
Sbjct  241  LAIKFLD  247


 Score =   178 bits (452),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 158/296 (53%), Gaps = 12/296 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G   E + LL  M+  G +PD+     +I+G+   K  ++A + ++ L   G +P+V++Y
Sbjct  97   GGIHEAMKLLDEMLSTGLQPDMYTYNAIIRGMCREKMTDQAYEFVRSLPSKGCKPDVISY  156

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       +      ++N M S G  P+VVTY+I++ S+C  GKL  A+ +L  M  
Sbjct  157  NILLRALLHKGKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKLDEAINLLKIMM-  215

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            D    PD  TY  LI A      +  A+K +D M+S G  P+I  YN IL  +C++G  D
Sbjct  216  DKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMISNGCLPDIVNYNTILSTMCKKGKAD  275

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
             A E    L  +GC PDV +YN ++ AL     W++GE+     L+ EM   G +P   T
Sbjct  276  EAMEVFEKLAEIGCPPDVSTYNTMMSAL-----WNNGERARALILVPEMIEKGIDPDEIT  330

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            YN  +S LCRDG +N+A+ +L  M   G  P   TY+ L+   CK  R+D AI++L
Sbjct  331  YNSLISCLCRDGLVNEALDLLVDMEGNGFPPTVITYNILLLGLCKAHRIDEAIEVL  386


 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 168/274 (61%), Gaps = 4/274 (1%)
 Frame = -1

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNVLAYTALIGGFCKTNRVEAANG  643
            KP V+  T LI+         +A+K++ ++L    +P++  Y A+I G C+    + A  
Sbjct  80   KPTVITYTILIEATILEGGIHEAMKLLDEMLSTGLQPDMYTYNAIIRGMCREKMTDQAYE  139

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
             +  + S+G  PDV++YNI++ ++  +GK     K++++M     C+P+VVTY++L+ ++
Sbjct  140  FVRSLPSKGCKPDVISYNILLRALLHKGKWSDGEKLVNEMFS-AGCEPNVVTYSILM-SS  197

Query  462  IVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPD  286
            + +DG + EA+ L+  M+ +GL P+ +TY+ ++   C+ G +D A +F+  + + GC PD
Sbjct  198  LCRDGKLDEAINLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMISNGCLPD  257

Query  285  VFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
            + +YN +L  +  +   D+  ++ ++++ +GC P   TYN  +S+L  +G+  +A+ ++ 
Sbjct  258  IVNYNTILSTMCKKGKADEAMEVFEKLAEIGCPPDVSTYNTMMSALWNNGERARALILVP  317

Query  105  IMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             M EKG+ P++ TY+ LIS  C++G ++ A+DLL
Sbjct  318  EMIEKGIDPDEITYNSLISCLCRDGLVNEALDLL  351


 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/266 (33%), Positives = 134/266 (50%), Gaps = 2/266 (1%)
 Frame = -1

Query  825  GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAA  649
            G KPDV+    L++ L    K     K++  +   G EPNV+ Y+ L+   C+  +++ A
Sbjct  148  GCKPDVISYNILLRALLHKGKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKLDEA  207

Query  648  NGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIE  469
              +L  M  +G  PD  TY+ +I + C  G+L LA+K LD M   N C PD+V Y  ++ 
Sbjct  208  INLLKIMMDKGLTPDTFTYDPLISAFCKGGRLDLAIKFLDYMIS-NGCLPDIVNYNTILS  266

Query  468  ATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKP  289
                K    EAM++ +++   G  P++ TYN ++  L   G   RA   V  +   G  P
Sbjct  267  TMCKKGKADEAMEVFEKLAEIGCPPDVSTYNTMMSALWNNGERARALILVPEMIEKGIDP  326

Query  288  DVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISML  109
            D  +YN L+  L      ++   LL +M   G  P   TYNI +  LC+  ++++AI +L
Sbjct  327  DEITYNSLISCLCRDGLVNEALDLLVDMEGNGFPPTVITYNILLLGLCKAHRIDEAIEVL  386

Query  108  KIMTEKGLTPNKFTYDPLISAFCKEG  31
            + M EKG  PN+ TY  LI      G
Sbjct  387  REMVEKGRRPNETTYILLIEGIGFSG  412


 Score =   143 bits (360),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 142/262 (54%), Gaps = 2/262 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK+ +   L+  M   G +P+VV  + L+  L    K ++A+ +++++   G  P+   Y
Sbjct  167  GKWSDGEKLVNEMFSAGCEPNVVTYSILMSSLCRDGKLDEAINLLKIMMDKGLTPDTFTY  226

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  FCK  R++ A   L+ M S G  PD+V YN ++ ++C +GK   A++V +++ E
Sbjct  227  DPLISAFCKGGRLDLAIKFLDYMISNGCLPDIVNYNTILSTMCKKGKADEAMEVFEKLAE  286

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
               C PDV TY  ++ A       + A+ LV EM+ +G++P+  TYN+++  LCR+G+V+
Sbjct  287  IG-CPPDVSTYNTMMSALWNNGERARALILVPEMIEKGIDPDEITYNSLISCLCRDGLVN  345

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A + +  +   G  P V +YNILL  L      D+  ++L+EM   G  P+  TY + +
Sbjct  346  EALDLLVDMEGNGFPPTVITYNILLLGLCKAHRIDEAIEVLREMVEKGRRPNETTYILLI  405

Query  156  SSLCRDGKLNKAISMLKIMTEK  91
              +   G   +A+ +   + +K
Sbjct  406  EGIGFSGWRVQAMEVANSLYQK  427



>ref|XP_006589209.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Glycine max]
 gb|KHN14814.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=561

 Score =   370 bits (949),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 249/331 (75%), Gaps = 5/331 (2%)
 Frame = -1

Query  993  RNLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKP  814
            R L N    KV++ +     Q  D ++ +  + LNR C  GK  E LY L+ MV  GYKP
Sbjct  37   RRLNNKGHTKVTSSDTRPH-QHYDFRDTNHIKSLNRLCKTGKCTEALYFLEQMVMNGYKP  95

Query  813  DVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLN  634
            DV+LCTKLIK LF+ K+ EKAV+VM++LEQ+GEP+  AY A+I GFC+++R +AANGV+ 
Sbjct  96   DVILCTKLIKCLFTSKRTEKAVRVMEILEQYGEPDSFAYNAVISGFCRSDRFDAANGVIL  155

Query  633  RMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVK  454
            RM++RGF PDVVTYNI+IGS+C RG L LALKV+DQ+ ED NC P ++TYT+LIEATI+ 
Sbjct  156  RMKNRGFSPDVVTYNILIGSLCARGNLDLALKVMDQLLED-NCNPTLITYTILIEATIIH  214

Query  453  DGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSY  274
             GI EAM+L+DEM+SRGL+P+IYTYN I++G+C+ G+VDRA+EFV +L      P +  Y
Sbjct  215  GGIDEAMRLLDEMMSRGLQPDIYTYNVIVRGMCKRGLVDRAFEFVSNL---SITPSLNLY  271

Query  273  NILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTE  94
            N+LL+ LL+   W+ GE+L+ +M   GCEP+  TY++ +SSLCRDGK  +A+ +L++M E
Sbjct  272  NLLLKGLLNEGRWEAGERLMSDMIVKGCEPNVVTYSVLISSLCRDGKAGEAVDVLRVMKE  331

Query  93   KGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +GL P+ + YDPLISAFCKEG++DLAI  +D
Sbjct  332  RGLNPDAYCYDPLISAFCKEGKVDLAIGFVD  362


 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/326 (30%), Positives = 168/326 (52%), Gaps = 34/326 (10%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C + +++    ++  M   G+ PDVV    LI  L +    + A+KVM QLLE    P +
Sbjct  142  CRSDRFDAANGVILRMKNRGFSPDVVTYNILIGSLCARGNLDLALKVMDQLLEDNCNPTL  201

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL--  532
            + YT LI        ++ A  +L+ M SRG  PD+ TYN+++  +C RG +  A + +  
Sbjct  202  ITYTILIEATIIHGGIDEAMRLLDEMMSRGLQPDIYTYNVIVRGMCKRGLVDRAFEFVSN  261

Query  531  --------------------------DQMKED---NNCKPDVVTYTVLIEATIVKDG-IS  442
                                      +++  D     C+P+VVTY+VLI +++ +DG   
Sbjct  262  LSITPSLNLYNLLLKGLLNEGRWEAGERLMSDMIVKGCEPNVVTYSVLI-SSLCRDGKAG  320

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            EA+ ++  M  RGL P+ Y Y+ ++   C+EG VD A  FV  + + G  PD+ +YN ++
Sbjct  321  EAVDVLRVMKERGLNPDAYCYDPLISAFCKEGKVDLAIGFVDDMISAGWLPDIVNYNTIM  380

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
             +L  +   D+   + K++  +GC P+  +YN    +L   G   +A+ M+  M   G+ 
Sbjct  381  GSLCKKGRADEALNIFKKLEEVGCPPNASSYNTMFGALWSSGDKIRALGMILEMLSNGVD  440

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLL  4
            P++ TY+ LIS+ C++G +D AI LL
Sbjct  441  PDRITYNSLISSLCRDGMVDEAIGLL  466


 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 153/295 (52%), Gaps = 13/295 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYT  694
            G  +E + LL  M+  G +PD+     +++G+      ++A + +  L     P++  Y 
Sbjct  215  GGIDEAMRLLDEMMSRGLQPDIYTYNVIVRGMCKRGLVDRAFEFVSNLSI--TPSLNLYN  272

Query  693  ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
             L+ G     R EA   +++ M  +G  P+VVTY+++I S+C  GK G A+ VL  MKE 
Sbjct  273  LLLKGLLNEGRWEAGERLMSDMIVKGCEPNVVTYSVLISSLCRDGKAGEAVDVLRVMKE-  331

Query  513  NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
                PD   Y  LI A   +  +  A+  VD+M+S G  P+I  YN I+  LC++G  D 
Sbjct  332  RGLNPDAYCYDPLISAFCKEGKVDLAIGFVDDMISAGWLPDIVNYNTIMGSLCKKGRADE  391

Query  333  AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFTY  169
            A    + L  +GC P+  SYN +  AL     W  G+K     ++ EM S G +P   TY
Sbjct  392  ALNIFKKLEEVGCPPNASSYNTMFGAL-----WSSGDKIRALGMILEMLSNGVDPDRITY  446

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N  +SSLCRDG +++AI +L  M      P   +Y+ ++   CK  R+  AI++L
Sbjct  447  NSLISSLCRDGMVDEAIGLLVDMERSEWQPTVISYNIVLLGLCKAHRIVDAIEVL  501


 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/257 (33%), Positives = 140/257 (54%), Gaps = 2/257 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G++E    L+  M+  G +P+VV  + LI  L    KA +AV V++++++ G  P+   Y
Sbjct  282  GRWEAGERLMSDMIVKGCEPNVVTYSVLISSLCRDGKAGEAVDVLRVMKERGLNPDAYCY  341

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  FCK  +V+ A G ++ M S G+ PD+V YN ++GS+C +G+   AL +  ++ E
Sbjct  342  DPLISAFCKEGKVDLAIGFVDDMISAGWLPDIVNYNTIMGSLCKKGRADEALNIFKKL-E  400

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            +  C P+  +Y  +  A         A+ ++ EMLS G++P+  TYN+++  LCR+GMVD
Sbjct  401  EVGCPPNASSYNTMFGALWSSGDKIRALGMILEMLSNGVDPDRITYNSLISSLCRDGMVD  460

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A   +  +     +P V SYNI+L  L       D  ++L  M   GC+P+  TY + V
Sbjct  461  EAIGLLVDMERSEWQPTVISYNIVLLGLCKAHRIVDAIEVLAVMVDNGCQPNETTYTLLV  520

Query  156  SSLCRDGKLNKAISMLK  106
              +   G  + A+ + K
Sbjct  521  EGVGYAGWRSYAVELAK  537


 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 100/195 (51%), Gaps = 2/195 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK +  +  +  M+  G+ PD+V    ++  L    +A++A+ + + LE+ G  PN 
Sbjct  349  CKEGKVDLAIGFVDDMISAGWLPDIVNYNTIMGSLCKKGRADEALNIFKKLEEVGCPPNA  408

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  + G    +     A G++  M S G  PD +TYN +I S+C  G +  A+ +L  
Sbjct  409  SSYNTMFGALWSSGDKIRALGMILEMLSNGVDPDRITYNSLISSLCRDGMVDEAIGLLVD  468

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E +  +P V++Y +++        I +A++++  M+  G +PN  TY  +++G+   G
Sbjct  469  M-ERSEWQPTVISYNIVLLGLCKAHRIVDAIEVLAVMVDNGCQPNETTYTLLVEGVGYAG  527

Query  345  MVDRAYEFVRSLPAM  301
                A E  +SL +M
Sbjct  528  WRSYAVELAKSLVSM  542



>ref|XP_003521773.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Glycine max]
 gb|KHN35321.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=570

 Score =   367 bits (942),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 241/311 (77%), Gaps = 1/311 (0%)
 Frame = -1

Query  933  QLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEK  754
              LD K+  + + L+RSC AG + E+LY L+++V  G+KPDVVLCTKLI GLF+ K  +K
Sbjct  51   HTLDFKDTHLLKSLSRSCKAGNFNESLYFLRHLVNKGHKPDVVLCTKLIHGLFTSKTIDK  110

Query  753  AVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGS  574
            A++VM +LE  G P+++AY A+I GFC+ NR+++A  VL+RM+++GF PD+VTYNI+IGS
Sbjct  111  AIQVMHILENHGHPDLIAYNAIITGFCRANRIDSAYQVLDRMKNKGFSPDIVTYNILIGS  170

Query  573  ICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEP  394
            +C RG L  AL+  +Q+ ++N CKP VVTYT+LIEAT+++ GI EAMKL+DEML   L+P
Sbjct  171  LCSRGMLDSALEFKNQLLKEN-CKPTVVTYTILIEATLLQGGIDEAMKLLDEMLEINLQP  229

Query  393  NIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLL  214
            +++TYN+I++G+CREG VDRA++ + S+ + G  PDV +YNILLR LL++  W+ G +L+
Sbjct  230  DMFTYNSIIRGMCREGYVDRAFQIISSISSKGYAPDVITYNILLRGLLNQGKWEAGYELM  289

Query  213  KEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKE  34
             +M + GCE +  TY++ +SS+CRDGK+ + + +LK M +KGL P+ + YDPLI+A CKE
Sbjct  290  SDMVARGCEANVVTYSVLISSVCRDGKVEEGVGLLKDMKKKGLKPDGYCYDPLIAALCKE  349

Query  33   GRLDLAIDLLD  1
            GR+DLAI++LD
Sbjct  350  GRVDLAIEVLD  360


 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 174/295 (59%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +  L     ++K   KP VV  T LI+        ++A+K++ ++LE   +P++
Sbjct  172  CSRGMLDSALEFKNQLLKENCKPTVVTYTILIEATLLQGGIDEAMKLLDEMLEINLQPDM  231

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y ++I G C+   V+ A  +++ + S+G+ PDV+TYNI++  + ++GK     +++  
Sbjct  232  FTYNSIIRGMCREGYVDRAFQIISSISSKGYAPDVITYNILLRGLLNQGKWEAGYELMSD  291

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M     C+ +VVTY+VLI +++ +DG + E + L+ +M  +GL+P+ Y Y+ ++  LC+E
Sbjct  292  MVA-RGCEANVVTYSVLI-SSVCRDGKVEEGVGLLKDMKKKGLKPDGYCYDPLIAALCKE  349

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  + + GC PD+ +YN +L  L  ++  D+   + +++  +GC P+  +Y
Sbjct  350  GRVDLAIEVLDVMISDGCVPDIVNYNTILACLCKQKRADEALSIFEKLGEVGCSPNASSY  409

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   +A+ M+  M +KG+ P+  TY+ LIS  C++G +D AI+LL
Sbjct  410  NSMFSALWSTGHKVRALGMILEMLDKGVDPDGITYNSLISCLCRDGMVDEAIELL  464


 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 148/295 (50%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  +    ++  +   GY PDV+    L++GL +  K E   ++M  +   G E NV
Sbjct  242  CREGYVDRAFQIISSISSKGYAPDVITYNILLRGLLNQGKWEAGYELMSDMVARGCEANV  301

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +VE   G+L  M+ +G  PD   Y+ +I ++C  G++ LA++VLD 
Sbjct  302  VTYSVLISSVCRDGKVEEGVGLLKDMKKKGLKPDGYCYDPLIAALCKEGRVDLAIEVLDV  361

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M  D  C PD+V Y  ++     +    EA+ + +++   G  PN  +YN++   L   G
Sbjct  362  MISDG-CVPDIVNYNTILACLCKQKRADEALSIFEKLGEVGCSPNASSYNSMFSALWSTG  420

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLL--KEMSSMGCEPHTFT  172
               RA   +  +   G  PD  +YN L+  L      D+  +LL   EM S  C+P   +
Sbjct  421  HKVRALGMILEMLDKGVDPDGITYNSLISCLCRDGMVDEAIELLVDMEMESSECKPSVVS  480

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            YNI +  LC+  +++ AI +L  M +KG  PN+ TY  LI      G L+ A DL
Sbjct  481  YNIVLLGLCKVSRVSDAIEVLAAMVDKGCRPNETTYTFLIEGIGFGGCLNDARDL  535


 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 103/196 (53%), Gaps = 2/196 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+ +  + +L  M+  G  PD+V    ++  L   K+A++A+ + + L + G  PN 
Sbjct  347  CKEGRVDLAIEVLDVMISDGCVPDIVNYNTILACLCKQKRADEALSIFEKLGEVGCSPNA  406

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y ++      T     A G++  M  +G  PD +TYN +I  +C  G +  A+++L  
Sbjct  407  SSYNSMFSALWSTGHKVRALGMILEMLDKGVDPDGITYNSLISCLCRDGMVDEAIELLVD  466

Query  525  MK-EDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M+ E + CKP VV+Y +++        +S+A++++  M+ +G  PN  TY  +++G+   
Sbjct  467  MEMESSECKPSVVSYNIVLLGLCKVSRVSDAIEVLAAMVDKGCRPNETTYTFLIEGIGFG  526

Query  348  GMVDRAYEFVRSLPAM  301
            G ++ A +   +L  M
Sbjct  527  GCLNDARDLATTLVNM  542



>gb|KDO44558.1| hypothetical protein CISIN_1g047017mg, partial [Citrus sinensis]
Length=534

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 240/333 (72%), Gaps = 21/333 (6%)
 Frame = -1

Query  990  NLKNLQSVKVST--ENR-NALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGY  820
            N K+ + V+VS+  E R N  +   D KE    + + RS  AGK++E+LY ++ MV  G 
Sbjct  9    NPKSNERVRVSSSAETRPNTHLLSFDVKETQFMKLIKRSFRAGKFDESLYFIESMVANGC  68

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGV  640
            KPDVV+CTKLIK  F  +K+ KAV+VM++LE++GEP+V AY ALI GFCK N++E AN V
Sbjct  69   KPDVVMCTKLIKKFFQERKSNKAVRVMEILEKYGEPDVFAYNALISGFCKANQIELANKV  128

Query  639  LNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATI  460
            L+R+RSRGF PDVVTYNIMIGS+C RG +  A KV DQ+  D NCKP V+TYT+LI+AT+
Sbjct  129  LDRLRSRGFSPDVVTYNIMIGSLCSRGMIESAFKVFDQLLRD-NCKPTVITYTILIQATM  187

Query  459  VKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
            ++    +AMKL+DEM                 G+C++GMV +A++FVRSL + GC+PDV 
Sbjct  188  LEGQTDKAMKLLDEM-----------------GMCKKGMVGQAFQFVRSLESRGCQPDVI  230

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
            SYN+LLR LL+   W++GEKL+ EM S G EP+  TY+I +SSLCRDGK   A+ +L+  
Sbjct  231  SYNMLLRTLLNMGKWEEGEKLMTEMISRGLEPNVVTYSILISSLCRDGKTEDAVDVLRAA  290

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             EKGLTP+ ++YDPLISA+CK+GRLDLAI+ LD
Sbjct  291  KEKGLTPDAYSYDPLISAYCKDGRLDLAIEFLD  323


 Score =   163 bits (412),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 159/318 (50%), Gaps = 32/318 (10%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM------------  739
            C  G  E    +   +++   KP V+  T LI+      + +KA+K++            
Sbjct  152  CSRGMIESAFKVFDQLLRDNCKPTVITYTILIQATMLEGQTDKAMKLLDEMGMCKKGMVG  211

Query  738  ------QLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMI  580
                  + LE  G +P+V++Y  L+       + E    ++  M SRG  P+VVTY+I+I
Sbjct  212  QAFQFVRSLESRGCQPDVISYNMLLRTLLNMGKWEEGEKLMTEMISRGLEPNVVTYSILI  271

Query  579  GSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRG  403
             S+C  GK   A+ VL   KE     PD  +Y  LI A   KDG +  A++ +D M+S G
Sbjct  272  SSLCRDGKTEDAVDVLRAAKE-KGLTPDAYSYDPLISA-YCKDGRLDLAIEFLDYMISDG  329

Query  402  LEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGE  223
              P+I  YN IL   C+ G  D+A E    L  +GC P+V SYN +  AL     W  G+
Sbjct  330  CLPDIVNYNTILAAFCKNGNADQALEIFEKLSDVGCPPNVSSYNTMFSAL-----WSSGD  384

Query  222  K-----LLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDP  58
            K     ++ EM S G EP   TYN  +S LCRDG +++A+ +L  M      P   +Y+ 
Sbjct  385  KIRALGMISEMLSKGIEPDEITYNSLISCLCRDGMVDEAVGLLVDMESTRFRPTVISYNI  444

Query  57   LISAFCKEGRLDLAIDLL  4
            +I  FCK  R++ +I++L
Sbjct  445  IILGFCKTRRINESIEVL  462


 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/293 (30%), Positives = 148/293 (51%), Gaps = 2/293 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G   +    ++ +   G +PDV+    L++ L ++ K E+  K+M +++ +  EPNV
Sbjct  205  CKKGMVGQAFQFVRSLESRGCQPDVISYNMLLRTLLNMGKWEEGEKLMTEMISRGLEPNV  264

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  + E A  VL   + +G  PD  +Y+ +I + C  G+L LA++ LD 
Sbjct  265  VTYSILISSLCRDGKTEDAVDVLRAAKEKGLTPDAYSYDPLISAYCKDGRLDLAIEFLDY  324

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M  D  C PD+V Y  ++ A        +A+++ +++   G  PN+ +YN +   L   G
Sbjct  325  MISDG-CLPDIVNYNTILAAFCKNGNADQALEIFEKLSDVGCPPNVSSYNTMFSALWSSG  383

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
               RA   +  + + G +PD  +YN L+  L      D+   LL +M S    P   +YN
Sbjct  384  DKIRALGMISEMLSKGIEPDEITYNSLISCLCRDGMVDEAVGLLVDMESTRFRPTVISYN  443

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            I +   C+  ++N++I +L  M EKG  PN+ TY  LI      G    A++L
Sbjct  444  IIILGFCKTRRINESIEVLAAMFEKGCKPNETTYVLLIEGIGYGGWRAEAMEL  496


 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 84/159 (53%), Gaps = 2/159 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  ++ L + + +  +G  P+V     +   L+S     +A+ ++ ++L +  EP+ 
Sbjct  345  CKNGNADQALEIFEKLSDVGCPPNVSSYNTMFSALWSSGDKIRALGMISEMLSKGIEPDE  404

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y +LI   C+   V+ A G+L  M S  F P V++YNI+I   C   ++  +++VL  
Sbjct  405  ITYNSLISCLCRDGMVDEAVGLLVDMESTRFRPTVISYNIIILGFCKTRRINESIEVLAA  464

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLS  409
            M E   CKP+  TY +LIE        +EAM+L + ++S
Sbjct  465  MFE-KGCKPNETTYVLLIEGIGYGGWRAEAMELANALVS  502



>ref|XP_006857320.1| hypothetical protein AMTR_s00067p00076830 [Amborella trichopoda]
 gb|ERN18787.1| hypothetical protein AMTR_s00067p00076830 [Amborella trichopoda]
Length=602

 Score =   355 bits (911),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 224/308 (73%), Gaps = 3/308 (1%)
 Frame = -1

Query  924  DSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK  745
            D  E    + LNRSC +GK  ETLY L YMV  G+ PDV+LCTKLIKG  S K AEKA++
Sbjct  62   DFNETHYIKLLNRSCKSGKLSETLYFLDYMVNKGHHPDVILCTKLIKGFCSAKNAEKAMR  121

Query  744  VMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            VM++LE +G P++ AY  LI G CK N +++A    NRM      PD+VTYNI+IGS+C 
Sbjct  122  VMKILESYGNPDIFAYNTLINGLCKLNLIDSATKTFNRMLETQCHPDIVTYNILIGSLCS  181

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
            RG+L LA+K LD++ E NNC P VVTYT+LIEAT    GI EAMKL+DEML+R L P+++
Sbjct  182  RGELDLAMKFLDRLLE-NNCSPTVVTYTILIEATCNIGGIDEAMKLLDEMLARNLHPDMF  240

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN I++G+C+EG +D A E  R+   + C+PD  SYNILLRALL ++ W D E +L EM
Sbjct  241  TYNVIIRGMCKEGKLDVALELFRT--KVNCEPDTISYNILLRALLSQQRWGDAENILSEM  298

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
             S G EP+  TY+I + +LC++GK+N+AI +LK M E+GL P+ ++Y+PLISAFC+EG+L
Sbjct  299  ISNGYEPNVVTYSIIIGALCQEGKVNQAIDILKDMMERGLKPDSYSYEPLISAFCREGKL  358

Query  24   DLAIDLLD  1
            D+AI  ++
Sbjct  359  DMAISFIE  366


 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/296 (30%), Positives = 150/296 (51%), Gaps = 5/296 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L L +   K+  +PD +    L++ L S ++   A  ++ +++    EPNV
Sbjct  250  CKEGKLDVALELFR--TKVNCEPDTISYNILLRALLSQQRWGDAENILSEMISNGYEPNV  307

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ +IG  C+  +V  A  +L  M  RG  PD  +Y  +I + C  GKL +A+  ++ 
Sbjct  308  VTYSIIIGALCQEGKVNQAIDILKDMMERGLKPDSYSYEPLISAFCREGKLDMAISFIEH  367

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEML-SRGLEPNIYTYNAILKGLCRE  349
            M   N C+ D++ Y  L+ A       +EA+++++ +  +R   P+  +YN ++ GL   
Sbjct  368  MI-CNGCELDIINYNTLLSAFCKVGEANEALEILENLWETRLCSPDASSYNTVIYGLWSN  426

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA + VR +   G  PD  +YNIL+  L      D    LL++M   G EP   TY
Sbjct  427  GDQLRALKLVRVMVGRGVDPDNITYNILINCLCRDGLVDHALILLEDMKRAGFEPTVITY  486

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            N  +  LC+  +++  I ML  M E+G  P + TY  LI     +G L  A+ L++
Sbjct  487  NTVILGLCKMHRIDMCIDMLAKMVERGCLPIEATYVILIEGVAYDGLLAEAVGLVE  542


 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/256 (29%), Positives = 134/256 (52%), Gaps = 1/256 (0%)
 Frame = -1

Query  849  LLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNVLAYTALIGGFC  673
            +L  M+  GY+P+VV  + +I  L    K  +A+ +++ ++E+  +P+  +Y  LI  FC
Sbjct  294  ILSEMISNGYEPNVVTYSIIIGALCQEGKVNQAIDILKDMMERGLKPDSYSYEPLISAFC  353

Query  672  KTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDV  493
            +  +++ A   +  M   G   D++ YN ++ + C  G+   AL++L+ + E   C PD 
Sbjct  354  REGKLDMAISFIEHMICNGCELDIINYNTLLSAFCKVGEANEALEILENLWETRLCSPDA  413

Query  492  VTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRS  313
             +Y  +I           A+KLV  M+ RG++P+  TYN ++  LCR+G+VD A   +  
Sbjct  414  SSYNTVIYGLWSNGDQLRALKLVRVMVGRGVDPDNITYNILINCLCRDGLVDHALILLED  473

Query  312  LPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGK  133
            +   G +P V +YN ++  L      D    +L +M   GC P   TY I +  +  DG 
Sbjct  474  MKRAGFEPTVITYNTVILGLCKMHRIDMCIDMLAKMVERGCLPIEATYVILIEGVAYDGL  533

Query  132  LNKAISMLKIMTEKGL  85
            L +A+ +++ +  +G+
Sbjct  534  LAEAVGLVEALLTRGV  549



>ref|XP_006408151.1| hypothetical protein EUTSA_v10022408mg, partial [Eutrema salsugineum]
 gb|ESQ49604.1| hypothetical protein EUTSA_v10022408mg, partial [Eutrema salsugineum]
Length=460

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 155/247 (63%), Positives = 211/247 (85%), Gaps = 1/247 (0%)
 Frame = -1

Query  741  MQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
            M++LE+FG+P+V AY ALI GFCK NR+E +  VL+RMRS+GF PD VTYNIMIGS+C R
Sbjct  1    MEILEKFGQPDVFAYNALINGFCKMNRIEDSTKVLDRMRSKGFSPDTVTYNIMIGSLCSR  60

Query  561  GKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYT  382
            GKL LALKVLDQ+  DN C+P V+TYT+LIEAT++  G+ EA+KL+DEMLSRGL+P+++T
Sbjct  61   GKLDLALKVLDQLLTDN-CQPTVITYTILIEATMLDGGVDEALKLLDEMLSRGLKPDMFT  119

Query  381  YNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            YN I++G+C+EGMV+RA+E VR+L   GC+PDV SYNILLRALL++  W++GEKL+ +M 
Sbjct  120  YNTIIRGMCKEGMVERAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTKMF  179

Query  201  SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLD  22
            S  CEP+  TY+I +++LCRDGK+++A+++LK+M EKGLTP+ ++YDPLI+AFC+EGRLD
Sbjct  180  SEKCEPNVVTYSILITTLCRDGKIDEALNLLKLMKEKGLTPDAYSYDPLIAAFCREGRLD  239

Query  21   LAIDLLD  1
            LAI+ L+
Sbjct  240  LAIEFLE  246


 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 171/295 (58%), Gaps = 4/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK +  L +L  ++    +P V+  T LI+        ++A+K++ ++L +  +P++
Sbjct  58   CSRGKLDLALKVLDQLLTDNCQPTVITYTILIEATMLDGGVDEALKLLDEMLSRGLKPDM  117

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              Y  +I G CK   VE A  ++  +  RG  PDV++YNI++ ++ ++GK     K++ +
Sbjct  118  FTYNTIIRGMCKEGMVERAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTK  177

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C+P+VVTY++LI  T+ +DG I EA+ L+  M  +GL P+ Y+Y+ ++   CRE
Sbjct  178  MFSEK-CEPNVVTYSILI-TTLCRDGKIDEALNLLKLMKEKGLTPDAYSYDPLIAAFCRE  235

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D A EF+ ++ + GC PD+ +YN +L  L      D   ++  ++  +GC P++ +Y
Sbjct  236  GRLDLAIEFLETMISEGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSY  295

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N   S+L   G   + + M+  M   G+ P++ TY+ +IS  C+EG ++ A +LL
Sbjct  296  NTMFSALWSSGDKIRGLQMISEMMSHGIDPDEITYNSMISCLCREGMVEEAFELL  350


 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/292 (34%), Positives = 158/292 (54%), Gaps = 2/292 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  +E L LL  M+  G KPD+     +I+G+      E+A ++++ LE  G EP+V++Y
Sbjct  96   GGVDEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVERAFEMVRNLELRGCEPDVISY  155

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              L+       + E    ++ +M S    P+VVTY+I+I ++C  GK+  AL +L  MKE
Sbjct  156  NILLRALLNQGKWEEGEKLMTKMFSEKCEPNVVTYSILITTLCRDGKIDEALNLLKLMKE  215

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN +L  LC+ G  D
Sbjct  216  -KGLTPDAYSYDPLIAAFCREGRLDLAIEFLETMISEGCLPDIVNYNTVLATLCKNGKAD  274

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
            +A E    L  +GC P+  SYN +  AL    +   G +++ EM S G +P   TYN  +
Sbjct  275  QALEIFGKLGEVGCSPNSSSYNTMFSALWSSGDKIRGLQMISEMMSHGIDPDEITYNSMI  334

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            S LCR+G + +A  +L  M      P+  TY+ ++  FCK  R++ AID+L+
Sbjct  335  SCLCREGMVEEAFELLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAIDVLE  386


 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 153/299 (51%), Gaps = 8/299 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  E    +++ +   G +PDV+    L++ L +  K E+  K+M ++  +  EPNV
Sbjct  128  CKEGMVERAFEMVRNLELRGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCEPNV  187

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +++ A  +L  M+ +G  PD  +Y+ +I + C  G+L LA++ L+ 
Sbjct  188  VTYSILITTLCRDGKIDEALNLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDLAIEFLET  247

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  +  C PD+V Y  ++ AT+ K+G   +A+++  ++   G  PN  +YN +   L   
Sbjct  248  MISEG-CLPDIVNYNTVL-ATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSS  305

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   R  + +  + + G  PD  +YN ++  L      ++  +LL +M S    P   TY
Sbjct  306  GDKIRGLQMISEMMSHGIDPDEITYNSMISCLCREGMVEEAFELLVDMRSCEFHPSVVTY  365

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG----RLDLAIDLL  4
            NI +   C+  ++  AI +L+ M E G  PN+ TY  LI      G     ++LA DL+
Sbjct  366  NIVLLGFCKAHRIEDAIDVLESMVENGCRPNETTYTMLIEGIGFAGYRAEAMELANDLV  424


 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/271 (30%), Positives = 142/271 (52%), Gaps = 6/271 (2%)
 Frame = -1

Query  921  SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV  742
            S  I +R  LN+    GK+EE   L+  M     +P+VV  + LI  L    K ++A+ +
Sbjct  154  SYNILLRALLNQ----GKWEEGEKLMTKMFSEKCEPNVVTYSILITTLCRDGKIDEALNL  209

Query  741  MQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICD  565
            ++L+++ G  P+  +Y  LI  FC+  R++ A   L  M S G  PD+V YN ++ ++C 
Sbjct  210  LKLMKEKGLTPDAYSYDPLIAAFCREGRLDLAIEFLETMISEGCLPDIVNYNTVLATLCK  269

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
             GK   AL++  ++ E   C P+  +Y  +  A          ++++ EM+S G++P+  
Sbjct  270  NGKADQALEIFGKLGE-VGCSPNSSSYNTMFSALWSSGDKIRGLQMISEMMSHGIDPDEI  328

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN+++  LCREGMV+ A+E +  + +    P V +YNI+L         +D   +L+ M
Sbjct  329  TYNSMISCLCREGMVEEAFELLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAIDVLESM  388

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISM  112
               GC P+  TY + +  +   G   +A+ +
Sbjct  389  VENGCRPNETTYTMLIEGIGFAGYRAEAMEL  419


 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 92/173 (53%), Gaps = 2/173 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK ++ L +   + ++G  P+      +   L+S     + ++++  +   G +P+ 
Sbjct  268  CKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSSGDKIRGLQMISEMMSHGIDPDE  327

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y ++I   C+   VE A  +L  MRS  F P VVTYNI++   C   ++  A+ VL+ 
Sbjct  328  ITYNSMISCLCREGMVEEAFELLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAIDVLES  387

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAIL  367
            M E N C+P+  TYT+LIE        +EAM+L ++++SR LE  +  Y  +L
Sbjct  388  MVE-NGCRPNETTYTMLIEGIGFAGYRAEAMELANDLVSRFLEHELCFYRCVL  439



>emb|CBI22375.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   343 bits (880),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 234/330 (71%), Gaps = 1/330 (0%)
 Frame = -1

Query  990  NLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPD  811
            N +N   V VS E R A +Q  D +E  + + LNRSC AGK+ E+LY L+ +V  GY PD
Sbjct  43   NSRNAPKVGVSAEARPAHLQSYDFRETHLMKLLNRSCKAGKFNESLYFLECLVNKGYTPD  102

Query  810  VVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNR  631
            V+LCTKLIKG F+ K  EKA +VM++LE   EP+V AY A+I GFCK NR+EAA  VLNR
Sbjct  103  VILCTKLIKGFFNFKNIEKASRVMEILESHTEPDVFAYNAVISGFCKVNRIEAATQVLNR  162

Query  630  MRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKD  451
            M++RGF PD+VTYNIMIGS+C+R KLGLALKVLDQ+  D NC P V+TYT+LIEATIV+ 
Sbjct  163  MKARGFLPDIVTYNIMIGSLCNRRKLGLALKVLDQLLLD-NCMPTVITYTILIEATIVEG  221

Query  450  GISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
            GI+EAMKL++EML+RGL P++YTYNAI++G+C+EGM D   + V  + + GC+P+  +Y+
Sbjct  222  GINEAMKLLEEMLARGLLPDMYTYNAIIRGMCKEGMWDEGEKLVAEMFSRGCEPNKVTYS  281

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
            IL+ +L      D+   +LK M      P T++Y+  +S+LC++G+L+ AI ++  M   
Sbjct  282  ILISSLCRFGRIDEAISVLKVMIEKELTPDTYSYDPLISALCKEGRLDLAIGIMDYMISN  341

Query  90   GLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            G  P+   Y+ +++A CK G  + A+++ +
Sbjct  342  GCLPDIVNYNTILAALCKNGNANQALEIFN  371



>gb|KHN04951.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=474

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/279 (59%), Positives = 224/279 (80%), Gaps = 4/279 (1%)
 Frame = -1

Query  837  MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRV  658
            MVK GYKPDV+LCTKLIKGLF+ K+ EKAV+VM++LEQ+G+P+  AY A+I GFC+++R 
Sbjct  1    MVKRGYKPDVILCTKLIKGLFTSKRTEKAVRVMEILEQYGDPDSFAYNAVISGFCRSDRF  60

Query  657  EAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTV  478
            +AAN V+ RM+ RGF PDVVTYNI+IGS+C RGKL LALKV+DQ+ ED NC P V+TYT+
Sbjct  61   DAANRVILRMKYRGFSPDVVTYNILIGSLCARGKLDLALKVMDQLLED-NCNPTVITYTI  119

Query  477  LIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMG  298
            LIEATI+   I +AM+L+DEM+SRGL+P++YTYN I++G+C+ G+VDRA+EFV +L    
Sbjct  120  LIEATIIHGSIDDAMRLLDEMMSRGLQPDMYTYNVIVRGMCKRGLVDRAFEFVSNL---N  176

Query  297  CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAI  118
              P +  YN+LL+ LL+   W+ GE+L+ +M   GCEP+  TY++ +SSLCRDGK  +A+
Sbjct  177  TTPSLNLYNLLLKGLLNEGRWEAGERLMSDMIVKGCEPNIVTYSVLISSLCRDGKAGEAV  236

Query  117  SMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +L++M EKGL P+ + YDPLISAFCKEG++DLAI  +D
Sbjct  237  DVLRVMKEKGLNPDAYCYDPLISAFCKEGKVDLAIGFVD  275


 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/326 (30%), Positives = 167/326 (51%), Gaps = 34/326 (10%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C + +++    ++  M   G+ PDVV    LI  L +  K + A+KVM QLLE    P V
Sbjct  55   CRSDRFDAANRVILRMKYRGFSPDVVTYNILIGSLCARGKLDLALKVMDQLLEDNCNPTV  114

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI        ++ A  +L+ M SRG  PD+ TYN+++  +C RG +  A + +  
Sbjct  115  ITYTILIEATIIHGSIDDAMRLLDEMMSRGLQPDMYTYNVIVRGMCKRGLVDRAFEFVSN  174

Query  525  MKED-------------------------------NNCKPDVVTYTVLIEATIVKDG-IS  442
            +                                    C+P++VTY+VLI +++ +DG   
Sbjct  175  LNTTPSLNLYNLLLKGLLNEGRWEAGERLMSDMIVKGCEPNIVTYSVLI-SSLCRDGKAG  233

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            EA+ ++  M  +GL P+ Y Y+ ++   C+EG VD A  FV  + + G  PD+ +YN ++
Sbjct  234  EAVDVLRVMKEKGLNPDAYCYDPLISAFCKEGKVDLAIGFVDDMISAGWLPDIVNYNTIM  293

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
             +L  +   D+   + K++  +GC P+  +YN    +L   G   +A++M+  M   G+ 
Sbjct  294  GSLCKKGRADEALNIFKKLEEVGCPPNASSYNTMFGALWSSGDKIRALTMILEMLSNGVD  353

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLL  4
            P++ TY+ LIS+ C++G +D AI LL
Sbjct  354  PDRITYNSLISSLCRDGMVDEAIGLL  379


 Score =   151 bits (382),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 153/295 (52%), Gaps = 13/295 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYT  694
            G  ++ + LL  M+  G +PD+     +++G+      ++A + +  L     P++  Y 
Sbjct  128  GSIDDAMRLLDEMMSRGLQPDMYTYNVIVRGMCKRGLVDRAFEFVSNLNT--TPSLNLYN  185

Query  693  ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
             L+ G     R EA   +++ M  +G  P++VTY+++I S+C  GK G A+ VL  MKE 
Sbjct  186  LLLKGLLNEGRWEAGERLMSDMIVKGCEPNIVTYSVLISSLCRDGKAGEAVDVLRVMKE-  244

Query  513  NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
                PD   Y  LI A   +  +  A+  VD+M+S G  P+I  YN I+  LC++G  D 
Sbjct  245  KGLNPDAYCYDPLISAFCKEGKVDLAIGFVDDMISAGWLPDIVNYNTIMGSLCKKGRADE  304

Query  333  AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFTY  169
            A    + L  +GC P+  SYN +  AL     W  G+K     ++ EM S G +P   TY
Sbjct  305  ALNIFKKLEEVGCPPNASSYNTMFGAL-----WSSGDKIRALTMILEMLSNGVDPDRITY  359

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N  +SSLCRDG +++AI +L  M      P   +Y+ ++   CK  R+  AI++L
Sbjct  360  NSLISSLCRDGMVDEAIGLLVDMERTEWQPTVISYNIVLLGLCKAHRIVDAIEVL  414


 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 140/257 (54%), Gaps = 2/257 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G++E    L+  M+  G +P++V  + LI  L    KA +AV V++++++ G  P+   Y
Sbjct  195  GRWEAGERLMSDMIVKGCEPNIVTYSVLISSLCRDGKAGEAVDVLRVMKEKGLNPDAYCY  254

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI  FCK  +V+ A G ++ M S G+ PD+V YN ++GS+C +G+   AL +  ++ E
Sbjct  255  DPLISAFCKEGKVDLAIGFVDDMISAGWLPDIVNYNTIMGSLCKKGRADEALNIFKKL-E  313

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
            +  C P+  +Y  +  A         A+ ++ EMLS G++P+  TYN+++  LCR+GMVD
Sbjct  314  EVGCPPNASSYNTMFGALWSSGDKIRALTMILEMLSNGVDPDRITYNSLISSLCRDGMVD  373

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A   +  +     +P V SYNI+L  L       D  ++L  M   GC+P+  TY + V
Sbjct  374  EAIGLLVDMERTEWQPTVISYNIVLLGLCKAHRIVDAIEVLAVMVDNGCQPNETTYTLLV  433

Query  156  SSLCRDGKLNKAISMLK  106
              +   G  + A+ + K
Sbjct  434  EGVGYAGWRSYAVELAK  450


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 101/196 (52%), Gaps = 4/196 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK +  +  +  M+  G+ PD+V    ++  L    +A++A+ + + LE+ G  PN 
Sbjct  262  CKEGKVDLAIGFVDDMISAGWLPDIVNYNTIMGSLCKKGRADEALNIFKKLEEVGCPPNA  321

Query  705  LAYTALIGGFCKT-NRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
             +Y  + G    + +++ A   +L  M S G  PD +TYN +I S+C  G +  A+ +L 
Sbjct  322  SSYNTMFGALWSSGDKIRALTMIL-EMLSNGVDPDRITYNSLISSLCRDGMVDEAIGLLV  380

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
             M E    +P V++Y +++        I +A++++  M+  G +PN  TY  +++G+   
Sbjct  381  DM-ERTEWQPTVISYNIVLLGLCKAHRIVDAIEVLAVMVDNGCQPNETTYTLLVEGVGYA  439

Query  348  GMVDRAYEFVRSLPAM  301
            G    A E  +SL +M
Sbjct  440  GWRSYAVELAKSLVSM  455



>ref|XP_004494750.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Cicer arietinum]
Length=591

 Score =   342 bits (878),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 234/311 (75%), Gaps = 3/311 (1%)
 Frame = -1

Query  927  LDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAV  748
            ++ K   + +  +RSC A KY ++LY LQ +V  GY+P   LCT L+K LF  +K +K V
Sbjct  71   INPKHTPLMKAFHRSCNARKYNDSLYFLQRLVNKGYRPTAALCTGLVKALFRCRKIDKVV  130

Query  747  KVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSIC  568
             VM+LLE++GEP+V AY A+I GF K NRV++A+ VL++M+ RGF P+VVTYNI+IG++C
Sbjct  131  WVMELLEKYGEPDVYAYNAVISGFFKANRVDSAHQVLDKMKKRGFAPNVVTYNILIGNLC  190

Query  567  DRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNI  388
             RGKL LALK+ D++ E+ NCKP ++TY +LIEATI++ G+  AMKL+D+ML+ GL+P+ 
Sbjct  191  SRGKLDLALKLADELLEE-NCKPTMITYKILIEATILEGGVDVAMKLLDDMLNSGLQPDT  249

Query  387  -YTYNAILKGLCREGMVDRAYEFVRSLPAMGCK-PDVFSYNILLRALLDRRNWDDGEKLL  214
             + YN+I++ +CREG+VD+A+E +RS+   G   PDV SYNILL+ LL +   + G+KL+
Sbjct  250  KFIYNSIMRVMCREGLVDKAFELIRSISDKGYYVPDVISYNILLQGLLSQGKLEYGQKLM  309

Query  213  KEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKE  34
             +M   G +P+  TY+I +SSLCR GK+ +A+ +LK M EKGLTPN ++YDPLI+AFCKE
Sbjct  310  TDMVLKGVQPNVVTYSILISSLCRGGKVEEAVGLLKAMKEKGLTPNAYSYDPLIAAFCKE  369

Query  33   GRLDLAIDLLD  1
             R+DLAI+ L+
Sbjct  370  SRVDLAIEFLN  380


 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/329 (29%), Positives = 165/329 (50%), Gaps = 39/329 (12%)
 Frame = -1

Query  876  AGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNVLA  700
            A + +    +L  M K G+ P+VV    LI  L S  K + A+K+  +LLE+  +P ++ 
Sbjct  157  ANRVDSAHQVLDKMKKRGFAPNVVTYNILIGNLCSRGKLDLALKLADELLEENCKPTMIT  216

Query  699  YTALI------GG------------------------------FCKTNRVEAANGVLNRM  628
            Y  LI      GG                               C+   V+ A  ++  +
Sbjct  217  YKILIEATILEGGVDVAMKLLDDMLNSGLQPDTKFIYNSIMRVMCREGLVDKAFELIRSI  276

Query  627  RSRGFF-PDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKD  451
              +G++ PDV++YNI++  +  +GKL    K++  M      +P+VVTY++LI +     
Sbjct  277  SDKGYYVPDVISYNILLQGLLSQGKLEYGQKLMTDMVL-KGVQPNVVTYSILISSLCRGG  335

Query  450  GISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
             + EA+ L+  M  +GL PN Y+Y+ ++   C+E  VD A EF+  + + GC P++ +YN
Sbjct  336  KVEEAVGLLKAMKEKGLTPNAYSYDPLIAAFCKESRVDLAIEFLNIMISDGCLPNIVNYN  395

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
             +L ++      D+   + +++  MGC P+  +YN   S+L   G   +A+ ++  M  K
Sbjct  396  TILASMCKNGKADEALNVFEKLGEMGCPPNVSSYNTIFSALWNFGDKIRALELILEMLSK  455

Query  90   GLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            G+ P+  TY+ LIS  C++  +D AI LL
Sbjct  456  GVDPDDITYNSLISYLCRDAMVDEAISLL  484


 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/299 (32%), Positives = 156/299 (52%), Gaps = 15/299 (5%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDV-VLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE--PNVL  703
            G  +  + LL  M+  G +PD   +   +++ +      +KA ++++ +   G   P+V+
Sbjct  228  GGVDVAMKLLDDMLNSGLQPDTKFIYNSIMRVMCREGLVDKAFELIRSISDKGYYVPDVI  287

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
            +Y  L+ G     ++E    ++  M  +G  P+VVTY+I+I S+C  GK+  A+ +L  M
Sbjct  288  SYNILLQGLLSQGKLEYGQKLMTDMVLKGVQPNVVTYSILISSLCRGGKVEEAVGLLKAM  347

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGM  343
            KE     P+  +Y  LI A   +  +  A++ ++ M+S G  PNI  YN IL  +C+ G 
Sbjct  348  KE-KGLTPNAYSYDPLIAAFCKESRVDLAIEFLNIMISDGCLPNIVNYNTILASMCKNGK  406

Query  342  VDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHT  178
             D A      L  MGC P+V SYN +  AL     W+ G+K     L+ EM S G +P  
Sbjct  407  ADEALNVFEKLGEMGCPPNVSSYNTIFSAL-----WNFGDKIRALELILEMLSKGVDPDD  461

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL-TPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TYN  +S LCRD  +++AIS+L  M       P   +++ ++   CK  R+D AI++L
Sbjct  462  ITYNSLISYLCRDAMVDEAISLLVDMESSEFHQPTVISFNTILLGLCKVRRIDDAIEVL  520


 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/296 (31%), Positives = 155/296 (52%), Gaps = 6/296 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYK-PDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            C  G  ++   L++ +   GY  PDV+    L++GL S  K E   K+M  +   G +PN
Sbjct  261  CREGLVDKAFELIRSISDKGYYVPDVISYNILLQGLLSQGKLEYGQKLMTDMVLKGVQPN  320

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ Y+ LI   C+  +VE A G+L  M+ +G  P+  +Y+ +I + C   ++ LA++ L+
Sbjct  321  VVTYSILISSLCRGGKVEEAVGLLKAMKEKGLTPNAYSYDPLIAAFCKESRVDLAIEFLN  380

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
             M  D  C P++V Y  ++ A++ K+G   EA+ + +++   G  PN+ +YN I   L  
Sbjct  381  IMISDG-CLPNIVNYNTIL-ASMCKNGKADEALNVFEKLGEMGCPPNVSSYNTIFSALWN  438

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM-SSMGCEPHTF  175
             G   RA E +  + + G  PD  +YN L+  L      D+   LL +M SS   +P   
Sbjct  439  FGDKIRALELILEMLSKGVDPDDITYNSLISYLCRDAMVDEAISLLVDMESSEFHQPTVI  498

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            ++N  +  LC+  +++ AI +L  M ++G  PN+ TY  LI      G  + A++L
Sbjct  499  SFNTILLGLCKVRRIDDAIEVLATMVDRGCMPNETTYLVLIEGIGYAGWPNDAMEL  554


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 96/197 (49%), Gaps = 3/197 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C   + +  +  L  M+  G  P++V    ++  +    KA++A+ V + L + G  PNV
Sbjct  367  CKESRVDLAIEFLNIMISDGCLPNIVNYNTILASMCKNGKADEALNVFEKLGEMGCPPNV  426

Query  705  LAYTALIGGFCK-TNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
             +Y  +        +++ A   +L  M S+G  PD +TYN +I  +C    +  A+ +L 
Sbjct  427  SSYNTIFSALWNFGDKIRALELIL-EMLSKGVDPDDITYNSLISYLCRDAMVDEAISLLV  485

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
             M+     +P V+++  ++        I +A++++  M+ RG  PN  TY  +++G+   
Sbjct  486  DMESSEFHQPTVISFNTILLGLCKVRRIDDAIEVLATMVDRGCMPNETTYLVLIEGIGYA  545

Query  348  GMVDRAYEFVRSLPAMG  298
            G  + A E   SL ++G
Sbjct  546  GWPNDAMELGSSLVSLG  562



>ref|XP_009364581.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Pyrus x bretschneideri]
Length=426

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 223/332 (67%), Gaps = 26/332 (8%)
 Frame = -1

Query  984  KNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVV  805
            +N      S E R   +Q  D KE  + + LNRSC AG+Y E LY L+ MV  GY+PDVV
Sbjct  44   RNPPKAAASAEARTTRLQNNDVKETHLMKVLNRSCKAGQYNEALYFLELMVNEGYRPDVV  103

Query  804  LCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMR  625
            LCTKLIKG F+ +  EKAV+V+Q+LE++GEP++  Y ALI GFCK NR+++AN +L++MR
Sbjct  104  LCTKLIKGFFNSRNVEKAVRVLQILEKYGEPDLFPYNALISGFCKANRIDSANKLLDKMR  163

Query  624  SRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGI  445
            SRGF PDVVTYNIMIGS+C RGKLGLALKVLDQ+ +D NC+P V+TY +LIEA I++ GI
Sbjct  164  SRGFSPDVVTYNIMIGSLCGRGKLGLALKVLDQLVKD-NCRPTVITYMILIEAMILEGGI  222

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
             EA+KL+D+MLSRGL+P++ TYNA+++G+  E               +GC P+V SYN +
Sbjct  223  DEAVKLLDDMLSRGLKPDMNTYNAVVRGILGE---------------VGCPPNVSSYNTM  267

Query  264  LRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
              AL     W+ G++     ++ EM S G +P   TYN  +S LCRD  +N+AI +L  M
Sbjct  268  FSAL-----WNCGDRVRALQMVSEMVSKGIDPDEITYNSLISYLCRDRMVNEAIGLLVDM  322

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               G  P   +Y+ ++   CK  R+  AI++L
Sbjct  323  ESGGFQPTVISYNIVLLGLCKTPRIVNAIEVL  354


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 75/148 (51%), Gaps = 1/148 (1%)
 Frame = -1

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
            +EA+  ++ M++ G  P++     ++KG      V++A   ++ L   G +PD+F YN L
Sbjct  84   NEALYFLELMVNEGYRPDVVLCTKLIKGFFNSRNVEKAVRVLQILEKYG-EPDLFPYNAL  142

Query  264  LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
            +         D   KLL +M S G  P   TYNI + SLC  GKL  A+ +L  + +   
Sbjct  143  ISGFCKANRIDSANKLLDKMRSRGFSPDVVTYNIMIGSLCGRGKLGLALKVLDQLVKDNC  202

Query  84   TPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             P   TY  LI A   EG +D A+ LLD
Sbjct  203  RPTVITYMILIEAMILEGGIDEAVKLLD  230



>ref|XP_006360522.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Solanum tuberosum]
Length=486

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 203/301 (67%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE+   L+ MV  G  PD++ CT LI+G   + + +KA +V+++LE  
Sbjct  135  RRLVRN---GELEESFKHLESMVYRGDIPDIIPCTSLIRGFCRIGQTKKATRVLEILEDS  191

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  ++ A  VL+RM      PDVVTYN ++ S+CD GKL  A
Sbjct  192  GAVPDVITYNVLISGYCKSGEIDNALKVLDRM---SVAPDVVTYNTILRSLCDSGKLKQA  248

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            + VLD+M +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G  P++ TYN ++ 
Sbjct  249  MHVLDRMLQ-KECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCVPDVVTYNVLIN  307

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG ++ A +F+ ++P+ GC+P+V ++NI+LR++     W D EKLL +M   GC P
Sbjct  308  GICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLADMVRKGCSP  367

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+ AFCKE ++D AI+ L
Sbjct  368  SVVTFNILINFLCRKGLLGRAIDLLEKMPKYGCTPNSLSYNPLLHAFCKEKKMDRAIEYL  427

Query  3    D  1
            +
Sbjct  428  E  428



>ref|XP_006856585.1| hypothetical protein AMTR_s00046p00202770 [Amborella trichopoda]
 gb|ERN18052.1| hypothetical protein AMTR_s00046p00202770 [Amborella trichopoda]
Length=585

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/299 (44%), Positives = 197/299 (66%), Gaps = 5/299 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE  715
            L R    G+ EE L  L+ M + G  PD++ CT LI+G   + K +K  +VM+++ + G 
Sbjct  116  LKRHVRNGELEEALVFLENMARNGEIPDIIPCTSLIRGFCKIGKTKKGTRVMEIIHESGA  175

Query  714  -PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             P+V+ Y  LI G+CK+  V+ A  VL RM      PDVVTYN ++ S+CD GKL  A++
Sbjct  176  VPDVITYNVLISGYCKSGEVDNALLVLERMSCS---PDVVTYNTILRSLCDEGKLKQAME  232

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VLD+M  +  C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ TYN ++ G+
Sbjct  233  VLDRMM-NRGCFPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDVVTYNVLINGI  291

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C+EG ++ A +F+ S+P+ GC+P+V ++NI+LR++     W D EKLL EM   GC P  
Sbjct  292  CKEGKLNEAIKFLNSMPSYGCRPNVITHNIILRSMCSTGRWMDAEKLLSEMIENGCSPSV  351

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             T+NI ++ LCR G + +AI +L+ M E G TPN  +Y+P++  FCKE  +D  I+ L+
Sbjct  352  VTFNILINFLCRKGLMRRAIDVLERMPEHGCTPNSLSYNPILHGFCKEKNMDRVIEYLE  410


 Score =   162 bits (409),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/345 (30%), Positives = 159/345 (46%), Gaps = 52/345 (15%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK ++ + +L  M+  G  PDV+  T LI+         +A+K++  +   G +P+V
Sbjct  222  CDEGKLKQAMEVLDRMMNRGCFPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDV  281

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  ++  A   LN M S G  P+V+T+NI++ S+C  G+   A K+L +
Sbjct  282  VTYNVLINGICKEGKLNEAIKFLNSMPSYGCRPNVITHNIILRSMCSTGRWMDAEKLLSE  341

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E N C P VVT+ +LI     K  +  A+ +++ M   G  PN  +YN IL G C+E 
Sbjct  342  MIE-NGCSPSVVTFNILINFLCRKGLMRRAIDVLERMPEHGCTPNSLSYNPILHGFCKEK  400

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP------  184
             +DR  E++  +   GC PD+ +YN LL AL      D   ++L+++ S GC P      
Sbjct  401  NMDRVIEYLEVMVLRGCFPDIVTYNTLLTALCKDGKVDAALEILRQLRSKGCSPVLITYN  460

Query  183  --------------------------------------------HTFTYNIFVSSLCRDG  136
                                                        +  TYN  +  LC+  
Sbjct  461  TVIDGLSKMGKTEEAIELQMRCREGKVDKAIEFFFEMEGKGIGPNAITYNALILGLCKAQ  520

Query  135  KLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +  +AI  L  M  KG  P + TY  LI     EGR   A++LL+
Sbjct  521  RTGQAIDFLAHMVSKGCKPTESTYTILIEGVANEGRPKEALNLLN  565


 Score =   138 bits (347),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 90/318 (28%), Positives = 145/318 (46%), Gaps = 52/318 (16%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    LI G+    K  +A+K +  +  +G  PN
Sbjct  256  TCKESGVGQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGKLNEAIKFLNSMPSYGCRPN  315

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L+ M   G  P VVT+NI+I  +C +G +  A+ VL+
Sbjct  316  VITHNIILRSMCSTGRWMDAEKLLSEMIENGCSPSVVTFNILINFLCRKGLMRRAIDVLE  375

Query  528  QMKEDN----------------------------------NCKPDVVTYTVLIEATIVKD  451
            +M E                                     C PD+VTY  L+ A + KD
Sbjct  376  RMPEHGCTPNSLSYNPILHGFCKEKNMDRVIEYLEVMVLRGCFPDIVTYNTLLTA-LCKD  434

Query  450  G-ISEAMKLVDEMLSRGLEPNIYTYNAILKGL---------------CREGMVDRAYEFV  319
            G +  A++++ ++ S+G  P + TYN ++ GL               CREG VD+A EF 
Sbjct  435  GKVDAALEILRQLRSKGCSPVLITYNTVIDGLSKMGKTEEAIELQMRCREGKVDKAIEFF  494

Query  318  RSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRD  139
              +   G  P+  +YN L+  L   +        L  M S GC+P   TY I +  +  +
Sbjct  495  FEMEGKGIGPNAITYNALILGLCKAQRTGQAIDFLAHMVSKGCKPTESTYTILIEGVANE  554

Query  138  GKLNKAISMLKIMTEKGL  85
            G+  +A+++L  + E+G+
Sbjct  555  GRPKEALNLLNELCERGV  572


 Score =   126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 130/263 (49%), Gaps = 17/263 (6%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L       +A+ V++ + + G 
Sbjct  323  LRSMCSTGRWMDAEKLLSEMIENGCSPSVVTFNILINFLCRKGLMRRAIDVLERMPEHGC  382

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  ++ GFCK   ++     L  M  RG FPD+VTYN ++ ++C  GK+  AL+
Sbjct  383  TPNSLSYNPILHGFCKEKNMDRVIEYLEVMVLRGCFPDIVTYNTLLTALCKDGKVDAALE  442

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKL--------VD-------EMLSRG  403
            +L Q++    C P ++TY  +I+         EA++L        VD       EM  +G
Sbjct  443  ILRQLR-SKGCSPVLITYNTVIDGLSKMGKTEEAIELQMRCREGKVDKAIEFFFEMEGKG  501

Query  402  LEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGE  223
            + PN  TYNA++ GLC+     +A +F+  + + GCKP   +Y IL+  + +     +  
Sbjct  502  IGPNAITYNALILGLCKAQRTGQAIDFLAHMVSKGCKPTESTYTILIEGVANEGRPKEAL  561

Query  222  KLLKEMSSMGCEPHTFTYNIFVS  154
             LL E+   G    +   N+ V+
Sbjct  562  NLLNELCERGVVKRSSAQNVAVN  584


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 68/129 (53%), Gaps = 3/129 (2%)
 Frame = -1

Query  387  YTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKE  208
            +  N +LK   R G ++ A  F+ ++   G  PD+     L+R          G ++++ 
Sbjct  110  FESNDLLKRHVRNGELEEALVFLENMARNGEIPDIIPCTSLIRGFCKIGKTKKGTRVMEI  169

Query  207  MSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGR  28
            +   G  P   TYN+ +S  C+ G+++ A+ +L+ M+    +P+  TY+ ++ + C EG+
Sbjct  170  IHESGAVPDVITYNVLISGYCKSGEVDNALLVLERMS---CSPDVVTYNTILRSLCDEGK  226

Query  27   LDLAIDLLD  1
            L  A+++LD
Sbjct  227  LKQAMEVLD  235



>ref|XP_010104578.1| hypothetical protein L484_025557 [Morus notabilis]
 gb|EXC01179.1| hypothetical protein L484_025557 [Morus notabilis]
Length=610

 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 205/308 (67%), Gaps = 7/308 (2%)
 Frame = -1

Query  918  KEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM  739
            +E +  +RL R    G+ EE   +L+ MV  G  PD++ CT LI+G   + K +KA +VM
Sbjct  113  EEFEGNKRLRRFVRNGELEEGFKVLERMVYHGDIPDIIACTSLIRGFCKIGKTKKASRVM  172

Query  738  QLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
            ++LE+ G  P+V+ Y  LI G+CK+  ++ A  VL+RM      PDVVTYN ++ ++CD 
Sbjct  173  EILEESGAAPDVITYNVLISGYCKSGEIDNALQVLDRM---SVAPDVVTYNTILRTLCDS  229

Query  561  GKLGLALKVLD-QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
            GKL  A++VLD Q++ +  C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ 
Sbjct  230  GKLKEAMEVLDRQLRRE--CYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDVV  287

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN ++ G+C+EG +D A +F+ ++P+ GC  +V ++NI+LR++     W D EKLL EM
Sbjct  288  TYNVLINGICKEGRLDEAIKFLNNMPSYGCHSNVITHNIILRSMCSTGRWMDAEKLLAEM  347

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
               GC P   T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+  FCKE ++
Sbjct  348  VRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKM  407

Query  24   DLAIDLLD  1
              AI+ LD
Sbjct  408  ARAIEYLD  415


 Score =   178 bits (451),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 158/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK +E + +L   ++    PDV+  T LI+         +A+K++  +   G +P+V
Sbjct  227  CDSGKLKEAMEVLDRQLRRECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDV  286

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S G   +V+T+NI++ S+C  G+   A K+L +
Sbjct  287  VTYNVLINGICKEGRLDEAIKFLNNMPSYGCHSNVITHNIILRSMCSTGRWMDAEKLLAE  346

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  347  MVR-KGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEK  405

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             + RA E++  + + GC PD+ +YN LL AL      D    +L ++SS GC P   TYN
Sbjct  406  KMARAIEYLDVMVSRGCYPDIVTYNTLLTALCKDGKVDIAVVILNQLSSKGCSPVLITYN  465

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + G+  +AI +L  M  KGL P+  TY  L+    +EG++D AI   
Sbjct  466  TVIDGLSKAGETERAIKLLYEMQRKGLKPDIITYSSLVGGLSREGKVDEAIKFF  519


 Score =   168 bits (425),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 156/295 (53%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    LI G+    + ++A+K +  +  +G   N
Sbjct  261  TCKESGVGQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIKFLNNMPSYGCHSN  320

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  321  VITHNIILRSMCSTGRWMDAEKLLAEMVRKGCSPSVVTFNILINFLCRKGLLGRAIDILE  380

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  L+     +  ++ A++ +D M+SRG  P+I TYN +L  LC++
Sbjct  381  KMPK-HGCTPNSLSYNPLLHGFCKEKKMARAIEYLDVMVSRGCYPDIVTYNTLLTALCKD  439

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A   +  L + GC P + +YN ++  L      +   KLL EM   G +P   TY
Sbjct  440  GKVDIAVVILNQLSSKGCSPVLITYNTVIDGLSKAGETERAIKLLYEMQRKGLKPDIITY  499

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI     +   G+ PN  T++ ++   CK  +   AID L
Sbjct  500  SSLVGGLSREGKVDEAIKFFHDLEGFGIKPNAITFNSIMLGLCKARQTSRAIDFL  554


 Score =   162 bits (409),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/272 (34%), Positives = 150/272 (55%), Gaps = 4/272 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV+ G  P VV    LI  L       +A+ +++ + + G 
Sbjct  328  LRSMCSTGRWMDAEKLLAEMVRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  387

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  ++  A   L+ M SRG +PD+VTYN ++ ++C  GK+ +A+ 
Sbjct  388  TPNSLSYNPLLHGFCKEKKMARAIEYLDVMVSRGCYPDIVTYNTLLTALCKDGKVDIAVV  447

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+     C P ++TY  +I+  + K G +E A+KL+ EM  +GL+P+I TY++++ G
Sbjct  448  ILNQL-SSKGCSPVLITYNTVIDG-LSKAGETERAIKLLYEMQRKGLKPDIITYSSLVGG  505

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +F   L   G KP+  ++N ++  L   R        L  M S GC+P 
Sbjct  506  LSREGKVDEAIKFFHDLEGFGIKPNAITFNSIMLGLCKARQTSRAIDFLAHMVSKGCKPT  565

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
              TY I +  L  +G   +A+ +L  +  +G+
Sbjct  566  EATYTILIEGLAYEGLAKEALELLSELCARGV  597



>ref|XP_010544054.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Tarenaya hassleriana]
Length=596

 Score =   277 bits (709),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/329 (41%), Positives = 209/329 (64%), Gaps = 5/329 (2%)
 Frame = -1

Query  984  KNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVV  805
            K++     S  + N+L   L +++++    L R    G+ +E    ++ MV  G  PD++
Sbjct  77   KSISGHNNSNGHTNSLNSSLVAEDVESNNHLRRLVRNGELDEGFKFMENMVYHGNVPDII  136

Query  804  LCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRM  628
             CT LI+G   + K  KA K++++LE  G  P+V+ Y  +I G+C+   ++ A  VL+RM
Sbjct  137  PCTSLIRGFCRMGKTRKAAKILEILEGSGAVPDVITYNVMISGYCRAGEMDNALSVLDRM  196

Query  627  RSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDG  448
                  PDVVTYN ++ S+CD GKL  A++VLD+  +   C PDV+TYT+LIEAT  + G
Sbjct  197  ---SVSPDVVTYNTILRSLCDSGKLKEAMEVLDRQLQ-RGCYPDVITYTILIEATCKESG  252

Query  447  ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNI  268
            + +AMKL+DEM +RG  P++ TYN ++ G+C+EG +D A EF+ ++P+ GC+P+V ++NI
Sbjct  253  VGQAMKLLDEMRNRGCNPDVVTYNVLVNGICKEGRIDEAIEFLNTMPSFGCQPNVITHNI  312

Query  267  LLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
            +LR++     W D EKLL +M   GC P   T+NI ++ LCR G L +AI +L+ M E G
Sbjct  313  ILRSMCSTGRWIDAEKLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPEHG  372

Query  87   LTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              PN  +Y+PL+  FCKE ++D AI+ L+
Sbjct  373  CYPNSLSYNPLLHGFCKEKKMDRAIEYLE  401


 Score =   189 bits (479),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 161/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK +E + +L   ++ G  PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  213  CDSGKLKEAMEVLDRQLQRGCYPDVITYTILIEATCKESGVGQAMKLLDEMRNRGCNPDV  272

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  273  VTYNVLVNGICKEGRIDEAIEFLNTMPSFGCQPNVITHNIILRSMCSTGRWIDAEKLLAD  332

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  333  MLR-KGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPEHGCYPNSLSYNPLLHGFCKEK  391

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  392  KMDRAIEYLELMVSRGCYPDIVTYNTLLTALCKDGKVDIAVEILNQLSSKGCSPVLITYN  451

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  KA+ +L  M  KGL P+  TY  L+    +EG++D AI L 
Sbjct  452  TVIDGLAKAGKTEKAMKLLDAMRGKGLKPDTITYSSLVGGLSREGKVDEAIKLF  505


 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 159/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G  PDVV    L+ G+    + ++A++ +  +  FG +PN
Sbjct  247  TCKESGVGQAMKLLDEMRNRGCNPDVVTYNVLVNGICKEGRIDEAIEFLNTMPSFGCQPN  306

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  307  VITHNIILRSMCSTGRWIDAEKLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILE  366

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M E + C P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  367  KMPE-HGCYPNSLSYNPLLHGFCKEKKMDRAIEYLELMVSRGCYPDIVTYNTLLTALCKD  425

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      +   KLL  M   G +P T TY
Sbjct  426  GKVDIAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTEKAMKLLDAMRGKGLKPDTITY  485

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI +     + G+  N  T++ ++   CK+ R D AI+ L
Sbjct  486  SSLVGGLSREGKVDEAIKLFHEFEQMGVKANAITFNSIMLGLCKKRRTDNAIEFL  540


 Score =   161 bits (407),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 148/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L       +A+ +++ + + G 
Sbjct  314  LRSMCSTGRWIDAEKLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPEHGC  373

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  374  YPNSLSYNPLLHGFCKEKKMDRAIEYLELMVSRGCYPDIVTYNTLLTALCKDGKVDIAVE  433

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +AMKL+D M  +GL+P+  TY++++ GL
Sbjct  434  ILNQL-SSKGCSPVLITYNTVIDGLAKAGKTEKAMKLLDAMRGKGLKPDTITYSSLVGGL  492

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +       MG K +  ++N ++  L  +R  D+  + L  M   GC+P+ 
Sbjct  493  SREGKVDEAIKLFHEFEQMGVKANAITFNSIMLGLCKKRRTDNAIEFLGYMIERGCKPNE  552

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G   +A+ +L  +  KGL
Sbjct  553  ATYTILIEGIAYEGFAKEALELLNELCRKGL  583



>emb|CAN61988.1| hypothetical protein VITISV_026694 [Vitis vinifera]
Length=553

 Score =   275 bits (704),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 201/301 (67%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ E+    L+ MV  G  PD++ CT LI+G   + K +KA  VM++LEQ 
Sbjct  65   RRLVRN---GELEDGFKFLESMVYRGDIPDIIPCTSLIRGFCRIGKTKKATWVMEILEQS  121

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  ++ A  VL+RM      PDVVTYN ++ ++CD GKL  A
Sbjct  122  GAVPDVITYNVLISGYCKSGEIDNALQVLDRMN---VAPDVVTYNTILRTLCDSGKLKQA  178

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            ++VLD+  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM ++G +P++ TYN ++ 
Sbjct  179  MEVLDRQLQ-KECYPDVITYTILIEATCKESGVGQAMKLLDEMRNKGSKPDVVTYNVLIN  237

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A +F+ ++P+ GC+P+V ++NI+LR++     W D EKLL +M   GC P
Sbjct  238  GICKEGRLDEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLSDMLRKGCSP  297

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M   G TPN  +Y+PL+  FCKE ++D AI+ L
Sbjct  298  SVVTFNILINFLCRQGLLGRAIDILEKMPMHGCTPNSLSYNPLLHGFCKEKKMDRAIEYL  357

Query  3    D  1
            D
Sbjct  358  D  358


 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/295 (35%), Positives = 170/295 (58%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C +G+ +  L +L  M      PDVV    +++ L    K ++A++V+ + L++   P+V
Sbjct  138  CKSGEIDNALQVLDRM---NVAPDVVTYNTILRTLCDSGKLKQAMEVLDRQLQKECYPDV  194

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + V  A  +L+ MR++G  PDVVTYN++I  IC  G+L  A+K L+ 
Sbjct  195  ITYTILIEATCKESGVGQAMKLLDEMRNKGSKPDVVTYNVLINGICKEGRLDEAIKFLNN  254

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C+P+V+T+ +++ +        +A KL+ +ML +G  P++ T+N ++  LCR+G
Sbjct  255  MPS-YGCQPNVITHNIILRSMCSTGRWMDAEKLLSDMLRKGCSPSVVTFNILINFLCRQG  313

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL      +  D   + L  M S GC P   TYN
Sbjct  314  LLGRAIDILEKMPMHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYN  373

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LC+DGK++ A+ +L  ++ KG +P   TY+ +I    K G+ + AI LLD
Sbjct  374  TLLTALCKDGKVDVAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERAIKLLD  428


 Score =   183 bits (464),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 161/291 (55%), Gaps = 2/291 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+         +A+K++  +   G +P+V
Sbjct  170  CDSGKLKQAMEVLDRQLQKECYPDVITYTILIEATCKESGVGQAMKLLDEMRNKGSKPDV  229

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  230  VTYNVLINGICKEGRLDEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLSD  289

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     +  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  290  MLR-KGCSPSVVTFNILINFLCRQGLLGRAIDILEKMPMHGCTPNSLSYNPLLHGFCKEK  348

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  349  KMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSSKGCSPVLITYN  408

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              +  L + GK  +AI +L  M  KGL P+  TY  L+S   +EG++D AI
Sbjct  409  TVIDGLSKVGKTERAIKLLDEMRRKGLKPDIITYSSLVSGLSREGKVDEAI  459


 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/295 (34%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    LI G+    + ++A+K +  +  +G +PN
Sbjct  204  TCKESGVGQAMKLLDEMRNKGSKPDVVTYNVLINGICKEGRLDEAIKFLNNMPSYGCQPN  263

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L+ M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  264  VITHNIILRSMCSTGRWMDAEKLLSDMLRKGCSPSVVTFNILINFLCRQGLLGRAIDILE  323

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M   + C P+ ++Y  L+     +  +  A++ +D M+SRG  P+I TYN +L  LC++
Sbjct  324  KMPM-HGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKD  382

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      +   KLL EM   G +P   TY
Sbjct  383  GKVDVAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERAIKLLDEMRRKGLKPDIITY  442

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  VS L R+GK+++AI     +   G+ PN  TY+ ++   CK  + D AID L
Sbjct  443  SSLVSGLSREGKVDEAIKFFHDLEGLGIRPNAITYNSIMLGLCKSRQTDRAIDFL  497


 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/272 (34%), Positives = 153/272 (56%), Gaps = 4/272 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L       +A+ +++ +   G 
Sbjct  271  LRSMCSTGRWMDAEKLLSDMLRKGCSPSVVTFNILINFLCRQGLLGRAIDILEKMPMHGC  330

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  331  TPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  390

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+     C P ++TY  +I+  + K G +E A+KL+DEM  +GL+P+I TY++++ G
Sbjct  391  ILNQLSS-KGCSPVLITYNTVIDG-LSKVGKTERAIKLLDEMRRKGLKPDIITYSSLVSG  448

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +F   L  +G +P+  +YN ++  L   R  D     L  M S  C+P 
Sbjct  449  LSREGKVDEAIKFFHDLEGLGIRPNAITYNSIMLGLCKSRQTDRAIDFLAYMISKRCKPT  508

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
              TY I +  +  +G   +A+ +L  +  +GL
Sbjct  509  EATYTILIEGIAYEGLAKEALDLLNELCSRGL  540



>ref|XP_006364562.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Solanum tuberosum]
Length=623

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 203/301 (67%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE+   L+ MV  G  PD++ CT LI+G   + + +KA +V+++LE  
Sbjct  135  RRLVRN---GELEESFKHLESMVYRGDIPDIIPCTSLIRGFCRIGQTKKATRVLEILEDS  191

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  ++ A  VL+RM      PDVVTYN ++ S+CD GKL  A
Sbjct  192  GAVPDVITYNVLISGYCKSGEIDNALKVLDRM---SVAPDVVTYNTILRSLCDSGKLKQA  248

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            + VLD+M +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G  P++ TYN ++ 
Sbjct  249  MHVLDRMLQ-KECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCVPDVVTYNVLIN  307

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG ++ A +F+ ++P+ GC+P+V ++NI+LR++     W D EKLL +M   GC P
Sbjct  308  GICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLADMVRKGCSP  367

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+ AFCKE ++D AI+ L
Sbjct  368  SVVTFNILINFLCRKGLLGRAIDLLEKMPKYGCTPNSLSYNPLLHAFCKEKKMDRAIEYL  427

Query  3    D  1
            +
Sbjct  428  E  428


 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/294 (35%), Positives = 158/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ +++L  M++    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  240  CDSGKLKQAMHVLDRMLQKECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCVPDV  299

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R+  A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  300  VTYNVLINGICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLAD  359

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ L+++M   G  PN  +YN +L   C+E 
Sbjct  360  MVR-KGCSPSVVTFNILINFLCRKGLLGRAIDLLEKMPKYGCTPNSLSYNPLLHAFCKEK  418

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++S  GC P   TYN
Sbjct  419  KMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSDKGCSPVLITYN  478

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   AI +L  M EKGL P+  TY   ++   +EG++D AI   
Sbjct  479  TVIDGLSKVGKTELAIELLNEMREKGLQPDIITYSSFVAGLSREGKVDEAIKFF  532


 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 157/295 (53%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G  PDVV    LI G+    +  +A+K +  +  +G +PN
Sbjct  274  TCKESGVGQAMKLLDEMRSKGCVPDVVTYNVLINGICKEGRLNEAIKFLNNMPSYGCQPN  333

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  334  VITHNIILRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDLLE  393

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M +   C P+ ++Y  L+ A   +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  394  KMPK-YGCTPNSLSYNPLLHAFCKEKKMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKD  452

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L   GC P + +YN ++  L      +   +LL EM   G +P   TY
Sbjct  453  GKVDVAVEILNQLSDKGCSPVLITYNTVIDGLSKVGKTELAIELLNEMREKGLQPDIITY  512

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            + FV+ L R+GK+++AI     +    + PN  TY+ ++   CK  + D AID L
Sbjct  513  SSFVAGLSREGKVDEAIKFFHDIEGLDVRPNAITYNAIMLGLCKARQTDRAIDFL  567


 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 142/251 (57%), Gaps = 4/251 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV+ G  P VV    LI  L       +A+ +++ + ++G 
Sbjct  341  LRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDLLEKMPKYGC  400

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+  FCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  401  TPNSLSYNPLLHAFCKEKKMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  460

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+  D  C P ++TY  +I+  + K G +E A++L++EM  +GL+P+I TY++ + G
Sbjct  461  ILNQL-SDKGCSPVLITYNTVIDG-LSKVGKTELAIELLNEMREKGLQPDIITYSSFVAG  518

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +F   +  +  +P+  +YN ++  L   R  D     L  M S GC+P 
Sbjct  519  LSREGKVDEAIKFFHDIEGLDVRPNAITYNAIMLGLCKARQTDRAIDFLAYMISKGCKPT  578

Query  180  TFTYNIFVSSL  148
              TY I +  +
Sbjct  579  ESTYTILIEGI  589



>ref|XP_010321813.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Solanum lycopersicum]
Length=619

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 202/301 (67%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE+   L+ MV  G  PD++ CT LI+G   + + +KA +V+++LE  
Sbjct  131  RRLVRN---GELEESFKHLESMVYRGDIPDIIPCTSLIRGFCRIGQTKKATRVLEILEDS  187

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  ++ A  VL+RM      PDVVTYN ++ S+CD GKL  A
Sbjct  188  GAVPDVITYNVLISGYCKSGEIDNALKVLDRM---SVAPDVVTYNTILRSLCDSGKLKQA  244

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            + VLD+M +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G  P++ TYN ++ 
Sbjct  245  MHVLDRMLQ-KECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCVPDVVTYNVLIN  303

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG ++ A +F+ ++P+ GC+P+V ++NI+LR++     W D EKLL +M   GC P
Sbjct  304  GICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLADMVRKGCSP  363

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+ AFCKE ++D AI  L
Sbjct  364  SVVTFNILINFLCRKGLLGRAIDLLEKMPKYGCTPNSLSYNPLLHAFCKEKKMDRAIQYL  423

Query  3    D  1
            +
Sbjct  424  E  424


 Score =   181 bits (459),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 158/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ +++L  M++    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  236  CDSGKLKQAMHVLDRMLQKECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCVPDV  295

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R+  A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  296  VTYNVLINGICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLAD  355

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ L+++M   G  PN  +YN +L   C+E 
Sbjct  356  MVR-KGCSPSVVTFNILINFLCRKGLLGRAIDLLEKMPKYGCTPNSLSYNPLLHAFCKEK  414

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA +++  + + GC PD+ +YN LL AL      D   ++L ++S  GC P   TYN
Sbjct  415  KMDRAIQYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSDKGCSPVLITYN  474

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   AI +L  M EKGL P+  TY   ++   +EG++D AI   
Sbjct  475  TVIDGLSKVGKTELAIELLNEMREKGLQPDIITYSSFVAGLSREGKVDEAIKFF  528


 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 157/295 (53%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G  PDVV    LI G+    +  +A+K +  +  +G +PN
Sbjct  270  TCKESGVGQAMKLLDEMRSKGCVPDVVTYNVLINGICKEGRLNEAIKFLNNMPSYGCQPN  329

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  330  VITHNIILRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDLLE  389

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M +   C P+ ++Y  L+ A   +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  390  KMPK-YGCTPNSLSYNPLLHAFCKEKKMDRAIQYLEVMVSRGCYPDIVTYNTLLTALCKD  448

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L   GC P + +YN ++  L      +   +LL EM   G +P   TY
Sbjct  449  GKVDVAVEILNQLSDKGCSPVLITYNTVIDGLSKVGKTELAIELLNEMREKGLQPDIITY  508

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            + FV+ L R+GK+++AI     +    + PN  TY+ ++   CK  + D AID L
Sbjct  509  SSFVAGLSREGKVDEAIKFFHDIEGLDVRPNAITYNAIMLGLCKARQTDRAIDFL  563


 Score =   155 bits (392),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 142/251 (57%), Gaps = 4/251 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV+ G  P VV    LI  L       +A+ +++ + ++G 
Sbjct  337  LRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDLLEKMPKYGC  396

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+  FCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  397  TPNSLSYNPLLHAFCKEKKMDRAIQYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  456

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+  D  C P ++TY  +I+  + K G +E A++L++EM  +GL+P+I TY++ + G
Sbjct  457  ILNQL-SDKGCSPVLITYNTVIDG-LSKVGKTELAIELLNEMREKGLQPDIITYSSFVAG  514

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +F   +  +  +P+  +YN ++  L   R  D     L  M S GC+P 
Sbjct  515  LSREGKVDEAIKFFHDIEGLDVRPNAITYNAIMLGLCKARQTDRAIDFLAYMISKGCKPT  574

Query  180  TFTYNIFVSSL  148
              TY I +  +
Sbjct  575  ESTYTILIEGI  585



>ref|XP_008444958.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Cucumis melo]
Length=610

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 199/301 (66%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE    L+ MV  G  PD++ CT LI+GL    K  KA +VM++LE  
Sbjct  120  RRLVRN---GELEEGFKFLEDMVYRGDIPDIIACTSLIRGLCKTGKTRKATRVMEILEDS  176

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  + +A  +L+RM      PDVVTYN ++ ++CD GKL  A
Sbjct  177  GAVPDVITYNVLISGYCKSGEIGSALQLLDRM---SVSPDVVTYNTILRTLCDSGKLKQA  233

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            ++VLD+  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM  +G +P++ TYN ++ 
Sbjct  234  MEVLDRQLQ-RECYPDVITYTILIEATCKESGVGQAMKLLDEMRDKGCKPDVVTYNVLIN  292

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A +F+  +P+ GC+P+V ++NI+LR++     W D EKLL EM   GC P
Sbjct  293  GICKEGRLDEAIKFLNHMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLAEMIRKGCSP  352

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G + +AI +L+ M + G TPN  +Y+PL+  FCKE ++D AI+ L
Sbjct  353  SVVTFNILINFLCRKGLIGRAIDVLEKMPQHGCTPNSLSYNPLLHGFCKEKKMDRAIEYL  412

Query  3    D  1
            D
Sbjct  413  D  413


 Score =   181 bits (460),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 159/291 (55%), Gaps = 2/291 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+         +A+K++  +   G +P+V
Sbjct  225  CDSGKLKQAMEVLDRQLQRECYPDVITYTILIEATCKESGVGQAMKLLDEMRDKGCKPDV  284

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L +
Sbjct  285  VTYNVLINGICKEGRLDEAIKFLNHMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLAE  344

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  I  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  345  MIR-KGCSPSVVTFNILINFLCRKGLIGRAIDVLEKMPQHGCTPNSLSYNPLLHGFCKEK  403

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++ S GC P   TYN
Sbjct  404  KMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDIAVEILNQLGSKGCSPVLITYN  463

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              +  L + GK   AI +L  M  KGL P+  TY  L+    +EG++D AI
Sbjct  464  TVIDGLSKVGKTGDAIKLLDEMKGKGLKPDIITYSTLVGGLSREGKVDEAI  514


 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/295 (34%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    LI G+    + ++A+K +  +  +G +PN
Sbjct  259  TCKESGVGQAMKLLDEMRDKGCKPDVVTYNVLINGICKEGRLDEAIKFLNHMPSYGCQPN  318

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G +G A+ VL+
Sbjct  319  VITHNIILRSMCSTGRWMDAEKLLAEMIRKGCSPSVVTFNILINFLCRKGLIGRAIDVLE  378

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  L+     +  +  A++ +D M+SRG  P+I TYN +L  LC++
Sbjct  379  KMPQ-HGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKD  437

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L       D  KLL EM   G +P   TY
Sbjct  438  GKVDIAVEILNQLGSKGCSPVLITYNTVIDGLSKVGKTGDAIKLLDEMKGKGLKPDIITY  497

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI+    + E G+ PN  TY+ ++   CK  +   AID L
Sbjct  498  STLVGGLSREGKVDEAIAFFHDLEEMGVRPNAITYNSIMLGLCKARQTVRAIDFL  552


 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 148/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L       +A+ V++ + Q G 
Sbjct  326  LRSMCSTGRWMDAEKLLAEMIRKGCSPSVVTFNILINFLCRKGLIGRAIDVLEKMPQHGC  385

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  386  TPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDIAVE  445

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM  +GL+P+I TY+ ++ GL
Sbjct  446  ILNQLGS-KGCSPVLITYNTVIDGLSKVGKTGDAIKLLDEMKGKGLKPDIITYSTLVGGL  504

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A  F   L  MG +P+  +YN ++  L   R        L  M + GC+P  
Sbjct  505  SREGKVDEAIAFFHDLEEMGVRPNAITYNSIMLGLCKARQTVRAIDFLAYMVARGCKPTE  564

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  L  +G   +A+ +L  +  +G+
Sbjct  565  ASYMILIEGLAYEGLTKEALELLDELYSRGV  595



>ref|XP_002285611.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Vitis vinifera]
Length=610

 Score =   276 bits (705),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 201/301 (67%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ E+    L+ MV  G  PD++ CT LI+G   + K +KA  VM++LEQ 
Sbjct  122  RRLVRN---GELEDGFKFLESMVYRGDIPDIIPCTSLIRGFCRIGKTKKATWVMEILEQS  178

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  ++ A  VL+RM      PDVVTYN ++ ++CD GKL  A
Sbjct  179  GAVPDVITYNVLISGYCKSGEIDNALQVLDRM---NVAPDVVTYNTILRTLCDSGKLKQA  235

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            ++VLD+  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM ++G +P++ TYN ++ 
Sbjct  236  MEVLDRQLQ-KECYPDVITYTILIEATCKESGVGQAMKLLDEMRNKGSKPDVVTYNVLIN  294

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A +F+ ++P+ GC+P+V ++NI+LR++     W D EKLL +M   GC P
Sbjct  295  GICKEGRLDEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLSDMLRKGCSP  354

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M   G TPN  +Y+PL+  FCKE ++D AI+ L
Sbjct  355  SVVTFNILINFLCRQGLLGRAIDILEKMPMHGCTPNSLSYNPLLHGFCKEKKMDRAIEYL  414

Query  3    D  1
            D
Sbjct  415  D  415


 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/295 (35%), Positives = 170/295 (58%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C +G+ +  L +L  M      PDVV    +++ L    K ++A++V+ + L++   P+V
Sbjct  195  CKSGEIDNALQVLDRM---NVAPDVVTYNTILRTLCDSGKLKQAMEVLDRQLQKECYPDV  251

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + V  A  +L+ MR++G  PDVVTYN++I  IC  G+L  A+K L+ 
Sbjct  252  ITYTILIEATCKESGVGQAMKLLDEMRNKGSKPDVVTYNVLINGICKEGRLDEAIKFLNN  311

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C+P+V+T+ +++ +        +A KL+ +ML +G  P++ T+N ++  LCR+G
Sbjct  312  MPS-YGCQPNVITHNIILRSMCSTGRWMDAEKLLSDMLRKGCSPSVVTFNILINFLCRQG  370

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL      +  D   + L  M S GC P   TYN
Sbjct  371  LLGRAIDILEKMPMHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYN  430

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LC+DGK++ A+ +L  ++ KG +P   TY+ +I    K G+ + AI LLD
Sbjct  431  TLLTALCKDGKVDVAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERAIKLLD  485


 Score =   183 bits (465),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 161/291 (55%), Gaps = 2/291 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+         +A+K++  +   G +P+V
Sbjct  227  CDSGKLKQAMEVLDRQLQKECYPDVITYTILIEATCKESGVGQAMKLLDEMRNKGSKPDV  286

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  287  VTYNVLINGICKEGRLDEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLSD  346

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     +  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  347  MLR-KGCSPSVVTFNILINFLCRQGLLGRAIDILEKMPMHGCTPNSLSYNPLLHGFCKEK  405

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  406  KMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSSKGCSPVLITYN  465

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              +  L + GK  +AI +L  M  KGL P+  TY  L+S   +EG++D AI
Sbjct  466  TVIDGLSKVGKTERAIKLLDEMRRKGLKPDIITYSSLVSGLSREGKVDEAI  516


 Score =   179 bits (453),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/295 (34%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    LI G+    + ++A+K +  +  +G +PN
Sbjct  261  TCKESGVGQAMKLLDEMRNKGSKPDVVTYNVLINGICKEGRLDEAIKFLNNMPSYGCQPN  320

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L+ M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  321  VITHNIILRSMCSTGRWMDAEKLLSDMLRKGCSPSVVTFNILINFLCRQGLLGRAIDILE  380

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M   + C P+ ++Y  L+     +  +  A++ +D M+SRG  P+I TYN +L  LC++
Sbjct  381  KMPM-HGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKD  439

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      +   KLL EM   G +P   TY
Sbjct  440  GKVDVAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERAIKLLDEMRRKGLKPDIITY  499

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  VS L R+GK+++AI     +   G+ PN  TY+ ++   CK  + D AID L
Sbjct  500  SSLVSGLSREGKVDEAIKFFHDLEGLGIRPNAITYNSIMLGLCKSRQTDRAIDFL  554


 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/272 (34%), Positives = 153/272 (56%), Gaps = 4/272 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L       +A+ +++ +   G 
Sbjct  328  LRSMCSTGRWMDAEKLLSDMLRKGCSPSVVTFNILINFLCRQGLLGRAIDILEKMPMHGC  387

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  388  TPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  447

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+     C P ++TY  +I+  + K G +E A+KL+DEM  +GL+P+I TY++++ G
Sbjct  448  ILNQL-SSKGCSPVLITYNTVIDG-LSKVGKTERAIKLLDEMRRKGLKPDIITYSSLVSG  505

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +F   L  +G +P+  +YN ++  L   R  D     L  M S  C+P 
Sbjct  506  LSREGKVDEAIKFFHDLEGLGIRPNAITYNSIMLGLCKSRQTDRAIDFLAYMISKRCKPT  565

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
              TY I +  +  +G   +A+ +L  +  +GL
Sbjct  566  EATYTILIEGIAYEGLAKEALDLLNELCSRGL  597



>ref|XP_011071341.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Sesamum indicum]
Length=600

 Score =   275 bits (704),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 200/301 (66%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE    L+ MV  G  PD++ CT LI+G   + K +KA +VM++LE  
Sbjct  112  RRLVRN---GELEEGFKHLENMVCRGDIPDIIPCTSLIRGFCRIGKTKKATRVMEILEDS  168

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  +  A  VL+RM      PDVVTYN ++ ++CD GKL  A
Sbjct  169  GAVPDVITYNVLISGYCKSGEIHNALKVLDRM---SVAPDVVTYNTILRTLCDSGKLKQA  225

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            + VL+Q  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ TYN ++ 
Sbjct  226  MDVLNQQLQ-KECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDVVTYNVLIN  284

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A +F+ ++P+ GC+P+V ++NI+LR++     W D EK+L EM   GC P
Sbjct  285  GICKEGRLDEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWIDAEKMLAEMLRKGCSP  344

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+  FCKE ++D AI+ L
Sbjct  345  SVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYL  404

Query  3    D  1
            +
Sbjct  405  E  405


 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/294 (34%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+         +A+K++  +   G +P+V
Sbjct  217  CDSGKLKQAMDVLNQQLQKECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDV  276

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L +
Sbjct  277  VTYNVLINGICKEGRLDEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWIDAEKMLAE  336

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  337  MLR-KGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEK  395

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L +++S GC P   TYN
Sbjct  396  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDIAVEILNQLNSKGCSPVLITYN  455

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  +A+ +L  M E+GL P+  TY  L+    +EG+++ AI   
Sbjct  456  TVIDGLSKMGKTERAMQLLVEMRERGLKPDIITYSSLVGGLSREGKVEAAIKFF  509


 Score =   175 bits (444),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/295 (33%), Positives = 158/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    LI G+    + ++A+K +  +  +G +PN
Sbjct  251  TCKESGVGQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIKFLNNMPSYGCQPN  310

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  311  VITHNIILRSMCSTGRWIDAEKMLAEMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILE  370

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  371  KMPK-HGCTPNSLSYNPLLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKD  429

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      +   +LL EM   G +P   TY
Sbjct  430  GKVDIAVEILNQLNSKGCSPVLITYNTVIDGLSKMGKTERAMQLLVEMRERGLKPDIITY  489

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+  AI   K +   G+ PN  TY+ ++   CK  + D AID L
Sbjct  490  SSLVGGLSREGKVEAAIKFFKELEGSGVRPNAITYNSIMLGLCKARQTDRAIDFL  544


 Score =   161 bits (407),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 148/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   +L  M++ G  P VV    LI  L       +A+ +++ + + G 
Sbjct  318  LRSMCSTGRWIDAEKMLAEMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  377

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  378  TPNSLSYNPLLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDIAVE  437

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+          AM+L+ EM  RGL+P+I TY++++ GL
Sbjct  438  ILNQLN-SKGCSPVLITYNTVIDGLSKMGKTERAMQLLVEMRERGLKPDIITYSSLVGGL  496

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG V+ A +F + L   G +P+  +YN ++  L   R  D     L  M S GC+P  
Sbjct  497  SREGKVEAAIKFFKELEGSGVRPNAITYNSIMLGLCKARQTDRAIDFLVYMVSKGCKPTE  556

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  L  +G   +A+ +L  +  +G+
Sbjct  557  STYTILIEGLAYEGFTKEALELLNELCSRGV  587



>ref|XP_006472405.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Citrus sinensis]
Length=619

 Score =   275 bits (704),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 209/328 (64%), Gaps = 8/328 (2%)
 Frame = -1

Query  981  NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVL  802
            +L +  +S+   N+ +   D +  +  RRL R+   G+ EE    L+ MV  G  PD++ 
Sbjct  104  HLNNGHISSGMENSSLNFEDFESNNHLRRLVRN---GELEEGFKFLESMVYHGDIPDIIP  160

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMR  625
            CT LI+G   V K  KA +VM+++E  G  P+V+ Y  LI G+C+   ++ A  VL RM 
Sbjct  161  CTSLIRGFCKVGKTRKATRVMEIVEDSGAVPDVITYNVLISGYCRLGEIDNALQVLERM-  219

Query  624  SRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGI  445
                 PDVVTYN ++ ++CD GKL LA++VL +  E   C PDV+TYT+LIEAT  + G+
Sbjct  220  --SVAPDVVTYNTILRTLCDSGKLNLAMEVLHKQLE-KECYPDVITYTILIEATCKESGV  276

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
             +AMKL+DEM ++G  P++ TYN ++ G+C+EG +D A +F+  +P+ GC+P+V ++NI+
Sbjct  277  GQAMKLLDEMRNKGCIPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNII  336

Query  264  LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
            LR++     W D E+LL EM   GC P   T+NI ++ LCR G L +AI +L+ M + G 
Sbjct  337  LRSMCSTGRWMDAERLLAEMVHKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  396

Query  84   TPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TPN  +Y+P++  FCKE ++D AI+ L+
Sbjct  397  TPNSLSYNPVLHGFCKEKKMDRAIEYLE  424


 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 159/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK    + +L   ++    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  236  CDSGKLNLAMEVLHKQLEKECYPDVITYTILIEATCKESGVGQAMKLLDEMRNKGCIPDV  295

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A ++L +
Sbjct  296  VTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNIILRSMCSTGRWMDAERLLAE  355

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  356  MVH-KGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPVLHGFCKEK  414

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++S+  C P   TYN
Sbjct  415  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSNKHCSPVLITYN  474

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  +A+ +L+ M  KGL P+  TY  L+    +EG++D AI L 
Sbjct  475  TVIDGLSKVGKTEQAMKLLEEMRTKGLKPDTITYSSLVGGLSREGKVDEAIKLF  528


 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G  PDVV    L+ G+    + ++A+K +  +  +G +PN
Sbjct  270  TCKESGVGQAMKLLDEMRNKGCIPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPN  329

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  330  VITHNIILRSMCSTGRWMDAERLLAEMVHKGCSPSVVTFNILINFLCRKGLLGRAIDILE  389

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  ++     +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  390  KMPK-HGCTPNSLSYNPVLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKD  448

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L    C P + +YN ++  L      +   KLL+EM + G +P T TY
Sbjct  449  GKVDVAVEILNQLSNKHCSPVLITYNTVIDGLSKVGKTEQAMKLLEEMRTKGLKPDTITY  508

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI +   +   G+ PN  TY+ ++   CK  +   AID+L
Sbjct  509  SSLVGGLSREGKVDEAIKLFHDLERLGVRPNVITYNSIMLGLCKARQTYRAIDIL  563


 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 151/271 (56%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV  G  P VV    LI  L       +A+ +++ + + G 
Sbjct  337  LRSMCSTGRWMDAERLLAEMVHKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  396

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  ++ GFCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  397  TPNSLSYNPVLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  456

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+  + +C P ++TY  +I+         +AMKL++EM ++GL+P+  TY++++ GL
Sbjct  457  ILNQLS-NKHCSPVLITYNTVIDGLSKVGKTEQAMKLLEEMRTKGLKPDTITYSSLVGGL  515

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +    L  +G +P+V +YN ++  L   R       +L +M +  C+P  
Sbjct  516  SREGKVDEAIKLFHDLERLGVRPNVITYNSIMLGLCKARQTYRAIDILADMVTRSCKPTE  575

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G   +A+ +L  +  +G+
Sbjct  576  ATYTILIEGIAYEGLAKEALDLLNQLCSRGV  606



>ref|XP_010671063.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Beta vulgaris subsp. vulgaris]
Length=613

 Score =   275 bits (703),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 199/300 (66%), Gaps = 8/300 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ +E    L+ MV  G  PD++ CT LI+G   V K  KA +V+++LE  
Sbjct  125  RRLVRN---GELDEAFRYLESMVYRGDIPDIIPCTSLIRGFCRVGKTRKATRVLEILEDS  181

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+C+   ++ A  +L+RM      PDVVTYN ++ S+CD GKL  A
Sbjct  182  GAVPDVITYNVLISGYCRAGEMDNALKLLDRM---SVAPDVVTYNTILRSLCDSGKLKQA  238

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            +KVLD+  E   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ TYN ++ 
Sbjct  239  MKVLDRQME-RECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDVVTYNVLIN  297

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A +F+ ++ ++GCKP+V ++NI+LR++     W D EKLL +M   GC P
Sbjct  298  GICKEGRLDEAIDFLNNMVSLGCKPNVITHNIILRSMCSTGRWMDAEKLLTDMLGKGCSP  357

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI ML  M + G TPN  +Y+PL+ AFCKE ++D A++ L
Sbjct  358  SVVTFNILINFLCRKGLLGRAIDMLDKMPKHGCTPNSLSYNPLLHAFCKEKKMDRALEYL  417


 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/295 (36%), Positives = 169/295 (57%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C AG+ +  L LL  M      PDVV    +++ L    K ++A+KV+ + +E+   P+V
Sbjct  198  CRAGEMDNALKLLDRM---SVAPDVVTYNTILRSLCDSGKLKQAMKVLDRQMERECYPDV  254

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + V  A  +L+ MRS+G  PDVVTYN++I  IC  G+L  A+  L+ 
Sbjct  255  ITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIDFLNN  314

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     CKP+V+T+ +++ +        +A KL+ +ML +G  P++ T+N ++  LCR+G
Sbjct  315  MVS-LGCKPNVITHNIILRSMCSTGRWMDAEKLLTDMLGKGCSPSVVTFNILINFLCRKG  373

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL A    +  D   + L  M S GC P   TYN
Sbjct  374  LLGRAIDMLDKMPKHGCTPNSLSYNPLLHAFCKEKKMDRALEYLGIMVSRGCYPDIVTYN  433

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LC+DG ++ A+ +L  ++ KG +P   TY+ +I    K G+ + AI LLD
Sbjct  434  TLLTALCKDGNVDVALEILNQLSSKGCSPVLITYNTVIDGLAKSGKTEHAIKLLD  488


 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 161/291 (55%), Gaps = 2/291 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+         +A+K++  +   G +P+V
Sbjct  230  CDSGKLKQAMKVLDRQMERECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDV  289

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  290  VTYNVLINGICKEGRLDEAIDFLNNMVSLGCKPNVITHNIILRSMCSTGRWMDAEKLLTD  349

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++D+M   G  PN  +YN +L   C+E 
Sbjct  350  ML-GKGCSPSVVTFNILINFLCRKGLLGRAIDMLDKMPKHGCTPNSLSYNPLLHAFCKEK  408

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL    N D   ++L ++SS GC P   TYN
Sbjct  409  KMDRALEYLGIMVSRGCYPDIVTYNTLLTALCKDGNVDVALEILNQLSSKGCSPVLITYN  468

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              +  L + GK   AI +L  M +KGL P+  TY  L+S   +EG+++ AI
Sbjct  469  TVIDGLAKSGKTEHAIKLLDEMQKKGLQPDIITYSSLVSGLSREGKIEEAI  519


 Score =   173 bits (439),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 155/295 (53%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    LI G+    + ++A+  +  +   G +PN
Sbjct  264  TCKESGVGQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIDFLNNMVSLGCKPN  323

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +LD
Sbjct  324  VITHNIILRSMCSTGRWMDAEKLLTDMLGKGCSPSVVTFNILINFLCRKGLLGRAIDMLD  383

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  L+ A   +  +  A++ +  M+SRG  P+I TYN +L  LC++
Sbjct  384  KMPK-HGCTPNSLSYNPLLHAFCKEKKMDRALEYLGIMVSRGCYPDIVTYNTLLTALCKD  442

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      +   KLL EM   G +P   TY
Sbjct  443  GNVDVALEILNQLSSKGCSPVLITYNTVIDGLAKSGKTEHAIKLLDEMQKKGLQPDIITY  502

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  VS L R+GK+ +AI     +   G+ PN  TY+ ++   CK      AID L
Sbjct  503  SSLVSGLSREGKIEEAIKFFHEIEGLGIQPNAITYNSIMLGLCKARDTARAIDFL  557


 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 149/272 (55%), Gaps = 4/272 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M+  G  P VV    LI  L       +A+ ++  + + G 
Sbjct  331  LRSMCSTGRWMDAEKLLTDMLGKGCSPSVVTFNILINFLCRKGLLGRAIDMLDKMPKHGC  390

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+  FCK  +++ A   L  M SRG +PD+VTYN ++ ++C  G + +AL+
Sbjct  391  TPNSLSYNPLLHAFCKEKKMDRALEYLGIMVSRGCYPDIVTYNTLLTALCKDGNVDVALE  450

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+     C P ++TY  +I+  + K G +E A+KL+DEM  +GL+P+I TY++++ G
Sbjct  451  ILNQLSS-KGCSPVLITYNTVIDG-LAKSGKTEHAIKLLDEMQKKGLQPDIITYSSLVSG  508

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG ++ A +F   +  +G +P+  +YN ++  L   R+       L  M S GC+P 
Sbjct  509  LSREGKIEEAIKFFHEIEGLGIQPNAITYNSIMLGLCKARDTARAIDFLAFMVSRGCKPT  568

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
              TY I V  +  +G   +A+ +L  +  +G 
Sbjct  569  ETTYTILVEGIAYEGLTKEALELLSELCARGF  600


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  DVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISML  109
            D F  N  LR L+     D+  + L+ M   G  P        +   CR GK  KA  +L
Sbjct  116  DEFESNNHLRRLVRNGELDEAFRYLESMVYRGDIPDIIPCTSLIRGFCRVGKTRKATRVL  175

Query  108  KIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +I+ + G  P+  TY+ LIS +C+ G +D A+ LLD
Sbjct  176  EILEDSGAVPDVITYNVLISGYCRAGEMDNALKLLD  211



>gb|KDO81276.1| hypothetical protein CISIN_1g043144mg, partial [Citrus sinensis]
Length=580

 Score =   274 bits (701),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 209/328 (64%), Gaps = 8/328 (2%)
 Frame = -1

Query  981  NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVL  802
            +L +  +S+   N+ +   D +  +  RRL R+   G+ EE    L+ MV  G  PD++ 
Sbjct  65   HLNNGHISSGMENSSLNFEDFESNNHLRRLVRN---GELEEGFKFLESMVYHGDIPDIIP  121

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMR  625
            CT LI+G   V K  KA +VM+++E  G  P+V+ Y  LI G+C+   ++ A  VL RM 
Sbjct  122  CTSLIRGFCKVGKTRKATRVMEIVEDSGAVPDVITYNVLISGYCRLGEIDNALQVLERM-  180

Query  624  SRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGI  445
                 PDVVTYN ++ ++CD GKL LA++VL +  E   C PDV+TYT+LIEAT  + G+
Sbjct  181  --SVAPDVVTYNTILRTLCDSGKLNLAMEVLHKQLE-KECYPDVITYTILIEATCKESGV  237

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
             +AMKL+DEM ++G  P++ TYN ++ G+C+EG +D A +F+  +P+ GC+P+V ++NI+
Sbjct  238  GQAMKLLDEMRNKGCIPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNII  297

Query  264  LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
            LR++     W D E+LL EM   GC P   T+NI ++ LCR G L +AI +L+ M + G 
Sbjct  298  LRSMCSTGRWMDAERLLAEMVLKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  357

Query  84   TPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TPN  +Y+P++  FCKE ++D AI+ L+
Sbjct  358  TPNSLSYNPVLHGFCKEKKMDRAIEYLE  385


 Score =   175 bits (444),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 159/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK    + +L   ++    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  197  CDSGKLNLAMEVLHKQLEKECYPDVITYTILIEATCKESGVGQAMKLLDEMRNKGCIPDV  256

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A ++L +
Sbjct  257  VTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNIILRSMCSTGRWMDAERLLAE  316

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  317  MVL-KGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPVLHGFCKEK  375

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++S+  C P   TYN
Sbjct  376  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSNKHCSPVLITYN  435

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  +A+ +L+ M  KGL P+  TY  L+    +EG++D AI L 
Sbjct  436  TVIDGLSKVGKTEQAMKLLEEMRTKGLKPDTITYSSLVGGLSREGKVDEAIKLF  489


 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G  PDVV    L+ G+    + ++A+K +  +  +G +PN
Sbjct  231  TCKESGVGQAMKLLDEMRNKGCIPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPN  290

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  291  VITHNIILRSMCSTGRWMDAERLLAEMVLKGCSPSVVTFNILINFLCRKGLLGRAIDILE  350

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  ++     +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  351  KMPK-HGCTPNSLSYNPVLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKD  409

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L    C P + +YN ++  L      +   KLL+EM + G +P T TY
Sbjct  410  GKVDVAVEILNQLSNKHCSPVLITYNTVIDGLSKVGKTEQAMKLLEEMRTKGLKPDTITY  469

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI +   +   G+ PN  TY+ ++   CK  +   AID+L
Sbjct  470  SSLVGGLSREGKVDEAIKLFHDLERLGVRPNVITYNSIMLGLCKARQTYRAIDIL  524


 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 151/271 (56%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV  G  P VV    LI  L       +A+ +++ + + G 
Sbjct  298  LRSMCSTGRWMDAERLLAEMVLKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  357

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  ++ GFCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  358  TPNSLSYNPVLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  417

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+  + +C P ++TY  +I+         +AMKL++EM ++GL+P+  TY++++ GL
Sbjct  418  ILNQL-SNKHCSPVLITYNTVIDGLSKVGKTEQAMKLLEEMRTKGLKPDTITYSSLVGGL  476

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +    L  +G +P+V +YN ++  L   R       +L +M +  C+P  
Sbjct  477  SREGKVDEAIKLFHDLERLGVRPNVITYNSIMLGLCKARQTYRAIDILADMVTRSCKPTE  536

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G   +A+ +L  +  +G+
Sbjct  537  ATYTILIEGIAYEGLAKEALDLLNQLCSRGV  567



>ref|XP_006433766.1| hypothetical protein CICLE_v10000605mg [Citrus clementina]
 gb|ESR47006.1| hypothetical protein CICLE_v10000605mg [Citrus clementina]
Length=619

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 209/328 (64%), Gaps = 8/328 (2%)
 Frame = -1

Query  981  NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVL  802
            +L +  +S+   N+ +   D +  +  RRL R+   G+ EE    L+ MV  G  PD++ 
Sbjct  104  HLNNGHISSGMENSSLNFEDFESNNHLRRLVRN---GELEEGFKFLESMVYHGDIPDIIP  160

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMR  625
            CT LI+G   V K  KA +VM+++E  G  P+V+ Y  LI G+C+   ++ A  VL RM 
Sbjct  161  CTSLIRGFCKVGKTRKATRVMEIVEDSGAVPDVITYNVLISGYCRLGEIDNALQVLERM-  219

Query  624  SRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGI  445
                 PDVVTYN ++ ++CD GKL LA++VL +  E   C PDV+TYT+LIEAT  + G+
Sbjct  220  --SVAPDVVTYNTILRTLCDSGKLNLAMEVLHKQLE-KECYPDVITYTILIEATCKESGV  276

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
             +AMKL+DEM ++G  P++ TYN ++ G+C+EG +D A +F+  +P+ GC+P+V ++NI+
Sbjct  277  GQAMKLLDEMRNKGCIPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNII  336

Query  264  LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
            LR++     W D E+LL EM   GC P   T+NI ++ LCR G L +AI +L+ M + G 
Sbjct  337  LRSMCSTGRWMDAERLLAEMVLKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  396

Query  84   TPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TPN  +Y+P++  FCKE ++D AI+ L+
Sbjct  397  TPNSLSYNPVLHGFCKEKKMDRAIEYLE  424


 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 159/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK    + +L   ++    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  236  CDSGKLNLAMEVLHKQLEKECYPDVITYTILIEATCKESGVGQAMKLLDEMRNKGCIPDV  295

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A ++L +
Sbjct  296  VTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNIILRSMCSTGRWMDAERLLAE  355

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  356  MVL-KGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPVLHGFCKEK  414

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++S+  C P   TYN
Sbjct  415  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSNKHCSPVLITYN  474

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  +A+ +L+ M  KGL P+  TY  L+    +EG++D AI L 
Sbjct  475  TVIDGLSKVGKTEQAMKLLEEMRTKGLKPDTITYSSLVGGLSREGKVDEAIKLF  528


 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/298 (32%), Positives = 161/298 (54%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            +  +C      + + LL  M   G  PDVV    L+ G+    + ++A+K +  +  +G 
Sbjct  267  IEATCKESGVGQAMKLLDEMRNKGCIPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGC  326

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PNV+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ 
Sbjct  327  QPNVITHNIILRSMCSTGRWMDAERLLAEMVLKGCSPSVVTFNILINFLCRKGLLGRAID  386

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L++M + + C P+ ++Y  ++     +  +  A++ ++ M+SRG  P+I TYN +L  L
Sbjct  387  ILEKMPK-HGCTPNSLSYNPVLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTAL  445

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G VD A E +  L    C P + +YN ++  L      +   KLL+EM + G +P T
Sbjct  446  CKDGKVDVAVEILNQLSNKHCSPVLITYNTVIDGLSKVGKTEQAMKLLEEMRTKGLKPDT  505

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+  V  L R+GK+++AI +   +   G+ PN  TY+ +I   CK  +   AID+L
Sbjct  506  ITYSSLVGGLSREGKVDEAIKLFHDLERLGVRPNVITYNSIILGLCKARQTYRAIDIL  563


 Score =   161 bits (407),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 152/271 (56%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV  G  P VV    LI  L       +A+ +++ + + G 
Sbjct  337  LRSMCSTGRWMDAERLLAEMVLKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  396

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  ++ GFCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  397  TPNSLSYNPVLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  456

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+  + +C P ++TY  +I+         +AMKL++EM ++GL+P+  TY++++ GL
Sbjct  457  ILNQL-SNKHCSPVLITYNTVIDGLSKVGKTEQAMKLLEEMRTKGLKPDTITYSSLVGGL  515

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +    L  +G +P+V +YN ++  L   R       +L +M + GC+P  
Sbjct  516  SREGKVDEAIKLFHDLERLGVRPNVITYNSIILGLCKARQTYRAIDILADMVTRGCKPTE  575

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G   +A+ +L  +  +G+
Sbjct  576  ATYTILIEGIAYEGLAKEALDLLNQLCSRGV  606



>ref|XP_009800134.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Nicotiana sylvestris]
Length=587

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 202/301 (67%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE+   L+ MV  G  PD++ CT LI+G   +   +KA +V+++LE  
Sbjct  99   RRLVRN---GELEESFKHLESMVYGGDIPDIIPCTSLIRGFCRIGLTKKATRVLEILEDS  155

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  ++ A  VL+RM      PDVVTYN ++ ++CD GKL  A
Sbjct  156  GAVPDVITYNVLISGYCKSGEIDNALKVLDRM---SVAPDVVTYNTILRTLCDSGKLKQA  212

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            + VLD+M +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G  P++ TYN ++ 
Sbjct  213  MHVLDRMLQ-RECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCIPDVVTYNVLIN  271

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG ++ A +F+ ++P+ GC+P+V ++NI+LR++     W D EKLL +M   GC P
Sbjct  272  GICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLADMVRKGCSP  331

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+ AFCKE ++D AI+ L
Sbjct  332  SVVTFNILINFLCRKGLLGRAIDLLERMPKYGCTPNSLSYNPLLHAFCKEKKMDRAIEYL  391

Query  3    D  1
            +
Sbjct  392  E  392


 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 158/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ +++L  M++    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  204  CDSGKLKQAMHVLDRMLQRECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCIPDV  263

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R+  A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  264  VTYNVLINGICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLAD  323

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ L++ M   G  PN  +YN +L   C+E 
Sbjct  324  MVR-KGCSPSVVTFNILINFLCRKGLLGRAIDLLERMPKYGCTPNSLSYNPLLHAFCKEK  382

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++S  GC P   TYN
Sbjct  383  KMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSDKGCSPVLITYN  442

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   AI +L  M EKGL P+  TY  L+S   +EG++D AI   
Sbjct  443  TVIDGLSKVGKTELAIELLNEMREKGLQPDIITYSSLVSGLSREGKVDEAIKFF  496


 Score =   163 bits (413),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 155/295 (53%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G  PDVV    LI G+    +  +A+K +  +  +G +PN
Sbjct  238  TCKESGVGQAMKLLDEMRSKGCIPDVVTYNVLINGICKEGRLNEAIKFLNNMPSYGCQPN  297

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  298  VITHNIILRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDLLE  357

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M +   C P+ ++Y  L+ A   +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  358  RMPK-YGCTPNSLSYNPLLHAFCKEKKMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKD  416

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L   GC P + +YN ++  L      +   +LL EM   G +P   TY
Sbjct  417  GKVDVAVEILNQLSDKGCSPVLITYNTVIDGLSKVGKTELAIELLNEMREKGLQPDIITY  476

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  VS L R+GK+++AI     +    + PN  TY+ ++   CK  +   AID L
Sbjct  477  SSLVSGLSREGKVDEAIKFFHDLEGLDVRPNAITYNAIMLGLCKARQTVRAIDFL  531


 Score =   158 bits (400),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 153/272 (56%), Gaps = 4/272 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV+ G  P VV    LI  L       +A+ +++ + ++G 
Sbjct  305  LRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDLLERMPKYGC  364

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+  FCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  365  TPNSLSYNPLLHAFCKEKKMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  424

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+  D  C P ++TY  +I+  + K G +E A++L++EM  +GL+P+I TY++++ G
Sbjct  425  ILNQLS-DKGCSPVLITYNTVIDG-LSKVGKTELAIELLNEMREKGLQPDIITYSSLVSG  482

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +F   L  +  +P+  +YN ++  L   R        L  M S GC+P 
Sbjct  483  LSREGKVDEAIKFFHDLEGLDVRPNAITYNAIMLGLCKARQTVRAIDFLAYMISKGCKPT  542

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
              TY I +  +  +G   +A+ +L  +  +G+
Sbjct  543  ESTYTILIEGIAYEGLAEEALDLLNELCCRGV  574



>ref|XP_007018302.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
 gb|EOY15527.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
Length=606

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 210/328 (64%), Gaps = 8/328 (2%)
 Frame = -1

Query  981  NLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVL  802
            +L +  VS+    +L    +S   +  R+  R+   G+ EE   LL+ MV  G  PD++ 
Sbjct  91   HLGNGHVSSSPLKSLHNFEESGSNNQLRKFVRN---GELEEGFKLLEGMVYHGEIPDIIA  147

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMR  625
            CT LI+G     K  KA +VM+++E  G  P+V+ Y  LI G+CK   ++ A  VL+RM 
Sbjct  148  CTSLIRGFCKKGKTRKATRVMEIIEDSGAVPDVITYNVLISGYCKAGEIDNALQVLDRM-  206

Query  624  SRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGI  445
                 PDVVTYN ++ S+CD GKL  A++V+D+  +   C PDV+TYT+LIEAT  + G+
Sbjct  207  --SVAPDVVTYNTILRSLCDSGKLKQAMEVMDRQLQ-RECYPDVITYTILIEATCKESGV  263

Query  444  SEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL  265
             +AMKL+DEM SRG +P++ TYN ++ G+C+EG +D A +F+ ++P+ GC+P+V ++NI+
Sbjct  264  GQAMKLLDEMRSRGCKPDVVTYNVLVNGICKEGRLDEAIKFLNNMPSYGCQPNVITHNII  323

Query  264  LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
            LR++     W D E+LL +M   GC P   T+NI ++ LCR G L +AI +L+ M + G 
Sbjct  324  LRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  383

Query  84   TPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TPN  +Y+PL+  FCKE +++ AI+ L+
Sbjct  384  TPNSLSYNPLLHGFCKEKKMERAIEYLE  411


 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/328 (33%), Positives = 166/328 (51%), Gaps = 38/328 (12%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C AG+ +  L +L  M      PDVV    +++ L    K ++A++VM + L++   P+V
Sbjct  191  CKAGEIDNALQVLDRM---SVAPDVVTYNTILRSLCDSGKLKQAMEVMDRQLQRECYPDV  247

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + V  A  +L+ MRSRG  PDVVTYN+++  IC  G+L  A+K L+ 
Sbjct  248  ITYTILIEATCKESGVGQAMKLLDEMRSRGCKPDVVTYNVLVNGICKEGRLDEAIKFLNN  307

Query  525  MKE----------------------------------DNNCKPDVVTYTVLIEATIVKDG  448
            M                                       C P VVT+ +LI     K  
Sbjct  308  MPSYGCQPNVITHNIILRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKGL  367

Query  447  ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNI  268
            +  A+ ++++M   G  PN  +YN +L G C+E  ++RA E++  + + GC PD+ +YN 
Sbjct  368  LGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMERAIEYLEIMVSRGCYPDIVTYNT  427

Query  267  LLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
            LL AL      D   ++L ++S+ GC P   TYN  +  L + GK ++AI +L+ M  KG
Sbjct  428  LLTALCKDGKVDVAVEILNQLSTKGCSPVLITYNTVIDGLSKVGKTDQAIKLLEEMRAKG  487

Query  87   LTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            L P+  TY  L+    +EG++D AI   
Sbjct  488  LKPDIITYSSLVGGLSREGKVDDAIKFF  515


 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/295 (33%), Positives = 158/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    L+ G+    + ++A+K +  +  +G +PN
Sbjct  257  TCKESGVGQAMKLLDEMRSRGCKPDVVTYNVLVNGICKEGRLDEAIKFLNNMPSYGCQPN  316

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  317  VITHNIILRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILE  376

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  377  KMPK-HGCTPNSLSYNPLLHGFCKEKKMERAIEYLEIMVSRGCYPDIVTYNTLLTALCKD  435

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L   GC P + +YN ++  L      D   KLL+EM + G +P   TY
Sbjct  436  GKVDVAVEILNQLSTKGCSPVLITYNTVIDGLSKVGKTDQAIKLLEEMRAKGLKPDIITY  495

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK++ AI         G+ PN  TY+ ++   CK  + D AID L
Sbjct  496  SSLVGGLSREGKVDDAIKFFHDFERMGIRPNAITYNSIMLGLCKARQTDRAIDFL  550


 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 150/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L       +A+ +++ + + G 
Sbjct  324  LRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  383

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  ++E A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  384  TPNSLSYNPLLHGFCKEKKMERAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  443

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL++EM ++GL+P+I TY++++ GL
Sbjct  444  ILNQL-STKGCSPVLITYNTVIDGLSKVGKTDQAIKLLEEMRAKGLKPDIITYSSLVGGL  502

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F      MG +P+  +YN ++  L   R  D     L  M   GC+P  
Sbjct  503  SREGKVDDAIKFFHDFERMGIRPNAITYNSIMLGLCKARQTDRAIDFLAYMVMRGCKPTE  562

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  L  +G  N+A+ +L  +  +G+
Sbjct  563  STYTILIEGLAYEGFANEALELLNELCSRGV  593



>ref|XP_011016979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Populus euphratica]
Length=591

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 196/301 (65%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            R+L R+   G+ EE    L+ MV  G  PD++  T LI+G   + K  KA ++M+++E  
Sbjct  103  RKLVRN---GELEEGFRFLENMVYRGEIPDIIASTSLIRGFCKIGKTRKATRIMEIIEDS  159

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK   ++ A  VL+RM      PDVVTYN ++ ++CD GKL  A
Sbjct  160  GAVPDVITYNVLISGYCKAGEIDNALRVLDRM---SVAPDVVTYNTILRTLCDSGKLKQA  216

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            ++VLD+  E   C PDV+TYT+LIEAT  + G+ +AMKL+DEM SRG +P++ TYN ++ 
Sbjct  217  MEVLDRQLE-KECYPDVITYTILIEATCAESGVGQAMKLLDEMRSRGCKPDVVTYNVLVN  275

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A +F+ S+P+ G +P+V ++NI+LR++     W D EKLL EM   GC P
Sbjct  276  GMCKEGRLDEAIKFLNSMPSYGSQPNVITHNIILRSMCSTGRWMDAEKLLTEMVRKGCSP  335

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M   G TPN  +Y+PL+  FCKE ++D AI  L
Sbjct  336  SVVTFNILINFLCRKGLLGRAIDILEKMPTHGCTPNSLSYNPLLHGFCKEKKMDRAIQYL  395

Query  3    D  1
            +
Sbjct  396  E  396


 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 165/294 (56%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+   +     +A+K++  +   G +P+V
Sbjct  208  CDSGKLKQAMEVLDRQLEKECYPDVITYTILIEATCAESGVGQAMKLLDEMRSRGCKPDV  267

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L +
Sbjct  268  VTYNVLVNGMCKEGRLDEAIKFLNSMPSYGSQPNVITHNIILRSMCSTGRWMDAEKLLTE  327

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M + G  PN  +YN +L G C+E 
Sbjct  328  MVR-KGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPTHGCTPNSLSYNPLLHGFCKEK  386

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA +++  + + GC PD+ +YN +L AL      D   +LL ++SS GC P   TYN
Sbjct  387  KMDRAIQYLEIMVSRGCYPDIVTYNTMLTALCKDGKVDAAVELLNQLSSKGCSPVLITYN  446

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK ++A+ +L  M  KGL P+  TY  LI+   +EG+++ A+   
Sbjct  447  TVIDGLSKVGKTDQAVELLHEMRGKGLKPDVITYSSLIAGLSREGKVEEALKFF  500


 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 158/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    L+ G+    + ++A+K +  +  +G +PN
Sbjct  242  TCAESGVGQAMKLLDEMRSRGCKPDVVTYNVLVNGMCKEGRLDEAIKFLNSMPSYGSQPN  301

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  302  VITHNIILRSMCSTGRWMDAEKLLTEMVRKGCSPSVVTFNILINFLCRKGLLGRAIDILE  361

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M   + C P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  362  KMP-THGCTPNSLSYNPLLHGFCKEKKMDRAIQYLEIMVSRGCYPDIVTYNTMLTALCKD  420

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      D   +LL EM   G +P   TY
Sbjct  421  GKVDAAVELLNQLSSKGCSPVLITYNTVIDGLSKVGKTDQAVELLHEMRGKGLKPDVITY  480

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  ++ L R+GK+ +A+     +   G+ PN FTY+ ++   CK  +   AID L
Sbjct  481  SSLIAGLSREGKVEEALKFFHDVEGFGVKPNAFTYNSIMFGLCKAQQTYRAIDFL  535


 Score =   157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 146/271 (54%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV+ G  P VV    LI  L       +A+ +++ +   G 
Sbjct  309  LRSMCSTGRWMDAEKLLTEMVRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPTHGC  368

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L  M SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  369  TPNSLSYNPLLHGFCKEKKMDRAIQYLEIMVSRGCYPDIVTYNTMLTALCKDGKVDAAVE  428

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A++L+ EM  +GL+P++ TY++++ GL
Sbjct  429  LLNQL-SSKGCSPVLITYNTVIDGLSKVGKTDQAVELLHEMRGKGLKPDVITYSSLIAGL  487

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG V+ A +F   +   G KP+ F+YN ++  L   +        L  M S GC+P  
Sbjct  488  SREGKVEEALKFFHDVEGFGVKPNAFTYNSIMFGLCKAQQTYRAIDFLAYMISKGCKPTE  547

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  +  +G   +A+ +L  +  +G+
Sbjct  548  VSYTILIEGIANEGLAKEALELLNELCSRGV  578



>ref|XP_010254618.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Nelumbo nucifera]
Length=624

 Score =   273 bits (698),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 203/309 (66%), Gaps = 5/309 (2%)
 Frame = -1

Query  924  DSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVK  745
             S++ +   +L R    G+ EE    L+ MV  G  PD++ CT LI+G     K +KA +
Sbjct  125  SSEDFESNNQLRRFVRNGELEEGFKFLENMVYHGDIPDIIPCTSLIRGFCRACKTKKATR  184

Query  744  VMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSIC  568
            V+++LE+ G  P+V+ Y  LI G+CK+  +E A  +L+RM      PDVVTYN ++ S+C
Sbjct  185  VLEILEESGAVPDVITYNVLISGYCKSGEIENALQLLDRM---SVAPDVVTYNTILRSLC  241

Query  567  DRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNI  388
            D GKL  A++VLD ++    C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++
Sbjct  242  DSGKLKQAMEVLD-LQLQKECYPDVITYTILIEATCKEFGVGQAMKLLDEMRSKGCKPDV  300

Query  387  YTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKE  208
             TYN ++ G+C+EG +D A +F+ ++P+ GC+P+V ++NI+LR++     W D EKLL +
Sbjct  301  VTYNVLINGICKEGRLDEAMKFLNNIPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLAD  360

Query  207  MSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGR  28
            M   GC P   T+NI ++ LCR G L +AI +L+ M + G  PN  +Y+PL+  FCKE +
Sbjct  361  MIRKGCSPSVVTFNILINFLCRRGLLGRAIDILEKMPKHGCIPNSLSYNPLLHGFCKEKK  420

Query  27   LDLAIDLLD  1
            +D AI+ L+
Sbjct  421  MDRAIEYLE  429


 Score =   178 bits (452),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 158/287 (55%), Gaps = 2/287 (1%)
 Frame = -1

Query  861  ETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALI  685
            + + LL  M   G KPDVV    LI G+    + ++A+K +  +  +G +PNV+ +  ++
Sbjct  283  QAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAMKFLNNIPSYGCQPNVITHNIIL  342

Query  684  GGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNC  505
               C T R   A  +L  M  +G  P VVT+NI+I  +C RG LG A+ +L++M + + C
Sbjct  343  RSMCSTGRWMDAEKLLADMIRKGCSPSVVTFNILINFLCRRGLLGRAIDILEKMPK-HGC  401

Query  504  KPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYE  325
             P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC++G VD A E
Sbjct  402  IPNSLSYNPLLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDIAVE  461

Query  324  FVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLC  145
             +  L + GC P + +YN ++  L    + D   KLL EM + G  P   TY+  V  L 
Sbjct  462  LLHQLGSKGCSPVLITYNTVIDGLSKMGSTDHAVKLLGEMLAKGLRPDIITYSSLVGGLS  521

Query  144  RDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            R+GK+++AI     +   G+ PN  TY+ +I   CK  + D AID L
Sbjct  522  REGKVDEAIKFFHELERLGIRPNAITYNSVILGLCKSRQTDRAIDFL  568


 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 173/325 (53%), Gaps = 8/325 (2%)
 Frame = -1

Query  960  STENRNALIQLLD----SKEIDIRRRLNRS-CGAGKYEETLYLLQYMVKIGYKPDVVLCT  796
            S E  NAL QLLD    + ++     + RS C +GK ++ + +L   ++    PDV+  T
Sbjct  211  SGEIENAL-QLLDRMSVAPDVVTYNTILRSLCDSGKLKQAMEVLDLQLQKECYPDVITYT  269

Query  795  KLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSR  619
             LI+         +A+K++  +   G +P+V+ Y  LI G CK  R++ A   LN + S 
Sbjct  270  ILIEATCKEFGVGQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAMKFLNNIPSY  329

Query  618  GFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE  439
            G  P+V+T+NI++ S+C  G+   A K+L  M     C P VVT+ +LI     +  +  
Sbjct  330  GCQPNVITHNIILRSMCSTGRWMDAEKLLADMIR-KGCSPSVVTFNILINFLCRRGLLGR  388

Query  438  AMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLR  259
            A+ ++++M   G  PN  +YN +L G C+E  +DRA E++  + + GC PD+ +YN LL 
Sbjct  389  AIDILEKMPKHGCIPNSLSYNPLLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  448

Query  258  ALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTP  79
            AL      D   +LL ++ S GC P   TYN  +  L + G  + A+ +L  M  KGL P
Sbjct  449  ALCKDGKVDIAVELLHQLGSKGCSPVLITYNTVIDGLSKMGSTDHAVKLLGEMLAKGLRP  508

Query  78   NKFTYDPLISAFCKEGRLDLAIDLL  4
            +  TY  L+    +EG++D AI   
Sbjct  509  DIITYSSLVGGLSREGKVDEAIKFF  533


 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 148/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L       +A+ +++ + + G 
Sbjct  342  LRSMCSTGRWMDAEKLLADMIRKGCSPSVVTFNILINFLCRRGLLGRAIDILEKMPKHGC  401

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  402  IPNSLSYNPLLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDIAVE  461

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L Q+     C P ++TY  +I+          A+KL+ EML++GL P+I TY++++ GL
Sbjct  462  LLHQLG-SKGCSPVLITYNTVIDGLSKMGSTDHAVKLLGEMLAKGLRPDIITYSSLVGGL  520

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F   L  +G +P+  +YN ++  L   R  D     L  M S GC+P  
Sbjct  521  SREGKVDEAIKFFHELERLGIRPNAITYNSVILGLCKSRQTDRAIDFLAYMVSKGCKPTE  580

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G   +A+ +L  +  +G+
Sbjct  581  ATYTILIEGIAYEGLAKEALELLNELCARGV  611


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 0/99 (0%)
 Frame = -1

Query  297  CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAI  118
            C  + F  N  LR  +     ++G K L+ M   G  P        +   CR  K  KA 
Sbjct  124  CSSEDFESNNQLRRFVRNGELEEGFKFLENMVYHGDIPDIIPCTSLIRGFCRACKTKKAT  183

Query  117  SMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +L+I+ E G  P+  TY+ LIS +CK G ++ A+ LLD
Sbjct  184  RVLEILEESGAVPDVITYNVLISGYCKSGEIENALQLLD  222



>ref|XP_004288876.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Fragaria vesca subsp. vesca]
Length=605

 Score =   272 bits (696),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/307 (43%), Positives = 198/307 (64%), Gaps = 5/307 (2%)
 Frame = -1

Query  918  KEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM  739
            +E +   +L R    G+ EE   LL+ MV  G  PD++ CT LI+G     K  KA ++M
Sbjct  108  EEFESNNQLRRLVRNGELEEGFRLLESMVYQGDIPDIIACTSLIRGFCKSGKTRKATRIM  167

Query  738  QLLEQFGEP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
             +LE+ G   +V+ Y  LI G+C+   ++ A  VL+RM      PDVVTYN ++ ++CD 
Sbjct  168  NILEESGAVLDVITYNVLISGYCRAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDS  224

Query  561  GKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYT  382
            GKL  A++VLD+  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ T
Sbjct  225  GKLKQAMEVLDRQLQ-RECYPDVITYTILIEATCKESGVEQAMKLLDEMKSKGCKPDVVT  283

Query  381  YNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            YN ++ G+C+EG +D A EF+ ++P   C+P+V ++NI+LR++     W D E+LL EM 
Sbjct  284  YNVLINGICKEGRLDEAIEFLNNMPPSDCQPNVITHNIILRSMCSTGRWMDAERLLAEMV  343

Query  201  SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLD  22
              GC P   T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+  FCKE ++D
Sbjct  344  GKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMD  403

Query  21   LAIDLLD  1
             AI+ LD
Sbjct  404  RAIEYLD  410


 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 174/295 (59%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C AG+ +  L +L  M      PDVV    +++ L    K ++A++V+ + L++   P+V
Sbjct  190  CRAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDSGKLKQAMEVLDRQLQRECYPDV  246

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + VE A  +L+ M+S+G  PDVVTYN++I  IC  G+L  A++ L+ 
Sbjct  247  ITYTILIEATCKESGVEQAMKLLDEMKSKGCKPDVVTYNVLINGICKEGRLDEAIEFLNN  306

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   ++C+P+V+T+ +++ +        +A +L+ EM+ +G  P++ T+N ++  LCR+G
Sbjct  307  MPP-SDCQPNVITHNIILRSMCSTGRWMDAERLLAEMVGKGCSPSVVTFNILINFLCRKG  365

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL      +  D   + L  M S GC P   TYN
Sbjct  366  LLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYN  425

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LC+DGK++ A+ +L  ++ KG +P   TY+ +I    K G+ + AI+LL+
Sbjct  426  TLLTALCKDGKVDVAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERAIELLE  480


 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 164/294 (56%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+        E+A+K++  ++  G +P+V
Sbjct  222  CDSGKLKQAMEVLDRQLQRECYPDVITYTILIEATCKESGVEQAMKLLDEMKSKGCKPDV  281

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M      P+V+T+NI++ S+C  G+   A ++L +
Sbjct  282  VTYNVLINGICKEGRLDEAIEFLNNMPPSDCQPNVITHNIILRSMCSTGRWMDAERLLAE  341

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  342  MV-GKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEK  400

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  401  KMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSSKGCSPVLITYN  460

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  +AI +L+ M +KGL P+  TY  L+    +EG++D AI  +
Sbjct  461  TVIDGLSKVGKTERAIELLEEMRKKGLKPDIITYSSLVGGLSREGKVDEAIKFV  514


 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/251 (35%), Positives = 144/251 (57%), Gaps = 4/251 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV  G  P VV    LI  L       +A+ +++ + + G 
Sbjct  323  LRSMCSTGRWMDAERLLAEMVGKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  382

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  383  TPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  442

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+     C P ++TY  +I+  + K G +E A++L++EM  +GL+P+I TY++++ G
Sbjct  443  ILNQL-SSKGCSPVLITYNTVIDG-LSKVGKTERAIELLEEMRKKGLKPDIITYSSLVGG  500

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +FVR L  MG +P+  ++N ++  L   R        L  M S GC+P 
Sbjct  501  LSREGKVDEAIKFVRDLEGMGVRPNAITFNCIMLGLCKARQTSRAIDFLAHMISKGCKPT  560

Query  180  TFTYNIFVSSL  148
              TY I +  +
Sbjct  561  EATYTILIEGI  571


 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 153/317 (48%), Gaps = 37/317 (12%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C     E+ + LL  M   G KPDVV    LI G+    + ++A++ +  +     +PN
Sbjct  256  TCKESGVEQAMKLLDEMKSKGCKPDVVTYNVLINGICKEGRLDEAIEFLNNMPPSDCQPN  315

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  316  VITHNIILRSMCSTGRWMDAERLLAEMVGKGCSPSVVTFNILINFLCRKGLLGRAIDILE  375

Query  528  QMKEDN----------------------------------NCKPDVVTYTVLIEATIVKD  451
            +M +                                     C PD+VTY  L+ A + KD
Sbjct  376  KMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTA-LCKD  434

Query  450  G-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSY  274
            G +  A+++++++ S+G  P + TYN ++ GL + G  +RA E +  +   G KPD+ +Y
Sbjct  435  GKVDVAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERAIELLEEMRKKGLKPDIITY  494

Query  273  NILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTE  94
            + L+  L      D+  K ++++  MG  P+  T+N  +  LC+  + ++AI  L  M  
Sbjct  495  SSLVGGLSREGKVDEAIKFVRDLEGMGVRPNAITFNCIMLGLCKARQTSRAIDFLAHMIS  554

Query  93   KGLTPNKFTYDPLISAF  43
            KG  P + TY  LI   
Sbjct  555  KGCKPTEATYTILIEGI  571



>ref|XP_009595574.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Nicotiana tomentosiformis]
Length=587

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/301 (44%), Positives = 202/301 (67%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE+   L+ MV  G  PD++ CT LI+G   + + +KA +V+++LE  
Sbjct  99   RRLVRN---GELEESFKHLESMVYGGDIPDIIPCTSLIRGFCRIGQTKKATRVLEILEDS  155

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  ++ A  VL+RM      PDVVTYN ++ ++CD GKL  A
Sbjct  156  GAVPDVITYNVLISGYCKSGEIDNALKVLDRM---SVAPDVVTYNTILRTLCDGGKLKQA  212

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            + VL+ M +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G  P++ TYN ++ 
Sbjct  213  MHVLNCMLQ-RECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCIPDVVTYNVLIN  271

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG ++ A +F+ ++P+ GC+P+V ++NI+LR++     W D EKLL +M   GC P
Sbjct  272  GICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLADMVRKGCSP  331

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+ AFCKE ++D AI+ L
Sbjct  332  SVVTFNILINFLCRKGLLGRAIDLLEKMPKYGCTPNSLSYNPLLHAFCKEKKMDRAIEYL  391

Query  3    D  1
            +
Sbjct  392  E  392


 Score =   181 bits (458),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 157/294 (53%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK ++ +++L  M++    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  204  CDGGKLKQAMHVLNCMLQRECYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCIPDV  263

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R+  A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  264  VTYNVLINGICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLAD  323

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ L+++M   G  PN  +YN +L   C+E 
Sbjct  324  MVR-KGCSPSVVTFNILINFLCRKGLLGRAIDLLEKMPKYGCTPNSLSYNPLLHAFCKEK  382

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL          ++L ++S  GC P   TYN
Sbjct  383  KMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVGVAVEILNQLSDKGCSPVLITYN  442

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   AI +L  M EKGL P+  TY  L+S   +EG++D AI   
Sbjct  443  TVIDGLSKVGKTELAIELLNEMREKGLQPDIITYSSLVSGLSREGKVDEAIKFF  496


 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 155/295 (53%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G  PDVV    LI G+    +  +A+K +  +  +G +PN
Sbjct  238  TCKESGVGQAMKLLDEMRSKGCIPDVVTYNVLINGICKEGRLNEAIKFLNNMPSYGCQPN  297

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  298  VITHNIILRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDLLE  357

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M +   C P+ ++Y  L+ A   +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  358  KMPK-YGCTPNSLSYNPLLHAFCKEKKMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKD  416

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G V  A E +  L   GC P + +YN ++  L      +   +LL EM   G +P   TY
Sbjct  417  GKVGVAVEILNQLSDKGCSPVLITYNTVIDGLSKVGKTELAIELLNEMREKGLQPDIITY  476

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  VS L R+GK+++AI     +    + PN  TY+ ++   CK  + D AID L
Sbjct  477  SSLVSGLSREGKVDEAIKFFHDLEGLDVRPNAITYNAIMLGLCKARQTDRAIDFL  531


 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/251 (35%), Positives = 144/251 (57%), Gaps = 4/251 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV+ G  P VV    LI  L       +A+ +++ + ++G 
Sbjct  305  LRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDLLEKMPKYGC  364

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+  FCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+G+A++
Sbjct  365  TPNSLSYNPLLHAFCKEKKMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVGVAVE  424

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+  D  C P ++TY  +I+  + K G +E A++L++EM  +GL+P+I TY++++ G
Sbjct  425  ILNQL-SDKGCSPVLITYNTVIDG-LSKVGKTELAIELLNEMREKGLQPDIITYSSLVSG  482

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +F   L  +  +P+  +YN ++  L   R  D     L  M S GC+P 
Sbjct  483  LSREGKVDEAIKFFHDLEGLDVRPNAITYNAIMLGLCKARQTDRAIDFLAYMISKGCKPT  542

Query  180  TFTYNIFVSSL  148
              TY I +  +
Sbjct  543  ESTYTILIEGI  553



>ref|XP_002302359.2| hypothetical protein POPTR_0002s11020g [Populus trichocarpa]
 gb|EEE81632.2| hypothetical protein POPTR_0002s11020g [Populus trichocarpa]
Length=637

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/292 (45%), Positives = 191/292 (65%), Gaps = 5/292 (2%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAY  697
            G+ EE    L+ MV  G  PD++  T LI+G   + K  KA ++M+++E  G  P+V+ Y
Sbjct  155  GELEEGFRFLENMVYRGEIPDIIASTSLIRGFCKIGKTRKATRIMEIIEDSGAVPDVITY  214

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI G+CK   ++ A  VL+RM      PDVVTYN ++ ++CD GKL  A++VLD+  E
Sbjct  215  NVLISGYCKAGEIDNALRVLDRM---SVAPDVVTYNTILRTLCDSGKLKQAMEVLDRQLE  271

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
               C PDV+TYT+LIEAT  + G+ +AMKL+DEM SRG +P++ TYN ++ G+C+EG +D
Sbjct  272  -KECYPDVITYTILIEATCAESGVGQAMKLLDEMGSRGCKPDVVTYNVLVNGMCKEGRLD  330

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A +F+ S+P+ G +P+V ++NI+LR++     W D EKLL EM   GC P   T+NI +
Sbjct  331  EAIKFLNSMPSYGSQPNVITHNIILRSMCSTGRWMDAEKLLTEMVRKGCSPSVVTFNILI  390

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + LCR G L +AI +L+ M   G TPN  +Y+PL+  FCKE ++D AI  L+
Sbjct  391  NFLCRKGLLGRAIDILEKMPTHGCTPNSLSYNPLLHGFCKEKKMDRAIQYLE  442


 Score =   184 bits (467),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/298 (35%), Positives = 167/298 (56%), Gaps = 10/298 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAV-KVMQLLEQFG----  718
            C +GK ++ + +L   ++    PDV+  T LI+       AE  V + M+LL++ G    
Sbjct  254  CDSGKLKQAMEVLDRQLEKECYPDVITYTILIEATC----AESGVGQAMKLLDEMGSRGC  309

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +P+V+ Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K
Sbjct  310  KPDVVTYNVLVNGMCKEGRLDEAIKFLNSMPSYGSQPNVITHNIILRSMCSTGRWMDAEK  369

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L +M     C P VVT+ +LI     K  +  A+ ++++M + G  PN  +YN +L G 
Sbjct  370  LLTEMVR-KGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPTHGCTPNSLSYNPLLHGF  428

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C+E  +DRA +++  + + GC PD+ +YN +L AL      D   +LL ++SS GC P  
Sbjct  429  CKEKKMDRAIQYLEIMVSRGCYPDIVTYNTMLTALCKDGKVDAAVELLNQLSSKGCSPVL  488

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TYN  +  L + GK ++A+ +L  M  KGL P+  TY  LI+   +EG+++ AI   
Sbjct  489  ITYNTVIDGLSKVGKTDQAVELLHEMRGKGLKPDVITYSSLIAGLSREGKVEEAIKFF  546


 Score =   181 bits (460),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 159/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    L+ G+    + ++A+K +  +  +G +PN
Sbjct  288  TCAESGVGQAMKLLDEMGSRGCKPDVVTYNVLVNGMCKEGRLDEAIKFLNSMPSYGSQPN  347

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  348  VITHNIILRSMCSTGRWMDAEKLLTEMVRKGCSPSVVTFNILINFLCRKGLLGRAIDILE  407

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M   + C P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  408  KMP-THGCTPNSLSYNPLLHGFCKEKKMDRAIQYLEIMVSRGCYPDIVTYNTMLTALCKD  466

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      D   +LL EM   G +P   TY
Sbjct  467  GKVDAAVELLNQLSSKGCSPVLITYNTVIDGLSKVGKTDQAVELLHEMRGKGLKPDVITY  526

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  ++ L R+GK+ +AI     +   G+ PN FTY+ ++   CK  + D AID L
Sbjct  527  SSLIAGLSREGKVEEAIKFFHDVEGFGVKPNAFTYNSIMFGLCKAQQTDRAIDFL  581


 Score =   161 bits (408),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 147/271 (54%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV+ G  P VV    LI  L       +A+ +++ +   G 
Sbjct  355  LRSMCSTGRWMDAEKLLTEMVRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPTHGC  414

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L  M SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  415  TPNSLSYNPLLHGFCKEKKMDRAIQYLEIMVSRGCYPDIVTYNTMLTALCKDGKVDAAVE  474

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A++L+ EM  +GL+P++ TY++++ GL
Sbjct  475  LLNQL-SSKGCSPVLITYNTVIDGLSKVGKTDQAVELLHEMRGKGLKPDVITYSSLIAGL  533

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG V+ A +F   +   G KP+ F+YN ++  L   +  D     L  M S GC+P  
Sbjct  534  SREGKVEEAIKFFHDVEGFGVKPNAFTYNSIMFGLCKAQQTDRAIDFLAYMISKGCKPTE  593

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  +  +G   +A+ +L  +  +G+
Sbjct  594  VSYTILIEGIANEGLAKEALELLNELCSRGV  624



>ref|XP_010917143.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Elaeis guineensis]
Length=585

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 197/307 (64%), Gaps = 8/307 (3%)
 Frame = -1

Query  918  KEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM  739
            K  D  RRL RS   G+ E+ L  L+ M   G  PDV+ CT LI+G     K +KA +V+
Sbjct  91   KSNDELRRLVRS---GELEKGLAFLERMAIRGAVPDVIPCTSLIRGFCRASKTKKAARVL  147

Query  738  QLLEQFGEP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
             ++E  G   +V+ Y  +IGG+CK+   + A  ++NRM      PDVVTYN +  S+C+R
Sbjct  148  AIVENSGASLDVITYNVMIGGYCKSGETDNALRLVNRM---SVPPDVVTYNTIFQSLCER  204

Query  561  GKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYT  382
            GKL  AL+VLD M +   C PDV TYT+LIEAT    G+ +AMKL+DEM ++G  P++ T
Sbjct  205  GKLKKALEVLDGMLQ-RGCTPDVFTYTILIEATCKDSGVGQAMKLLDEMRAKGCTPDVVT  263

Query  381  YNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            +N ++ G+C+EG +D A +F+ ++P+ GC P+V S+NI+LR++     W D EKLL +M 
Sbjct  264  FNVLINGICKEGRLDEAIKFLNNMPSYGCNPNVISHNIILRSMCSTGRWMDAEKLLADMV  323

Query  201  SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLD  22
              GC P   T+NI ++ LCR G L +AI +L+ M E G TPN  +Y+PL+  FCKE +++
Sbjct  324  RKGCSPSVVTFNILINFLCRKGLLGRAIDVLEKMPEHGCTPNSLSYNPLLHGFCKEKKME  383

Query  21   LAIDLLD  1
             AI+ LD
Sbjct  384  RAIEYLD  390


 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/295 (34%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G  PDVV    LI G+    + ++A+K +  +  +G  PN
Sbjct  236  TCKDSGVGQAMKLLDEMRAKGCTPDVVTFNVLINGICKEGRLDEAIKFLNNMPSYGCNPN  295

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+++  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ VL+
Sbjct  296  VISHNIILRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDVLE  355

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M E + C P+ ++Y  L+     +  +  A++ +D M+SRG  P+I TYN +L  LC++
Sbjct  356  KMPE-HGCTPNSLSYNPLLHGFCKEKKMERAIEYLDVMVSRGCYPDIVTYNTLLTALCKD  414

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A + +  L + GC P + +YN ++  L    N +   +LLKEM   G  P   TY
Sbjct  415  GKVDVAVDMLHELGSKGCTPVLITYNTVIDGLSKAGNTEKALELLKEMVGKGLRPDIITY  474

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V+ L R+GK+N+AI +   + + G+ PN   Y+ +I   CK  + D AID  
Sbjct  475  SSLVAGLSREGKINEAIRIFNELEKLGIRPNAIIYNSVILGLCKSRQTDRAIDFF  529


 Score =   178 bits (452),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK ++ L +L  M++ G  PDV   T LI+         +A+K++  +   G  P+V
Sbjct  202  CERGKLKKALEVLDGMLQRGCTPDVFTYTILIEATCKDSGVGQAMKLLDEMRAKGCTPDV  261

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + +  LI G CK  R++ A   LN M S G  P+V+++NI++ S+C  G+   A K+L  
Sbjct  262  VTFNVLINGICKEGRLDEAIKFLNNMPSYGCNPNVISHNIILRSMCSTGRWMDAEKLLAD  321

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  322  MVR-KGCSPSVVTFNILINFLCRKGLLGRAIDVLEKMPEHGCTPNSLSYNPLLHGFCKEK  380

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             ++RA E++  + + GC PD+ +YN LL AL      D    +L E+ S GC P   TYN
Sbjct  381  KMERAIEYLDVMVSRGCYPDIVTYNTLLTALCKDGKVDVAVDMLHELGSKGCTPVLITYN  440

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +  L + G   KA+ +LK M  KGL P+  TY  L++   +EG+++ AI + +
Sbjct  441  TVIDGLSKAGNTEKALELLKEMVGKGLRPDIITYSSLVAGLSREGKINEAIRIFN  495


 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 144/271 (53%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV+ G  P VV    LI  L       +A+ V++ + + G 
Sbjct  303  LRSMCSTGRWMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDVLEKMPEHGC  362

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  ++E A   L+ M SRG +PD+VTYN ++ ++C  GK+ +A+ 
Sbjct  363  TPNSLSYNPLLHGFCKEKKMERAIEYLDVMVSRGCYPDIVTYNTLLTALCKDGKVDVAVD  422

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L ++     C P ++TY  +I+         +A++L+ EM+ +GL P+I TY++++ GL
Sbjct  423  MLHELGS-KGCTPVLITYNTVIDGLSKAGNTEKALELLKEMVGKGLRPDIITYSSLVAGL  481

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG ++ A      L  +G +P+   YN ++  L   R  D        M S GC P+ 
Sbjct  482  SREGKINEAIRIFNELEKLGIRPNAIIYNSVILGLCKSRQTDRAIDFFAYMVSKGCMPNE  541

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G   +A+ +L  +  +G+
Sbjct  542  STYTILIEGMAYEGMSKEALDLLSELCSRGV  572



>emb|CDX94933.1| BnaC05g07380D [Brassica napus]
Length=590

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 205/317 (65%), Gaps = 10/317 (3%)
 Frame = -1

Query  945  NALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVK  766
            N+   L D++  +  R+L R   AG+ EE    L+ MV  G  PD++ CT LI+G   + 
Sbjct  84   NSSFALEDAESNNHLRQLVR---AGELEEGFKFLENMVYHGNVPDIIPCTTLIRGFCRMG  140

Query  765  KAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYN  589
            K ++A K++++LE  G  P+V+ Y  +I G+CK   + +A  +L+RM      PDVVTYN
Sbjct  141  KTKRAAKILEILEGSGAVPDVITYNVMISGYCKAGEINSALSLLDRM---SVSPDVVTYN  197

Query  588  IMIGSICDRGKLGLALKVLD-QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEML  412
             ++ S+CD GKL  A++VLD Q+K D  C PDV+TYT+LIEAT  + G+ EAMKL+DEM 
Sbjct  198  TILRSLCDSGKLKQAMEVLDRQLKRD--CYPDVITYTILIEATCKESGVGEAMKLLDEMR  255

Query  411  SRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWD  232
             +G  P++ TYN ++ G+C+EG +D A +F+  +P+ GC+P+V ++NI+LR++     W 
Sbjct  256  VKGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNIILRSMCSTGRWM  315

Query  231  DGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLI  52
            D EKLL +M   G  P   T+NI ++ LCR G L +AI +L+ M + G  PN  +Y+PL+
Sbjct  316  DAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCQPNSLSYNPLL  375

Query  51   SAFCKEGRLDLAIDLLD  1
              FCKE ++D AI+ L+
Sbjct  376  HGFCKEKKMDRAIEYLE  392


 Score =   180 bits (457),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 107/320 (33%), Positives = 171/320 (53%), Gaps = 7/320 (2%)
 Frame = -1

Query  945  NALIQLLD----SKEIDIRRRLNRS-CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKG  781
            N+ + LLD    S ++     + RS C +GK ++ + +L   +K    PDV+  T LI+ 
Sbjct  178  NSALSLLDRMSVSPDVVTYNTILRSLCDSGKLKQAMEVLDRQLKRDCYPDVITYTILIEA  237

Query  780  LFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPD  604
                    +A+K++  +   G  P+V+ Y  L+ G CK  R++ A   LN M S G  P+
Sbjct  238  TCKESGVGEAMKLLDEMRVKGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPN  297

Query  603  VVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLV  424
            V+T+NI++ S+C  G+   A K+L  M       P VVT+ +LI     K  +  A+ ++
Sbjct  298  VITHNIILRSMCSTGRWMDAEKLLADMLR-KGFSPSVVTFNILINFLCRKGLLGRAIDIL  356

Query  423  DEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDR  244
            ++M   G +PN  +YN +L G C+E  +DRA E++  + + GC PD+ +YN +L AL   
Sbjct  357  EKMPKHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKD  416

Query  243  RNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTY  64
               +D  ++L ++SS GC P   TYN  +  L + GK  KAI +L  M  K L P+  TY
Sbjct  417  GKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTITY  476

Query  63   DPLISAFCKEGRLDLAIDLL  4
              L+    +EG++D AI   
Sbjct  477  SSLVGGLSREGKVDEAIKFF  496


 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 158/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      E + LL  M   G  PDVV    L+ G+    + ++A+K +  +  +G +PN
Sbjct  238  TCKESGVGEAMKLLDEMRVKGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPN  297

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +GF P VVT+NI+I  +C +G LG A+ +L+
Sbjct  298  VITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILE  357

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C+P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  358  KMPK-HGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKD  416

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G V+ A E +  L + GC P + +YN ++  L          KLL EM +    P T TY
Sbjct  417  GKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTITY  476

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI         G+ PN  T++ +I   CK  + D AID L
Sbjct  477  SSLVGGLSREGKVDEAIKFFHEFERMGVRPNAVTFNSIILGLCKTRQTDRAIDFL  531


 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 149/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G+ P VV    LI  L       +A+ +++ + + G 
Sbjct  305  LRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  364

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PN L+Y  L+ GFCK  +++ A   L RM SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  365  QPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVE  424

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM ++ L P+  TY++++ GL
Sbjct  425  ILNQL-SSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTITYSSLVGGL  483

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F      MG +P+  ++N ++  L   R  D     L  M + GC+P  
Sbjct  484  SREGKVDEAIKFFHEFERMGVRPNAVTFNSIILGLCKTRQTDRAIDFLVYMINRGCKPTE  543

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  +  +G   +A+ +L  +  KGL
Sbjct  544  TSYTILIEGIAYEGMAKEALELLNELCNKGL  574



>gb|KFK43289.1| hypothetical protein AALP_AA1G104700 [Arabis alpina]
Length=594

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 210/339 (62%), Gaps = 12/339 (4%)
 Frame = -1

Query  999  RERNLKNLQSVKVSTENRNALIQLLDS----KEIDIRRRLNRSCGAGKYEETLYLLQYMV  832
            R +   N  SV  S  N N     ++S    ++++    L +   AG+ EE    L+ MV
Sbjct  64   RAQKFDNSASVH-SNSNGNGHYTSVNSSFVLEDVESNNHLRQMVRAGELEEGFKFLENMV  122

Query  831  KIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVE  655
              G  PD++ CT LI+G   + K +KA K++++LE  G  P+V+ Y  +I G+CK   + 
Sbjct  123  YHGNVPDIIACTTLIRGFCRLGKTKKAAKILEILEGSGAVPDVITYNVMISGYCKAGEIN  182

Query  654  AANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD-QMKEDNNCKPDVVTYTV  478
             A  +L++M      PDVVTYN ++ S+CD GKL  A++VLD Q++ D  C PDV+TYT+
Sbjct  183  NALSLLDKM---SVSPDVVTYNTILRSLCDSGKLKQAMEVLDRQLQRD--CYPDVITYTI  237

Query  477  LIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMG  298
            LIEAT  + G+ +AMKL+DEM  RG  P++ TYN ++ G+C+EG +D A +F+  +P+ G
Sbjct  238  LIEATCKESGVEQAMKLLDEMRERGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYG  297

Query  297  CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAI  118
            C+P+V ++NI+LR++     W D EKLL EM   G  P   T+NI ++ LCR G L +AI
Sbjct  298  CQPNVITHNIILRSMCSTGRWMDAEKLLAEMLRKGFSPSVVTFNILINFLCRKGLLGRAI  357

Query  117  SMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +L+ M + G  PN  +Y+PL+  FCKE ++D AI+ L+
Sbjct  358  DILEKMPKHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLE  396


 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/295 (36%), Positives = 170/295 (58%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C AG+    L LL    K+   PDVV    +++ L    K ++A++V+ + L++   P+V
Sbjct  176  CKAGEINNALSLLD---KMSVSPDVVTYNTILRSLCDSGKLKQAMEVLDRQLQRDCYPDV  232

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + VE A  +L+ MR RG  PDVVTYN+++  IC  G+L  A+K L+ 
Sbjct  233  ITYTILIEATCKESGVEQAMKLLDEMRERGCTPDVVTYNVLVNGICKEGRLDEAIKFLND  292

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C+P+V+T+ +++ +        +A KL+ EML +G  P++ T+N ++  LCR+G
Sbjct  293  MPS-YGCQPNVITHNIILRSMCSTGRWMDAEKLLAEMLRKGFSPSVVTFNILINFLCRKG  351

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC+P+  SYN LL      +  D   + L+ M S GC P   TYN
Sbjct  352  LLGRAIDILEKMPKHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYN  411

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LC+DGK+  A+ +L  ++ KG +P   TY+ +I    K G+   AI LLD
Sbjct  412  TMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLSKAGKTGKAIKLLD  466


 Score =   179 bits (453),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 161/295 (55%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C     E+ + LL  M + G  PDVV    L+ G+    + ++A+K +  +  +G +PN
Sbjct  242  TCKESGVEQAMKLLDEMRERGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPN  301

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +GF P VVT+NI+I  +C +G LG A+ +L+
Sbjct  302  VITHNIILRSMCSTGRWMDAEKLLAEMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILE  361

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C+P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC++
Sbjct  362  KMPK-HGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKD  420

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G V+ A E +  L + GC P + +YN ++  L          KLL EM +   +P T TY
Sbjct  421  GKVEDAVEILNQLSSKGCSPVLITYNTVIDGLSKAGKTGKAIKLLDEMRAKDLKPDTITY  480

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI         G+ PN  T++ ++   CK  + D AID L
Sbjct  481  SSLVGGLSREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKSRQTDRAIDFL  535


 Score =   170 bits (430),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 152/271 (56%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G+ P VV    LI  L       +A+ +++ + + G 
Sbjct  309  LRSMCSTGRWMDAEKLLAEMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  368

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PN L+Y  L+ GFCK  +++ A   L RM SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  369  QPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVE  428

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM ++ L+P+  TY++++ GL
Sbjct  429  ILNQL-SSKGCSPVLITYNTVIDGLSKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGL  487

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F      MG +P+  ++N ++  L   R  D     L  M + GC+P  
Sbjct  488  SREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKSRQTDRAIDFLVYMINRGCKPTE  547

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  L  +G  N+A+++L  +  KGL
Sbjct  548  TSYTILIEGLAYEGMANEALALLSELCNKGL  578



>ref|XP_003523769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Glycine max]
Length=602

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 198/301 (66%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            R+L R+   G+ EE L  L+ M+  G  PDV+ CT LI+G     K +KA ++M++LE  
Sbjct  114  RKLVRN---GELEEGLKFLERMIYQGDIPDVIACTSLIRGFCRSGKTKKATRIMEILENS  170

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LIGG+CK+  ++ A  VL RM      PDVVTYN ++ S+CD GKL  A
Sbjct  171  GAVPDVITYNVLIGGYCKSGEIDKALEVLERM---SVAPDVVTYNTILRSLCDSGKLKEA  227

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            ++VLD+  +   C PDV+TYT+LIEAT    G+ +AMKL+DEM  +G +P++ TYN ++ 
Sbjct  228  MEVLDRQLQ-RECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLIN  286

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A +F+ ++P+ GCKP+V ++NI+LR++     W D E+LL +M   GC P
Sbjct  287  GICKEGRLDEAIKFLNNMPSYGCKPNVITHNIILRSMCSTGRWMDAERLLSDMLRKGCSP  346

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR   L +AI +L+ M + G  PN  +Y+PL+  FC+E ++D AI+ L
Sbjct  347  SVVTFNILINFLCRKRLLGRAIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYL  406

Query  3    D  1
            +
Sbjct  407  E  407


 Score =   186 bits (473),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 171/295 (58%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C +G+ ++ L +L+ M      PDVV    +++ L    K ++A++V+ + L++   P+V
Sbjct  187  CKSGEIDKALEVLERM---SVAPDVVTYNTILRSLCDSGKLKEAMEVLDRQLQRECYPDV  243

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   C  + V  A  +L+ MR +G  PDVVTYN++I  IC  G+L  A+K L+ 
Sbjct  244  ITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLINGICKEGRLDEAIKFLNN  303

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     CKP+V+T+ +++ +        +A +L+ +ML +G  P++ T+N ++  LCR+ 
Sbjct  304  MP-SYGCKPNVITHNIILRSMCSTGRWMDAERLLSDMLRKGCSPSVVTFNILINFLCRKR  362

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL      +  D   + L+ M S GC P   TYN
Sbjct  363  LLGRAIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYN  422

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LC+DGK++ A+ +L  ++ KG +P   TY+ +I    K G+ + A++LL+
Sbjct  423  TLLTALCKDGKVDAAVEILNQLSSKGCSPVLITYNTVIDGLTKVGKTEYAVELLE  477


 Score =   181 bits (458),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 163/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK +E + +L   ++    PDV+  T LI+   +     +A+K++  + + G +P+V
Sbjct  219  CDSGKLKEAMEVLDRQLQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDV  278

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A ++L  
Sbjct  279  VTYNVLINGICKEGRLDEAIKFLNNMPSYGCKPNVITHNIILRSMCSTGRWMDAERLLSD  338

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  339  MLR-KGCSPSVVTFNILINFLCRKRLLGRAIDVLEKMPKHGCVPNSLSYNPLLHGFCQEK  397

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  398  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDAAVEILNQLSSKGCSPVLITYN  457

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   A+ +L+ M  KGL P+  TY  L+    +EG++D AI + 
Sbjct  458  TVIDGLTKVGKTEYAVELLEEMRRKGLKPDIITYSTLLRGLGREGKVDEAIKIF  511


 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/320 (29%), Positives = 155/320 (48%), Gaps = 37/320 (12%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            +  +C      + + LL  M K G KPDVV    LI G+    + ++A+K +  +  +G 
Sbjct  250  IEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLINGICKEGRLDEAIKFLNNMPSYGC  309

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PNV+ +  ++   C T R   A  +L+ M  +G  P VVT+NI+I  +C +  LG A+ 
Sbjct  310  KPNVITHNIILRSMCSTGRWMDAERLLSDMLRKGCSPSVVTFNILINFLCRKRLLGRAID  369

Query  537  VLDQMKEDN----------------------------------NCKPDVVTYTVLIEATI  460
            VL++M +                                     C PD+VTY  L+ A +
Sbjct  370  VLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTA-L  428

Query  459  VKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             KDG +  A+++++++ S+G  P + TYN ++ GL + G  + A E +  +   G KPD+
Sbjct  429  CKDGKVDAAVEILNQLSSKGCSPVLITYNTVIDGLTKVGKTEYAVELLEEMRRKGLKPDI  488

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +Y+ LLR L      D+  K+  +M  +  +P   TYN  +  LC+  + ++AI  L  
Sbjct  489  ITYSTLLRGLGREGKVDEAIKIFHDMEGLSIKPSAVTYNAIMLGLCKAQQTSRAIDFLAY  548

Query  102  MTEKGLTPNKFTYDPLISAF  43
            M EKG  P + TY  LI   
Sbjct  549  MVEKGCKPTEATYTILIEGI  568


 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 70/137 (51%), Gaps = 5/137 (4%)
 Frame = -1

Query  411  SRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWD  232
            SR  E   +  N  L+ L R G ++   +F+  +   G  PDV +   L+R         
Sbjct  101  SRSFEE--FASNIHLRKLVRNGELEEGLKFLERMIYQGDIPDVIACTSLIRGFCRSGKTK  158

Query  231  DGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLI  52
               ++++ + + G  P   TYN+ +   C+ G+++KA+ +L+ M+   + P+  TY+ ++
Sbjct  159  KATRIMEILENSGAVPDVITYNVLIGGYCKSGEIDKALEVLERMS---VAPDVVTYNTIL  215

Query  51   SAFCKEGRLDLAIDLLD  1
             + C  G+L  A+++LD
Sbjct  216  RSLCDSGKLKEAMEVLD  232



>ref|XP_008378619.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Malus domestica]
Length=613

 Score =   270 bits (690),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/301 (44%), Positives = 196/301 (65%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE    L+ M+  G  PD++ CT LI+G     K +KA ++M +LE  
Sbjct  125  RRLVRN---GELEEGFKFLENMLYRGDMPDIIACTSLIRGFCKSGKTKKATRIMNILEDS  181

Query  720  GEP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G   +V+ Y  LI G+CK   ++ A  VL+RM      PDVVTYN ++ ++CD GKL  A
Sbjct  182  GAVLDVITYNVLISGYCKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDSGKLKQA  238

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            ++VLD+  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ TYN ++ 
Sbjct  239  MEVLDRQMQ-RQCYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNVLIN  297

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A +F+  +P+  C+P+V ++NI+LR++     W D EKLL EM   GC P
Sbjct  298  GICKEGRLDEAIKFLNDMPSSDCQPNVITHNIILRSMCSTGRWMDAEKLLAEMVHRGCSP  357

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+  FCKE ++D AI+ L
Sbjct  358  SVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYL  417

Query  3    D  1
            D
Sbjct  418  D  418


 Score =   194 bits (494),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/294 (35%), Positives = 172/294 (59%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C AG+ +  L +L  M      PDVV    +++ L    K ++A++V+ + +++   P+V
Sbjct  198  CKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDSGKLKQAMEVLDRQMQRQCYPDV  254

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + VE A  +L+ MRS+G  PDVVTYN++I  IC  G+L  A+K L+ 
Sbjct  255  ITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIKFLND  314

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   ++C+P+V+T+ +++ +        +A KL+ EM+ RG  P++ T+N ++  LCR+G
Sbjct  315  MPS-SDCQPNVITHNIILRSMCSTGRWMDAEKLLAEMVHRGCSPSVVTFNILINFLCRKG  373

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL      +  D   + L  M S GC P   TYN
Sbjct  374  LLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDTMVSRGCYPDIVTYN  433

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +++LC+D K++ A+ +L  ++ KG +P   TY+ +I    K G+ + A++LL
Sbjct  434  TLLTALCKDAKVDIAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERALELL  487


 Score =   184 bits (466),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 163/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+        E+A+K++  +   G +P+V
Sbjct  230  CDSGKLKQAMEVLDRQMQRQCYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDV  289

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S    P+V+T+NI++ S+C  G+   A K+L +
Sbjct  290  VTYNVLINGICKEGRLDEAIKFLNDMPSSDCQPNVITHNIILRSMCSTGRWMDAEKLLAE  349

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  350  MVH-RGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEK  408

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++ ++ + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  409  KMDRAIEYLDTMVSRGCYPDIVTYNTLLTALCKDAKVDIAVEILNQLSSKGCSPVLITYN  468

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  +A+ +L  M +KGL P+  TY   +    +EG++D AI  +
Sbjct  469  TVIDGLSKVGKTERALELLHEMRKKGLKPDVITYSSXVGGLSREGKVDEAIKFV  522


 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 158/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C     E+ + LL  M   G KPDVV    LI G+    + ++A+K +  +     +PN
Sbjct  264  TCKESGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIKFLNDMPSSDCQPN  323

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  RG  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  324  VITHNIILRSMCSTGRWMDAEKLLAEMVHRGCSPSVVTFNILINFLCRKGLLGRAIDILE  383

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  L+     +  +  A++ +D M+SRG  P+I TYN +L  LC++
Sbjct  384  KMPK-HGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDTMVSRGCYPDIVTYNTLLTALCKD  442

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
              VD A E +  L + GC P + +YN ++  L      +   +LL EM   G +P   TY
Sbjct  443  AKVDIAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERALELLHEMRKKGLKPDVITY  502

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI  +  + + G+ PN  T++ ++   CK  +   AID L
Sbjct  503  SSXVGGLSREGKVDEAIKFVHDLEDXGVKPNAITFNSIMLGLCKAKQTCRAIDFL  557


 Score =   155 bits (392),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 150/272 (55%), Gaps = 4/272 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV  G  P VV    LI  L       +A+ +++ + + G 
Sbjct  331  LRSMCSTGRWMDAEKLLAEMVHRGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  390

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C   K+ +A++
Sbjct  391  TPNSLSYNPLLHGFCKEKKMDRAIEYLDTMVSRGCYPDIVTYNTLLTALCKDAKVDIAVE  450

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+     C P ++TY  +I+  + K G +E A++L+ EM  +GL+P++ TY++ + G
Sbjct  451  ILNQL-SSKGCSPVLITYNTVIDG-LSKVGKTERALELLHEMRKKGLKPDVITYSSXVGG  508

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +FV  L   G KP+  ++N ++  L   +        L  M S GC+P 
Sbjct  509  LSREGKVDEAIKFVHDLEDXGVKPNAITFNSIMLGLCKAKQTCRAIDFLAYMVSRGCKPT  568

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
              TY I +  +  +G   +A+ +L  +  KG+
Sbjct  569  EATYTILIEGIAYEGLAKEALELLNELCYKGV  600



>gb|KHN09027.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=513

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 198/302 (66%), Gaps = 10/302 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            R+L R+   G+ EE L  L+ M+  G  PDV+ CT LI+G     K  KA ++M++LE  
Sbjct  25   RKLVRN---GELEEGLKFLERMIYQGDIPDVIACTSLIRGFCRSGKTRKATRIMEILENS  81

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LIGG+CK+  ++ A  VL RM      PDVVTYN ++ S+CD GKL  A
Sbjct  82   GAVPDVITYNVLIGGYCKSGEIDKALQVLERM---SVAPDVVTYNTILRSLCDSGKLKEA  138

Query  543  LKVLD-QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAIL  367
            ++VLD QM+ +  C PDV+TYT+LIEAT    G+ +AMKL+DEM  +G +P++ TYN ++
Sbjct  139  MEVLDRQMQRE--CYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLI  196

Query  366  KGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCE  187
             G+C+EG +D A +F+ ++P  GC+P+V ++NI+LR++     W D E+LL +M   GC 
Sbjct  197  NGICKEGRLDEAIKFLNNMPLYGCQPNVITHNIILRSMCSTGRWMDAERLLADMLRKGCS  256

Query  186  PHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            P   T+NI ++ LCR   L +AI +L+ M + G  PN  +Y+PL+  FC+E ++D AI+ 
Sbjct  257  PSVVTFNILINFLCRKRLLGRAIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEY  316

Query  6    LD  1
            L+
Sbjct  317  LE  318


 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 160/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK +E + +L   ++    PDV+  T LI+   +     +A+K++  + + G +P+V
Sbjct  130  CDSGKLKEAMEVLDRQMQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDV  189

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M   G  P+V+T+NI++ S+C  G+   A ++L  
Sbjct  190  VTYNVLINGICKEGRLDEAIKFLNNMPLYGCQPNVITHNIILRSMCSTGRWMDAERLLAD  249

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  250  MLR-KGCSPSVVTFNILINFLCRKRLLGRAIDVLEKMPKHGCVPNSLSYNPLLHGFCQEK  308

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  309  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKADAAVEILNQLSSKGCSPVLITYN  368

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   A  +L+ M  KGL P+  TY  L+     EG++D AI + 
Sbjct  369  TVIDGLTKVGKTEYAAELLEEMRRKGLKPDIITYSTLLRGLGCEGKVDEAIKIF  422


 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/320 (30%), Positives = 155/320 (48%), Gaps = 37/320 (12%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            +  +C      + + LL  M K G KPDVV    LI G+    + ++A+K +  +  +G 
Sbjct  161  IEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLINGICKEGRLDEAIKFLNNMPLYGC  220

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PNV+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +  LG A+ 
Sbjct  221  QPNVITHNIILRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKRLLGRAID  280

Query  537  VLDQMKEDN----------------------------------NCKPDVVTYTVLIEATI  460
            VL++M +                                     C PD+VTY  L+ A +
Sbjct  281  VLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTA-L  339

Query  459  VKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             KDG ++ A+++++++ S+G  P + TYN ++ GL + G  + A E +  +   G KPD+
Sbjct  340  CKDGKADAAVEILNQLSSKGCSPVLITYNTVIDGLTKVGKTEYAAELLEEMRRKGLKPDI  399

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +Y+ LLR L      D+  K+  +M  +  +P   TYN  +  LC+  + ++AI  L  
Sbjct  400  ITYSTLLRGLGCEGKVDEAIKIFHDMEGLSIKPSAVTYNAIMLGLCKAQQTSRAIDFLAY  459

Query  102  MTEKGLTPNKFTYDPLISAF  43
            M EKG  P K TY  LI   
Sbjct  460  MVEKGCKPTKATYTILIEGI  479


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 70/137 (51%), Gaps = 5/137 (4%)
 Frame = -1

Query  411  SRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWD  232
            SR  E   +  N  L+ L R G ++   +F+  +   G  PDV +   L+R         
Sbjct  12   SRSFEE--FASNIHLRKLVRNGELEEGLKFLERMIYQGDIPDVIACTSLIRGFCRSGKTR  69

Query  231  DGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLI  52
               ++++ + + G  P   TYN+ +   C+ G+++KA+ +L+ M+   + P+  TY+ ++
Sbjct  70   KATRIMEILENSGAVPDVITYNVLIGGYCKSGEIDKALQVLERMS---VAPDVVTYNTIL  126

Query  51   SAFCKEGRLDLAIDLLD  1
             + C  G+L  A+++LD
Sbjct  127  RSLCDSGKLKEAMEVLD  143



>ref|XP_004170776.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Cucumis sativus]
Length=665

 Score =   271 bits (692),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 200/308 (65%), Gaps = 7/308 (2%)
 Frame = -1

Query  918  KEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM  739
            +E++    L R    G+ EE    L+ MV  G  PD++ CT LI+GL    K  KA +VM
Sbjct  109  EEVENNNHLRRLVRNGELEEGFKFLEDMVCRGDIPDIIACTSLIRGLCKTGKTWKATRVM  168

Query  738  QLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
            ++LE  G  P+V+ Y  LI G+CKT  + +A  +L+RM      PDVVTYN ++ ++CD 
Sbjct  169  EILEDSGAVPDVITYNVLISGYCKTGEIGSALQLLDRMSVS---PDVVTYNTILRTLCDS  225

Query  561  GKLGLALKVLD-QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
            GKL  A++VLD QM+ +  C PDV+TYT+LIEAT  + G+ +AMKL+DEM  +G +P++ 
Sbjct  226  GKLKEAMEVLDRQMQRE--CYPDVITYTILIEATCKESGVGQAMKLLDEMRDKGCKPDVV  283

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
            TYN ++ G+C+EG +D A  F+  +P+ GC+P+V ++NI+LR++     W D EK L EM
Sbjct  284  TYNVLINGICKEGRLDEAIRFLNHMPSYGCQPNVITHNIILRSMCSTGRWMDAEKFLAEM  343

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
               GC P   T+NI ++ LCR G + +AI +L+ M + G TPN  +Y+PL+ A CK+ ++
Sbjct  344  IRKGCSPSVVTFNILINFLCRKGLIGRAIDVLEKMPQHGCTPNSLSYNPLLHALCKDKKM  403

Query  24   DLAIDLLD  1
            + AI+ LD
Sbjct  404  ERAIEYLD  411


 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/295 (34%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    LI G+    + ++A++ +  +  +G +PN
Sbjct  257  TCKESGVGQAMKLLDEMRDKGCKPDVVTYNVLINGICKEGRLDEAIRFLNHMPSYGCQPN  316

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A   L  M  +G  P VVT+NI+I  +C +G +G A+ VL+
Sbjct  317  VITHNIILRSMCSTGRWMDAEKFLAEMIRKGCSPSVVTFNILINFLCRKGLIGRAIDVLE  376

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  L+ A      +  A++ +D M+SRG  P+I TYN +L  LC++
Sbjct  377  KMPQ-HGCTPNSLSYNPLLHALCKDKKMERAIEYLDIMVSRGCYPDIVTYNTLLTALCKD  435

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      DD  KLL EM   G +P   TY
Sbjct  436  GKVDVAVEILNQLGSKGCSPVLITYNTVIDGLSKVGKTDDAIKLLDEMKGKGLKPDIITY  495

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI+    + E G+ PN  TY+ ++   CK  +   AID L
Sbjct  496  STLVGGLSREGKVDEAIAFFHDLEEMGVKPNAITYNSIMLGLCKARQTVRAIDFL  550


 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 145/271 (54%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +    L  M++ G  P VV    LI  L       +A+ V++ + Q G 
Sbjct  324  LRSMCSTGRWMDAEKFLAEMIRKGCSPSVVTFNILINFLCRKGLIGRAIDVLEKMPQHGC  383

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+   CK  ++E A   L+ M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  384  TPNSLSYNPLLHALCKDKKMERAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVE  443

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM  +GL+P+I TY+ ++ GL
Sbjct  444  ILNQLGS-KGCSPVLITYNTVIDGLSKVGKTDDAIKLLDEMKGKGLKPDIITYSTLVGGL  502

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A  F   L  MG KP+  +YN ++  L   R        L  M + GC+P  
Sbjct  503  SREGKVDEAIAFFHDLEEMGVKPNAITYNSIMLGLCKARQTVRAIDFLAYMVARGCKPTE  562

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  L  +G   +A+ +L  +  +G+
Sbjct  563  TSYMILIEGLAYEGLAKEALELLNELCSRGV  593



>ref|XP_008338987.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Malus domestica]
Length=613

 Score =   269 bits (688),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 197/307 (64%), Gaps = 5/307 (2%)
 Frame = -1

Query  918  KEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM  739
            +E +   +L R    G+ EE    L+ M+  G  PD++ CT LI+G     K  KA ++M
Sbjct  116  EEFESNNQLRRLVRNGELEEGFKFLENMLYHGDMPDIIACTSLIRGFCKSGKTRKATRIM  175

Query  738  QLLEQFGEP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
             +LE+ G   +V+ Y  LI G+CK   ++ A  VL+RM      PDVVTYN ++ ++CD 
Sbjct  176  NILEESGAILDVITYNVLISGYCKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDS  232

Query  561  GKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYT  382
            GKL  A++VLD+  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ T
Sbjct  233  GKLKQAMEVLDRQLQ-RECYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVT  291

Query  381  YNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            YN ++ G+C+EG +D A +F+  +P+  C+P+V ++NI+LR++     W D EKLL EM 
Sbjct  292  YNVLINGICKEGRLDEAIKFLNDMPSSDCQPNVITHNIVLRSMCSTGRWMDAEKLLAEMV  351

Query  201  SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLD  22
              GC P   T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+  FCKE ++D
Sbjct  352  HRGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMD  411

Query  21   LAIDLLD  1
             AI+ LD
Sbjct  412  RAIEYLD  418


 Score =   197 bits (501),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 173/294 (59%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C AG+ +  L +L  M      PDVV    +++ L    K ++A++V+ + L++   P+V
Sbjct  198  CKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDSGKLKQAMEVLDRQLQRECYPDV  254

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + VE A  +L+ MRS+G  PDVVTYN++I  IC  G+L  A+K L+ 
Sbjct  255  ITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIKFLND  314

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   ++C+P+V+T+ +++ +        +A KL+ EM+ RG  P++ T+N ++  LCR+G
Sbjct  315  MPS-SDCQPNVITHNIVLRSMCSTGRWMDAEKLLAEMVHRGCSPSVVTFNILINFLCRKG  373

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL      +  D   + L  M S GC P   TYN
Sbjct  374  LLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYN  433

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +++LC+DGK++ A+ +L  ++ KG +P   TY+ +I    K G+ + A++LL
Sbjct  434  TLLTALCKDGKVDSAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTECALELL  487


 Score =   181 bits (460),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+        E+A+K++  +   G +P+V
Sbjct  230  CDSGKLKQAMEVLDRQLQRECYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDV  289

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S    P+V+T+NI++ S+C  G+   A K+L +
Sbjct  290  VTYNVLINGICKEGRLDEAIKFLNDMPSSDCQPNVITHNIVLRSMCSTGRWMDAEKLLAE  349

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  350  MVH-RGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEK  408

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  409  KMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDSAVEILNQLSSKGCSPVLITYN  468

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   A+ +L  M +KGL P+  TY  ++    +EG++D AI  +
Sbjct  469  TVIDGLSKVGKTECALELLHEMRKKGLKPDVITYSSVVGGLSREGKVDEAIKFV  522


 Score =   174 bits (440),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 159/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C     E+ + LL  M   G KPDVV    LI G+    + ++A+K +  +     +PN
Sbjct  264  TCKESGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIKFLNDMPSSDCQPN  323

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  RG  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  324  VITHNIVLRSMCSTGRWMDAEKLLAEMVHRGCSPSVVTFNILINFLCRKGLLGRAIDILE  383

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  L+     +  +  A++ +D M+SRG  P+I TYN +L  LC++
Sbjct  384  KMPK-HGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKD  442

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      +   +LL EM   G +P   TY
Sbjct  443  GKVDSAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTECALELLHEMRKKGLKPDVITY  502

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI  +  + + G+ PN  T++ ++   CK  +   AID L
Sbjct  503  SSVVGGLSREGKVDEAIKFVHDLEDSGVKPNAITFNSIMLGLCKAKQAGRAIDFL  557


 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 151/272 (56%), Gaps = 4/272 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV  G  P VV    LI  L       +A+ +++ + + G 
Sbjct  331  LRSMCSTGRWMDAEKLLAEMVHRGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  390

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C  GK+  A++
Sbjct  391  TPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDSAVE  450

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+     C P ++TY  +I+  + K G +E A++L+ EM  +GL+P++ TY++++ G
Sbjct  451  ILNQLSS-KGCSPVLITYNTVIDG-LSKVGKTECALELLHEMRKKGLKPDVITYSSVVGG  508

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD A +FV  L   G KP+  ++N ++  L   +        L  M S GC+P 
Sbjct  509  LSREGKVDEAIKFVHDLEDSGVKPNAITFNSIMLGLCKAKQAGRAIDFLAYMVSKGCQPT  568

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
              TY I +  +  +G   +A+ +L  +  +G+
Sbjct  569  EATYTILIEGIAYEGLAKEALELLNELCYRGV  600



>ref|XP_009366374.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Pyrus x bretschneideri]
Length=613

 Score =   269 bits (688),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 197/307 (64%), Gaps = 5/307 (2%)
 Frame = -1

Query  918  KEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM  739
            +E +   +L R    G+ EE    L+ M+  G  PD++ CT LI+G     K  KA ++M
Sbjct  116  EEFESNNQLRRLVRNGELEEGFKFLENMLYHGDMPDIIACTSLIRGFCKSGKTRKATRIM  175

Query  738  QLLEQFGEP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
             +LE+ G   +V+ Y  LI G+CK   ++ A  VL+RM      PDVVTYN ++ ++CD 
Sbjct  176  NILEESGAILDVITYNVLISGYCKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDS  232

Query  561  GKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYT  382
            GKL  A++VLD+  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ T
Sbjct  233  GKLKQAMEVLDRQLQ-RECYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVT  291

Query  381  YNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            YN ++ G+C+EG +D A +F+  +P+  C+P+V ++NI+LR++     W D EKLL EM 
Sbjct  292  YNVLINGICKEGRLDEAIKFLNDMPSSDCQPNVITHNIVLRSMCSTGRWMDAEKLLAEMV  351

Query  201  SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLD  22
              GC P   T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+  FCKE ++D
Sbjct  352  HRGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMD  411

Query  21   LAIDLLD  1
             AI+ LD
Sbjct  412  RAIEYLD  418


 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 173/294 (59%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C AG+ +  L +L  M      PDVV    +++ L    K ++A++V+ + L++   P+V
Sbjct  198  CKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDSGKLKQAMEVLDRQLQRECYPDV  254

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + VE A  +L+ MRS+G  PDVVTYN++I  IC  G+L  A+K L+ 
Sbjct  255  ITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIKFLND  314

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   ++C+P+V+T+ +++ +        +A KL+ EM+ RG  P++ T+N ++  LCR+G
Sbjct  315  MPS-SDCQPNVITHNIVLRSMCSTGRWMDAEKLLAEMVHRGCSPSVVTFNILINFLCRKG  373

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL      +  D   + L  M S GC P   TYN
Sbjct  374  LLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYN  433

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +++LC+DGK++ A+ +L  ++ KG +P   TY+ +I    K G+ + A++LL
Sbjct  434  TLLTALCKDGKVDSAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERALELL  487


 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 163/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+        E+A+K++  +   G +P+V
Sbjct  230  CDSGKLKQAMEVLDRQLQRECYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDV  289

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S    P+V+T+NI++ S+C  G+   A K+L +
Sbjct  290  VTYNVLINGICKEGRLDEAIKFLNDMPSSDCQPNVITHNIVLRSMCSTGRWMDAEKLLAE  349

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  350  MVH-RGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEK  408

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  409  KMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDSAVEILNQLSSKGCSPVLITYN  468

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  +A+ +L  M +KGL P+  TY  L+    +EG++D AI  +
Sbjct  469  TVIDGLSKVGKTERALELLHEMRKKGLKPDVITYSSLVGGLSREGKIDEAIKFV  522


 Score =   175 bits (444),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 159/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C     E+ + LL  M   G KPDVV    LI G+    + ++A+K +  +     +PN
Sbjct  264  TCKESGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIKFLNDMPSSDCQPN  323

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  RG  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  324  VITHNIVLRSMCSTGRWMDAEKLLAEMVHRGCSPSVVTFNILINFLCRKGLLGRAIDILE  383

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M + + C P+ ++Y  L+     +  +  A++ +D M+SRG  P+I TYN +L  LC++
Sbjct  384  KMPK-HGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKD  442

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A E +  L + GC P + +YN ++  L      +   +LL EM   G +P   TY
Sbjct  443  GKVDSAVEILNQLSSKGCSPVLITYNTVIDGLSKVGKTERALELLHEMRKKGLKPDVITY  502

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V  L R+GK+++AI  +  + + G+ PN  T++ ++   CK  +   AID L
Sbjct  503  SSLVGGLSREGKIDEAIKFVHDLEDSGVKPNAITFNSIMLGLCKAKQTGRAIDFL  557


 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 146/271 (54%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV  G  P VV    LI  L       +A+ +++ + + G 
Sbjct  331  LRSMCSTGRWMDAEKLLAEMVHRGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  390

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C  GK+  A++
Sbjct  391  TPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDSAVE  450

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+          A++L+ EM  +GL+P++ TY++++ GL
Sbjct  451  ILNQLSS-KGCSPVLITYNTVIDGLSKVGKTERALELLHEMRKKGLKPDVITYSSLVGGL  509

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG +D A +FV  L   G KP+  ++N ++  L   +        L  M S GC+P  
Sbjct  510  SREGKIDEAIKFVHDLEDSGVKPNAITFNSIMLGLCKAKQTGRAIDFLAYMVSKGCQPTE  569

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G   +A+ +L  +  +G+
Sbjct  570  VTYTILIEGIAYEGLTKEALDLLNELCYRGV  600



>ref|XP_009148305.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Brassica rapa]
Length=593

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 205/317 (65%), Gaps = 10/317 (3%)
 Frame = -1

Query  945  NALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVK  766
            N+   L D++  +  R+L R+   G+ EE    L+ MV  G  PD++ CT LI+G   + 
Sbjct  87   NSSFALEDAESNNHLRQLVRT---GELEEGFKFLENMVYHGNVPDIIPCTTLIRGFCRMG  143

Query  765  KAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYN  589
            K +KA K++++LE  G  P+V+ Y  +I G+C+   + +A  +L+RM      PDVVTYN
Sbjct  144  KTKKAAKILEILEGSGAVPDVITYNVMISGYCRAGEITSALSLLDRM---SVSPDVVTYN  200

Query  588  IMIGSICDRGKLGLALKVLD-QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEML  412
             ++ S+CD GKL  A++VLD Q+K D  C PDV+TYT+LIEAT  + G+ EAMKL+DEM 
Sbjct  201  TILRSLCDSGKLKQAMEVLDRQLKRD--CYPDVITYTILIEATCRESGVGEAMKLLDEMR  258

Query  411  SRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWD  232
             +G  P++ TYN ++ G+C+EG +D A +F+  +P+ GC+P+V ++NI+LR++     W 
Sbjct  259  VKGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNIILRSMCSTGRWM  318

Query  231  DGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLI  52
            D EKLL +M   G  P   T+NI ++ LCR G L +AI +L+ M + G  PN  +Y+PL+
Sbjct  319  DAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCQPNSLSYNPLL  378

Query  51   SAFCKEGRLDLAIDLLD  1
              FCKE ++D AI+ L+
Sbjct  379  HGFCKEKKMDRAIEYLE  395


 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 159/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   +K    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  207  CDSGKLKQAMEVLDRQLKRDCYPDVITYTILIEATCRESGVGEAMKLLDEMRVKGCTPDV  266

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  267  VTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLAD  326

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M       P VVT+ +LI     K  +  A+ ++++M   G +PN  +YN +L G C+E 
Sbjct  327  MLR-KGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCQPNSLSYNPLLHGFCKEK  385

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN +L AL      +D  ++L ++SS GC P   TYN
Sbjct  386  KMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYN  445

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  KAI +L  M  K L P+  TY  L+    +EG++D AI   
Sbjct  446  TVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTITYSSLVGGLSREGKVDEAIKFF  499


 Score =   175 bits (443),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 159/296 (54%), Gaps = 5/296 (2%)
 Frame = -1

Query  888  RSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EP  712
            R  G G   E + LL  M   G  PDVV    L+ G+    + ++A+K +  +  +G +P
Sbjct  243  RESGVG---EAMKLLDEMRVKGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQP  299

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            NV+ +  ++   C T R   A  +L  M  +GF P VVT+NI+I  +C +G LG A+ +L
Sbjct  300  NVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDIL  359

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++M + + C+P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC+
Sbjct  360  EKMPK-HGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCK  418

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            +G V+ A E +  L + GC P + +YN ++  L          KLL EM +    P T T
Sbjct  419  DGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTIT  478

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            Y+  V  L R+GK+++AI         G+ PN  T++ ++   CK  + D AID L
Sbjct  479  YSSLVGGLSREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKTRQTDRAIDFL  534


 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 149/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G+ P VV    LI  L       +A+ +++ + + G 
Sbjct  308  LRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  367

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PN L+Y  L+ GFCK  +++ A   L RM SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  368  QPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVE  427

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM ++ L P+  TY++++ GL
Sbjct  428  ILNQL-SSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTITYSSLVGGL  486

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F      MG +P+  ++N ++  L   R  D     L  M + GC+P  
Sbjct  487  SREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKTRQTDRAIDFLVYMINRGCKPTE  546

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  +  +G   +A+ ++  +  KGL
Sbjct  547  TSYTILIEGIAYEGMAKEALELVNELCNKGL  577



>ref|XP_010061566.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Eucalyptus grandis]
 gb|KCW68536.1| hypothetical protein EUGRSUZ_F02164 [Eucalyptus grandis]
Length=620

 Score =   269 bits (687),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 196/301 (65%), Gaps = 8/301 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE    L+ MV  G  PDV+ CT LI+G   + K  KA +VM++LE+ 
Sbjct  132  RRLVRN---GELEEGFKFLENMVYRGDIPDVIACTSLIRGFCKLGKTRKATRVMEILEES  188

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK   +E A  VL RM      PDVVTYN ++ ++CD GKL  A
Sbjct  189  GAVPDVITYNVLISGYCKAGEIENALQVLERM---SIDPDVVTYNTILRTLCDSGKLKQA  245

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            ++VLD ++    C PDV+TYT+LIEAT  + G+ +AMKL+DEM  +G +P++ TYN ++ 
Sbjct  246  MQVLD-LQLQKGCYPDVITYTILIEATCKECGVGQAMKLLDEMRIKGCKPDVVTYNVLIN  304

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A +F+ ++P+  C+P+V ++NI+LR++     W D E+LL +M   GC P
Sbjct  305  GICKEGRLDEAIKFLNNMPSYNCQPNVITHNIILRSMCSTGRWMDAERLLADMLRKGCSP  364

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M   G TPN  +Y+PL+  FCKE ++  AI+ L
Sbjct  365  SVVTFNILINFLCRKGLLGRAIDVLEKMPNHGCTPNSLSYNPLLHGFCKEKKMKRAIEYL  424

Query  3    D  1
            D
Sbjct  425  D  425


 Score =   181 bits (459),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 165/325 (51%), Gaps = 38/325 (12%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C AG+ E  L +L+ M      PDVV    +++ L    K ++A++V+ L  Q G  P+V
Sbjct  205  CKAGEIENALQVLERM---SIDPDVVTYNTILRTLCDSGKLKQAMQVLDLQLQKGCYPDV  261

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK   V  A  +L+ MR +G  PDVVTYN++I  IC  G+L  A+K L+ 
Sbjct  262  ITYTILIEATCKECGVGQAMKLLDEMRIKGCKPDVVTYNVLINGICKEGRLDEAIKFLNN  321

Query  525  MKEDN----------------------------------NCKPDVVTYTVLIEATIVKDG  448
            M   N                                   C P VVT+ +LI     K  
Sbjct  322  MPSYNCQPNVITHNIILRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKGL  381

Query  447  ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNI  268
            +  A+ ++++M + G  PN  +YN +L G C+E  + RA E++  + + GC PD+ +YN 
Sbjct  382  LGRAIDVLEKMPNHGCTPNSLSYNPLLHGFCKEKKMKRAIEYLDIMVSRGCYPDIVTYNT  441

Query  267  LLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
            LL AL      +   ++L ++S+ GC P   TYN  +  L + GK N+AI +L  M EKG
Sbjct  442  LLTALCKDGKVNIAVEILNQLSTKGCSPVLITYNTVIDGLSKVGKTNRAIELLDEMREKG  501

Query  87   LTPNKFTYDPLISAFCKEGRLDLAI  13
            L P+  TY  LI    +EG++D AI
Sbjct  502  LRPDIITYSSLIGGLSREGKVDEAI  526


 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 160/297 (54%), Gaps = 5/297 (2%)
 Frame = -1

Query  888  RSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EP  712
            + CG G   + + LL  M   G KPDVV    LI G+    + ++A+K +  +  +  +P
Sbjct  273  KECGVG---QAMKLLDEMRIKGCKPDVVTYNVLINGICKEGRLDEAIKFLNNMPSYNCQP  329

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            NV+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ VL
Sbjct  330  NVITHNIILRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDVL  389

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++M  ++ C P+ ++Y  L+     +  +  A++ +D M+SRG  P+I TYN +L  LC+
Sbjct  390  EKMP-NHGCTPNSLSYNPLLHGFCKEKKMKRAIEYLDIMVSRGCYPDIVTYNTLLTALCK  448

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            +G V+ A E +  L   GC P + +YN ++  L      +   +LL EM   G  P   T
Sbjct  449  DGKVNIAVEILNQLSTKGCSPVLITYNTVIDGLSKVGKTNRAIELLDEMREKGLRPDIIT  508

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            Y+  +  L R+GK+++AI     +   G+ PN  TY+ ++   CK  + D AIDLLD
Sbjct  509  YSSLIGGLSREGKVDEAIRFFHELETLGVKPNAITYNSIMLGLCKTRQTDRAIDLLD  565


 Score =   164 bits (416),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 148/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L       +A+ V++ +   G 
Sbjct  338  LRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDVLEKMPNHGC  397

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C  GK+ +A++
Sbjct  398  TPNSLSYNPLLHGFCKEKKMKRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVNIAVE  457

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+        + A++L+DEM  +GL P+I TY++++ GL
Sbjct  458  ILNQLST-KGCSPVLITYNTVIDGLSKVGKTNRAIELLDEMREKGLRPDIITYSSLIGGL  516

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A  F   L  +G KP+  +YN ++  L   R  D    LL  M S  C+P  
Sbjct  517  SREGKVDEAIRFFHELETLGVKPNAITYNSIMLGLCKTRQTDRAIDLLDYMVSRKCKPTE  576

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G   +A+ +L  +  +G+
Sbjct  577  ATYTILIEGIAHEGFAKEALQLLNELCTRGV  607


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = -1

Query  273  NILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTE  94
            N  LR L+     ++G K L+ M   G  P        +   C+ GK  KA  +++I+ E
Sbjct  128  NNHLRRLVRNGELEEGFKFLENMVYRGDIPDVIACTSLIRGFCKLGKTRKATRVMEILEE  187

Query  93   KGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             G  P+  TY+ LIS +CK G ++ A+ +L+
Sbjct  188  SGAVPDVITYNVLISGYCKAGEIENALQVLE  218



>ref|NP_172461.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q3EDF8.1|PPR28_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g09900 
[Arabidopsis thaliana]
 gb|AEE28512.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=598

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 195/307 (64%), Gaps = 5/307 (2%)
 Frame = -1

Query  918  KEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM  739
            ++++    L +    G+ EE    L+ MV  G  PD++ CT LI+G   + K  KA K++
Sbjct  101  EDVESNNHLRQMVRTGELEEGFKFLENMVYHGNVPDIIPCTTLIRGFCRLGKTRKAAKIL  160

Query  738  QLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
            ++LE  G  P+V+ Y  +I G+CK   +  A  VL+RM      PDVVTYN ++ S+CD 
Sbjct  161  EILEGSGAVPDVITYNVMISGYCKAGEINNALSVLDRM---SVSPDVVTYNTILRSLCDS  217

Query  561  GKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYT  382
            GKL  A++VLD+M +  +C PDV+TYT+LIEAT    G+  AMKL+DEM  RG  P++ T
Sbjct  218  GKLKQAMEVLDRMLQ-RDCYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDVVT  276

Query  381  YNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            YN ++ G+C+EG +D A +F+  +P+ GC+P+V ++NI+LR++     W D EKLL +M 
Sbjct  277  YNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWMDAEKLLADML  336

Query  201  SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLD  22
              G  P   T+NI ++ LCR G L +AI +L+ M + G  PN  +Y+PL+  FCKE ++D
Sbjct  337  RKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPQHGCQPNSLSYNPLLHGFCKEKKMD  396

Query  21   LAIDLLD  1
             AI+ L+
Sbjct  397  RAIEYLE  403


 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 159/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L  M++    PDV+  T LI+          A+K++  +   G  P+V
Sbjct  215  CDSGKLKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDV  274

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  275  VTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWMDAEKLLAD  334

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M       P VVT+ +LI     K  +  A+ ++++M   G +PN  +YN +L G C+E 
Sbjct  335  MLR-KGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPQHGCQPNSLSYNPLLHGFCKEK  393

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN +L AL      +D  ++L ++SS GC P   TYN
Sbjct  394  KMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYN  453

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  KAI +L  M  K L P+  TY  L+    +EG++D AI   
Sbjct  454  TVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGLSREGKVDEAIKFF  507


 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 158/296 (53%), Gaps = 5/296 (2%)
 Frame = -1

Query  888  RSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EP  712
            R  G G     + LL  M   G  PDVV    L+ G+    + ++A+K +  +   G +P
Sbjct  251  RDSGVG---HAMKLLDEMRDRGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQP  307

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            NV+ +  ++   C T R   A  +L  M  +GF P VVT+NI+I  +C +G LG A+ +L
Sbjct  308  NVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDIL  367

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++M + + C+P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC+
Sbjct  368  EKMPQ-HGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCK  426

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            +G V+ A E +  L + GC P + +YN ++  L          KLL EM +   +P T T
Sbjct  427  DGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTIT  486

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            Y+  V  L R+GK+++AI         G+ PN  T++ ++   CK  + D AID L
Sbjct  487  YSSLVGGLSREGKVDEAIKFFHEFERMGIRPNAVTFNSIMLGLCKSRQTDRAIDFL  542


 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 151/271 (56%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G+ P VV    LI  L       +A+ +++ + Q G 
Sbjct  316  LRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPQHGC  375

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PN L+Y  L+ GFCK  +++ A   L RM SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  376  QPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVE  435

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM ++ L+P+  TY++++ GL
Sbjct  436  ILNQLSS-KGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGL  494

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F      MG +P+  ++N ++  L   R  D     L  M + GC+P+ 
Sbjct  495  SREGKVDEAIKFFHEFERMGIRPNAVTFNSIMLGLCKSRQTDRAIDFLVFMINRGCKPNE  554

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  L  +G   +A+ +L  +  KGL
Sbjct  555  TSYTILIEGLAYEGMAKEALELLNELCNKGL  585



>emb|CDX93465.1| BnaA06g05830D [Brassica napus]
Length=593

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 205/317 (65%), Gaps = 10/317 (3%)
 Frame = -1

Query  945  NALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVK  766
            N+   L D++  +  R+L R+   G+ EE    L+ MV  G  PD++ CT LI+G   + 
Sbjct  87   NSSFALEDAESNNHLRQLVRT---GELEEGFKFLENMVYHGNVPDIIPCTTLIRGFCRMG  143

Query  765  KAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYN  589
            K +KA K++++LE  G  P+V+ Y  +I G+C+   + +A  +L+RM      PDVVTYN
Sbjct  144  KTKKAAKILEILEGSGAVPDVITYNVMISGYCRAGDINSALSLLDRM---SVSPDVVTYN  200

Query  588  IMIGSICDRGKLGLALKVLD-QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEML  412
             ++ S+CD GKL  A++VLD Q+K D  C PDV+TYT+LIEAT  + G+ EAMKL+DEM 
Sbjct  201  TILRSLCDSGKLKQAMEVLDRQLKRD--CYPDVITYTILIEATCRESGVGEAMKLLDEMR  258

Query  411  SRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWD  232
             +G  P++ TYN ++ G+C+EG +D A +F+  +P+ GC+P+V ++NI+LR++     W 
Sbjct  259  VKGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPNVITHNIILRSMCSTGRWM  318

Query  231  DGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLI  52
            D EKLL +M   G  P   T+NI ++ LCR G L +AI +L+ M + G  PN  +Y+PL+
Sbjct  319  DAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCQPNSLSYNPLL  378

Query  51   SAFCKEGRLDLAIDLLD  1
              FCKE ++D AI+ L+
Sbjct  379  HGFCKEKKMDRAIEYLE  395


 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/320 (33%), Positives = 171/320 (53%), Gaps = 7/320 (2%)
 Frame = -1

Query  945  NALIQLLD----SKEIDIRRRLNRS-CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKG  781
            N+ + LLD    S ++     + RS C +GK ++ + +L   +K    PDV+  T LI+ 
Sbjct  181  NSALSLLDRMSVSPDVVTYNTILRSLCDSGKLKQAMEVLDRQLKRDCYPDVITYTILIEA  240

Query  780  LFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPD  604
                    +A+K++  +   G  P+V+ Y  L+ G CK  R++ A   LN M S G  P+
Sbjct  241  TCRESGVGEAMKLLDEMRVKGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPN  300

Query  603  VVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLV  424
            V+T+NI++ S+C  G+   A K+L  M       P VVT+ +LI     K  +  A+ ++
Sbjct  301  VITHNIILRSMCSTGRWMDAEKLLADMLR-KGFSPSVVTFNILINFLCRKGLLGRAIDIL  359

Query  423  DEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDR  244
            ++M   G +PN  +YN +L G C+E  +DRA E++  + + GC PD+ +YN +L AL   
Sbjct  360  EKMPKHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKD  419

Query  243  RNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTY  64
               +D  ++L ++SS GC P   TYN  +  L + GK  KAI +L  M  K L P+  TY
Sbjct  420  GKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTITY  479

Query  63   DPLISAFCKEGRLDLAIDLL  4
              L+    +EG++D AI   
Sbjct  480  SSLVGGLSREGKVDEAIKFF  499


 Score =   175 bits (443),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 159/296 (54%), Gaps = 5/296 (2%)
 Frame = -1

Query  888  RSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EP  712
            R  G G   E + LL  M   G  PDVV    L+ G+    + ++A+K +  +  +G +P
Sbjct  243  RESGVG---EAMKLLDEMRVKGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQP  299

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            NV+ +  ++   C T R   A  +L  M  +GF P VVT+NI+I  +C +G LG A+ +L
Sbjct  300  NVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDIL  359

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++M + + C+P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC+
Sbjct  360  EKMPK-HGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCK  418

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            +G V+ A E +  L + GC P + +YN ++  L          KLL EM +    P T T
Sbjct  419  DGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTIT  478

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            Y+  V  L R+GK+++AI         G+ PN  T++ ++   CK  + D AID L
Sbjct  479  YSSLVGGLSREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKTRQTDRAIDFL  534


 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 149/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G+ P VV    LI  L       +A+ +++ + + G 
Sbjct  308  LRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  367

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PN L+Y  L+ GFCK  +++ A   L RM SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  368  QPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVE  427

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM ++ L P+  TY++++ GL
Sbjct  428  ILNQL-SSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTITYSSLVGGL  486

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F      MG +P+  ++N ++  L   R  D     L  M + GC+P  
Sbjct  487  SREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKTRQTDRAIDFLVYMINRGCKPTE  546

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  +  +G   +A+ +L  +  KGL
Sbjct  547  TSYTILIEGIAYEGMAKEALELLNELCNKGL  577



>ref|XP_002889775.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66034.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=598

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 201/316 (64%), Gaps = 8/316 (3%)
 Frame = -1

Query  945  NALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVK  766
            N+   L D +  +  R+L R+   G+ EE    L+ MV  G  PD++ CT LI+G   + 
Sbjct  95   NSSFVLEDVESNNHLRQLVRT---GELEEGFKFLENMVYHGNVPDIIPCTTLIRGFCRMG  151

Query  765  KAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYN  589
            K  KA K++++LE  G  P+V+ Y  +I G+CK   +  A  VL+RM      PDVVTYN
Sbjct  152  KTRKAAKILEVLEGSGAVPDVITYNVMISGYCKAGEINNALSVLDRM---SVSPDVVTYN  208

Query  588  IMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLS  409
             ++ S+CD GKL  A++VLD+M +  +C PDV+TYT+LIEAT    G+ +AMKL+DEM  
Sbjct  209  TILRSLCDSGKLKQAMEVLDRMLQ-RDCYPDVITYTILIEATCRDSGVGQAMKLLDEMRD  267

Query  408  RGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDD  229
            RG  P++ TYN ++ G+C+EG +D A +F+  +P+ GC+P+V ++NI+LR++     W D
Sbjct  268  RGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWMD  327

Query  228  GEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLIS  49
             EKLL +M   G  P   T+NI ++ LCR G L +AI +L+ M + G  PN  +Y+PL+ 
Sbjct  328  AEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCQPNSLSYNPLLH  387

Query  48   AFCKEGRLDLAIDLLD  1
             FCKE ++D AI+ L+
Sbjct  388  GFCKEKKMDRAIEYLE  403


 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 160/291 (55%), Gaps = 2/291 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L  M++    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  215  CDSGKLKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGQAMKLLDEMRDRGCTPDV  274

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  275  VTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWMDAEKLLAD  334

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M       P VVT+ +LI     K  +  A+ ++++M   G +PN  +YN +L G C+E 
Sbjct  335  MLR-KGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCQPNSLSYNPLLHGFCKEK  393

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN +L AL      +D  ++L ++SS GC P   TYN
Sbjct  394  KMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYN  453

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              +  L + GK  KAI +L  M  K L P+  TY  L+    +EG++D AI
Sbjct  454  TVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGLSREGKVDEAI  504


 Score =   172 bits (437),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 159/296 (54%), Gaps = 5/296 (2%)
 Frame = -1

Query  888  RSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EP  712
            R  G G   + + LL  M   G  PDVV    L+ G+    + ++A+K +  +   G +P
Sbjct  251  RDSGVG---QAMKLLDEMRDRGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQP  307

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            NV+ +  ++   C T R   A  +L  M  +GF P VVT+NI+I  +C +G LG A+ +L
Sbjct  308  NVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDIL  367

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++M + + C+P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC+
Sbjct  368  EKMPK-HGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCK  426

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            +G V+ A E +  L + GC P + +YN ++  L          KLL EM +   +P T T
Sbjct  427  DGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTIT  486

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            Y+  V  L R+GK+++AI         G+ PN  T++ ++   CK  + D AID L
Sbjct  487  YSSLVGGLSREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKTRQTDRAIDFL  542


 Score =   166 bits (421),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 150/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G+ P VV    LI  L       +A+ +++ + + G 
Sbjct  316  LRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  375

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PN L+Y  L+ GFCK  +++ A   L RM SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  376  QPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVE  435

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM ++ L+P+  TY++++ GL
Sbjct  436  ILNQLSS-KGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGL  494

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F      MG +P+  ++N ++  L   R  D     L  M + GC+P  
Sbjct  495  SREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKTRQTDRAIDFLVYMINRGCKPTE  554

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  L  +G   +A+ +L  +  KGL
Sbjct  555  TSYTILIEGLAYEGMAKEALELLNELCNKGL  585



>ref|XP_003527866.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Glycine max]
Length=603

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 198/302 (66%), Gaps = 10/302 (3%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            R+L R+   G+ EE L  L+ M+  G  PDV+ CT LI+G     K  KA ++M++LE  
Sbjct  115  RKLVRN---GELEEGLKFLERMIYQGDIPDVIACTSLIRGFCRSGKTRKATRIMEILENS  171

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LIGG+CK+  ++ A  VL RM      PDVVTYN ++ S+CD GKL  A
Sbjct  172  GAVPDVITYNVLIGGYCKSGEIDKALQVLERM---SVAPDVVTYNTILRSLCDSGKLKEA  228

Query  543  LKVLD-QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAIL  367
            ++VLD QM+ +  C PDV+TYT+LIEAT    G+ +AMKL+DEM  +G +P++ TYN ++
Sbjct  229  MEVLDRQMQRE--CYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLI  286

Query  366  KGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCE  187
             G+C+EG +D A +F+ ++P  GC+P+V ++NI+LR++     W D E+LL +M   GC 
Sbjct  287  NGICKEGRLDEAIKFLNNMPLYGCQPNVITHNIILRSMCSTGRWMDAERLLADMLRKGCS  346

Query  186  PHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            P   T+NI ++ LCR   L +AI +L+ M + G  PN  +Y+PL+  FC+E ++D AI+ 
Sbjct  347  PSVVTFNILINFLCRKRLLGRAIDVLEKMPKHGCMPNSLSYNPLLHGFCQEKKMDRAIEY  406

Query  6    LD  1
            L+
Sbjct  407  LE  408


 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 160/294 (54%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK +E + +L   ++    PDV+  T LI+   +     +A+K++  + + G +P+V
Sbjct  220  CDSGKLKEAMEVLDRQMQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDV  279

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M   G  P+V+T+NI++ S+C  G+   A ++L  
Sbjct  280  VTYNVLINGICKEGRLDEAIKFLNNMPLYGCQPNVITHNIILRSMCSTGRWMDAERLLAD  339

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  340  MLR-KGCSPSVVTFNILINFLCRKRLLGRAIDVLEKMPKHGCMPNSLSYNPLLHGFCQEK  398

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  399  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKADAAVEILNQLSSKGCSPVLITYN  458

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   A  +L+ M  KGL P+  TY  L+     EG++D AI + 
Sbjct  459  TVIDGLTKVGKTEYAAELLEEMRRKGLKPDIITYSTLLRGLGCEGKVDEAIKIF  512


 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/317 (30%), Positives = 154/317 (49%), Gaps = 37/317 (12%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M K G KPDVV    LI G+    + ++A+K +  +  +G +PN
Sbjct  254  TCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLINGICKEGRLDEAIKFLNNMPLYGCQPN  313

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +  LG A+ VL+
Sbjct  314  VITHNIILRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKRLLGRAIDVLE  373

Query  528  QMKEDN----------------------------------NCKPDVVTYTVLIEATIVKD  451
            +M +                                     C PD+VTY  L+ A + KD
Sbjct  374  KMPKHGCMPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTA-LCKD  432

Query  450  GISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSY  274
            G ++ A+++++++ S+G  P + TYN ++ GL + G  + A E +  +   G KPD+ +Y
Sbjct  433  GKADAAVEILNQLSSKGCSPVLITYNTVIDGLTKVGKTEYAAELLEEMRRKGLKPDIITY  492

Query  273  NILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTE  94
            + LLR L      D+  K+  +M  +  +P   TYN  +  LC+  + ++AI  L  M E
Sbjct  493  STLLRGLGCEGKVDEAIKIFHDMEGLSIKPSAVTYNAIMLGLCKAQQTSRAIDFLAYMVE  552

Query  93   KGLTPNKFTYDPLISAF  43
            KG  P K TY  LI   
Sbjct  553  KGCKPTKATYTILIEGI  569


 Score =   140 bits (354),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 135/251 (54%), Gaps = 4/251 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L   +   +A+ V++ + + G 
Sbjct  321  LRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKRLLGRAIDVLEKMPKHGC  380

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFC+  +++ A   L  M SRG +PD+VTYN ++ ++C  GK   A++
Sbjct  381  MPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKADAAVE  440

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+     C P ++TY  +I+  + K G +E A +L++EM  +GL+P+I TY+ +L+G
Sbjct  441  ILNQL-SSKGCSPVLITYNTVIDG-LTKVGKTEYAAELLEEMRRKGLKPDIITYSTLLRG  498

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L  EG VD A +    +  +  KP   +YN ++  L   +        L  M   GC+P 
Sbjct  499  LGCEGKVDEAIKIFHDMEGLSIKPSAVTYNAIMLGLCKAQQTSRAIDFLAYMVEKGCKPT  558

Query  180  TFTYNIFVSSL  148
              TY I +  +
Sbjct  559  KATYTILIEGI  569



>ref|XP_004501057.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Cicer arietinum]
Length=591

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/337 (40%), Positives = 205/337 (61%), Gaps = 7/337 (2%)
 Frame = -1

Query  1002  FRERNLKNLQSVKVSTEN--RNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVK  829
             F  ++ +  Q +  +  N  +++ I   + +EID    L +    GK E+    L+ M  
Sbjct  59    FNRKSQQRFQRIPTNNSNGIQSSSIDSQNLEEIDNNSYLVKLVRIGKLEQGFRFLERMSY  118

Query  828   IGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEA  652
              G  PDV+ CT LI+      K +KA +V+Q+LE  G  P+V+ Y  LI G+CK+  VE 
Sbjct  119   QGDMPDVIACTNLIRQFCKTGKTKKATRVLQILEDSGAVPDVITYNVLISGYCKSGEVEE  178

Query  651   ANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLI  472
             A  VL RM      PDVVTYN ++ S+CD GKL  A++VLD+  E   C PDV+TYT+LI
Sbjct  179   ALQVLERM---SVSPDVVTYNTILRSLCDSGKLKQAMEVLDRQLE-RVCYPDVITYTILI  234

Query  471   EATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCK  292
             EA   + G+ EAMKL D M  +G +P+++T+N ++ G C+EG +D+A +F+  + + GC+
Sbjct  235   EAICKESGVGEAMKLFDAMRIKGCKPDVFTFNVLINGFCKEGRLDKAIKFLNDMSSYGCE  294

Query  291   PDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISM  112
             P+V ++NI+LR+L     W D E LL +M   GC P   T+NI ++ LCR G L +AI +
Sbjct  295   PNVITHNIILRSLCGTGRWRDAESLLSDMLRKGCSPSVVTFNILINFLCRKGLLGRAIDI  354

Query  111   LKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             L+ M   G TPN  +Y+PL+  FC+E ++D AI+ L+
Sbjct  355   LEKMKNHGCTPNSLSYNPLLHGFCQEKKMDRAIEYLE  391


 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 102/294 (35%), Positives = 163/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+ +       +A+K+   +   G +P+V
Sbjct  203  CDSGKLKQAMEVLDRQLERVCYPDVITYTILIEAICKESGVGEAMKLFDAMRIKGCKPDV  262

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              +  LI GFCK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A  +L  
Sbjct  263  FTFNVLINGFCKEGRLDKAIKFLNDMSSYGCEPNVITHNIILRSLCGTGRWRDAESLLSD  322

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M + G  PN  +YN +L G C+E 
Sbjct  323  MLR-KGCSPSVVTFNILINFLCRKGLLGRAIDILEKMKNHGCTPNSLSYNPLLHGFCQEK  381

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   +LL ++SS GC P   TYN
Sbjct  382  KMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVALELLNQLSSKGCSPVAITYN  441

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + G   +A+ +L  M  KGL P+  TY  LI+ F +EG++D+AI + 
Sbjct  442  TVIGGLSKVGATERAMKLLDEMCRKGLKPDVVTYSSLIAGFIREGKVDVAIKIF  495


 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 156/294 (53%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C      E + L   M   G KPDV     LI G     + +KA+K +  +  +G EPNV
Sbjct  238  CKESGVGEAMKLFDAMRIKGCKPDVFTFNVLINGFCKEGRLDKAIKFLNDMSSYGCEPNV  297

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + +  ++   C T R   A  +L+ M  +G  P VVT+NI+I  +C +G LG A+ +L++
Sbjct  298  ITHNIILRSLCGTGRWRDAESLLSDMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEK  357

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            MK ++ C P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC++G
Sbjct  358  MK-NHGCTPNSLSYNPLLHGFCQEKKMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDG  416

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A E +  L + GC P   +YN ++  L      +   KLL EM   G +P   TY+
Sbjct  417  KVDVALELLNQLSSKGCSPVAITYNTVIGGLSKVGATERAMKLLDEMCRKGLKPDVVTYS  476

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              ++   R+GK++ AI +   +   G+  N  TY+ ++S  CK  R   AIDLL
Sbjct  477  SLIAGFIREGKVDVAIKIFHELERLGIRANAVTYNSIMSGLCKARRTSHAIDLL  530


 Score =   161 bits (408),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 149/268 (56%), Gaps = 4/268 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CG G++ +   LL  M++ G  P VV    LI  L       +A+ +++ ++  G  PN 
Sbjct  308  CGTGRWRDAESLLSDMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMKNHGCTPNS  367

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L+Y  L+ GFC+  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+ +AL++L+Q
Sbjct  368  LSYNPLLHGFCQEKKMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVALELLNQ  427

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +     C P  +TY  +I   + K G +E AMKL+DEM  +GL+P++ TY++++ G  RE
Sbjct  428  L-SSKGCSPVAITYNTVI-GGLSKVGATERAMKLLDEMCRKGLKPDVVTYSSLIAGFIRE  485

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G VD A +    L  +G + +  +YN ++  L   R       LL  M + GC+P   TY
Sbjct  486  GKVDVAIKIFHELERLGIRANAVTYNSIMSGLCKARRTSHAIDLLARMIAKGCKPTEATY  545

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             I +  +  +G   +A+ +L  ++ +G 
Sbjct  546  TILIEGIAYEGLAEEALGLLNELSSRGF  573



>ref|XP_008219211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Prunus mume]
Length=611

 Score =   267 bits (682),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 217/359 (60%), Gaps = 22/359 (6%)
 Frame = -1

Query  1023  VKCKKHEFRERNLKN--LQSVKVSTENRNALIQLLDS---------------KEIDIRRR  895
             ++C+ H+  +++ +   L + KV T + N  +Q +++               +E +   +
Sbjct  62    IQCRIHDGYQKHRRKPVLVASKVETLSSNGRLQNVENTPHGSLNKMDSSNGFEEFESNNQ  121

Query  894   LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE  715
             L R    G+ EE    L+ MV  G  PD + CT LI+G     K  KA ++M +LE+ G 
Sbjct  122   LRRLVRNGELEEGFKFLETMVYRGDVPDNIACTSLIRGFCKSGKTRKATRIMNILEESGA  181

Query  714   P-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
               +V+ Y  LI G+CK   ++ A  VL+RM      PDVVTYN ++ ++CD GKL  A++
Sbjct  182   ILDVITYNVLISGYCKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDSGKLTQAME  238

Query  537   VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
             VLD+  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ TYN ++ G+
Sbjct  239   VLDRQLQ-RECYPDVITYTILIEATCKEYGVEQAMKLLDEMRSKGCKPDVVTYNVLINGI  297

Query  357   CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             C+EG +D A  F+  +P+  C+P+V ++NI+LR++     W D EKLL +M   GC P  
Sbjct  298   CKEGRLDEAIRFLNEMPSSDCQPNVITHNIILRSMCSTGRWMDAEKLLADMVLRGCSPSV  357

Query  177   FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+  FCKE ++D AI+ LD
Sbjct  358   VTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLD  416


 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 172/295 (58%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C AG+ +  L +L  M      PDVV    +++ L    K  +A++V+ + L++   P+V
Sbjct  196  CKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDSGKLTQAMEVLDRQLQRECYPDV  252

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK   VE A  +L+ MRS+G  PDVVTYN++I  IC  G+L  A++ L++
Sbjct  253  ITYTILIEATCKEYGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIRFLNE  312

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   ++C+P+V+T+ +++ +        +A KL+ +M+ RG  P++ T+N ++  LCR+G
Sbjct  313  MPS-SDCQPNVITHNIILRSMCSTGRWMDAEKLLADMVLRGCSPSVVTFNILINFLCRKG  371

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL      +  D   + L  M S GC P   TYN
Sbjct  372  LLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYN  431

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LC+DGK++ A+ +L  ++ KG +P   TY+ +I    K G+   AI+LLD
Sbjct  432  TLLTALCKDGKVDNAVGILNQLSSKGCSPVLITYNTVIDGLSKVGKTKRAIELLD  486


 Score =   155 bits (393),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 146/271 (54%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  MV  G  P VV    LI  L       +A+ +++ + + G 
Sbjct  329  LRSMCSTGRWMDAEKLLADMVLRGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGC  388

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C  GK+  A+ 
Sbjct  389  TPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDNAVG  448

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+          A++L+DEM  +GL+P+I TY++++ GL
Sbjct  449  ILNQL-SSKGCSPVLITYNTVIDGLSKVGKTKRAIELLDEMRKKGLKPDIITYSSLVGGL  507

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +FV  L   G KP+  ++N ++  L   +        L  M S GC+P  
Sbjct  508  SREGKVDEAIKFVHDLEDSGIKPNAITFNSVMLGLCKAKQTGRAIDFLAYMVSKGCKPTE  567

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G   +A+ +L  +  +G+
Sbjct  568  ATYTILIEGIANEGLAKEALELLNELCCRGV  598


 Score =   150 bits (378),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/331 (29%), Positives = 158/331 (48%), Gaps = 37/331 (11%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPN  709
            +C     E+ + LL  M   G KPDVV    LI G+    + ++A++ + ++     +PN
Sbjct  262  TCKEYGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIRFLNEMPSSDCQPN  321

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  RG  P VVT+NI+I  +C +G LG A+ +L+
Sbjct  322  VITHNIILRSMCSTGRWMDAEKLLADMVLRGCSPSVVTFNILINFLCRKGLLGRAIDILE  381

Query  528  QMKEDN----------------------------------NCKPDVVTYTVLIEATIVKD  451
            +M +                                     C PD+VTY  L+ A + KD
Sbjct  382  KMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTA-LCKD  440

Query  450  G-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSY  274
            G +  A+ +++++ S+G  P + TYN ++ GL + G   RA E +  +   G KPD+ +Y
Sbjct  441  GKVDNAVGILNQLSSKGCSPVLITYNTVIDGLSKVGKTKRAIELLDEMRKKGLKPDIITY  500

Query  273  NILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTE  94
            + L+  L      D+  K + ++   G +P+  T+N  +  LC+  +  +AI  L  M  
Sbjct  501  SSLVGGLSREGKVDEAIKFVHDLEDSGIKPNAITFNSVMLGLCKAKQTGRAIDFLAYMVS  560

Query  93   KGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            KG  P + TY  LI     EG    A++LL+
Sbjct  561  KGCKPTEATYTILIEGIANEGLAKEALELLN  591



>ref|XP_009402131.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Musa acuminata subsp. malaccensis]
Length=570

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 191/300 (64%), Gaps = 5/300 (2%)
 Frame = -1

Query  897  RLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG  718
            RL R    G+ +E L LL+ M   G  PD++ CT LI+G   + +   A +V+ LLE  G
Sbjct  79   RLRRVVRLGELDEGLRLLEAMPGRGEVPDIIPCTSLIRGFCRLGRTRSAARVLDLLESSG  138

Query  717  E-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLAL  541
              P+V+ Y  +I G+CK+   +AA  +L RM      PDVVTYN +  S+C+RG+L  AL
Sbjct  139  AAPDVITYNVMIAGYCKSGVPDAALRLLRRMT---VPPDVVTYNTIFQSLCERGRLTKAL  195

Query  540  KVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
            ++LD M +   C PDV TYT+LIEA   + G+ +AMKL+DEM ++G  P++ TYN ++ G
Sbjct  196  ELLDSMLQ-RGCAPDVFTYTILIEAACKESGVGQAMKLLDEMRAKGCTPDVVTYNVLING  254

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            +C+EG +D A EF+  + + GC P+V S+NI+LR++     W D EKLL +M   GC P 
Sbjct  255  ICKEGRLDEAIEFLSGMQSYGCNPNVISHNIILRSMCSTGRWMDAEKLLADMIHKGCSPS  314

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              T+NI ++ LCR G L +AI +L+ M E G TPN  +Y+P++  FCKE ++D A++ LD
Sbjct  315  VVTFNILINFLCRKGLLARAIDVLEKMPEHGCTPNSMSYNPVLHGFCKEKKMDRALEYLD  374


 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 164/294 (56%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  + L LL  M++ G  PDV   T LI+         +A+K++  +   G  P+V
Sbjct  186  CERGRLTKALELLDSMLQRGCAPDVFTYTILIEAACKESGVGQAMKLLDEMRAKGCTPDV  245

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   L+ M+S G  P+V+++NI++ S+C  G+   A K+L  
Sbjct  246  VTYNVLINGICKEGRLDEAIEFLSGMQSYGCNPNVISHNIILRSMCSTGRWMDAEKLLAD  305

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  ++ A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  306  MIH-KGCSPSVVTFNILINFLCRKGLLARAIDVLEKMPEHGCTPNSMSYNPVLHGFCKEK  364

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      +   ++L+++   GC P   TYN
Sbjct  365  KMDRALEYLDKMVSRGCYPDIVTYNTLLTALCKDGKVEVALEMLQQLGGKGCSPVLITYN  424

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + G  +KA+ +LK M +KGL P+  TY  L++   +EGR++ AI++ 
Sbjct  425  TVIDGLSKVGNTSKALELLKEMMQKGLHPDIITYSSLVAGLSREGRINEAINIF  478


 Score =   181 bits (459),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 163/294 (55%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +G  +  L LL+ M      PDVV    + + L    +  KA++++  + Q G  P+V
Sbjct  154  CKSGVPDAALRLLRRMT---VPPDVVTYNTIFQSLCERGRLTKALELLDSMLQRGCAPDV  210

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
              YT LI   CK + V  A  +L+ MR++G  PDVVTYN++I  IC  G+L  A++ L  
Sbjct  211  FTYTILIEAACKESGVGQAMKLLDEMRAKGCTPDVVTYNVLINGICKEGRLDEAIEFLSG  270

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +   C P+V+++ +++ +        +A KL+ +M+ +G  P++ T+N ++  LCR+G
Sbjct  271  M-QSYGCNPNVISHNIILRSMCSTGRWMDAEKLLADMIHKGCSPSVVTFNILINFLCRKG  329

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN +L      +  D   + L +M S GC P   TYN
Sbjct  330  LLARAIDVLEKMPEHGCTPNSMSYNPVLHGFCKEKKMDRALEYLDKMVSRGCYPDIVTYN  389

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +++LC+DGK+  A+ ML+ +  KG +P   TY+ +I    K G    A++LL
Sbjct  390  TLLTALCKDGKVEVALEMLQQLGGKGCSPVLITYNTVIDGLSKVGNTSKALELL  443


 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G  PDVV    LI G+    + ++A++ +  ++ +G  PN
Sbjct  220  ACKESGVGQAMKLLDEMRAKGCTPDVVTYNVLINGICKEGRLDEAIEFLSGMQSYGCNPN  279

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+++  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G L  A+ VL+
Sbjct  280  VISHNIILRSMCSTGRWMDAEKLLADMIHKGCSPSVVTFNILINFLCRKGLLARAIDVLE  339

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M E + C P+ ++Y  ++     +  +  A++ +D+M+SRG  P+I TYN +L  LC++
Sbjct  340  KMPE-HGCTPNSMSYNPVLHGFCKEKKMDRALEYLDKMVSRGCYPDIVTYNTLLTALCKD  398

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G V+ A E ++ L   GC P + +YN ++  L    N     +LLKEM   G  P   TY
Sbjct  399  GKVEVALEMLQQLGGKGCSPVLITYNTVIDGLSKVGNTSKALELLKEMMQKGLHPDIITY  458

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  V+ L R+G++N+AI++ + + + G  PN   Y+ +I   CK  +   AID  
Sbjct  459  SSLVAGLSREGRINEAINIFQDLQKMGTRPNANIYNSIILGLCKVQQTVRAIDFF  513


 Score =   152 bits (385),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 145/271 (54%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M+  G  P VV    LI  L       +A+ V++ + + G 
Sbjct  287  LRSMCSTGRWMDAEKLLADMIHKGCSPSVVTFNILINFLCRKGLLARAIDVLEKMPEHGC  346

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN ++Y  ++ GFCK  +++ A   L++M SRG +PD+VTYN ++ ++C  GK+ +AL+
Sbjct  347  TPNSMSYNPVLHGFCKEKKMDRALEYLDKMVSRGCYPDIVTYNTLLTALCKDGKVEVALE  406

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L Q+     C P ++TY  +I+        S+A++L+ EM+ +GL P+I TY++++ GL
Sbjct  407  MLQQLG-GKGCSPVLITYNTVIDGLSKVGNTSKALELLKEMMQKGLHPDIITYSSLVAGL  465

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG ++ A    + L  MG +P+   YN ++  L   +           M S GC P  
Sbjct  466  SREGRINEAINIFQDLQKMGTRPNANIYNSIILGLCKVQQTVRAIDFFAYMVSNGCMPTE  525

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  L  +G   +A+ +L  +  +G+
Sbjct  526  STYTILIEGLAYEGMTTEALELLGELCSRGV  556


 Score = 67.0 bits (162),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 62/126 (49%), Gaps = 3/126 (2%)
 Frame = -1

Query  378  NAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSS  199
            N  L+ + R G +D     + ++P  G  PD+     L+R            ++L  + S
Sbjct  77   NDRLRRVVRLGELDEGLRLLEAMPGRGEVPDIIPCTSLIRGFCRLGRTRSAARVLDLLES  136

Query  198  MGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDL  19
             G  P   TYN+ ++  C+ G  + A+ +L+ MT   + P+  TY+ +  + C+ GRL  
Sbjct  137  SGAAPDVITYNVMIAGYCKSGVPDAALRLLRRMT---VPPDVVTYNTIFQSLCERGRLTK  193

Query  18   AIDLLD  1
            A++LLD
Sbjct  194  ALELLD  199



>ref|XP_010490447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Camelina sativa]
Length=600

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/307 (42%), Positives = 195/307 (64%), Gaps = 5/307 (2%)
 Frame = -1

Query  918  KEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM  739
            ++++    L +    G+ EE    L+ MV  G  PD++ CT LI+G   + K  KA K++
Sbjct  103  EDVESNNHLRQMVRTGELEEGFKFLENMVYHGNVPDIIPCTTLIRGFCRMGKTRKAAKIL  162

Query  738  QLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
            ++LE  G  P+V+ Y  +I G+CK   +  A  VL+RM      PDVVTYN ++ S+CD 
Sbjct  163  EILEGSGAVPDVITYNVMISGYCKAGEISNALSVLDRM---SVSPDVVTYNTILRSLCDS  219

Query  561  GKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYT  382
            GKL  A++VL++M +  +C PDV+TYT+LIEAT    G+ +AMKL+DEM  RG  P++ T
Sbjct  220  GKLKQAMEVLNRMLQ-RDCYPDVITYTILIEATCRDSGVGQAMKLLDEMRDRGCTPDVVT  278

Query  381  YNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            YN ++ G+C+EG +D A +F+  +P+ GC+P+V ++NI+LR++     W D EKLL +M 
Sbjct  279  YNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWMDAEKLLADML  338

Query  201  SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLD  22
              G  P   T+NI ++ LCR G L +AI +L+ M   G  PN  +Y+PL+  FCKE ++D
Sbjct  339  RKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPNHGCQPNSLSYNPLLHGFCKEKKMD  398

Query  21   LAIDLLD  1
             AI+ L+
Sbjct  399  RAIEYLE  405


 Score =   182 bits (463),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 161/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L  M++    PDV+  T LI+         +A+K++  +   G  P+V
Sbjct  217  CDSGKLKQAMEVLNRMLQRDCYPDVITYTILIEATCRDSGVGQAMKLLDEMRDRGCTPDV  276

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A K+L  
Sbjct  277  VTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWMDAEKLLAD  336

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M       P VVT+ +LI     K  +  A+ ++++M + G +PN  +YN +L G C+E 
Sbjct  337  MLR-KGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPNHGCQPNSLSYNPLLHGFCKEK  395

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN +L AL      +D  ++L ++SS GC P   TYN
Sbjct  396  KMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYN  455

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK  KAI +L  M  K L P+  TY  L+    +EG++D AI   
Sbjct  456  TVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGLSREGKVDEAIKFF  509


 Score =   172 bits (437),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 159/296 (54%), Gaps = 5/296 (2%)
 Frame = -1

Query  888  RSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EP  712
            R  G G   + + LL  M   G  PDVV    L+ G+    + ++A+K +  +   G +P
Sbjct  253  RDSGVG---QAMKLLDEMRDRGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQP  309

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            NV+ +  ++   C T R   A  +L  M  +GF P VVT+NI+I  +C +G LG A+ +L
Sbjct  310  NVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDIL  369

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++M  ++ C+P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC+
Sbjct  370  EKMP-NHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCK  428

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            +G V+ A E +  L + GC P + +YN ++  L          KLL EM +   +P T T
Sbjct  429  DGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTIT  488

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            Y+  V  L R+GK+++AI         G+ PN  T++ ++   CK  + D AID L
Sbjct  489  YSSLVGGLSREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKTRQTDRAIDFL  544


 Score =   164 bits (416),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 149/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G+ P VV    LI  L       +A+ +++ +   G 
Sbjct  318  LRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPNHGC  377

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PN L+Y  L+ GFCK  +++ A   L RM SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  378  QPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVE  437

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM ++ L+P+  TY++++ GL
Sbjct  438  ILNQL-SSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGL  496

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F      MG +P+  ++N ++  L   R  D     L  M + GC+P  
Sbjct  497  SREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKTRQTDRAIDFLVYMINRGCKPTE  556

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  +  +G   +A+ +L  +  KGL
Sbjct  557  TSYTILIEGIAYEGMPKEALELLNELCNKGL  587



>ref|XP_007137661.1| hypothetical protein PHAVU_009G145100g [Phaseolus vulgaris]
 gb|ESW09655.1| hypothetical protein PHAVU_009G145100g [Phaseolus vulgaris]
Length=600

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 193/292 (66%), Gaps = 5/292 (2%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAY  697
            G+ EE L  L+ M+  G  PDV+ CT LI+G     K +KA +VM++LE  G  P+V+ Y
Sbjct  118  GELEEGLKFLERMIYQGDIPDVIACTSLIRGFCKGGKTKKATRVMEILENSGAVPDVITY  177

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
              LI G+CK+  ++ A  VL RM      PDVVTYN ++ S+C  GKL  A++VLD+  +
Sbjct  178  NVLISGYCKSGDIDRALQVLERM---SVAPDVVTYNTILRSLCSSGKLKEAMEVLDRQLQ  234

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
               C PDV+TYT+LIEAT  + G+ +AMKL+DEM ++G +P++ TYN ++ G+C+EG +D
Sbjct  235  -RECYPDVITYTILIEATCNESGVGQAMKLLDEMRNKGCKPDVVTYNVLINGICKEGRLD  293

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A +F+ S+P+ GC+P+V ++NI+LR++     W D E+LL +M   GC P   T+NI +
Sbjct  294  EAIKFLNSMPSYGCQPNVITHNIILRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILI  353

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + LCR   L +AI +L+ M + G  PN  +Y+PL+  FC+E ++D AI+ L+
Sbjct  354  NFLCRKRLLGRAIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLE  405


 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK +E + +L   ++    PDV+  T LI+   +     +A+K++  +   G +P+V
Sbjct  217  CSSGKLKEAMEVLDRQLQRECYPDVITYTILIEATCNESGVGQAMKLLDEMRNKGCKPDV  276

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A ++L  
Sbjct  277  VTYNVLINGICKEGRLDEAIKFLNSMPSYGCQPNVITHNIILRSMCSTGRWMDAERLLAD  336

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  337  MLR-KGCSPSVVTFNILINFLCRKRLLGRAIDVLEKMPKHGCVPNSLSYNPLLHGFCQEK  395

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  396  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDAAIEILNQLSSKGCSPVLVTYN  455

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   A+ +L+ M  KGL P+  TY  L+    +EG++D AI + 
Sbjct  456  TVIDGLAKVGKTESAVELLEEMRRKGLKPDIITYSSLLRGLGREGKVDKAIKIF  509


 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 152/272 (56%), Gaps = 4/272 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L   +   +A+ V++ + + G 
Sbjct  318  LRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKRLLGRAIDVLEKMPKHGC  377

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFC+  +++ A   L  M SRG +PD+VTYN ++ ++C  GK+  A++
Sbjct  378  VPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDAAIE  437

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+     C P +VTY  +I+  + K G +E A++L++EM  +GL+P+I TY+++L+G
Sbjct  438  ILNQLS-SKGCSPVLVTYNTVIDG-LAKVGKTESAVELLEEMRRKGLKPDIITYSSLLRG  495

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG VD+A +  R +  +  KP+  +YN ++  L   +        L  M   GC P 
Sbjct  496  LGREGKVDKAIKIFRDMEGLSIKPNAITYNSIMFGLCKAQQTSRAIDFLAYMVEQGCRPT  555

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
              TY I +  +  +G   +A+ +L ++  +G 
Sbjct  556  EVTYTILIEGIADEGLAEEALELLNVLCSRGF  587


 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/331 (29%), Positives = 162/331 (49%), Gaps = 37/331 (11%)
 Frame = -1

Query  885  SCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            +C      + + LL  M   G KPDVV    LI G+    + ++A+K +  +  +G +PN
Sbjct  251  TCNESGVGQAMKLLDEMRNKGCKPDVVTYNVLINGICKEGRLDEAIKFLNSMPSYGCQPN  310

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +  LG A+ VL+
Sbjct  311  VITHNIILRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILINFLCRKRLLGRAIDVLE  370

Query  528  QMKEDN----------------------------------NCKPDVVTYTVLIEATIVKD  451
            +M +                                     C PD+VTY  L+ A + KD
Sbjct  371  KMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTA-LCKD  429

Query  450  G-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSY  274
            G +  A+++++++ S+G  P + TYN ++ GL + G  + A E +  +   G KPD+ +Y
Sbjct  430  GKVDAAIEILNQLSSKGCSPVLVTYNTVIDGLAKVGKTESAVELLEEMRRKGLKPDIITY  489

Query  273  NILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTE  94
            + LLR L      D   K+ ++M  +  +P+  TYN  +  LC+  + ++AI  L  M E
Sbjct  490  SSLLRGLGREGKVDKAIKIFRDMEGLSIKPNAITYNSIMFGLCKAQQTSRAIDFLAYMVE  549

Query  93   KGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +G  P + TY  LI     EG  + A++LL+
Sbjct  550  QGCRPTEVTYTILIEGIADEGLAEEALELLN  580


 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 70/137 (51%), Gaps = 5/137 (4%)
 Frame = -1

Query  411  SRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWD  232
            SR  E   +  N  L+ L R G ++   +F+  +   G  PDV +   L+R         
Sbjct  99   SRNFEE--FASNIHLRKLVRNGELEEGLKFLERMIYQGDIPDVIACTSLIRGFCKGGKTK  156

Query  231  DGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLI  52
               ++++ + + G  P   TYN+ +S  C+ G +++A+ +L+ M+   + P+  TY+ ++
Sbjct  157  KATRVMEILENSGAVPDVITYNVLISGYCKSGDIDRALQVLERMS---VAPDVVTYNTIL  213

Query  51   SAFCKEGRLDLAIDLLD  1
             + C  G+L  A+++LD
Sbjct  214  RSLCSSGKLKEAMEVLD  230



>emb|CDP00950.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/281 (45%), Positives = 193/281 (69%), Gaps = 7/281 (2%)
 Frame = -1

Query  837  MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNR  661
            MV  G  PD++ CT LI+G   + K +KA +V++ LE+ G  P+V+ Y  LI G+CK+  
Sbjct  1    MVYKGDIPDIIPCTSLIRGFCKLGKTKKATRVLEFLEESGAVPDVITYNVLISGYCKSGE  60

Query  660  VEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD-QMKEDNNCKPDVVTY  484
            ++ A  +L+RM      PDVVTYN ++ S+C  GKL  A++VLD Q++ +  C PDV+TY
Sbjct  61   IDNALKLLDRM---SVAPDVVTYNTILRSLCGSGKLKQAMEVLDRQLRRE--CYPDVITY  115

Query  483  TVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPA  304
            T+LIEAT  + G+ +AMKL+DEM ++G +P++ TYN ++ G+C+EG +D A +F+R++P+
Sbjct  116  TILIEATCRESGVGQAMKLLDEMSAKGCKPDVVTYNVLINGICKEGRLDEAIKFLRNMPS  175

Query  303  MGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNK  124
             GC+P+V ++NI+LR++     W D EKLL EM   GC P   T+NI ++ LCR G L +
Sbjct  176  YGCQPNVITHNIILRSMCSTGRWMDAEKLLTEMLRKGCSPSVVTFNILINFLCRKGLLGR  235

Query  123  AISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            AI +L+ M + G TPN  +Y+PL+  FCKE ++D AI+ L+
Sbjct  236  AIDVLERMPKYGCTPNSLSYNPLLHGFCKEKKMDRAIEYLE  276


 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CG+GK ++ + +L   ++    PDV+  T LI+         +A+K++  +   G +P+V
Sbjct  88   CGSGKLKQAMEVLDRQLRRECYPDVITYTILIEATCRESGVGQAMKLLDEMSAKGCKPDV  147

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   L  M S G  P+V+T+NI++ S+C  G+   A K+L +
Sbjct  148  VTYNVLINGICKEGRLDEAIKFLRNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLTE  207

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ +++ M   G  PN  +YN +L G C+E 
Sbjct  208  MLR-KGCSPSVVTFNILINFLCRKGLLGRAIDVLERMPKYGCTPNSLSYNPLLHGFCKEK  266

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  267  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCRDGKADVAVEILDQLSSRGCSPVLITYN  326

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   AI +L  M EKGL P+  TY  L+   C+EG++D AI  +
Sbjct  327  TVIDGLSKVGKTESAIKLLHEMREKGLQPDIITYSSLVGGLCREGKVDEAISFI  380


 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 163/296 (55%), Gaps = 5/296 (2%)
 Frame = -1

Query  888  RSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EP  712
            R  G G   + + LL  M   G KPDVV    LI G+    + ++A+K ++ +  +G +P
Sbjct  124  RESGVG---QAMKLLDEMSAKGCKPDVVTYNVLINGICKEGRLDEAIKFLRNMPSYGCQP  180

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            NV+ +  ++   C T R   A  +L  M  +G  P VVT+NI+I  +C +G LG A+ VL
Sbjct  181  NVITHNIILRSMCSTGRWMDAEKLLTEMLRKGCSPSVVTFNILINFLCRKGLLGRAIDVL  240

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++M +   C P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LCR
Sbjct  241  ERMPK-YGCTPNSLSYNPLLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCR  299

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            +G  D A E +  L + GC P + +YN ++  L      +   KLL EM   G +P   T
Sbjct  300  DGKADVAVEILDQLSSRGCSPVLITYNTVIDGLSKVGKTESAIKLLHEMREKGLQPDIIT  359

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            Y+  V  LCR+GK+++AIS +  + E G+ PN  TY+ ++   CK  + D AID L
Sbjct  360  YSSLVGGLCREGKVDEAISFIHELEELGIKPNAITYNAIMLGLCKARQTDRAIDFL  415


 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 150/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G  P VV    LI  L       +A+ V++ + ++G 
Sbjct  189  LRSMCSTGRWMDAEKLLTEMLRKGCSPSVVTFNILINFLCRKGLLGRAIDVLERMPKYGC  248

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y  L+ GFCK  +++ A   L  M SRG +PD+VTYN ++ ++C  GK  +A++
Sbjct  249  TPNSLSYNPLLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCRDGKADVAVE  308

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +LDQ+     C P ++TY  +I+          A+KL+ EM  +GL+P+I TY++++ GL
Sbjct  309  ILDQL-SSRGCSPVLITYNTVIDGLSKVGKTESAIKLLHEMREKGLQPDIITYSSLVGGL  367

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            CREG VD A  F+  L  +G KP+  +YN ++  L   R  D     L  M S GC+P  
Sbjct  368  CREGKVDEAISFIHELEELGIKPNAITYNAIMLGLCKARQTDRAIDFLAYMVSKGCKPTE  427

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             TY I +  +  +G  N+A+ +L  +  +G+
Sbjct  428  STYTILIEGIAYEGLANEALELLNELCSRGV  458



>gb|KHN08231.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=471

 Score =   260 bits (664),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/280 (44%), Positives = 186/280 (66%), Gaps = 5/280 (2%)
 Frame = -1

Query  837  MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNR  661
            M+  G  PDV+ CT LI+G     K +KA ++M++LE  G  P+V+ Y  LIGG+CK+  
Sbjct  1    MIYQGDIPDVIACTSLIRGFCRSGKTKKATRIMEILENSGAVPDVITYNVLIGGYCKSGE  60

Query  660  VEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYT  481
            ++ A  VL RM      PDVVTYN ++ S+CD GKL  A++VLD+  +   C PDV+TYT
Sbjct  61   IDKALEVLERM---SVAPDVVTYNTILRSLCDSGKLKEAMEVLDRQLQ-RECYPDVITYT  116

Query  480  VLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAM  301
            +LIEAT    G+ +AMKL+DEM  +G +P++ TYN ++ G+C+EG +D A +F+ ++P+ 
Sbjct  117  ILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLINGICKEGRLDEAIKFLNNMPSY  176

Query  300  GCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKA  121
            GCKP+V ++NI+LR++     W D E+LL +M   GC P   T+NI ++ LCR   L +A
Sbjct  177  GCKPNVITHNIILRSMCSTGRWMDAERLLSDMLRKGCSPSVVTFNILINFLCRKRLLGRA  236

Query  120  ISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            I +L+ M + G  PN  +Y+PL+  FC+E ++D AI+ L+
Sbjct  237  IDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLE  276


 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 171/295 (58%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C +G+ ++ L +L+ M      PDVV    +++ L    K ++A++V+ + L++   P+V
Sbjct  56   CKSGEIDKALEVLERM---SVAPDVVTYNTILRSLCDSGKLKEAMEVLDRQLQRECYPDV  112

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   C  + V  A  +L+ MR +G  PDVVTYN++I  IC  G+L  A+K L+ 
Sbjct  113  ITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLINGICKEGRLDEAIKFLNN  172

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     CKP+V+T+ +++ +        +A +L+ +ML +G  P++ T+N ++  LCR+ 
Sbjct  173  MPS-YGCKPNVITHNIILRSMCSTGRWMDAERLLSDMLRKGCSPSVVTFNILINFLCRKR  231

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            ++ RA + +  +P  GC P+  SYN LL      +  D   + L+ M S GC P   TYN
Sbjct  232  LLGRAIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYN  291

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LC+DGK++ A+ +L  ++ KG +P   TY+ +I    K G+ + A++LL+
Sbjct  292  TLLTALCKDGKVDAAVEILNQLSSKGCSPVLITYNTVIDGLTKVGKTEYAVELLE  346


 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 163/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK +E + +L   ++    PDV+  T LI+   +     +A+K++  + + G +P+V
Sbjct  88   CDSGKLKEAMEVLDRQLQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDV  147

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI G CK  R++ A   LN M S G  P+V+T+NI++ S+C  G+   A ++L  
Sbjct  148  VTYNVLINGICKEGRLDEAIKFLNNMPSYGCKPNVITHNIILRSMCSTGRWMDAERLLSD  207

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C+E 
Sbjct  208  MLR-KGCSPSVVTFNILINFLCRKRLLGRAIDVLEKMPKHGCVPNSLSYNPLLHGFCQEK  266

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YN LL AL      D   ++L ++SS GC P   TYN
Sbjct  267  KMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDAAVEILNQLSSKGCSPVLITYN  326

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  L + GK   A+ +L+ M  KGL P+  TY  L+    +EG++D AI + 
Sbjct  327  TVIDGLTKVGKTEYAVELLEEMRRKGLKPDIITYSTLLRGLGREGKVDEAIKIF  380


 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/320 (29%), Positives = 155/320 (48%), Gaps = 37/320 (12%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            +  +C      + + LL  M K G KPDVV    LI G+    + ++A+K +  +  +G 
Sbjct  119  IEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNVLINGICKEGRLDEAIKFLNNMPSYGC  178

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PNV+ +  ++   C T R   A  +L+ M  +G  P VVT+NI+I  +C +  LG A+ 
Sbjct  179  KPNVITHNIILRSMCSTGRWMDAERLLSDMLRKGCSPSVVTFNILINFLCRKRLLGRAID  238

Query  537  VLDQMKEDN----------------------------------NCKPDVVTYTVLIEATI  460
            VL++M +                                     C PD+VTY  L+ A +
Sbjct  239  VLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTA-L  297

Query  459  VKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             KDG +  A+++++++ S+G  P + TYN ++ GL + G  + A E +  +   G KPD+
Sbjct  298  CKDGKVDAAVEILNQLSSKGCSPVLITYNTVIDGLTKVGKTEYAVELLEEMRRKGLKPDI  357

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +Y+ LLR L      D+  K+  +M  +  +P   TYN  +  LC+  + ++AI  L  
Sbjct  358  ITYSTLLRGLGREGKVDEAIKIFHDMEGLSIKPSAVTYNAIMLGLCKAQQTSRAIDFLAY  417

Query  102  MTEKGLTPNKFTYDPLISAF  43
            M EKG  P + TY  LI   
Sbjct  418  MVEKGCKPTEATYTILIEGI  437



>ref|XP_006596395.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
isoform X4 [Glycine max]
Length=425

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 203/327 (62%), Gaps = 9/327 (3%)
 Frame = -1

Query  978  LQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLC  799
            L  V+ S +  N  +   +S EI   RRL R+   G+ EE    L+YM   G  PDV+ C
Sbjct  62   LNGVESSPDRVNTSLNFEES-EIRHLRRLIRN---GELEEGSRFLEYMTNKGKSPDVIAC  117

Query  798  TKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            T LI+    + + + A ++M +LE+ G   +V +Y  LI G+CK+  +E A  VL+RM  
Sbjct  118  TALIREFCKIGRTKNASQIMGILEESGAVIDVTSYNVLISGYCKSGEIEEALRVLDRM--  175

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
             G  P+  TY+ ++ S+CDRGKL  A++VL +  + + C PDVVT TVLI+AT  + G+ 
Sbjct  176  -GVSPNAATYDAVLCSLCDRGKLKQAMQVLGRQLQ-SKCYPDVVTCTVLIDATCKESGVG  233

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            +AMKL +EM ++G +P++ TYN ++KG C+ G +D A  F++ LP+ GC+PDV S+N++L
Sbjct  234  QAMKLFNEMRNKGCKPDVVTYNVLIKGFCKGGRLDEAIRFLKKLPSYGCQPDVISHNMIL  293

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            R+L     W D  KLL  M   GC P   T+NI ++ LC+ G L KA+++L++M + G T
Sbjct  294  RSLCSGGRWMDAMKLLATMLRKGCLPSVVTFNILINFLCQKGLLGKALNVLEMMPKHGHT  353

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            PN  +++PLI  FC    +D AI+ L+
Sbjct  354  PNSRSFNPLIQGFCNGKGIDRAIEYLE  380



>ref|XP_007141295.1| hypothetical protein PHAVU_008G183900g [Phaseolus vulgaris]
 ref|XP_007141296.1| hypothetical protein PHAVU_008G183900g [Phaseolus vulgaris]
 gb|ESW13289.1| hypothetical protein PHAVU_008G183900g [Phaseolus vulgaris]
 gb|ESW13290.1| hypothetical protein PHAVU_008G183900g [Phaseolus vulgaris]
Length=606

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 196/321 (61%), Gaps = 9/321 (3%)
 Frame = -1

Query  960  STENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKG  781
            S+   N  +   DS EI   RRL R+   G+ EE+   L+YM   G  PDV+ CT LI+G
Sbjct  64   SSARVNTSLNFEDS-EICHLRRLIRN---GQLEESSKFLEYMTNKGNIPDVIACTSLIRG  119

Query  780  LFSVKKAEKAVKVMQLLEQF-GEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPD  604
               + + + A ++M +LE+     +V  Y  LI  +CK    E A  +L+ M      P+
Sbjct  120  FCKIGRPKNATRIMGILEESRAVIDVTCYNVLISSYCKLGNTEEALRILDHM---SVAPN  176

Query  603  VVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLV  424
              TY+ ++  +CDRGKL  A++VLD+  + + C PD+VT+TVLI+AT  + G+ +AMKL 
Sbjct  177  ATTYDAILCCLCDRGKLKQAMQVLDRQMQ-SKCYPDIVTFTVLIDATCKESGVGQAMKLF  235

Query  423  DEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDR  244
            +EM  +G +P++  YN ++KG+C EG +D A  F+  LP+ GC+PDV S+NI+LR+L  R
Sbjct  236  NEMRRKGCKPDVIAYNVLIKGICNEGRLDEAIRFLNKLPSYGCQPDVISHNIVLRSLCSR  295

Query  243  RNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTY  64
              W D  KLL  M   GC P   T+NI ++ LC+ G L KA+++L++M + G TPN  +Y
Sbjct  296  GRWMDAMKLLANMLRKGCFPSVVTFNILINFLCQKGLLGKALNVLEMMPKHGHTPNSRSY  355

Query  63   DPLISAFCKEGRLDLAIDLLD  1
            +PLI  FC E  +D AI+ L+
Sbjct  356  NPLIQGFCNEKGIDRAIEYLE  376


 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/295 (34%), Positives = 166/295 (56%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK ++ + +L   ++    PD+V  T LI          +A+K+   + + G +P+V
Sbjct  188  CDRGKLKQAMQVLDRQMQSKCYPDIVTFTVLIDATCKESGVGQAMKLFNEMRRKGCKPDV  247

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            +AY  LI G C   R++ A   LN++ S G  PDV+++NI++ S+C RG+   A+K+L  
Sbjct  248  IAYNVLIKGICNEGRLDEAIRFLNKLPSYGCQPDVISHNIVLRSLCSRGRWMDAMKLLAN  307

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  + +A+ +++ M   G  PN  +YN +++G C E 
Sbjct  308  MLR-KGCFPSVVTFNILINFLCQKGLLGKALNVLEMMPKHGHTPNSRSYNPLIQGFCNEK  366

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YNILL AL      DD  ++L+++ S GC P   TYN
Sbjct  367  GIDRAIEYLEIMVSRGCYPDIVTYNILLTALCKDGKADDAVEILRQLCSKGCSPSLVTYN  426

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +  L + GK+  A+ + + M+  GL P+  TY+ +I    K G+  LA++LL+
Sbjct  427  TVIDGLLKVGKIECAVELFEEMSRIGLKPDIITYNIIIDGLLKMGKAKLAVELLE  481


 Score =   164 bits (414),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 98/333 (29%), Positives = 167/333 (50%), Gaps = 37/333 (11%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            ++ +C      + + L   M + G KPDV+    LIKG+ +  + ++A++ +  L  +G 
Sbjct  219  IDATCKESGVGQAMKLFNEMRRKGCKPDVIAYNVLIKGICNEGRLDEAIRFLNKLPSYGC  278

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +P+V+++  ++   C   R   A  +L  M  +G FP VVT+NI+I  +C +G LG AL 
Sbjct  279  QPDVISHNIVLRSLCSRGRWMDAMKLLANMLRKGCFPSVVTFNILINFLCQKGLLGKALN  338

Query  537  VLDQMKEDNN----------------------------------CKPDVVTYTVLIEATI  460
            VL+ M +  +                                  C PD+VTY +L+ A +
Sbjct  339  VLEMMPKHGHTPNSRSYNPLIQGFCNEKGIDRAIEYLEIMVSRGCYPDIVTYNILLTA-L  397

Query  459  VKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             KDG   +A++++ ++ S+G  P++ TYN ++ GL + G ++ A E    +  +G KPD+
Sbjct  398  CKDGKADDAVEILRQLCSKGCSPSLVTYNTVIDGLLKVGKIECAVELFEEMSRIGLKPDI  457

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +YNI++  LL         +LL+EM S   +P   T    V  L R+GK+++AI     
Sbjct  458  ITYNIIIDGLLKMGKAKLAVELLEEMCSKVLKPDPITCTSVVGGLSREGKVHEAIKFFHY  517

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            M   G+ PN F Y+ ++   CK  +   AID L
Sbjct  518  MKRFGIRPNVFIYNSIMMGLCKAQQTSRAIDFL  550


 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 148/295 (50%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNV  706
            C  G++ + + LL  M++ G  P VV    LI  L       KA+ V++++ + G  PN 
Sbjct  293  CSRGRWMDAMKLLANMLRKGCFPSVVTFNILINFLCQKGLLGKALNVLEMMPKHGHTPNS  352

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  LI GFC    ++ A   L  M SRG +PD+VTYNI++ ++C  GK   A+++L Q
Sbjct  353  RSYNPLIQGFCNEKGIDRAIEYLEIMVSRGCYPDIVTYNILLTALCKDGKADDAVEILRQ  412

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C P +VTY  +I+  +    I  A++L +EM   GL+P+I TYN I+ GL + G
Sbjct  413  LC-SKGCSPSLVTYNTVIDGLLKVGKIECAVELFEEMSRIGLKPDIITYNIIIDGLLKMG  471

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
                A E +  + +   KPD  +   ++  L       +  K    M   G  P+ F YN
Sbjct  472  KAKLAVELLEEMCSKVLKPDPITCTSVVGGLSREGKVHEAIKFFHYMKRFGIRPNVFIYN  531

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +  LC+  + ++AI  L  M  KG  P + TY  ++     EG  D A  LL+
Sbjct  532  SIMMGLCKAQQTSRAIDFLVDMVAKGCKPTEATYSVIVEGIIYEGLADEASKLLN  586


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 61/118 (52%), Gaps = 1/118 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK +  + LL+ M     KPD + CT ++ GL    K  +A+K    +++FG  PNV  Y
Sbjct  471  GKAKLAVELLEEMCSKVLKPDPITCTSVVGGLSREGKVHEAIKFFHYMKRFGIRPNVFIY  530

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             +++ G CK  +   A   L  M ++G  P   TY++++  I   G    A K+L+++
Sbjct  531  NSIMMGLCKAQQTSRAIDFLVDMVAKGCKPTEATYSVIVEGIIYEGLADEASKLLNEL  588



>ref|XP_006596392.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
isoform X1 [Glycine max]
 ref|XP_006596393.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
isoform X2 [Glycine max]
 ref|XP_006596394.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
isoform X3 [Glycine max]
Length=611

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 203/327 (62%), Gaps = 9/327 (3%)
 Frame = -1

Query  978  LQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLC  799
            L  V+ S +  N  +   +S EI   RRL R+   G+ EE    L+YM   G  PDV+ C
Sbjct  62   LNGVESSPDRVNTSLNFEES-EIRHLRRLIRN---GELEEGSRFLEYMTNKGKSPDVIAC  117

Query  798  TKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            T LI+    + + + A ++M +LE+ G   +V +Y  LI G+CK+  +E A  VL+RM  
Sbjct  118  TALIREFCKIGRTKNASQIMGILEESGAVIDVTSYNVLISGYCKSGEIEEALRVLDRM--  175

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
             G  P+  TY+ ++ S+CDRGKL  A++VL +  + + C PDVVT TVLI+AT  + G+ 
Sbjct  176  -GVSPNAATYDAVLCSLCDRGKLKQAMQVLGRQLQ-SKCYPDVVTCTVLIDATCKESGVG  233

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            +AMKL +EM ++G +P++ TYN ++KG C+ G +D A  F++ LP+ GC+PDV S+N++L
Sbjct  234  QAMKLFNEMRNKGCKPDVVTYNVLIKGFCKGGRLDEAIRFLKKLPSYGCQPDVISHNMIL  293

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            R+L     W D  KLL  M   GC P   T+NI ++ LC+ G L KA+++L++M + G T
Sbjct  294  RSLCSGGRWMDAMKLLATMLRKGCLPSVVTFNILINFLCQKGLLGKALNVLEMMPKHGHT  353

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            PN  +++PLI  FC    +D AI+ L+
Sbjct  354  PNSRSFNPLIQGFCNGKGIDRAIEYLE  380


 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/295 (34%), Positives = 163/295 (55%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK ++ + +L   ++    PDVV CT LI          +A+K+   +   G +P+V
Sbjct  192  CDRGKLKQAMQVLGRQLQSKCYPDVVTCTVLIDATCKESGVGQAMKLFNEMRNKGCKPDV  251

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI GFCK  R++ A   L ++ S G  PDV+++N+++ S+C  G+   A+K+L  
Sbjct  252  VTYNVLIKGFCKGGRLDEAIRFLKKLPSYGCQPDVISHNMILRSLCSGGRWMDAMKLLAT  311

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  + +A+ +++ M   G  PN  ++N +++G C   
Sbjct  312  MLR-KGCLPSVVTFNILINFLCQKGLLGKALNVLEMMPKHGHTPNSRSFNPLIQGFCNGK  370

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YNILL AL      DD   +L ++SS GC P   +YN
Sbjct  371  GIDRAIEYLEIMVSRGCYPDIVTYNILLTALCKDGKVDDAVVILSQLSSKGCSPSLISYN  430

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +  L + GK   AI + + M  KGL  +  TY+ +I+   K G+ +LA++LL+
Sbjct  431  TVIDGLLKVGKTECAIELFEEMCRKGLEADIITYNIIINGLLKVGKAELAVELLE  485


 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/333 (28%), Positives = 162/333 (49%), Gaps = 37/333 (11%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            ++ +C      + + L   M   G KPDVV    LIKG     + ++A++ ++ L  +G 
Sbjct  223  IDATCKESGVGQAMKLFNEMRNKGCKPDVVTYNVLIKGFCKGGRLDEAIRFLKKLPSYGC  282

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +P+V+++  ++   C   R   A  +L  M  +G  P VVT+NI+I  +C +G LG AL 
Sbjct  283  QPDVISHNMILRSLCSGGRWMDAMKLLATMLRKGCLPSVVTFNILINFLCQKGLLGKALN  342

Query  537  VLDQMKEDNN----------------------------------CKPDVVTYTVLIEATI  460
            VL+ M +  +                                  C PD+VTY +L+ A +
Sbjct  343  VLEMMPKHGHTPNSRSFNPLIQGFCNGKGIDRAIEYLEIMVSRGCYPDIVTYNILLTA-L  401

Query  459  VKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             KDG + +A+ ++ ++ S+G  P++ +YN ++ GL + G  + A E    +   G + D+
Sbjct  402  CKDGKVDDAVVILSQLSSKGCSPSLISYNTVIDGLLKVGKTECAIELFEEMCRKGLEADI  461

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +YNI++  LL     +   +LL+EM   G +P   T    V  L R+GK+ +A+     
Sbjct  462  ITYNIIINGLLKVGKAELAVELLEEMCYKGLKPDLITCTSVVGGLSREGKVREAMKFFHY  521

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +    + PN F Y+ +I+  CK  +  LAID L
Sbjct  522  LKRFAIRPNAFIYNSIITGLCKSQQTSLAIDFL  554


 Score =   152 bits (384),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 148/286 (52%), Gaps = 4/286 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNV  706
            C  G++ + + LL  M++ G  P VV    LI  L       KA+ V++++ + G  PN 
Sbjct  297  CSGGRWMDAMKLLATMLRKGCLPSVVTFNILINFLCQKGLLGKALNVLEMMPKHGHTPNS  356

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             ++  LI GFC    ++ A   L  M SRG +PD+VTYNI++ ++C  GK+  A+ +L Q
Sbjct  357  RSFNPLIQGFCNGKGIDRAIEYLEIMVSRGCYPDIVTYNILLTALCKDGKVDDAVVILSQ  416

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +     C P +++Y  +I+  ++K G +E A++L +EM  +GLE +I TYN I+ GL + 
Sbjct  417  L-SSKGCSPSLISYNTVIDG-LLKVGKTECAIELFEEMCRKGLEADIITYNIIINGLLKV  474

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G  + A E +  +   G KPD+ +   ++  L       +  K    +      P+ F Y
Sbjct  475  GKAELAVELLEEMCYKGLKPDLITCTSVVGGLSREGKVREAMKFFHYLKRFAIRPNAFIY  534

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG  31
            N  ++ LC+  + + AI  L  M  KG  P + TY  LI     EG
Sbjct  535  NSIITGLCKSQQTSLAIDFLADMVAKGCKPTEATYTTLIKGITYEG  580



>gb|EPS61251.1| hypothetical protein M569_13548, partial [Genlisea aurea]
Length=488

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/311 (42%), Positives = 195/311 (63%), Gaps = 20/311 (6%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R    G+ E+ L  +Q MV     PD++ CT LI+G     K  KA  VMQ+LE+ 
Sbjct  5    RRLVRH---GQLEKALRHIQGMVSQREIPDIIPCTSLIRGFCRAGKTNKATVVMQILEES  61

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGK----  556
            G  P+++ Y  LI GFCK   V  A   L  + S    PDVVTYN ++ ++C+ G     
Sbjct  62   GAAPDLITYNVLISGFCKLGEVGNA---LQLLESMTVAPDVVTYNTILRALCNGGGGGGG  118

Query  555  ----LGLALKVLDQM--KEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEP  394
                L  A++V+D+M  KE   C PDV+TYT+LIEAT+ ++G+ +AM+L+D+M  RG +P
Sbjct  119  GRGRLSEAMEVIDRMLLKE---CHPDVITYTILIEATLKENGVDQAMELLDDMKRRGCKP  175

Query  393  NIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLL  214
            +I TYN ++ G+C+EG +D A +F+ ++ + GC+P+V ++NI+LR++     W D EKLL
Sbjct  176  DIVTYNVLIDGICKEGKLDEAIKFLDTMSSYGCRPNVITHNIILRSMCSTGRWMDAEKLL  235

Query  213  KEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKE  34
             EM   GC P   T+NI ++ LCR G L +A+ +L+ M E G TPN  +Y+ L+  FCKE
Sbjct  236  SEMLVKGCSPSVVTFNILINFLCRKGLLLRAVDVLERMPENGCTPNSLSYNSLLHTFCKE  295

Query  33   GRLDLAIDLLD  1
             ++D A++ L+
Sbjct  296  KKMDSALEYLE  306


 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 167/303 (55%), Gaps = 14/303 (5%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVV--------LCTKLIKGLFSVKKAEKAVKVM-QLL  730
            C  G+    L LL+ M      PDVV        LC     G     +  +A++V+ ++L
Sbjct  78   CKLGEVGNALQLLESMT---VAPDVVTYNTILRALCNGGGGGGGGRGRLSEAMEVIDRML  134

Query  729  EQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLG  550
             +   P+V+ YT LI    K N V+ A  +L+ M+ RG  PD+VTYN++I  IC  GKL 
Sbjct  135  LKECHPDVITYTILIEATLKENGVDQAMELLDDMKRRGCKPDIVTYNVLIDGICKEGKLD  194

Query  549  LALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAI  370
             A+K LD M     C+P+V+T+ +++ +        +A KL+ EML +G  P++ T+N +
Sbjct  195  EAIKFLDTMSS-YGCRPNVITHNIILRSMCSTGRWMDAEKLLSEMLVKGCSPSVVTFNIL  253

Query  369  LKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGC  190
            +  LCR+G++ RA + +  +P  GC P+  SYN LL      +  D   + L+ M S GC
Sbjct  254  INFLCRKGLLLRAVDVLERMPENGCTPNSLSYNSLLHTFCKEKKMDSALEYLELMVSRGC  313

Query  189  EPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG-LTPNKFTYDPLISAFCKEGRLDLAI  13
             P   TYN  +++LCRDGK++ A+++L  +  KG  +P   TY+ +I    K GR D A+
Sbjct  314  YPDIVTYNTMLTALCRDGKVDAAVAILNRLRSKGRCSPVLITYNTVIDGLSKMGRTDEAM  373

Query  12   DLL  4
            +LL
Sbjct  374  ELL  376


 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 134/252 (53%), Gaps = 1/252 (0%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M+  G  P VV    LI  L       +AV V++ + + G 
Sbjct  219  LRSMCSTGRWMDAEKLLSEMLVKGCSPSVVTFNILINFLCRKGLLLRAVDVLERMPENGC  278

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN L+Y +L+  FCK  ++++A   L  M SRG +PD+VTYN M+ ++C  GK+  A+ 
Sbjct  279  TPNSLSYNSLLHTFCKEKKMDSALEYLELMVSRGCYPDIVTYNTMLTALCRDGKVDAAVA  338

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L++++    C P ++TY  +I+         EAM+L+ EM  RGL P++ T ++I+ GL
Sbjct  339  ILNRLRSKGRCSPVLITYNTVIDGLSKMGRTDEAMELLVEMRGRGLRPDVITCSSIMMGL  398

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             +EG V+ + EF  SL   G +P+   YN ++  +   R  D     L  M   GC+P  
Sbjct  399  SKEGKVEESVEFFESLEGSGIRPNANIYNSMMLGMCKARRTDRAIDFLDRMVDGGCKPTE  458

Query  177  FTYNIFVSSLCR  142
             TY I +  L +
Sbjct  459  STYTILIEGLSK  470


 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/313 (27%), Positives = 147/313 (47%), Gaps = 38/313 (12%)
 Frame = -1

Query  864  EETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTAL  688
            ++ + LL  M + G KPD+V    LI G+    K ++A+K +  +  +G  PNV+ +  +
Sbjct  159  DQAMELLDDMKRRGCKPDIVTYNVLIDGICKEGKLDEAIKFLDTMSSYGCRPNVITHNII  218

Query  687  IGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDN-  511
            +   C T R   A  +L+ M  +G  P VVT+NI+I  +C +G L  A+ VL++M E+  
Sbjct  219  LRSMCSTGRWMDAEKLLSEMLVKGCSPSVVTFNILINFLCRKGLLLRAVDVLERMPENGC  278

Query  510  ---------------------------------NCKPDVVTYTVLIEATIVKDG-ISEAM  433
                                              C PD+VTY  ++ A + +DG +  A+
Sbjct  279  TPNSLSYNSLLHTFCKEKKMDSALEYLELMVSRGCYPDIVTYNTMLTA-LCRDGKVDAAV  337

Query  432  KLVDEMLSRG-LEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRA  256
             +++ + S+G   P + TYN ++ GL + G  D A E +  +   G +PDV + + ++  
Sbjct  338  AILNRLRSKGRCSPVLITYNTVIDGLSKMGRTDEAMELLVEMRGRGLRPDVITCSSIMMG  397

Query  255  LLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPN  76
            L      ++  +  + +   G  P+   YN  +  +C+  + ++AI  L  M + G  P 
Sbjct  398  LSKEGKVEESVEFFESLEGSGIRPNANIYNSMMLGMCKARRTDRAIDFLDRMVDGGCKPT  457

Query  75   KFTYDPLISAFCK  37
            + TY  LI    K
Sbjct  458  ESTYTILIEGLSK  470


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/113 (24%), Positives = 56/113 (50%), Gaps = 3/113 (3%)
 Frame = -1

Query  378  NAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSS  199
            N+ L+ L R G +++A   ++ + +    PD+     L+R        +    +++ +  
Sbjct  1    NSSLRRLVRHGQLEKALRHIQGMVSQREIPDIIPCTSLIRGFCRAGKTNKATVVMQILEE  60

Query  198  MGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFC  40
             G  P   TYN+ +S  C+ G++  A+ +L+ MT   + P+  TY+ ++ A C
Sbjct  61   SGAAPDLITYNVLISGFCKLGEVGNALQLLESMT---VAPDVVTYNTILRALC  110



>gb|KHN39972.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=611

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 202/327 (62%), Gaps = 9/327 (3%)
 Frame = -1

Query  978  LQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLC  799
            L  V+ S +  N  +   +S EI   RRL R+   G+ EE    L+YM   G  PDV+ C
Sbjct  62   LNGVESSPDRVNTSLNFEES-EIRHLRRLIRN---GELEEGSRFLEYMTNKGKSPDVIAC  117

Query  798  TKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            T LI+    + + + A ++M +LE+ G   +V +Y  LI G+CK+  +E A  VL+RM  
Sbjct  118  TALIREFCKIGRTKNASQIMGILEESGAVIDVTSYNVLISGYCKSGEIEEALRVLDRM--  175

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
             G  P+  TY+ ++ S+CDRGKL  A++VL +  + + C PDVVT TVLI+AT  + G+ 
Sbjct  176  -GVSPNAATYDAVLCSLCDRGKLKQAMQVLGRQLQ-SKCYPDVVTCTVLIDATCKESGVG  233

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            +AMKL +EM ++G +P++ TYN ++KG C+ G +D A  F++ LP+ GC+PDV S+N++L
Sbjct  234  QAMKLFNEMRNKGCKPDVVTYNVLIKGFCKGGRLDEAIRFLKKLPSYGCQPDVISHNMIL  293

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            R+L     W D  KLL  M   GC P   T+NI ++ LC+ G   KA+++L++M + G T
Sbjct  294  RSLCSGGRWMDAMKLLATMLRKGCLPSVVTFNILINFLCQKGLPGKALNVLEMMPKHGHT  353

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            PN  +++PLI  FC    +D AI+ L+
Sbjct  354  PNSRSFNPLIQGFCNGKGIDRAIEYLE  380


 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 162/295 (55%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK ++ + +L   ++    PDVV CT LI          +A+K+   +   G +P+V
Sbjct  192  CDRGKLKQAMQVLGRQLQSKCYPDVVTCTVLIDATCKESGVGQAMKLFNEMRNKGCKPDV  251

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI GFCK  R++ A   L ++ S G  PDV+++N+++ S+C  G+   A+K+L  
Sbjct  252  VTYNVLIKGFCKGGRLDEAIRFLKKLPSYGCQPDVISHNMILRSLCSGGRWMDAMKLLAT  311

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K    +A+ +++ M   G  PN  ++N +++G C   
Sbjct  312  MLR-KGCLPSVVTFNILINFLCQKGLPGKALNVLEMMPKHGHTPNSRSFNPLIQGFCNGK  370

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E++  + + GC PD+ +YNI+L AL      DD   +L ++SS GC P   +YN
Sbjct  371  GIDRAIEYLEIMVSRGCYPDIVTYNIVLTALCKDGKVDDAVVILSQLSSKGCSPSLISYN  430

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +  L + GK   AI + + M  KGL  +  TY+ +I+   K G+ +LA++LL+
Sbjct  431  TVIDGLLKVGKTECAIELFEEMCRKGLEADIITYNIIINGLLKVGKAELAVELLE  485


 Score =   152 bits (384),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 148/286 (52%), Gaps = 4/286 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNV  706
            C  G++ + + LL  M++ G  P VV    LI  L       KA+ V++++ + G  PN 
Sbjct  297  CSGGRWMDAMKLLATMLRKGCLPSVVTFNILINFLCQKGLPGKALNVLEMMPKHGHTPNS  356

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             ++  LI GFC    ++ A   L  M SRG +PD+VTYNI++ ++C  GK+  A+ +L Q
Sbjct  357  RSFNPLIQGFCNGKGIDRAIEYLEIMVSRGCYPDIVTYNIVLTALCKDGKVDDAVVILSQ  416

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +     C P +++Y  +I+  ++K G +E A++L +EM  +GLE +I TYN I+ GL + 
Sbjct  417  L-SSKGCSPSLISYNTVIDG-LLKVGKTECAIELFEEMCRKGLEADIITYNIIINGLLKV  474

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G  + A E +  +   G KPD+ +   ++  L       +  K    +      P+ F Y
Sbjct  475  GKAELAVELLEEMCYKGLKPDLITCTSVVGGLSREGKVREAMKFFHYLKRFAIRPNAFIY  534

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG  31
            N  ++ LC+  + + AI  L  M  KG  P + TY  LI     EG
Sbjct  535  NSIITGLCKSQQTSLAIDFLADMVAKGCKPTEATYTTLIKGITYEG  580


 Score =   150 bits (378),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/333 (28%), Positives = 161/333 (48%), Gaps = 37/333 (11%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            ++ +C      + + L   M   G KPDVV    LIKG     + ++A++ ++ L  +G 
Sbjct  223  IDATCKESGVGQAMKLFNEMRNKGCKPDVVTYNVLIKGFCKGGRLDEAIRFLKKLPSYGC  282

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +P+V+++  ++   C   R   A  +L  M  +G  P VVT+NI+I  +C +G  G AL 
Sbjct  283  QPDVISHNMILRSLCSGGRWMDAMKLLATMLRKGCLPSVVTFNILINFLCQKGLPGKALN  342

Query  537  VLDQMKEDNN----------------------------------CKPDVVTYTVLIEATI  460
            VL+ M +  +                                  C PD+VTY +++ A +
Sbjct  343  VLEMMPKHGHTPNSRSFNPLIQGFCNGKGIDRAIEYLEIMVSRGCYPDIVTYNIVLTA-L  401

Query  459  VKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             KDG + +A+ ++ ++ S+G  P++ +YN ++ GL + G  + A E    +   G + D+
Sbjct  402  CKDGKVDDAVVILSQLSSKGCSPSLISYNTVIDGLLKVGKTECAIELFEEMCRKGLEADI  461

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +YNI++  LL     +   +LL+EM   G +P   T    V  L R+GK+ +A+     
Sbjct  462  ITYNIIINGLLKVGKAELAVELLEEMCYKGLKPDLITCTSVVGGLSREGKVREAMKFFHY  521

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +    + PN F Y+ +I+  CK  +  LAID L
Sbjct  522  LKRFAIRPNAFIYNSIITGLCKSQQTSLAIDFL  554



>ref|XP_007141297.1| hypothetical protein PHAVU_008G184000g [Phaseolus vulgaris]
 gb|ESW13291.1| hypothetical protein PHAVU_008G184000g [Phaseolus vulgaris]
Length=622

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/335 (39%), Positives = 199/335 (59%), Gaps = 12/335 (4%)
 Frame = -1

Query  1002  FRERNLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIG  823
             FR+  L  ++S   S +  N+ +   DS+   +R  +      G+ EE    L+YM   G
Sbjct  56    FRKGALNGMES---SPDGVNSSLSFEDSENDHLRMLVKN----GELEEGSKFLEYMTNKG  108

Query  822   YKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAAN  646
               PDV+ CT LI     + + +KA ++M +L++ G   +V  Y  LIGG+CK+  ++ A 
Sbjct  109   SMPDVIACTTLIHEFCKIGRTKKATQIMGILDESGAVIDVTTYNFLIGGYCKSGEIKEAL  168

Query  645   GVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEA  466
              VL+RM      P+  TY+ +  S+CDR KL  A++V D ++  + C PDVVTYT LI+A
Sbjct  169   RVLDRMS---VAPNADTYDTIFHSLCDRMKLKQAMEVPD-IELQSKCYPDVVTYTELIDA  224

Query  465   TIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPD  286
             T  ++G+ ++MKL+ EM+S+G +PN+ TYN ++KG+C EG +D A  F+  L + GC PD
Sbjct  225   TCKENGVGQSMKLLIEMMSKGCKPNVVTYNVLIKGICNEGRLDEAIRFLNKLRSYGCNPD  284

Query  285   VFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
             V S+ I+L +L     W D  KLL  M   GC P   T+NI +   C+ G L KA+++L+
Sbjct  285   VISHTIILHSLCSGGRWMDAMKLLASMLRKGCSPSVVTFNILIKFFCQKGLLGKALNVLE  344

Query  105   IMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +M + G TPN  +Y+PLI  FC E  +D AI+ L+
Sbjct  345   MMPKHGCTPNSRSYNPLIEGFCNEKSVDRAIEYLE  379


 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 153/273 (56%), Gaps = 2/273 (1%)
 Frame = -1

Query  816  PDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNVLAYTALIGGFCKTNRVEAANGV  640
            PDVV  T+LI          +++K++ +++ +  +PNV+ Y  LI G C   R++ A   
Sbjct  213  PDVVTYTELIDATCKENGVGQSMKLLIEMMSKGCKPNVVTYNVLIKGICNEGRLDEAIRF  272

Query  639  LNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATI  460
            LN++RS G  PDV+++ I++ S+C  G+   A+K+L  M     C P VVT+ +LI+   
Sbjct  273  LNKLRSYGCNPDVISHTIILHSLCSGGRWMDAMKLLASMLR-KGCSPSVVTFNILIKFFC  331

Query  459  VKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
             K  + +A+ +++ M   G  PN  +YN +++G C E  VDRA E++  + + GC PD+ 
Sbjct  332  QKGLLGKALNVLEMMPKHGCTPNSRSYNPLIEGFCNEKSVDRAIEYLEIMVSRGCYPDIV  391

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
            +YNILL AL      DD  ++L ++S  G      TYNI +  L   GK   A+ + + M
Sbjct  392  TYNILLTALCKDGKVDDAVEILNQLSFEGFLSSLITYNIVIDRLLTVGKTEPAVELFEEM  451

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + KGL P+  TY  +I    K G+ +  ++LL+
Sbjct  452  SRKGLEPDIVTYSTIIDGLLKVGKTEHGLELLE  484


 Score =   164 bits (416),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 160/295 (54%), Gaps = 2/295 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            ++ +C      +++ LL  M+  G KP+VV    LIKG+ +  + ++A++ +  L  +G 
Sbjct  222  IDATCKENGVGQSMKLLIEMMSKGCKPNVVTYNVLIKGICNEGRLDEAIRFLNKLRSYGC  281

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             P+V+++T ++   C   R   A  +L  M  +G  P VVT+NI+I   C +G LG AL 
Sbjct  282  NPDVISHTIILHSLCSGGRWMDAMKLLASMLRKGCSPSVVTFNILIKFFCQKGLLGKALN  341

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VL+ M + + C P+  +Y  LIE    +  +  A++ ++ M+SRG  P+I TYN +L  L
Sbjct  342  VLEMMPK-HGCTPNSRSYNPLIEGFCNEKSVDRAIEYLEIMVSRGCYPDIVTYNILLTAL  400

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G VD A E +  L   G    + +YNI++  LL     +   +L +EMS  G EP  
Sbjct  401  CKDGKVDDAVEILNQLSFEGFLSSLITYNIVIDRLLTVGKTEPAVELFEEMSRKGLEPDI  460

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
             TY+  +  L + GK    + +L+ M  KG+ PN  T+  ++    ++G++  AI
Sbjct  461  VTYSTIIDGLLKVGKTEHGLELLEEMCSKGMKPNLITFTSVVGGLSRKGKVHEAI  515


 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/289 (30%), Positives = 151/289 (52%), Gaps = 2/289 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L+  C  G++ + + LL  M++ G  P VV    LIK         KA+ V++++ + G 
Sbjct  292  LHSLCSGGRWMDAMKLLASMLRKGCSPSVVTFNILIKFFCQKGLLGKALNVLEMMPKHGC  351

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN  +Y  LI GFC    V+ A   L  M SRG +PD+VTYNI++ ++C  GK+  A++
Sbjct  352  TPNSRSYNPLIEGFCNEKSVDRAIEYLEIMVSRGCYPDIVTYNILLTALCKDGKVDDAVE  411

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+  +      ++TY ++I+  +       A++L +EM  +GLEP+I TY+ I+ GL
Sbjct  412  ILNQLSFEGFLS-SLITYNIVIDRLLTVGKTEPAVELFEEMSRKGLEPDIVTYSTIIDGL  470

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             + G  +   E +  + + G KP++ ++  ++  L  +    +       +  +G  P+ 
Sbjct  471  LKVGKTEHGLELLEEMCSKGMKPNLITFTSVVGGLSRKGKVHEAIIFFNYLEGLGITPNA  530

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG  31
            F YN  +  LC+  + ++AI  L  M   G  P + TY+ L+     EG
Sbjct  531  FIYNSIMMGLCKTQQTSRAIDFLAYMVANGCKPTESTYNILVKGISCEG  579


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 1/118 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            GK E  L LL+ M   G KP+++  T ++ GL    K  +A+     LE  G  PN   Y
Sbjct  474  GKTEHGLELLEEMCSKGMKPNLITFTSVVGGLSRKGKVHEAIIFFNYLEGLGITPNAFIY  533

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             +++ G CKT +   A   L  M + G  P   TYNI++  I   G    A K+ +++
Sbjct  534  NSIMMGLCKTQQTSRAIDFLAYMVANGCKPTESTYNILVKGISCEGFPEEASKLWNEL  591



>ref|XP_004490467.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Cicer arietinum]
Length=578

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 189/309 (61%), Gaps = 6/309 (2%)
 Frame = -1

Query  927  LDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAV  748
            L+ +E DI   L      G+ EE    L++M+  G  PDV  C         V K +KA 
Sbjct  77   LNFEEFDIHH-LRMMVRNGELEEGFEFLKHMINKGNIPDVTECXXXXXXFSKVGKTKKAA  135

Query  747  KVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSI  571
            +VM++LE+ G   +V  Y  LI G+CK+  ++ A  VL+ MR     P+VVTY+I++  +
Sbjct  136  RVMEILEKSGAVIDVKTYNVLIDGYCKSGEIKEALLVLDHMR---VAPNVVTYDIILRGL  192

Query  570  CDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPN  391
            CD+GKL  A +VLD+  + + C P+V+TYT+LI+AT  K G+++AM+L DEM S+G +PN
Sbjct  193  CDKGKLKEATEVLDRQLQ-SECYPNVITYTMLIDATCKKSGVNKAMRLFDEMRSKGCKPN  251

Query  390  IYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLK  211
            + TYN ++ G+C EG  D A   ++ LP+ GC+PDVFSYNI+L +L     W D +KLL 
Sbjct  252  VVTYNVLIDGICNEGRSDEAIRLLKYLPSYGCQPDVFSYNIILGSLCSIGRWMDAQKLLA  311

Query  210  EMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEG  31
             M   GC P   T+NI ++ L R G + KA  +L++MT  G TPN  +Y+ L+  FC   
Sbjct  312  SMFRRGCAPCVVTFNILINFLSRKGLVGKARDVLEMMTRHGCTPNSRSYNSLLQGFCDAK  371

Query  30   RLDLAIDLL  4
            ++D AI+ L
Sbjct  372  KIDRAIEYL  380


 Score =   175 bits (444),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 169/297 (57%), Gaps = 7/297 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C +G+ +E L +L +M      P+VV    +++GL    K ++A +V+ + L+    PNV
Sbjct  161  CKSGEIKEALLVLDHMR---VAPNVVTYDIILRGLCDKGKLKEATEVLDRQLQSECYPNV  217

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT LI   CK + V  A  + + MRS+G  P+VVTYN++I  IC+ G+   A+++L  
Sbjct  218  ITYTMLIDATCKKSGVNKAMRLFDEMRSKGCKPNVVTYNVLIDGICNEGRSDEAIRLLKY  277

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C+PDV +Y +++ +        +A KL+  M  RG  P + T+N ++  L R+G
Sbjct  278  L-PSYGCQPDVFSYNIILGSLCSIGRWMDAQKLLASMFRRGCAPCVVTFNILINFLSRKG  336

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            +V +A + +  +   GC P+  SYN LL+   D +  D   + LK M S GC P+  TYN
Sbjct  337  LVGKARDVLEMMTRHGCTPNSRSYNSLLQGFCDAKKIDRAIEYLKIMESRGCSPNIVTYN  396

Query  165  IFVSSLCRDGKLNKAISMLKIMTE--KGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            I +SSLC+DGK++ A+ +L  ++   KG +  + TY+ +I+   K G+   A+ LL+
Sbjct  397  ILLSSLCKDGKVDGAVEILNQLSASGKGCSSVRVTYNIVINGLLKAGKTAHAVQLLE  453


 Score =   166 bits (421),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 158/300 (53%), Gaps = 4/300 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            ++ +C      + + L   M   G KP+VV    LI G+ +  ++++A+++++ L  +G 
Sbjct  224  IDATCKKSGVNKAMRLFDEMRSKGCKPNVVTYNVLIDGICNEGRSDEAIRLLKYLPSYGC  283

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +P+V +Y  ++G  C   R   A  +L  M  RG  P VVT+NI+I  +  +G +G A  
Sbjct  284  QPDVFSYNIILGSLCSIGRWMDAQKLLASMFRRGCAPCVVTFNILINFLSRKGLVGKARD  343

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VL+ M   + C P+  +Y  L++       I  A++ +  M SRG  PNI TYN +L  L
Sbjct  344  VLEMMTR-HGCTPNSRSYNSLLQGFCDAKKIDRAIEYLKIMESRGCSPNIVTYNILLSSL  402

Query  357  CREGMVDRAYEFVRSLPAMG--CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            C++G VD A E +  L A G  C     +YNI++  LL         +LL+EM   G +P
Sbjct  403  CKDGKVDGAVEILNQLSASGKGCSSVRVTYNIVINGLLKAGKTAHAVQLLEEMCRKGLKP  462

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +  TY   +  L R+GK+++AI     +   G+ PN FTY+ +++  CK  +   AID L
Sbjct  463  NIITYTSLIGGLSREGKVHEAIEFFHDLEGLGVKPNAFTYNSIMTGLCKAQQTCGAIDFL  522


 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 144/272 (53%), Gaps = 2/272 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M + G  P VV    LI  L       KA  V++++ + G 
Sbjct  294  LGSLCSIGRWMDAQKLLASMFRRGCAPCVVTFNILINFLSRKGLVGKARDVLEMMTRHGC  353

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN  +Y +L+ GFC   +++ A   L  M SRG  P++VTYNI++ S+C  GK+  A++
Sbjct  354  TPNSRSYNSLLQGFCDAKKIDRAIEYLKIMESRGCSPNIVTYNILLSSLCKDGKVDGAVE  413

Query  537  VLDQMKEDN-NCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
            +L+Q+      C    VTY ++I   +     + A++L++EM  +GL+PNI TY +++ G
Sbjct  414  ILNQLSASGKGCSSVRVTYNIVINGLLKAGKTAHAVQLLEEMCRKGLKPNIITYTSLIGG  473

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            L REG V  A EF   L  +G KP+ F+YN ++  L   +        L  M + GC+P 
Sbjct  474  LSREGKVHEAIEFFHDLEGLGVKPNAFTYNSIMTGLCKAQQTCGAIDFLAYMIAKGCKPT  533

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
              TYNI +  +  +G   +A+ +   +  +G+
Sbjct  534  EATYNILIQGIAYEGLTEEALELSNELYSRGV  565



>ref|XP_006306156.1| hypothetical protein CARUB_v10011677mg, partial [Capsella rubella]
 gb|EOA39054.1| hypothetical protein CARUB_v10011677mg, partial [Capsella rubella]
Length=609

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/317 (39%), Positives = 189/317 (60%), Gaps = 23/317 (7%)
 Frame = -1

Query  945  NALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVK  766
            N+   L D +  +  R+L R+   G+ EE    L+ MV  G  PD++ CT LI+G   + 
Sbjct  97   NSSFALEDVESNNHLRQLVRT---GELEEGFRFLENMVYHGNVPDIIPCTTLIRGFCRMG  153

Query  765  KAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYN  589
            K  KA K++++LE  G  P+V+ Y  +I G+CK   +  A  VL+RM      PDVVTYN
Sbjct  154  KTRKAAKILEILEGSGAVPDVITYNVMISGYCKAGEISNALSVLDRM---SVSPDVVTYN  210

Query  588  IMIGSICDRGKLGLALKVLDQM-KEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEML  412
             ++ S+CD GKL  A++VLD+M + D+ C+                 G+ +AMKL+DEM 
Sbjct  211  TILRSLCDSGKLKQAMEVLDRMLQRDSTCR---------------DSGVGQAMKLLDEMR  255

Query  411  SRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWD  232
             RG  P++ TYN ++ G+C+EG ++ A +F+  +P+ GC+P+V ++NI+LR++     W 
Sbjct  256  DRGCTPDVVTYNVLVNGICKEGRLNEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWM  315

Query  231  DGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLI  52
            D EKLL +M   G  P   T+NI ++ LCR G L +AI +L+ M   G  PN  +Y+PL+
Sbjct  316  DAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPNHGCQPNSLSYNPLL  375

Query  51   SAFCKEGRLDLAIDLLD  1
              FCKE ++D AI+ L+
Sbjct  376  HGFCKEKKMDRAIEYLE  392


 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/316 (33%), Positives = 162/316 (51%), Gaps = 27/316 (9%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV-------------  742
            C AG+    L +L  M      PDVV    +++ L    K ++A++V             
Sbjct  185  CKAGEISNALSVLDRM---SVSPDVVTYNTILRSLCDSGKLKQAMEVLDRMLQRDSTCRD  241

Query  741  ------MQLLEQFGE----PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTY  592
                  M+LL++  +    P+V+ Y  L+ G CK  R+  A   LN M S G  P+V+T+
Sbjct  242  SGVGQAMKLLDEMRDRGCTPDVVTYNVLVNGICKEGRLNEAIKFLNDMPSSGCQPNVITH  301

Query  591  NIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEML  412
            NI++ S+C  G+   A K+L  M       P VVT+ +LI     K  +  A+ ++++M 
Sbjct  302  NIILRSMCSTGRWMDAEKLLADMLR-KGFSPSVVTFNILINFLCRKGLLGRAIDILEKMP  360

Query  411  SRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWD  232
            + G +PN  +YN +L G C+E  +DRA E++  + + GC PD+ +YN +L AL      +
Sbjct  361  NHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVE  420

Query  231  DGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLI  52
            D  ++L ++SS GC P   TYN  +  L + GK  KAI +L  M  K L P+  TY  L+
Sbjct  421  DAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLV  480

Query  51   SAFCKEGRLDLAIDLL  4
                +EG++D AI   
Sbjct  481  GGLSREGKVDEAIKFF  496


 Score =   172 bits (437),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 158/296 (53%), Gaps = 5/296 (2%)
 Frame = -1

Query  888  RSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EP  712
            R  G G   + + LL  M   G  PDVV    L+ G+    +  +A+K +  +   G +P
Sbjct  240  RDSGVG---QAMKLLDEMRDRGCTPDVVTYNVLVNGICKEGRLNEAIKFLNDMPSSGCQP  296

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            NV+ +  ++   C T R   A  +L  M  +GF P VVT+NI+I  +C +G LG A+ +L
Sbjct  297  NVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDIL  356

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR  352
            ++M  ++ C+P+ ++Y  L+     +  +  A++ ++ M+SRG  P+I TYN +L  LC+
Sbjct  357  EKMP-NHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCK  415

Query  351  EGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT  172
            +G V+ A E +  L + GC P + +YN ++  L          KLL EM +   +P T T
Sbjct  416  DGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTIT  475

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            Y+  V  L R+GK+++AI         G+ PN  T++ ++   CK  + D AID L
Sbjct  476  YSSLVGGLSREGKVDEAIKFFHEFERMGIRPNAVTFNSIMLGLCKTRQTDRAIDFL  531


 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 149/271 (55%), Gaps = 2/271 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L   C  G++ +   LL  M++ G+ P VV    LI  L       +A+ +++ +   G 
Sbjct  305  LRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPNHGC  364

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PN L+Y  L+ GFCK  +++ A   L RM SRG +PD+VTYN M+ ++C  GK+  A++
Sbjct  365  QPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVE  424

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+Q+     C P ++TY  +I+         +A+KL+DEM ++ L+P+  TY++++ GL
Sbjct  425  ILNQL-SSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGL  483

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             REG VD A +F      MG +P+  ++N ++  L   R  D     L  M + GC+P  
Sbjct  484  SREGKVDEAIKFFHEFERMGIRPNAVTFNSIMLGLCKTRQTDRAIDFLVYMINRGCKPTE  543

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGL  85
             +Y I +  L  +G   +A+ +L  +  KGL
Sbjct  544  TSYTILIEGLAYEGMAKEALELLNELCNKGL  574



>dbj|BAD15828.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAG91121.1| unnamed protein product [Oryza sativa Japonica Group]
Length=554

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/291 (41%), Positives = 179/291 (62%), Gaps = 12/291 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYT  694
            G+ +E L L    V    +PD   C  LIK L +  +  +A +V+        P+V+AY 
Sbjct  79   GELDEALRL----VGSARRPDAGTCAALIKKLSASGRTAEARRVLAACG----PDVMAYN  130

Query  693  ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
            A++ G+C   +++AA  ++  M      PD  TYN +I  +C RG+   AL VLD+M   
Sbjct  131  AMVAGYCGAGQLDAARRLVAEMPVE---PDAYTYNTLIRGLCGRGRTANALAVLDEMLR-  186

Query  513  NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
              C PDVVTYT+L+EAT  + G  +AMKL+DEM  +G  P+I TYN ++ G+C+EG VD 
Sbjct  187  RRCVPDVVTYTILLEATCKRSGYKQAMKLLDEMRDKGCTPDIVTYNVVVNGICQEGRVDD  246

Query  333  AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVS  154
            A EF+++LP+ GC+P+  SYNI+L+ L     W+D E+L+ EM   GC P+  T+N+ +S
Sbjct  247  AIEFLKNLPSYGCEPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVTFNMLIS  306

Query  153  SLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             LCR G +  A+ +L+ + + G TPN  +Y+PL+ AFCK+ ++D A+  LD
Sbjct  307  FLCRKGLVEPALEVLEQIPKYGCTPNSLSYNPLLHAFCKQKKMDKAMAFLD  357


 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 163/295 (55%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            CGAG+ +    L+  M     +PD      LI+GL    +   A+ V+ ++L +   P+V
Sbjct  137  CGAGQLDAARRLVAEMP---VEPDAYTYNTLIRGLCGRGRTANALAVLDEMLRRRCVPDV  193

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT L+   CK +  + A  +L+ MR +G  PD+VTYN+++  IC  G++  A++ L  
Sbjct  194  VTYTILLEATCKRSGYKQAMKLLDEMRDKGCTPDIVTYNVVVNGICQEGRVDDAIEFLKN  253

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C+P+ V+Y ++++     +   +A +L+ EM  +G  PN+ T+N ++  LCR+G
Sbjct  254  LPS-YGCEPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVTFNMLISFLCRKG  312

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            +V+ A E +  +P  GC P+  SYN LL A   ++  D     L  M S GC P   +YN
Sbjct  313  LVEPALEVLEQIPKYGCTPNSLSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYN  372

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LCR G+++ A+ +L  + +KG  P   +Y+ +I    K G+   A++LL+
Sbjct  373  TLLTALCRSGEVDVAVELLHQLKDKGCAPVLISYNTVIDGLTKAGKTKEALELLN  427


 Score =   177 bits (449),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 158/298 (53%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L  +C    Y++ + LL  M   G  PD+V    ++ G+    + + A++ ++ L  +G 
Sbjct  200  LEATCKRSGYKQAMKLLDEMRDKGCTPDIVTYNVVVNGICQEGRVDDAIEFLKNLPSYGC  259

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            EPN ++Y  ++ G C   R E A  ++  M  +G  P+VVT+N++I  +C +G +  AL+
Sbjct  260  EPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVTFNMLISFLCRKGLVEPALE  319

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VL+Q+ +   C P+ ++Y  L+ A   +  + +AM  +D M+SRG  P+I +YN +L  L
Sbjct  320  VLEQIPK-YGCTPNSLSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYNTLLTAL  378

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            CR G VD A E +  L   GC P + SYN ++  L       +  +LL EM S G +P  
Sbjct  379  CRSGEVDVAVELLHQLKDKGCAPVLISYNTVIDGLTKAGKTKEALELLNEMVSKGLQPDI  438

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+   + LCR+ ++  AI     + + G+ PN   Y+ +I   CK      AIDL 
Sbjct  439  ITYSTIAAGLCREDRIEDAIRAFGKVQDMGIRPNTVLYNAIILGLCKRRETHSAIDLF  496


 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 152/271 (56%), Gaps = 3/271 (1%)
 Frame = -1

Query  816  PDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVL  637
            PDV+    ++ G     + + A +++   E   EP+   Y  LI G C   R   A  VL
Sbjct  124  PDVMAYNAMVAGYCGAGQLDAARRLVA--EMPVEPDAYTYNTLIRGLCGRGRTANALAVL  181

Query  636  NRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIV  457
            + M  R   PDVVTY I++ + C R     A+K+LD+M+ D  C PD+VTY V++     
Sbjct  182  DEMLRRRCVPDVVTYTILLEATCKRSGYKQAMKLLDEMR-DKGCTPDIVTYNVVVNGICQ  240

Query  456  KDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFS  277
            +  + +A++ +  + S G EPN  +YN +LKGLC     + A E +  +   GC P+V +
Sbjct  241  EGRVDDAIEFLKNLPSYGCEPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVT  300

Query  276  YNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMT  97
            +N+L+  L  +   +   ++L+++   GC P++ +YN  + + C+  K++KA++ L +M 
Sbjct  301  FNMLISFLCRKGLVEPALEVLEQIPKYGCTPNSLSYNPLLHAFCKQKKMDKAMAFLDLMV  360

Query  96   EKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             +G  P+  +Y+ L++A C+ G +D+A++LL
Sbjct  361  SRGCYPDIVSYNTLLTALCRSGEVDVAVELL  391


 Score =   160 bits (406),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 149/267 (56%), Gaps = 2/267 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++E+   L+  M + G  P+VV    LI  L      E A++V++ + ++G  PN 
Sbjct  274  CTAERWEDAEELMGEMGQKGCPPNVVTFNMLISFLCRKGLVEPALEVLEQIPKYGCTPNS  333

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L+Y  L+  FCK  +++ A   L+ M SRG +PD+V+YN ++ ++C  G++ +A+++L Q
Sbjct  334  LSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYNTLLTALCRSGEVDVAVELLHQ  393

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +K D  C P +++Y  +I+         EA++L++EM+S+GL+P+I TY+ I  GLCRE 
Sbjct  394  LK-DKGCAPVLISYNTVIDGLTKAGKTKEALELLNEMVSKGLQPDIITYSTIAAGLCRED  452

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             ++ A      +  MG +P+   YN ++  L  RR       L   M   GC P+  TY 
Sbjct  453  RIEDAIRAFGKVQDMGIRPNTVLYNAIILGLCKRRETHSAIDLFAYMIGNGCMPNESTYT  512

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L  +G + +A  +L  +  +G+
Sbjct  513  ILIEGLAYEGLIKEARDLLDELCSRGV  539



>ref|XP_003575182.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Brachypodium distachyon]
 ref|XP_010235566.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Brachypodium distachyon]
 ref|XP_010235567.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Brachypodium distachyon]
 ref|XP_010235568.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Brachypodium distachyon]
Length=557

 Score =   236 bits (602),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 119/291 (41%), Positives = 180/291 (62%), Gaps = 8/291 (3%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYT  694
            G  EE L L++ M  +        C  LIK L +  +  +A +V+   E    P+V+AY 
Sbjct  73   GDLEEALRLVESMSGLEPSAAPGPCAALIKKLCASGRTAEARRVLAACE----PDVMAYN  128

Query  693  ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
            A++ G+C T +++AA  ++  M      PD  TYN +I  +C RG+ G AL VLD M   
Sbjct  129  AMVAGYCVTGQLDAARRLVADMP---MEPDSYTYNTLIRGLCGRGRTGNALVVLDDMLR-  184

Query  513  NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
              C PDVVTYT+L+EAT  + G  +AMKL+DEM ++G  P+I TYN ++ G+C+EG VD 
Sbjct  185  RGCVPDVVTYTILLEATCKRSGYKQAMKLLDEMRAKGCAPDIITYNVVVNGICQEGRVDD  244

Query  333  AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVS  154
            A EF++SLP+ GC+P+  SYNI+L+ L     W+D EKL+ EMS  G  P+  T+N+ +S
Sbjct  245  AIEFLKSLPSHGCEPNTVSYNIVLKGLCTAERWEDAEKLMAEMSQKGYPPNVVTFNMLIS  304

Query  153  SLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             LCR G +  A+ +L  + + G TPN  +Y+P++ AFCK+ ++D A+  ++
Sbjct  305  FLCRRGLVEPAMEVLDQIPKYGCTPNSLSYNPILHAFCKQKKMDRAMAFVE  355


 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/298 (32%), Positives = 158/298 (53%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L  +C    Y++ + LL  M   G  PD++    ++ G+    + + A++ ++ L   G 
Sbjct  198  LEATCKRSGYKQAMKLLDEMRAKGCAPDIITYNVVVNGICQEGRVDDAIEFLKSLPSHGC  257

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            EPN ++Y  ++ G C   R E A  ++  M  +G+ P+VVT+N++I  +C RG +  A++
Sbjct  258  EPNTVSYNIVLKGLCTAERWEDAEKLMAEMSQKGYPPNVVTFNMLISFLCRRGLVEPAME  317

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VLDQ+ +   C P+ ++Y  ++ A   +  +  AM  V+ M+SRG  P+I +YN +L  L
Sbjct  318  VLDQIPK-YGCTPNSLSYNPILHAFCKQKKMDRAMAFVELMVSRGCYPDIVSYNTLLTAL  376

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            CR G VD A E +  L   GC P + SYN ++  L       +  +LL EM + G +P  
Sbjct  377  CRGGEVDAAVELLHQLKDKGCTPVLISYNTVIDGLTKAGKTKEALELLNEMVTKGLQPDI  436

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+   S LCR+ ++ +AI     + + G+ PN   Y+ ++   CK      AIDL 
Sbjct  437  ITYSTISSGLCREDRIEEAIRAFCKVQDMGIRPNTVLYNAILLGLCKRRETHNAIDLF  494


 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 156/274 (57%), Gaps = 2/274 (1%)
 Frame = -1

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNVLAYTALIGGFCKTNRVEAANG  643
            +PD      LI+GL    +   A+ V+  +L +   P+V+ YT L+   CK +  + A  
Sbjct  153  EPDSYTYNTLIRGLCGRGRTGNALVVLDDMLRRGCVPDVVTYTILLEATCKRSGYKQAMK  212

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
            +L+ MR++G  PD++TYN+++  IC  G++  A++ L  +   + C+P+ V+Y ++++  
Sbjct  213  LLDEMRAKGCAPDIITYNVVVNGICQEGRVDDAIEFLKSLP-SHGCEPNTVSYNIVLKGL  271

Query  462  IVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
               +   +A KL+ EM  +G  PN+ T+N ++  LCR G+V+ A E +  +P  GC P+ 
Sbjct  272  CTAERWEDAEKLMAEMSQKGYPPNVVTFNMLISFLCRRGLVEPAMEVLDQIPKYGCTPNS  331

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             SYN +L A   ++  D     ++ M S GC P   +YN  +++LCR G+++ A+ +L  
Sbjct  332  LSYNPILHAFCKQKKMDRAMAFVELMVSRGCYPDIVSYNTLLTALCRGGEVDAAVELLHQ  391

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + +KG TP   +Y+ +I    K G+   A++LL+
Sbjct  392  LKDKGCTPVLISYNTVIDGLTKAGKTKEALELLN  425


 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 155/291 (53%), Gaps = 2/291 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CG G+    L +L  M++ G  PDVV  T L++        ++A+K++  +   G  P++
Sbjct  167  CGRGRTGNALVVLDDMLRRGCVPDVVTYTILLEATCKRSGYKQAMKLLDEMRAKGCAPDI  226

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  ++ G C+  RV+ A   L  + S G  P+ V+YNI++  +C   +   A K++ +
Sbjct  227  ITYNVVVNGICQEGRVDDAIEFLKSLPSHGCEPNTVSYNIVLKGLCTAERWEDAEKLMAE  286

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +     P+VVT+ +LI     +  +  AM+++D++   G  PN  +YN IL   C++ 
Sbjct  287  MSQKGY-PPNVVTFNMLISFLCRRGLVEPAMEVLDQIPKYGCTPNSLSYNPILHAFCKQK  345

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA  FV  + + GC PD+ SYN LL AL      D   +LL ++   GC P   +YN
Sbjct  346  KMDRAMAFVELMVSRGCYPDIVSYNTLLTALCRGGEVDAAVELLHQLKDKGCTPVLISYN  405

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              +  L + GK  +A+ +L  M  KGL P+  TY  + S  C+E R++ AI
Sbjct  406  TVIDGLTKAGKTKEALELLNEMVTKGLQPDIITYSTISSGLCREDRIEEAI  456


 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 149/267 (56%), Gaps = 2/267 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++E+   L+  M + GY P+VV    LI  L      E A++V+  + ++G  PN 
Sbjct  272  CTAERWEDAEKLMAEMSQKGYPPNVVTFNMLISFLCRRGLVEPAMEVLDQIPKYGCTPNS  331

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L+Y  ++  FCK  +++ A   +  M SRG +PD+V+YN ++ ++C  G++  A+++L Q
Sbjct  332  LSYNPILHAFCKQKKMDRAMAFVELMVSRGCYPDIVSYNTLLTALCRGGEVDAAVELLHQ  391

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +K D  C P +++Y  +I+         EA++L++EM+++GL+P+I TY+ I  GLCRE 
Sbjct  392  LK-DKGCTPVLISYNTVIDGLTKAGKTKEALELLNEMVTKGLQPDIITYSTISSGLCRED  450

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             ++ A      +  MG +P+   YN +L  L  RR   +   L   M S GC P+  TY 
Sbjct  451  RIEEAIRAFCKVQDMGIRPNTVLYNAILLGLCKRRETHNAIDLFIYMISNGCMPNESTYT  510

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L  +G + +A  +L  +  +G+
Sbjct  511  ILIEGLTYEGLVKEARELLGELCSRGV  537



>ref|XP_006575366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
isoform X1 [Glycine max]
 ref|XP_006575367.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
isoform X2 [Glycine max]
 gb|KHN26162.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=601

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/331 (40%), Positives = 200/331 (60%), Gaps = 11/331 (3%)
 Frame = -1

Query  981  NLQ-SVKVSTENRNALIQLLDSKEIDIRR--RLNRSCGAGKYEETLYLLQYMVKIGYKPD  811
            NLQ S + S    N +   L+ +E +I    RL R+   G+ EE    L+YM   G  PD
Sbjct  47   NLQHSERFSKGALNGVNTSLNFEESEIHHLCRLIRN---GELEEGSRFLEYMTNKGKIPD  103

Query  810  VVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAANGVLN  634
            VV CT LI+    + + + A ++M +LE+ G   +  +Y  LI  +CK+  +E A  VL+
Sbjct  104  VVACTALIREFCKIGRTKNATRIMGILEESGAVIDANSYNVLINAYCKSGEIEEALRVLD  163

Query  633  RMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVK  454
                    P+  TY+ ++ S+CDRGKL  A++VLD+  + + C PDVVT TVLI+AT  +
Sbjct  164  HTS---VAPNAATYDAVLCSLCDRGKLKQAMQVLDRQLQ-SKCYPDVVTCTVLIDATCKE  219

Query  453  DGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSY  274
             G+ +AMKL +EM  +G +P++ TYN ++KG C+EG +D A  F++ LP+ GC+ DV S+
Sbjct  220  SGVGQAMKLFNEMRGKGCKPDVVTYNVLIKGFCKEGRLDEAIIFLKKLPSYGCQSDVISH  279

Query  273  NILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTE  94
            N++LR+L     W D  KLL  M   GC P   T+NI ++ LC+ G L KA+++L++M +
Sbjct  280  NMILRSLCSGGRWMDAMKLLATMLRKGCFPSVVTFNILINFLCQKGLLGKALNVLEMMPK  339

Query  93   KGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             G TPN  +++PLI  FC    +D AI+ L+
Sbjct  340  HGHTPNSRSFNPLIQGFCNRKGIDRAIEHLE  370


 Score =   172 bits (436),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 97/295 (33%), Positives = 161/295 (55%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  GK ++ + +L   ++    PDVV CT LI          +A+K+   +   G +P+V
Sbjct  182  CDRGKLKQAMQVLDRQLQSKCYPDVVTCTVLIDATCKESGVGQAMKLFNEMRGKGCKPDV  241

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI GFCK  R++ A   L ++ S G   DV+++N+++ S+C  G+   A+K+L  
Sbjct  242  VTYNVLIKGFCKEGRLDEAIIFLKKLPSYGCQSDVISHNMILRSLCSGGRWMDAMKLLAT  301

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P VVT+ +LI     K  + +A+ +++ M   G  PN  ++N +++G C   
Sbjct  302  MLR-KGCFPSVVTFNILINFLCQKGLLGKALNVLEMMPKHGHTPNSRSFNPLIQGFCNRK  360

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA E +  + + GC PD+ +YNILL AL      DD   +L ++SS GC P   +YN
Sbjct  361  GIDRAIEHLEIMVSRGCYPDIVTYNILLTALCKDGKVDDAVVILSQLSSKGCSPSLISYN  420

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +  L + GK   A+ + + M  KGL  +  TY+ +I+   K G+ +LA++LL+
Sbjct  421  TVIDGLLKVGKTECAVELFEEMCRKGLEADIITYNIIINGLLKVGKAELAVELLE  475


 Score =   152 bits (383),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 95/333 (29%), Positives = 162/333 (49%), Gaps = 37/333 (11%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            ++ +C      + + L   M   G KPDVV    LIKG     + ++A+  ++ L  +G 
Sbjct  213  IDATCKESGVGQAMKLFNEMRGKGCKPDVVTYNVLIKGFCKEGRLDEAIIFLKKLPSYGC  272

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            + +V+++  ++   C   R   A  +L  M  +G FP VVT+NI+I  +C +G LG AL 
Sbjct  273  QSDVISHNMILRSLCSGGRWMDAMKLLATMLRKGCFPSVVTFNILINFLCQKGLLGKALN  332

Query  537  VLDQMKEDNN----------------------------------CKPDVVTYTVLIEATI  460
            VL+ M +  +                                  C PD+VTY +L+ A +
Sbjct  333  VLEMMPKHGHTPNSRSFNPLIQGFCNRKGIDRAIEHLEIMVSRGCYPDIVTYNILLTA-L  391

Query  459  VKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             KDG + +A+ ++ ++ S+G  P++ +YN ++ GL + G  + A E    +   G + D+
Sbjct  392  CKDGKVDDAVVILSQLSSKGCSPSLISYNTVIDGLLKVGKTECAVELFEEMCRKGLEADI  451

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +YNI++  LL     +   +LL+EM   G +P   T    V  L R+GK+++AI     
Sbjct  452  ITYNIIINGLLKVGKAELAVELLEEMCYKGLKPDLITCTSVVGGLSREGKVHEAIKFFHY  511

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            +   G+ PN F Y+ ++   CK  +  LAID L
Sbjct  512  LKGFGIKPNAFIYNSIMMGLCKAQQTSLAIDFL  544


 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 151/294 (51%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNV  706
            C  G++ + + LL  M++ G  P VV    LI  L       KA+ V++++ + G  PN 
Sbjct  287  CSGGRWMDAMKLLATMLRKGCFPSVVTFNILINFLCQKGLLGKALNVLEMMPKHGHTPNS  346

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             ++  LI GFC    ++ A   L  M SRG +PD+VTYNI++ ++C  GK+  A+ +L Q
Sbjct  347  RSFNPLIQGFCNRKGIDRAIEHLEIMVSRGCYPDIVTYNILLTALCKDGKVDDAVVILSQ  406

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +     C P +++Y  +I+  ++K G +E A++L +EM  +GLE +I TYN I+ GL + 
Sbjct  407  L-SSKGCSPSLISYNTVIDG-LLKVGKTECAVELFEEMCRKGLEADIITYNIIINGLLKV  464

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G  + A E +  +   G KPD+ +   ++  L       +  K    +   G +P+ F Y
Sbjct  465  GKAELAVELLEEMCYKGLKPDLITCTSVVGGLSREGKVHEAIKFFHYLKGFGIKPNAFIY  524

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDL  7
            N  +  LC+  + + AI  L  M   G  P + +Y  LI     EG  + A  L
Sbjct  525  NSIMMGLCKAQQTSLAIDFLVDMVANGCKPTEASYTTLIKGITYEGLAEEASKL  578



>gb|AFK46081.1| unknown [Lotus japonicus]
Length=327

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = -1

Query  495  VVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVR  316
            +VTYT+LIEATI+K G+ + MKL+DEM+  GL P+++ +NA++ G+CREG+VDRA+EF+R
Sbjct  25   LVTYTILIEATILKGGVDDVMKLLDEMIESGLRPDMFIFNAVVGGMCREGLVDRAFEFIR  84

Query  315  SLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDG  136
             + A G  PDV SY+ILLR LL++R W+DGEKL+ +M S GCEP+  TY+I +SSLCRDG
Sbjct  85   YISAKGYAPDVISYSILLRGLLNQRKWEDGEKLMSDMLSKGCEPNVVTYSILISSLCRDG  144

Query  135  KLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            K+ +A+S+LK+M E+GLTP+ ++YDPLI+AFCKE R+DLAI+ L+
Sbjct  145  KVEEAVSLLKVMKEQGLTPDAYSYDPLIAAFCKESRVDLAIEFLE  189


 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/252 (33%), Positives = 151/252 (60%), Gaps = 7/252 (3%)
 Frame = -1

Query  744  VMQLLEQFGE----PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIG  577
            VM+LL++  E    P++  + A++GG C+   V+ A   +  + ++G+ PDV++Y+I++ 
Sbjct  44   VMKLLDEMIESGLRPDMFIFNAVVGGMCREGLVDRAFEFIRYISAKGYAPDVISYSILLR  103

Query  576  SICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGL  400
             + ++ K     K++  M     C+P+VVTY++LI +++ +DG + EA+ L+  M  +GL
Sbjct  104  GLLNQRKWEDGEKLMSDMLS-KGCEPNVVTYSILI-SSLCRDGKVEEAVSLLKVMKEQGL  161

Query  399  EPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK  220
             P+ Y+Y+ ++   C+E  VD A EF+ S+ + GC PD+ +YN +L  L      D+  K
Sbjct  162  TPDAYSYDPLIAAFCKESRVDLAIEFLESMISDGCLPDIVNYNTILSTLCKNGKADEALK  221

Query  219  LLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFC  40
            + +++  +GC P+  +YN   S+L   G   +A+ M+  M  K + P++ TY+ LIS  C
Sbjct  222  IFEKLGEVGCPPNVSSYNTLFSALWSSGHKIRALGMILEMLSKDIDPDEITYNSLISCLC  281

Query  39   KEGRLDLAIDLL  4
            ++  +D AI+LL
Sbjct  282  RDAMVDQAIELL  293


 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 154/294 (52%), Gaps = 12/294 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAY  697
            G  ++ + LL  M++ G +PD+ +   ++ G+      ++A + ++ +   G  P+V++Y
Sbjct  39   GGVDDVMKLLDEMIESGLRPDMFIFNAVVGGMCREGLVDRAFEFIRYISAKGYAPDVISY  98

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
            + L+ G     + E    +++ M S+G  P+VVTY+I+I S+C  GK+  A+ +L  MKE
Sbjct  99   SILLRGLLNQRKWEDGEKLMSDMLSKGCEPNVVTYSILISSLCRDGKVEEAVSLLKVMKE  158

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  +Y  LI A   +  +  A++ ++ M+S G  P+I  YN IL  LC+ G  D
Sbjct  159  -QGLTPDAYSYDPLIAAFCKESRVDLAIEFLESMISDGCLPDIVNYNTILSTLCKNGKAD  217

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEK-----LLKEMSSMGCEPHTFT  172
             A +    L  +GC P+V SYN L  AL     W  G K     ++ EM S   +P   T
Sbjct  218  EALKIFEKLGEVGCPPNVSSYNTLFSAL-----WSSGHKIRALGMILEMLSKDIDPDEIT  272

Query  171  YNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAID  10
            YN  +S LCRD  +++AI +L  M      P+  +Y+ ++    K  R+  AI+
Sbjct  273  YNSLISCLCRDAMVDQAIELLVDMESSVYQPSVISYNIVLLGLSKVHRISDAIE  326


 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 135/257 (53%), Gaps = 4/257 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNV  706
            C  G  +     ++Y+   GY PDV+  + L++GL + +K E   K+M  +L +  EPNV
Sbjct  71   CREGLVDRAFEFIRYISAKGYAPDVISYSILLRGLLNQRKWEDGEKLMSDMLSKGCEPNV  130

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y+ LI   C+  +VE A  +L  M+ +G  PD  +Y+ +I + C   ++ LA++ L+ 
Sbjct  131  VTYSILISSLCRDGKVEEAVSLLKVMKEQGLTPDAYSYDPLIAAFCKESRVDLAIEFLES  190

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M  D  C PD+V Y  ++ +T+ K+G   EA+K+ +++   G  PN+ +YN +   L   
Sbjct  191  MISDG-CLPDIVNYNTIL-STLCKNGKADEALKIFEKLGEVGCPPNVSSYNTLFSALWSS  248

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G   RA   +  + +    PD  +YN L+  L      D   +LL +M S   +P   +Y
Sbjct  249  GHKIRALGMILEMLSKDIDPDEITYNSLISCLCRDAMVDQAIELLVDMESSVYQPSVISY  308

Query  168  NIFVSSLCRDGKLNKAI  118
            NI +  L +  +++ AI
Sbjct  309  NIVLLGLSKVHRISDAI  325



>gb|EYU45465.1| hypothetical protein MIMGU_mgv1a003559mg [Erythranthe guttata]
Length=578

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/301 (42%), Positives = 178/301 (59%), Gaps = 31/301 (10%)
 Frame = -1

Query  900  RRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQF  721
            RRL R+   G+ EE    L+ MV  G  PD++ CT LI+G   V K +KA +VM++LE  
Sbjct  113  RRLVRN---GELEEGFKHLENMVYHGDIPDIIPCTSLIRGFCRVGKTKKATRVMEILEDS  169

Query  720  GE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLA  544
            G  P+V+ Y  LI G+CK+  +  A  VL RM      PDVVTYN ++ ++CD GKL  A
Sbjct  170  GAVPDVITYNVLISGYCKSGEIYNALKVLERM---SVAPDVVTYNTILRTLCDSGKLKQA  226

Query  543  LKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILK  364
            ++VLDQ  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM  +G +P++ TYN ++ 
Sbjct  227  MEVLDQQLQ-KECYPDVITYTILIEATCKESGVEQAMKLLDEMRDKGCKPDVVTYNVLIN  285

Query  363  GLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEP  184
            G+C+EG +D A                         +     W D EKLL EM   GC P
Sbjct  286  GICKEGRLDEAI-----------------------IMCSTGRWMDAEKLLAEMLRKGCSP  322

Query  183  HTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               T+NI ++ LCR G L +AI +L+ M + G TPN  +Y+PL+  FCKE ++D AI+ L
Sbjct  323  SVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYL  382

Query  3    D  1
            +
Sbjct  383  E  383


 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/306 (31%), Positives = 161/306 (53%), Gaps = 14/306 (5%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK ++ + +L   ++    PDV+  T LI+        E+A+K++  +   G +P+V
Sbjct  218  CDSGKLKQAMEVLDQQLQKECYPDVITYTILIEATCKESGVEQAMKLLDEMRDKGCKPDV  277

Query  705  LAYTALIGGFCKTNRVEAA------------NGVLNRMRSRGFFPDVVTYNIMIGSICDR  562
            + Y  LI G CK  R++ A              +L  M  +G  P VVT+NI+I  +C +
Sbjct  278  VTYNVLINGICKEGRLDEAIIMCSTGRWMDAEKLLAEMLRKGCSPSVVTFNILINFLCRK  337

Query  561  GKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYT  382
            G LG A+ +L++M + + C P+ ++Y  L+     +  +  A++ ++ M++RG  P+I T
Sbjct  338  GLLGRAIDILEKMPK-HGCTPNSLSYNPLLHGFCKEKKMDRAIEYLEVMVTRGCYPDIVT  396

Query  381  YNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
            YN +L  LC++G VD A E +  L + GC P + +YN ++  L      +   +LL EM 
Sbjct  397  YNTLLTALCKDGKVDIAVEILNQLSSKGCSPVLITYNTVIDGLSKMGKTERAMQLLFEMR  456

Query  201  SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLD  22
              G  P   TY+  V  L R+GK+ +AI   + +   G+ PN   Y+ ++   CK  + D
Sbjct  457  ERGLRPDIITYSSLVGGLSREGKVEEAIDFFQDLEGMGVRPNSVIYNAIMLGLCKARKTD  516

Query  21   LAIDLL  4
             AI+ L
Sbjct  517  RAINFL  522


 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/267 (33%), Positives = 146/267 (55%), Gaps = 2/267 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G++ +   LL  M++ G  P VV    LI  L       +A+ +++ + + G  PN 
Sbjct  300  CSTGRWMDAEKLLAEMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNS  359

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L+Y  L+ GFCK  +++ A   L  M +RG +PD+VTYN ++ ++C  GK+ +A+++L+Q
Sbjct  360  LSYNPLLHGFCKEKKMDRAIEYLEVMVTRGCYPDIVTYNTLLTALCKDGKVDIAVEILNQ  419

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C P ++TY  +I+          AM+L+ EM  RGL P+I TY++++ GL REG
Sbjct  420  LS-SKGCSPVLITYNTVIDGLSKMGKTERAMQLLFEMRERGLRPDIITYSSLVGGLSREG  478

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             V+ A +F + L  MG +P+   YN ++  L   R  D     L  M S GC+P   TY 
Sbjct  479  KVEEAIDFFQDLEGMGVRPNSVIYNAIMLGLCKARKTDRAINFLVHMVSKGCKPTESTYT  538

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L  +G   +A+ +L  +  +G+
Sbjct  539  ILIEGLAYEGFTKEALELLNELCSRGV  565


 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
            F  N  LR L+     ++G K L+ M   G  P        +   CR GK  KA  +++I
Sbjct  106  FESNNYLRRLVRNGELEEGFKHLENMVYHGDIPDIIPCTSLIRGFCRVGKTKKATRVMEI  165

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + + G  P+  TY+ LIS +CK G +  A+ +L+
Sbjct  166  LEDSGAVPDVITYNVLISGYCKSGEIYNALKVLE  199



>ref|XP_006647398.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006647399.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
isoform X2 [Oryza brachyantha]
Length=554

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 169/267 (63%), Gaps = 8/267 (3%)
 Frame = -1

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            C  LIK L +  +  +A +V+   +    P+V+AY +++ G+C   +++AA  ++  M  
Sbjct  99   CAALIKKLCASGRTAEARRVLAACD----PDVMAYNSMVAGYCGAGQLDAARRLVAEMP-  153

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
                PD  TYN +I  +C RG+   AL VLD M     C PDVVTYT+L+EAT  ++G  
Sbjct  154  --MEPDAYTYNTLIRGLCGRGRTANALAVLDDMLR-RRCVPDVVTYTILLEATCKRNGYK  210

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            +AMKL+DEM ++G  P+I TYN ++ G+C+EG VD A EF+++LP+ GC P+  SYNI+L
Sbjct  211  QAMKLLDEMRAKGCTPDIVTYNVVVNGICQEGRVDDAMEFLKNLPSYGCDPNTVSYNIVL  270

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            + L     W+D E L+ EM   GC P+  T+N+ +S LCR G +  A+ +L+ + + G T
Sbjct  271  KGLCTAERWEDAEVLMAEMGQKGCPPNVVTFNMLISFLCRKGLVEPAMEVLEQIPKYGCT  330

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            PN  +Y+PL+ AFCK+ ++D A+  LD
Sbjct  331  PNSLSYNPLLHAFCKQKKMDKAMAFLD  357


 Score =   180 bits (457),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 162/295 (55%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNV  706
            CGAG+ +    L+  M     +PD      LI+GL    +   A+ V+  +L +   P+V
Sbjct  137  CGAGQLDAARRLVAEMP---MEPDAYTYNTLIRGLCGRGRTANALAVLDDMLRRRCVPDV  193

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT L+   CK N  + A  +L+ MR++G  PD+VTYN+++  IC  G++  A++ L  
Sbjct  194  VTYTILLEATCKRNGYKQAMKLLDEMRAKGCTPDIVTYNVVVNGICQEGRVDDAMEFLKN  253

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C P+ V+Y ++++     +   +A  L+ EM  +G  PN+ T+N ++  LCR+G
Sbjct  254  LPS-YGCDPNTVSYNIVLKGLCTAERWEDAEVLMAEMGQKGCPPNVVTFNMLISFLCRKG  312

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            +V+ A E +  +P  GC P+  SYN LL A   ++  D     L  M S GC P   +YN
Sbjct  313  LVEPAMEVLEQIPKYGCTPNSLSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYN  372

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LCR G+++ AI +L  + +KG TP   +Y+ +I    K G+   A++LL+
Sbjct  373  TLLTALCRSGEVDVAIELLHQLKDKGCTPVLISYNTVIDGLTKAGKTKEALELLN  427


 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/298 (32%), Positives = 158/298 (53%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L  +C    Y++ + LL  M   G  PD+V    ++ G+    + + A++ ++ L  +G 
Sbjct  200  LEATCKRNGYKQAMKLLDEMRAKGCTPDIVTYNVVVNGICQEGRVDDAMEFLKNLPSYGC  259

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PN ++Y  ++ G C   R E A  ++  M  +G  P+VVT+N++I  +C +G +  A++
Sbjct  260  DPNTVSYNIVLKGLCTAERWEDAEVLMAEMGQKGCPPNVVTFNMLISFLCRKGLVEPAME  319

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VL+Q+ +   C P+ ++Y  L+ A   +  + +AM  +D M+SRG  P+I +YN +L  L
Sbjct  320  VLEQIPK-YGCTPNSLSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYNTLLTAL  378

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            CR G VD A E +  L   GC P + SYN ++  L       +  +LL EM S G +P  
Sbjct  379  CRSGEVDVAIELLHQLKDKGCTPVLISYNTVIDGLTKAGKTKEALELLNEMVSKGLQPDI  438

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+   S LCR+ ++  AI     + + G+ PN   Y+ ++   CK      AIDL 
Sbjct  439  ITYSTIASGLCREDRIEDAIGAFCKVQDMGIRPNTVLYNAILLGLCKRRETHGAIDLF  496


 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/267 (33%), Positives = 149/267 (56%), Gaps = 2/267 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++E+   L+  M + G  P+VV    LI  L      E A++V++ + ++G  PN 
Sbjct  274  CTAERWEDAEVLMAEMGQKGCPPNVVTFNMLISFLCRKGLVEPAMEVLEQIPKYGCTPNS  333

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L+Y  L+  FCK  +++ A   L+ M SRG +PD+V+YN ++ ++C  G++ +A+++L Q
Sbjct  334  LSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYNTLLTALCRSGEVDVAIELLHQ  393

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +K D  C P +++Y  +I+         EA++L++EM+S+GL+P+I TY+ I  GLCRE 
Sbjct  394  LK-DKGCTPVLISYNTVIDGLTKAGKTKEALELLNEMVSKGLQPDIITYSTIASGLCRED  452

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             ++ A      +  MG +P+   YN +L  L  RR       L   M   GC P+  TY 
Sbjct  453  RIEDAIGAFCKVQDMGIRPNTVLYNAILLGLCKRRETHGAIDLFVCMIGNGCMPNESTYT  512

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L  +G + +A  +L  +  +G+
Sbjct  513  ILIEGLAYEGLIKEARELLDELCSRGV  539


 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 148/299 (49%), Gaps = 2/299 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            +N  C  G+ ++ +  L+ +   G  P+ V    ++KGL + ++ E A  +M  + Q G 
Sbjct  235  VNGICQEGRVDDAMEFLKNLPSYGCDPNTVSYNIVLKGLCTAERWEDAEVLMAEMGQKGC  294

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PNV+ +  LI   C+   VE A  VL ++   G  P+ ++YN ++ + C + K+  A+ 
Sbjct  295  PPNVVTFNMLISFLCRKGLVEPAMEVLEQIPKYGCTPNSLSYNPLLHAFCKQKKMDKAMA  354

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
             LD M     C PD+V+Y  L+ A      +  A++L+ ++  +G  P + +YN ++ GL
Sbjct  355  FLDLMVS-RGCYPDIVSYNTLLTALCRSGEVDVAIELLHQLKDKGCTPVLISYNTVIDGL  413

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             + G    A E +  + + G +PD+ +Y+ +   L      +D      ++  MG  P+T
Sbjct  414  TKAGKTKEALELLNEMVSKGLQPDIITYSTIASGLCREDRIEDAIGAFCKVQDMGIRPNT  473

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              YN  +  LC+  + + AI +   M   G  PN+ TY  LI     EG +  A +LLD
Sbjct  474  VLYNAILLGLCKRRETHGAIDLFVCMIGNGCMPNESTYTILIEGLAYEGLIKEARELLD  532



>dbj|BAK03057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91889.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88192.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/292 (40%), Positives = 179/292 (61%), Gaps = 11/292 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVV-LCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAY  697
            G  EE + L++ M   G +P     C  LIK L +  +  +A +V+   E    P+V++Y
Sbjct  70   GDLEEAIRLVESMA--GLEPSAAGPCAALIKKLCASGRTAEARRVLASCE----PDVMSY  123

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
             A++ G+C T +++ A  ++  M      PD  TYN +I  +C RG+   AL VLD M  
Sbjct  124  NAMVAGYCVTGQLDNARRLVAAMP---MEPDTYTYNTLIRGLCGRGRTDNALAVLDDMLR  180

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
               C PDVVTYT+L+EAT  + G  +A+KL+DEM  +G  P+I TYN ++ G+C+EG VD
Sbjct  181  -RGCVPDVVTYTILLEATCKRSGYKQAVKLLDEMRDKGCAPDIVTYNVVVNGICQEGRVD  239

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
             A EF++SLP+ GC+P+  SYNI+L+ L     W+D EKL+ EMS  G  P+  T+N+ +
Sbjct  240  DAMEFLKSLPSYGCEPNTVSYNIVLKGLCTAERWEDAEKLMAEMSRKGRPPNVVTFNMLI  299

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            S LCR G +  A+ +L  + + G TPN  +Y+P++ AFCK+ ++D A+  ++
Sbjct  300  SFLCRRGLVEPAMEILDQIPKYGCTPNSLSYNPILHAFCKQKKMDRAMAFVE  351


 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/298 (32%), Positives = 159/298 (53%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L  +C    Y++ + LL  M   G  PD+V    ++ G+    + + A++ ++ L  +G 
Sbjct  194  LEATCKRSGYKQAVKLLDEMRDKGCAPDIVTYNVVVNGICQEGRVDDAMEFLKSLPSYGC  253

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            EPN ++Y  ++ G C   R E A  ++  M  +G  P+VVT+N++I  +C RG +  A++
Sbjct  254  EPNTVSYNIVLKGLCTAERWEDAEKLMAEMSRKGRPPNVVTFNMLISFLCRRGLVEPAME  313

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +LDQ+ +   C P+ ++Y  ++ A   +  +  AM  V+ M+S G  P+I +YN +L  L
Sbjct  314  ILDQIPK-YGCTPNSLSYNPILHAFCKQKKMDRAMAFVELMVSSGCYPDIVSYNTLLTAL  372

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            CR G VD A E +  L   GC P + SYN ++  L      ++  +LL EM + G +P  
Sbjct  373  CRGGEVDAAVELLHQLKDKGCTPVLISYNTVIDGLTKAGKTEEALELLNEMVTKGLQPDI  432

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+   S LCR+G++ +AI     + + G+ PN   Y+ ++   CK      AIDL 
Sbjct  433  ITYSTISSGLCREGRIEEAIKAFCKVQDMGIRPNTVLYNAILLGLCKRRATHSAIDLF  490


 Score =   175 bits (443),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 156/274 (57%), Gaps = 2/274 (1%)
 Frame = -1

Query  819  KPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNVLAYTALIGGFCKTNRVEAANG  643
            +PD      LI+GL    + + A+ V+  +L +   P+V+ YT L+   CK +  + A  
Sbjct  149  EPDTYTYNTLIRGLCGRGRTDNALAVLDDMLRRGCVPDVVTYTILLEATCKRSGYKQAVK  208

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
            +L+ MR +G  PD+VTYN+++  IC  G++  A++ L  +     C+P+ V+Y ++++  
Sbjct  209  LLDEMRDKGCAPDIVTYNVVVNGICQEGRVDDAMEFLKSLP-SYGCEPNTVSYNIVLKGL  267

Query  462  IVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
               +   +A KL+ EM  +G  PN+ T+N ++  LCR G+V+ A E +  +P  GC P+ 
Sbjct  268  CTAERWEDAEKLMAEMSRKGRPPNVVTFNMLISFLCRRGLVEPAMEILDQIPKYGCTPNS  327

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             SYN +L A   ++  D     ++ M S GC P   +YN  +++LCR G+++ A+ +L  
Sbjct  328  LSYNPILHAFCKQKKMDRAMAFVELMVSSGCYPDIVSYNTLLTALCRGGEVDAAVELLHQ  387

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + +KG TP   +Y+ +I    K G+ + A++LL+
Sbjct  388  LKDKGCTPVLISYNTVIDGLTKAGKTEEALELLN  421


 Score =   173 bits (438),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/291 (33%), Positives = 156/291 (54%), Gaps = 2/291 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CG G+ +  L +L  M++ G  PDVV  T L++        ++AVK++  +   G  P++
Sbjct  163  CGRGRTDNALAVLDDMLRRGCVPDVVTYTILLEATCKRSGYKQAVKLLDEMRDKGCAPDI  222

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  ++ G C+  RV+ A   L  + S G  P+ V+YNI++  +C   +   A K++ +
Sbjct  223  VTYNVVVNGICQEGRVDDAMEFLKSLPSYGCEPNTVSYNIVLKGLCTAERWEDAEKLMAE  282

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M       P+VVT+ +LI     +  +  AM+++D++   G  PN  +YN IL   C++ 
Sbjct  283  MSRKGR-PPNVVTFNMLISFLCRRGLVEPAMEILDQIPKYGCTPNSLSYNPILHAFCKQK  341

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +DRA  FV  + + GC PD+ SYN LL AL      D   +LL ++   GC P   +YN
Sbjct  342  KMDRAMAFVELMVSSGCYPDIVSYNTLLTALCRGGEVDAAVELLHQLKDKGCTPVLISYN  401

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              +  L + GK  +A+ +L  M  KGL P+  TY  + S  C+EGR++ AI
Sbjct  402  TVIDGLTKAGKTEEALELLNEMVTKGLQPDIITYSTISSGLCREGRIEEAI  452


 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 148/267 (55%), Gaps = 2/267 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++E+   L+  M + G  P+VV    LI  L      E A++++  + ++G  PN 
Sbjct  268  CTAERWEDAEKLMAEMSRKGRPPNVVTFNMLISFLCRRGLVEPAMEILDQIPKYGCTPNS  327

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L+Y  ++  FCK  +++ A   +  M S G +PD+V+YN ++ ++C  G++  A+++L Q
Sbjct  328  LSYNPILHAFCKQKKMDRAMAFVELMVSSGCYPDIVSYNTLLTALCRGGEVDAAVELLHQ  387

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +K D  C P +++Y  +I+         EA++L++EM+++GL+P+I TY+ I  GLCREG
Sbjct  388  LK-DKGCTPVLISYNTVIDGLTKAGKTEEALELLNEMVTKGLQPDIITYSTISSGLCREG  446

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             ++ A +    +  MG +P+   YN +L  L  RR       L   M S GC P+  TY 
Sbjct  447  RIEEAIKAFCKVQDMGIRPNTVLYNAILLGLCKRRATHSAIDLFTYMVSNGCMPNESTYT  506

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L  +G + +A  M+  +  +G+
Sbjct  507  ILIEGLAYEGLVKEAREMMAELCSRGV  533



>ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic-like [Cicer arietinum]
Length=572

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/344 (38%), Positives = 199/344 (58%), Gaps = 15/344 (4%)
 Frame = -1

Query  990  NLKNLQSVKVSTENRNALIQLLDSKEIDIRRRLN----RSCGAGKYEE---------TLY  850
            ++ NL +    T N+  L ++L S  I I  + +     +  AGK ++            
Sbjct  29   HVPNLHNHTFLTFNKKRLSRVLASTHITIPSKDSVFNLPNWKAGKNDQKSREIRINDAFL  88

Query  849  LLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFC  673
             L+YMV  G+KPDVV  T+L+  L    KA KAV+VM+++   G  P+V +YT L+   C
Sbjct  89   HLEYMVGKGHKPDVVQATQLLYDLCKSGKARKAVRVMEIMGGSGIIPDVASYTFLVNYLC  148

Query  672  KTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDV  493
            K   V  A  ++ +M   GF  + VTYN ++  +C  GKL  ++++LD++ +     P+ 
Sbjct  149  KRGNVGYAMQLVEKMEGLGFPTNTVTYNTLVKGLCTHGKLNQSMQILDKLIK-KGLVPNA  207

Query  492  VTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRS  313
            +TY++L+EA   + G+ EAMKL+DE++++G EPN+ +YN +L GLC+EG  + A E  R 
Sbjct  208  ITYSILLEAAYKERGVDEAMKLLDEIIAKGGEPNLVSYNVLLTGLCKEGRTEEAIELFRE  267

Query  312  LPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGK  133
            LPA G KP V S+NILLR+L     W++  KLL EM   G  P   TYNI ++SL   G+
Sbjct  268  LPAKGFKPCVVSHNILLRSLCYDGRWEEAYKLLAEMDEEGQAPSVVTYNILITSLSLHGR  327

Query  132  LNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + +A  +L  M   G   +  +Y+P+I+  CKEG++DL I  LD
Sbjct  328  IEQAFKVLDEMARSGFKVSANSYNPIIARLCKEGKVDLVIRCLD  371


 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/363 (25%), Positives = 164/363 (45%), Gaps = 71/363 (20%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  GK  +++ +L  ++K G  P+ +  + L++  +  +  ++A+K++ +++ + GEPN+
Sbjct  183  CTHGKLNQSMQILDKLIKKGLVPNAITYSILLEAAYKERGVDEAMKLLDEIIAKGGEPNL  242

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++Y  L+ G CK  R E A  +   + ++GF P VV++NI++ S+C  G+   A K+L +
Sbjct  243  VSYNVLLTGLCKEGRTEEAIELFRELPAKGFKPCVVSHNILLRSLCYDGRWEEAYKLLAE  302

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDE------------------------  418
            M E+    P VVTY +LI +  +   I +A K++DE                        
Sbjct  303  MDEEGQA-PSVVTYNILITSLSLHGRIEQAFKVLDEMARSGFKVSANSYNPIIARLCKEG  361

Query  417  -----------MLSRGLEPNIYTYNAIL------KG------------------------  361
                       M++R    N  TYNAI       KG                        
Sbjct  362  KVDLVIRCLDQMVNRRFHLNGGTYNAIALFCEQGKGKEAFLIFERLGKKQNYPIHDFYKN  421

Query  360  ----LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMG  193
                LCR+G    A++ +  +   G  PD ++Y+ L+R +     +D+  ++   +    
Sbjct  422  VITVLCRKGNTYSAFQILYEMTMHGFTPDSYTYSSLIRGMCREGMFDEALEIFGILEEHD  481

Query  192  CEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              PH   YN  +   C+  K++ +I + ++M  KG  PN+ TY  L+     E   DLA 
Sbjct  482  YVPHVDNYNALILGFCKSHKIDLSIEVFQMMVNKGCMPNEITYTILVEGIAFEEENDLAA  541

Query  12   DLL  4
             LL
Sbjct  542  SLL  544


 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 84/302 (28%), Positives = 135/302 (45%), Gaps = 38/302 (13%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNV  706
            C  G+ EE + L + +   G+KP VV    L++ L    + E+A K++  +++ G+ P+V
Sbjct  253  CKEGRTEEAIELFRELPAKGFKPCVVSHNILLRSLCYDGRWEEAYKLLAEMDEEGQAPSV  312

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI       R+E A  VL+ M   GF     +YN +I  +C  GK+ L ++ LDQ
Sbjct  313  VTYNILITSLSLHGRIEQAFKVLDEMARSGFKVSANSYNPIIARLCKEGKVDLVIRCLDQ  372

Query  525  M-----------------------------------KEDNNCKPDVVTYTVLIEATIVKD  451
            M                                   K+ N    D   Y  +I     K 
Sbjct  373  MVNRRFHLNGGTYNAIALFCEQGKGKEAFLIFERLGKKQNYPIHDF--YKNVITVLCRKG  430

Query  450  GISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
                A +++ EM   G  P+ YTY+++++G+CREGM D A E    L      P V +YN
Sbjct  431  NTYSAFQILYEMTMHGFTPDSYTYSSLIRGMCREGMFDEALEIFGILEEHDYVPHVDNYN  490

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
             L+         D   ++ + M + GC P+  TY I V  +  + + + A S+LK +  K
Sbjct  491  ALILGFCKSHKIDLSIEVFQMMVNKGCMPNEITYTILVEGIAFEEENDLAASLLKELCLK  550

Query  90   GL  85
            G+
Sbjct  551  GV  552



>ref|NP_001141010.1| hypothetical protein [Zea mays]
 gb|ACF85162.1| unknown [Zea mays]
 gb|AFW71902.1| hypothetical protein ZEAMMB73_497690 [Zea mays]
Length=567

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 168/267 (63%), Gaps = 8/267 (3%)
 Frame = -1

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            C  LIK L +  +   A +V+        P+V+ Y A++ G+C   +++AA  ++  M  
Sbjct  107  CAALIKKLCASGRTADARRVLAA----SGPDVMVYNAMVAGYCGAGQLDAARRLVADMPV  162

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
                PD  TYN +I  +C RG+   AL VL+ M     C PDVVTYT+L+EAT  + G  
Sbjct  163  E---PDAYTYNTLIRGLCGRGRTSNALAVLEDMFR-RGCLPDVVTYTILLEATCKRSGYK  218

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            +AMKL+DEM  +G  P+I TYN +L G+C+EG V+ A EF+++LP+ GC+P+  SYNI+L
Sbjct  219  QAMKLLDEMHDKGCAPDIVTYNVVLNGICQEGRVEDAMEFLKNLPSYGCEPNTVSYNIVL  278

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            + L     W+D EKL++EM+  GC P+  T+N+ +S LCR G +  A+ +L+ M + G T
Sbjct  279  KGLFTAERWEDAEKLMEEMAHKGCPPNVVTFNMLISFLCRRGLVEPAMEVLEQMPQYGCT  338

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            PN  +Y+PL+ AFCK+ ++  A++ ++
Sbjct  339  PNSLSYNPLLHAFCKQKKIHKAMEFVE  365


 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 165/295 (56%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CGAG+ +    L+  M     +PD      LI+GL    +   A+ V++ + + G  P+V
Sbjct  145  CGAGQLDAARRLVADM---PVEPDAYTYNTLIRGLCGRGRTSNALAVLEDMFRRGCLPDV  201

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT L+   CK +  + A  +L+ M  +G  PD+VTYN+++  IC  G++  A++ L  
Sbjct  202  VTYTILLEATCKRSGYKQAMKLLDEMHDKGCAPDIVTYNVVLNGICQEGRVEDAMEFLKN  261

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C+P+ V+Y ++++     +   +A KL++EM  +G  PN+ T+N ++  LCR G
Sbjct  262  LP-SYGCEPNTVSYNIVLKGLFTAERWEDAEKLMEEMAHKGCPPNVVTFNMLISFLCRRG  320

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            +V+ A E +  +P  GC P+  SYN LL A   ++      + ++ M S GC P   +YN
Sbjct  321  LVEPAMEVLEQMPQYGCTPNSLSYNPLLHAFCKQKKIHKAMEFVELMVSRGCYPDIVSYN  380

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LCR+G+++ AI +L  + +KG +P   +Y+ +I    K G+   A++LLD
Sbjct  381  TLLTALCRNGEVDVAIELLHQLKDKGCSPVLISYNTVIDGLTKAGKTKEALELLD  435


 Score =   175 bits (444),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 159/298 (53%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L  +C    Y++ + LL  M   G  PD+V    ++ G+    + E A++ ++ L  +G 
Sbjct  208  LEATCKRSGYKQAMKLLDEMHDKGCAPDIVTYNVVLNGICQEGRVEDAMEFLKNLPSYGC  267

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            EPN ++Y  ++ G     R E A  ++  M  +G  P+VVT+N++I  +C RG +  A++
Sbjct  268  EPNTVSYNIVLKGLFTAERWEDAEKLMEEMAHKGCPPNVVTFNMLISFLCRRGLVEPAME  327

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VL+QM +   C P+ ++Y  L+ A   +  I +AM+ V+ M+SRG  P+I +YN +L  L
Sbjct  328  VLEQMPQ-YGCTPNSLSYNPLLHAFCKQKKIHKAMEFVELMVSRGCYPDIVSYNTLLTAL  386

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            CR G VD A E +  L   GC P + SYN ++  L       +  +LL EM+S G +P  
Sbjct  387  CRNGEVDVAIELLHQLKDKGCSPVLISYNTVIDGLTKAGKTKEALELLDEMTSKGLQPDI  446

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+   S LCR+ ++ +A+     + + G+ P    Y+ ++   CK      AIDL 
Sbjct  447  ITYSTIASGLCREDRIEEAVRTFCKVQDMGIRPTAALYNAILLGLCKRRETHNAIDLF  504


 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 156/291 (54%), Gaps = 2/291 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CG G+    L +L+ M + G  PDVV  T L++        ++A+K++  +   G  P++
Sbjct  177  CGRGRTSNALAVLEDMFRRGCLPDVVTYTILLEATCKRSGYKQAMKLLDEMHDKGCAPDI  236

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  ++ G C+  RVE A   L  + S G  P+ V+YNI++  +    +   A K++++
Sbjct  237  VTYNVVLNGICQEGRVEDAMEFLKNLPSYGCEPNTVSYNIVLKGLFTAERWEDAEKLMEE  296

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C P+VVT+ +LI     +  +  AM+++++M   G  PN  +YN +L   C++ 
Sbjct  297  MAH-KGCPPNVVTFNMLISFLCRRGLVEPAMEVLEQMPQYGCTPNSLSYNPLLHAFCKQK  355

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             + +A EFV  + + GC PD+ SYN LL AL      D   +LL ++   GC P   +YN
Sbjct  356  KIHKAMEFVELMVSRGCYPDIVSYNTLLTALCRNGEVDVAIELLHQLKDKGCSPVLISYN  415

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              +  L + GK  +A+ +L  MT KGL P+  TY  + S  C+E R++ A+
Sbjct  416  TVIDGLTKAGKTKEALELLDEMTSKGLQPDIITYSTIASGLCREDRIEEAV  466


 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/270 (33%), Positives = 146/270 (54%), Gaps = 2/270 (1%)
 Frame = -1

Query  876  AGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLA  700
            A ++E+   L++ M   G  P+VV    LI  L      E A++V++ + Q+G  PN L+
Sbjct  284  AERWEDAEKLMEEMAHKGCPPNVVTFNMLISFLCRRGLVEPAMEVLEQMPQYGCTPNSLS  343

Query  699  YTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMK  520
            Y  L+  FCK  ++  A   +  M SRG +PD+V+YN ++ ++C  G++ +A+++L Q+K
Sbjct  344  YNPLLHAFCKQKKIHKAMEFVELMVSRGCYPDIVSYNTLLTALCRNGEVDVAIELLHQLK  403

Query  519  EDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMV  340
             D  C P +++Y  +I+         EA++L+DEM S+GL+P+I TY+ I  GLCRE  +
Sbjct  404  -DKGCSPVLISYNTVIDGLTKAGKTKEALELLDEMTSKGLQPDIITYSTIASGLCREDRI  462

Query  339  DRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIF  160
            + A      +  MG +P    YN +L  L  RR   +   L   M S GC P+  TY I 
Sbjct  463  EEAVRTFCKVQDMGIRPTAALYNAILLGLCKRRETHNAIDLFAYMISSGCMPNESTYTIL  522

Query  159  VSSLCRDGKLNKAISMLKIMTEKGLTPNKF  70
            V  L  +G + +A  +   +  +G+   K 
Sbjct  523  VEGLAYEGLVKEARELFAQLCSRGVVNKKL  552


 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 149/298 (50%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            LN  C  G+ E+ +  L+ +   G +P+ V    ++KGLF+ ++ E A K+M+ +   G 
Sbjct  243  LNGICQEGRVEDAMEFLKNLPSYGCEPNTVSYNIVLKGLFTAERWEDAEKLMEEMAHKGC  302

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PNV+ +  LI   C+   VE A  VL +M   G  P+ ++YN ++ + C + K+  A++
Sbjct  303  PPNVVTFNMLISFLCRRGLVEPAMEVLEQMPQYGCTPNSLSYNPLLHAFCKQKKIHKAME  362

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
             ++ M     C PD+V+Y  L+ A      +  A++L+ ++  +G  P + +YN ++ GL
Sbjct  363  FVELMV-SRGCYPDIVSYNTLLTALCRNGEVDVAIELLHQLKDKGCSPVLISYNTVIDGL  421

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             + G    A E +  + + G +PD+ +Y+ +   L      ++  +   ++  MG  P  
Sbjct  422  TKAGKTKEALELLDEMTSKGLQPDIITYSTIASGLCREDRIEEAVRTFCKVQDMGIRPTA  481

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              YN  +  LC+  + + AI +   M   G  PN+ TY  L+     EG +  A +L 
Sbjct  482  ALYNAILLGLCKRRETHNAIDLFAYMISSGCMPNESTYTILVEGLAYEGLVKEARELF  539



>emb|CDM84445.1| unnamed protein product [Triticum aestivum]
Length=669

 Score =   229 bits (583),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 173/300 (58%), Gaps = 5/300 (2%)
 Frame = -1

Query  897  RLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG  718
            RL R        E   L++     G  PDV LCTKLI+ L    +   A +V++  E  G
Sbjct  45   RLRRLIARDDLAEAARLVETSSSRGEAPDVYLCTKLIRNLCRRGRTSDAARVLRTAEASG  104

Query  717  EP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLAL  541
             P +V AY  L+ G+C+  R++AA  ++  M      PD  TY  +I  +CDRG++G AL
Sbjct  105  APVDVFAYNTLVAGYCRYGRLDAARRLIAEMPVP---PDAYTYTPIIRGLCDRGRVGDAL  161

Query  540  KVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
             +LD M +   C+P VVTYTVL+EA     G  EAM ++DEM ++G  PNI TYN I+ G
Sbjct  162  ALLDDMLQ-RGCQPSVVTYTVLLEAVCKSSGFGEAMNVLDEMRAKGCTPNIVTYNVIING  220

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            +CREG VD A E +  L + G +PD+ SY  +L+ L   R WDD + L  EM    C P+
Sbjct  221  MCREGRVDDAREILNRLSSYGFEPDIVSYTTVLKGLCAARRWDDVKVLFAEMVEKNCVPN  280

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              T+++ V   CR G + +AI +L+ M++ G TPN    + +I+A CK+GR+D A D L+
Sbjct  281  EVTFDMLVRFFCRGGMVERAIEVLQQMSQHGCTPNTTLCNIVINAMCKQGRVDDAYDFLN  340


 Score =   184 bits (468),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 162/295 (55%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  + L LL  M++ G +P VV  T L++ +       +A+ V+  +   G  PN+
Sbjct  152  CDRGRVGDALALLDDMLQRGCQPSVVTYTVLLEAVCKSSGFGEAMNVLDEMRAKGCTPNI  211

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  +I G C+  RV+ A  +LNR+ S GF PD+V+Y  ++  +C   +    +KVL  
Sbjct  212  VTYNVIINGMCREGRVDDAREILNRLSSYGFEPDIVSYTTVLKGLCAARRWD-DVKVLFA  270

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
               + NC P+ VT+ +L+        +  A++++ +M   G  PN    N ++  +C++G
Sbjct  271  EMVEKNCVPNEVTFDMLVRFFCRGGMVERAIEVLQQMSQHGCTPNTTLCNIVINAMCKQG  330

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD AY+F+ ++   GC PD  SY  +LR L     W+  ++LL EM    C P+  T+N
Sbjct  331  RVDDAYDFLNNMGMYGCNPDTISYTTVLRGLCRSGRWEHAKELLPEMVLKNCPPNEVTFN  390

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             F+  LC+ G + +AI ++++M E G +    TY+ L+  FC +GR+D A++L +
Sbjct  391  TFICILCQKGLIEQAIKLIELMPEYGCSVGIVTYNALVHGFCVQGRVDSALELFN  445


 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 156/333 (47%), Gaps = 40/333 (12%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKK----------------  763
            +N  C  G+ ++   +L  +   G++PD+V  T ++KGL + ++                
Sbjct  218  INGMCREGRVDDAREILNRLSSYGFEPDIVSYTTVLKGLCAARRWDDVKVLFAEMVEKNC  277

Query  762  -------------------AEKAVKVMQLLEQFG-EPNVLAYTALIGGFCKTNRVEAANG  643
                                E+A++V+Q + Q G  PN      +I   CK  RV+ A  
Sbjct  278  VPNEVTFDMLVRFFCRGGMVERAIEVLQQMSQHGCTPNTTLCNIVINAMCKQGRVDDAYD  337

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
             LN M   G  PD ++Y  ++  +C  G+   A ++L +M    NC P+ VT+   I   
Sbjct  338  FLNNMGMYGCNPDTISYTTVLRGLCRSGRWEHAKELLPEMVL-KNCPPNEVTFNTFICIL  396

Query  462  IVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
              K  I +A+KL++ M   G    I TYNA++ G C +G VD A E   +LP   C+P+ 
Sbjct  397  CQKGLIEQAIKLIELMPEYGCSVGIVTYNALVHGFCVQGRVDSALELFNNLP---CEPNT  453

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +Y  LL  L      D   +LL EM    C  +  T+N+ VS  C+ G + +AI ++  
Sbjct  454  ITYTTLLTGLCHTEQLDAAAELLAEMIQKDCPLNAVTFNVLVSFFCQKGFVEEAIELVYQ  513

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            M E G TPN  T++ L+    K+   + A++LL
Sbjct  514  MMEHGCTPNLITFNTLLDGITKDCNSEEALELL  546


 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/325 (26%), Positives = 150/325 (46%), Gaps = 32/325 (10%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  E  + +LQ M + G  P+  LC  +I  +    + + A   +  +  +G  P+ 
Sbjct  292  CRGGMVERAIEVLQQMSQHGCTPNTTLCNIVINAMCKQGRVDDAYDFLNNMGMYGCNPDT  351

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++YT ++ G C++ R E A  +L  M  +   P+ VT+N  I  +C +G +  A+K+++ 
Sbjct  352  ISYTTVLRGLCRSGRWEHAKELLPEMVLKNCPPNEVTFNTFICILCQKGLIEQAIKLIEL  411

Query  525  MKED-----------------------------NN--CKPDVVTYTVLIEATIVKDGISE  439
            M E                              NN  C+P+ +TYT L+      + +  
Sbjct  412  MPEYGCSVGIVTYNALVHGFCVQGRVDSALELFNNLPCEPNTITYTTLLTGLCHTEQLDA  471

Query  438  AMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLR  259
            A +L+ EM+ +    N  T+N ++   C++G V+ A E V  +   GC P++ ++N LL 
Sbjct  472  AAELLAEMIQKDCPLNAVTFNVLVSFFCQKGFVEEAIELVYQMMEHGCTPNLITFNTLLD  531

Query  258  ALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTP  79
             +    N ++  +LL  + S G    T TY+  V  L R+ +  +AI M   + + G+ P
Sbjct  532  GITKDCNSEEALELLHGLVSKGVSLDTITYSSVVDVLSREDRTEEAIQMFHAVQDMGMRP  591

Query  78   NKFTYDPLISAFCKEGRLDLAIDLL  4
                Y+ ++ A CK    D AI+  
Sbjct  592  KAGMYNKILFALCKRCETDQAIEFF  616


 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/287 (28%), Positives = 142/287 (49%), Gaps = 5/287 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +G++E    LL  MV     P+ V     I  L      E+A+K+++L+ ++G    +
Sbjct  362  CRSGRWEHAKELLPEMVLKNCPPNEVTFNTFICILCQKGLIEQAIKLIELMPEYGCSVGI  421

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y AL+ GFC   RV++A  + N +      P+ +TY  ++  +C   +L  A ++L +
Sbjct  422  VTYNALVHGFCVQGRVDSALELFNNLPCE---PNTITYTTLLTGLCHTEQLDAAAELLAE  478

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +  +C  + VT+ VL+     K  + EA++LV +M+  G  PN+ T+N +L G+ ++ 
Sbjct  479  MIQ-KDCPLNAVTFNVLVSFFCQKGFVEEAIELVYQMMEHGCTPNLITFNTLLDGITKDC  537

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A E +  L + G   D  +Y+ ++  L      ++  ++   +  MG  P    YN
Sbjct  538  NSEEALELLHGLVSKGVSLDTITYSSVVDVLSREDRTEEAIQMFHAVQDMGMRPKAGMYN  597

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
              + +LC+  + ++AI     M   G  PN+ TY  LI     EG L
Sbjct  598  KILFALCKRCETDQAIEFFAYMVSNGCMPNESTYIILIEGLAHEGML  644


 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/267 (29%), Positives = 140/267 (52%), Gaps = 5/267 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVL  703
            C  G  E+ + L++ M + G    +V    L+ G     + + A+++   L    EPN +
Sbjct  397  CQKGLIEQAIKLIELMPEYGCSVGIVTYNALVHGFCVQGRVDSALELFNNLP--CEPNTI  454

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             YT L+ G C T +++AA  +L  M  +    + VT+N+++   C +G +  A++++ QM
Sbjct  455  TYTTLLTGLCHTEQLDAAAELLAEMIQKDCPLNAVTFNVLVSFFCQKGFVEEAIELVYQM  514

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGIS-EAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
             E + C P+++T+  L++  I KD  S EA++L+  ++S+G+  +  TY++++  L RE 
Sbjct  515  ME-HGCTPNLITFNTLLDG-ITKDCNSEEALELLHGLVSKGVSLDTITYSSVVDVLSRED  572

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A +   ++  MG +P    YN +L AL  R   D   +    M S GC P+  TY 
Sbjct  573  RTEEAIQMFHAVQDMGMRPKAGMYNKILFALCKRCETDQAIEFFAYMVSNGCMPNESTYI  632

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L  +G L +A  +L  +  KG+
Sbjct  633  ILIEGLAHEGMLKEARYVLSELYAKGV  659



>dbj|BAJ91202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=669

 Score =   228 bits (581),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 173/300 (58%), Gaps = 5/300 (2%)
 Frame = -1

Query  897  RLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG  718
            RL R        E   L++     G  PDV LCTKLI+ L    +   A +V++  E  G
Sbjct  45   RLRRLIARDDLAEAARLVETSSSRGEAPDVYLCTKLIRNLCRRGRTSDAARVLRTAEASG  104

Query  717  EP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLAL  541
             P +V AY  L+ G+C+  R++AA  ++  M      PD  TY  +I  +CDRG++G AL
Sbjct  105  APVDVFAYNTLVAGYCRYGRLDAARRLIASMPVP---PDAYTYTPIIRGLCDRGRVGDAL  161

Query  540  KVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
             +LD M +   C+P VVTYTVL+EA     G  EAM ++DEM ++G  PNI TYN I+ G
Sbjct  162  ALLDDMLQ-RGCQPSVVTYTVLLEAVCKSSGFGEAMNVLDEMRAKGCTPNIVTYNVIING  220

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            +CREG VD A E +  L + G +PD+ SY  +L+ L   R WDD + L  EM    C P+
Sbjct  221  MCREGRVDDAKEILNRLSSYGFQPDIVSYTTVLKGLCAARRWDDVKVLFAEMVDKKCVPN  280

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              T+++ V   CR G + +AI +L+ M++ G TPN    + +I+A CK+GR+D A D L+
Sbjct  281  EVTFDMLVRFFCRGGMVERAIQVLQQMSQHGCTPNTTLCNIVINAICKQGRVDDAYDFLN  340


 Score =   184 bits (468),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 161/295 (55%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  + L LL  M++ G +P VV  T L++ +       +A+ V+  +   G  PN+
Sbjct  152  CDRGRVGDALALLDDMLQRGCQPSVVTYTVLLEAVCKSSGFGEAMNVLDEMRAKGCTPNI  211

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  +I G C+  RV+ A  +LNR+ S GF PD+V+Y  ++  +C   +    +KVL  
Sbjct  212  VTYNVIINGMCREGRVDDAKEILNRLSSYGFQPDIVSYTTVLKGLCAARRWD-DVKVLFA  270

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
               D  C P+ VT+ +L+        +  A++++ +M   G  PN    N ++  +C++G
Sbjct  271  EMVDKKCVPNEVTFDMLVRFFCRGGMVERAIQVLQQMSQHGCTPNTTLCNIVINAICKQG  330

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD AY+F+ ++   GC PD  SY  +LR L     W+  ++LL EM    C P+  T+N
Sbjct  331  RVDDAYDFLNNMGMYGCNPDTISYTTVLRGLCRAGRWEHAKELLPEMVRKNCPPNEVTFN  390

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             F+  LC+ G + +AI ++++M E G +    TY+ L+  FC +GR+D A++L +
Sbjct  391  TFICILCQKGLIEQAIKLIELMPEYGCSVGIVTYNALVHGFCVQGRVDSALELFN  445


 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 162/300 (54%), Gaps = 7/300 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM--QLLEQF  721
            +N  C  G+ ++   +L  +   G++PD+V  T ++KGL + ++ +  VKV+  +++++ 
Sbjct  218  INGMCREGRVDDAKEILNRLSSYGFQPDIVSYTTVLKGLCAARRWDD-VKVLFAEMVDKK  276

Query  720  GEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLAL  541
              PN + +  L+  FC+   VE A  VL +M   G  P+    NI+I +IC +G++  A 
Sbjct  277  CVPNEVTFDMLVRFFCRGGMVERAIQVLQQMSQHGCTPNTTLCNIVINAICKQGRVDDAY  336

Query  540  KVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
              L+ M     C PD ++YT ++           A +L+ EM+ +   PN  T+N  +  
Sbjct  337  DFLNNMGM-YGCNPDTISYTTVLRGLCRAGRWEHAKELLPEMVRKNCPPNEVTFNTFICI  395

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            LC++G++++A + +  +P  GC   + +YN L+     +   D   +L    +++ CEP+
Sbjct  396  LCQKGLIEQAIKLIELMPEYGCSVGIVTYNALVHGFCVQGRVDSALELF---NNLPCEPN  452

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            T TY   ++ LC   +L+ A  +L  M +K    N  T++ L+S FC++G ++ A++L++
Sbjct  453  TITYTTLLTGLCHAERLDAAAELLAGMIQKDCPLNAVTFNVLVSFFCQKGFVEEAMELVN  512


 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/294 (26%), Positives = 144/294 (49%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  E  + +LQ M + G  P+  LC  +I  +    + + A   +  +  +G  P+ 
Sbjct  292  CRGGMVERAIQVLQQMSQHGCTPNTTLCNIVINAICKQGRVDDAYDFLNNMGMYGCNPDT  351

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++YT ++ G C+  R E A  +L  M  +   P+ VT+N  I  +C +G +  A+K+++ 
Sbjct  352  ISYTTVLRGLCRAGRWEHAKELLPEMVRKNCPPNEVTFNTFICILCQKGLIEQAIKLIEL  411

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E   C   +VTY  L+    V+  +  A++L + +     EPN  TY  +L GLC   
Sbjct  412  MPE-YGCSVGIVTYNALVHGFCVQGRVDSALELFNNL---PCEPNTITYTTLLTGLCHAE  467

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A E +  +    C  +  ++N+L+     +   ++  +L+ +M   GC P+  T+N
Sbjct  468  RLDAAAELLAGMIQKDCPLNAVTFNVLVSFFCQKGFVEEAMELVNQMMEHGCTPNLITFN  527

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  + +D    +A+ +L  +  KG++ +  TY  ++    +E R + AI +L
Sbjct  528  TLLDGITKDCNSEEALELLHGLVSKGVSLDTITYSSVVDVLSREDRTEEAIQML  581


 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/287 (29%), Positives = 144/287 (50%), Gaps = 5/287 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C AG++E    LL  MV+    P+ V     I  L      E+A+K+++L+ ++G    +
Sbjct  362  CRAGRWEHAKELLPEMVRKNCPPNEVTFNTFICILCQKGLIEQAIKLIELMPEYGCSVGI  421

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y AL+ GFC   RV++A  + N +      P+ +TY  ++  +C   +L  A ++L  
Sbjct  422  VTYNALVHGFCVQGRVDSALELFNNLPCE---PNTITYTTLLTGLCHAERLDAAAELLAG  478

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +  +C  + VT+ VL+     K  + EAM+LV++M+  G  PN+ T+N +L G+ ++ 
Sbjct  479  MIQ-KDCPLNAVTFNVLVSFFCQKGFVEEAMELVNQMMEHGCTPNLITFNTLLDGITKDC  537

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A E +  L + G   D  +Y+ ++  L      ++  ++L  +  MG  P    YN
Sbjct  538  NSEEALELLHGLVSKGVSLDTITYSSVVDVLSREDRTEEAIQMLHAVQDMGMRPKVGMYN  597

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
              + +LC+  + ++AI     M   G  PN+ TY  LI     EG L
Sbjct  598  KILFALCKRCETDQAIDFFAYMVSNGCMPNESTYIILIEGLAHEGLL  644


 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 141/267 (53%), Gaps = 5/267 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVL  703
            C  G  E+ + L++ M + G    +V    L+ G     + + A+++   L    EPN +
Sbjct  397  CQKGLIEQAIKLIELMPEYGCSVGIVTYNALVHGFCVQGRVDSALELFNNLP--CEPNTI  454

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             YT L+ G C   R++AA  +L  M  +    + VT+N+++   C +G +  A+++++QM
Sbjct  455  TYTTLLTGLCHAERLDAAAELLAGMIQKDCPLNAVTFNVLVSFFCQKGFVEEAMELVNQM  514

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGIS-EAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
             E + C P+++T+  L++  I KD  S EA++L+  ++S+G+  +  TY++++  L RE 
Sbjct  515  ME-HGCTPNLITFNTLLDG-ITKDCNSEEALELLHGLVSKGVSLDTITYSSVVDVLSRED  572

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A + + ++  MG +P V  YN +L AL  R   D        M S GC P+  TY 
Sbjct  573  RTEEAIQMLHAVQDMGMRPKVGMYNKILFALCKRCETDQAIDFFAYMVSNGCMPNESTYI  632

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L  +G L +A  +L  +  KG+
Sbjct  633  ILIEGLAHEGLLKEARYVLSELYAKGV  659



>gb|EAY86332.1| hypothetical protein OsI_07707 [Oryza sativa Indica Group]
Length=584

 Score =   226 bits (577),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 115/291 (40%), Positives = 175/291 (60%), Gaps = 12/291 (4%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYT  694
            G+ +E L L    V    +PD   C  LIK L +  +  +A +V+        P+V+AY 
Sbjct  81   GELDEALRL----VGSARRPDAGTCAALIKKLSASGRTAEARRVLAACG----PDVMAYN  132

Query  693  ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
            A++ G+C   +V+AA         R    D  T + +I  +C RG+   AL VLD+M   
Sbjct  133  AMMAGYCGAGQVDAAR---RWCAERAVERDAYTCDTLIRGLCGRGRTANALAVLDEMLR-  188

Query  513  NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
              C PDVVTYT+L+EAT  + G  +AMKL+DEM  +G  P+I TYN ++ G+C+EG VD 
Sbjct  189  RRCVPDVVTYTILLEATCKRSGYKQAMKLLDEMRDKGCTPDIVTYNVVVNGICQEGRVDD  248

Query  333  AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVS  154
            A EF+++LP+ GC+P+  SYNI+L+ L     W+D E+L+ EM   GC P+  T+N+ +S
Sbjct  249  AIEFLKNLPSYGCEPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVTFNMLIS  308

Query  153  SLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             LCR G +  A+ +L+ + + G +PN  +Y+PL+ AFCK+ ++D A+  LD
Sbjct  309  FLCRKGLVEPALEVLEQIPKYGCSPNSLSYNPLLHAFCKQKKMDKAMAFLD  359


 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 158/298 (53%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L  +C    Y++ + LL  M   G  PD+V    ++ G+    + + A++ ++ L  +G 
Sbjct  202  LEATCKRSGYKQAMKLLDEMRDKGCTPDIVTYNVVVNGICQEGRVDDAIEFLKNLPSYGC  261

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            EPN ++Y  ++ G C   R E A  ++  M  +G  P+VVT+N++I  +C +G +  AL+
Sbjct  262  EPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVTFNMLISFLCRKGLVEPALE  321

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VL+Q+ +   C P+ ++Y  L+ A   +  + +AM  +D M+SRG  P+I +YN +L  L
Sbjct  322  VLEQIPK-YGCSPNSLSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYNTLLTAL  380

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            CR G VD A E +  L   GC P + SYN ++  L       +  +LL EM S G +P  
Sbjct  381  CRSGEVDVAVELLHQLKDKGCAPVLISYNTVIDGLTKAGKTKEALELLNEMVSKGLQPDI  440

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+   + LCR+ ++  AI     + + G+ PN   Y+ +I   CK      AIDL 
Sbjct  441  ITYSTIAAGLCREDRIEDAIRAFGKVQDMGIRPNTVLYNAIILGLCKRRETHSAIDLF  498


 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/295 (31%), Positives = 163/295 (55%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            CGAG+ +      ++  +   + D   C  LI+GL    +   A+ V+ ++L +   P+V
Sbjct  139  CGAGQVDAAR---RWCAERAVERDAYTCDTLIRGLCGRGRTANALAVLDEMLRRRCVPDV  195

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT L+   CK +  + A  +L+ MR +G  PD+VTYN+++  IC  G++  A++ L  
Sbjct  196  VTYTILLEATCKRSGYKQAMKLLDEMRDKGCTPDIVTYNVVVNGICQEGRVDDAIEFLKN  255

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C+P+ V+Y ++++     +   +A +L+ EM  +G  PN+ T+N ++  LCR+G
Sbjct  256  LPS-YGCEPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVTFNMLISFLCRKG  314

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            +V+ A E +  +P  GC P+  SYN LL A   ++  D     L  M S GC P   +YN
Sbjct  315  LVEPALEVLEQIPKYGCSPNSLSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYN  374

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LCR G+++ A+ +L  + +KG  P   +Y+ +I    K G+   A++LL+
Sbjct  375  TLLTALCRSGEVDVAVELLHQLKDKGCAPVLISYNTVIDGLTKAGKTKEALELLN  429


 Score =   160 bits (406),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 148/266 (56%), Gaps = 2/266 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++E+   L+  M + G  P+VV    LI  L      E A++V++ + ++G  PN 
Sbjct  276  CTAERWEDAEELMGEMGQKGCPPNVVTFNMLISFLCRKGLVEPALEVLEQIPKYGCSPNS  335

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L+Y  L+  FCK  +++ A   L+ M SRG +PD+V+YN ++ ++C  G++ +A+++L Q
Sbjct  336  LSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYNTLLTALCRSGEVDVAVELLHQ  395

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +K D  C P +++Y  +I+         EA++L++EM+S+GL+P+I TY+ I  GLCRE 
Sbjct  396  LK-DKGCAPVLISYNTVIDGLTKAGKTKEALELLNEMVSKGLQPDIITYSTIAAGLCRED  454

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             ++ A      +  MG +P+   YN ++  L  RR       L   M   GC P+  TY 
Sbjct  455  RIEDAIRAFGKVQDMGIRPNTVLYNAIILGLCKRRETHSAIDLFAYMIGNGCMPNESTYT  514

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKG  88
            I +  L  +G + +A  +L  +  +G
Sbjct  515  ILIEGLAYEGLIKEARDLLDELCSRG  540



>ref|XP_004952727.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Setaria italica]
Length=567

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/267 (40%), Positives = 168/267 (63%), Gaps = 8/267 (3%)
 Frame = -1

Query  801  CTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            C  LIK L +  +   A +V+        P+V+AY A++ G+C   +++AA  ++  M  
Sbjct  107  CAALIKKLCASGRTADARRVLSACV----PDVMAYNAMVAGYCGAGQLDAARRLVADMPV  162

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
                PD  TYN +I  +C RG+   AL VLD M     C PDVVTYT+L+EAT  + G  
Sbjct  163  E---PDAYTYNTLIRGLCGRGRTSNALGVLDDMLR-RGCVPDVVTYTILLEATCKRSGYK  218

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            +AMK++D+M ++G  P++ TYN ++ G+C+EG VD A EF+++LP+ GC+P+  SYNI+L
Sbjct  219  QAMKILDDMRAKGCAPDLVTYNVVVNGICQEGRVDDAMEFLKNLPSYGCEPNTVSYNIVL  278

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            + L     W+D E+L+ EM+  GC P+  T+N+ +S LCR G +  A+ +L+ + + G T
Sbjct  279  KGLFTAERWEDAEELMAEMAQKGCPPNVVTFNMLISFLCRRGLVEPAMEVLEQIPKYGCT  338

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
            PN  +Y+PL+  FCK+ ++D A+  +D
Sbjct  339  PNSLSYNPLLHVFCKQKKMDKAMAFVD  365


 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 163/295 (55%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNV  706
            CGAG+ +    L+  M     +PD      LI+GL    +   A+ V+  +L +   P+V
Sbjct  145  CGAGQLDAARRLVADM---PVEPDAYTYNTLIRGLCGRGRTSNALGVLDDMLRRGCVPDV  201

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT L+   CK +  + A  +L+ MR++G  PD+VTYN+++  IC  G++  A++ L  
Sbjct  202  VTYTILLEATCKRSGYKQAMKILDDMRAKGCAPDLVTYNVVVNGICQEGRVDDAMEFLKN  261

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C+P+ V+Y ++++     +   +A +L+ EM  +G  PN+ T+N ++  LCR G
Sbjct  262  LPS-YGCEPNTVSYNIVLKGLFTAERWEDAEELMAEMAQKGCPPNVVTFNMLISFLCRRG  320

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            +V+ A E +  +P  GC P+  SYN LL     ++  D     +  M S GC P   +YN
Sbjct  321  LVEPAMEVLEQIPKYGCTPNSLSYNPLLHVFCKQKKMDKAMAFVDLMVSRGCYPDIVSYN  380

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LCR+G+++ AI +L  + +KG +P   +Y+ +I    K G+   A++LL+
Sbjct  381  TLLTALCRNGEVDVAIDLLHQLKDKGCSPVLISYNTVIDGLTKAGKTKEALELLN  435


 Score =   164 bits (414),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/298 (31%), Positives = 157/298 (53%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L  +C    Y++ + +L  M   G  PD+V    ++ G+    + + A++ ++ L  +G 
Sbjct  208  LEATCKRSGYKQAMKILDDMRAKGCAPDLVTYNVVVNGICQEGRVDDAMEFLKNLPSYGC  267

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            EPN ++Y  ++ G     R E A  ++  M  +G  P+VVT+N++I  +C RG +  A++
Sbjct  268  EPNTVSYNIVLKGLFTAERWEDAEELMAEMAQKGCPPNVVTFNMLISFLCRRGLVEPAME  327

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VL+Q+ +   C P+ ++Y  L+     +  + +AM  VD M+SRG  P+I +YN +L  L
Sbjct  328  VLEQIPK-YGCTPNSLSYNPLLHVFCKQKKMDKAMAFVDLMVSRGCYPDIVSYNTLLTAL  386

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            CR G VD A + +  L   GC P + SYN ++  L       +  +LL EM   G +P  
Sbjct  387  CRNGEVDVAIDLLHQLKDKGCSPVLISYNTVIDGLTKAGKTKEALELLNEMIGKGLQPDI  446

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+   S LCR+ ++ +AI+    + + G+ PN   Y+ ++   CK      AI+L 
Sbjct  447  ITYSTIASGLCREDRIEEAITTFCKVQDMGIRPNAVLYNAILLGLCKRRETYNAINLF  504


 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/270 (32%), Positives = 149/270 (55%), Gaps = 2/270 (1%)
 Frame = -1

Query  876  AGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLA  700
            A ++E+   L+  M + G  P+VV    LI  L      E A++V++ + ++G  PN L+
Sbjct  284  AERWEDAEELMAEMAQKGCPPNVVTFNMLISFLCRRGLVEPAMEVLEQIPKYGCTPNSLS  343

Query  699  YTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMK  520
            Y  L+  FCK  +++ A   ++ M SRG +PD+V+YN ++ ++C  G++ +A+ +L Q+K
Sbjct  344  YNPLLHVFCKQKKMDKAMAFVDLMVSRGCYPDIVSYNTLLTALCRNGEVDVAIDLLHQLK  403

Query  519  EDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMV  340
             D  C P +++Y  +I+         EA++L++EM+ +GL+P+I TY+ I  GLCRE  +
Sbjct  404  -DKGCSPVLISYNTVIDGLTKAGKTKEALELLNEMIGKGLQPDIITYSTIASGLCREDRI  462

Query  339  DRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIF  160
            + A      +  MG +P+   YN +L  L  RR   +   L   M S GC P+  TY I 
Sbjct  463  EEAITTFCKVQDMGIRPNAVLYNAILLGLCKRRETYNAINLFSYMISNGCMPNESTYTIL  522

Query  159  VSSLCRDGKLNKAISMLKIMTEKGLTPNKF  70
            +  L  +G   +A  +L  +  +G+   KF
Sbjct  523  IEGLAYEGLAKEARELLGELCSRGVVNKKF  552


 Score =   137 bits (346),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 145/298 (49%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            +N  C  G+ ++ +  L+ +   G +P+ V    ++KGLF+ ++ E A ++M  + Q G 
Sbjct  243  VNGICQEGRVDDAMEFLKNLPSYGCEPNTVSYNIVLKGLFTAERWEDAEELMAEMAQKGC  302

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PNV+ +  LI   C+   VE A  VL ++   G  P+ ++YN ++   C + K+  A+ 
Sbjct  303  PPNVVTFNMLISFLCRRGLVEPAMEVLEQIPKYGCTPNSLSYNPLLHVFCKQKKMDKAMA  362

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
             +D M     C PD+V+Y  L+ A      +  A+ L+ ++  +G  P + +YN ++ GL
Sbjct  363  FVDLMVS-RGCYPDIVSYNTLLTALCRNGEVDVAIDLLHQLKDKGCSPVLISYNTVIDGL  421

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
             + G    A E +  +   G +PD+ +Y+ +   L      ++      ++  MG  P+ 
Sbjct  422  TKAGKTKEALELLNEMIGKGLQPDIITYSTIASGLCREDRIEEAITTFCKVQDMGIRPNA  481

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              YN  +  LC+  +   AI++   M   G  PN+ TY  LI     EG    A +LL
Sbjct  482  VLYNAILLGLCKRRETYNAINLFSYMISNGCMPNESTYTILIEGLAYEGLAKEARELL  539



>gb|EAZ23484.1| hypothetical protein OsJ_07180 [Oryza sativa Japonica Group]
Length=457

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 154/235 (66%), Gaps = 4/235 (2%)
 Frame = -1

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            +AY A++ G+C   +++AA  ++  M      PD  TYN +I  +C RG+   AL VLD+
Sbjct  1    MAYNAMVAGYCGAGQLDAARRLVAEMPVE---PDAYTYNTLIRGLCGRGRTANALAVLDE  57

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M     C PDVVTYT+L+EAT  + G  +AMKL+DEM  +G  P+I TYN ++ G+C+EG
Sbjct  58   MLR-RRCVPDVVTYTILLEATCKRSGYKQAMKLLDEMRDKGCTPDIVTYNVVVNGICQEG  116

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A EF+++LP+ GC+P+  SYNI+L+ L     W+D E+L+ EM   GC P+  T+N
Sbjct  117  RVDDAIEFLKNLPSYGCEPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVTFN  176

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + +S LCR G +  A+ +L+ + + G TPN  +Y+PL+ AFCK+ ++D A+  LD
Sbjct  177  MLISFLCRKGLVEPALEVLEQIPKYGCTPNSLSYNPLLHAFCKQKKMDKAMAFLD  231


 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 163/295 (55%), Gaps = 5/295 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            CGAG+ +    L+  M     +PD      LI+GL    +   A+ V+ ++L +   P+V
Sbjct  11   CGAGQLDAARRLVAEM---PVEPDAYTYNTLIRGLCGRGRTANALAVLDEMLRRRCVPDV  67

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + YT L+   CK +  + A  +L+ MR +G  PD+VTYN+++  IC  G++  A++ L  
Sbjct  68   VTYTILLEATCKRSGYKQAMKLLDEMRDKGCTPDIVTYNVVVNGICQEGRVDDAIEFLKN  127

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C+P+ V+Y ++++     +   +A +L+ EM  +G  PN+ T+N ++  LCR+G
Sbjct  128  LPS-YGCEPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVTFNMLISFLCRKG  186

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            +V+ A E +  +P  GC P+  SYN LL A   ++  D     L  M S GC P   +YN
Sbjct  187  LVEPALEVLEQIPKYGCTPNSLSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYN  246

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              +++LCR G+++ A+ +L  + +KG  P   +Y+ +I    K G+   A++LL+
Sbjct  247  TLLTALCRSGEVDVAVELLHQLKDKGCAPVLISYNTVIDGLTKAGKTKEALELLN  301


 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 158/298 (53%), Gaps = 2/298 (1%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L  +C    Y++ + LL  M   G  PD+V    ++ G+    + + A++ ++ L  +G 
Sbjct  74   LEATCKRSGYKQAMKLLDEMRDKGCTPDIVTYNVVVNGICQEGRVDDAIEFLKNLPSYGC  133

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            EPN ++Y  ++ G C   R E A  ++  M  +G  P+VVT+N++I  +C +G +  AL+
Sbjct  134  EPNTVSYNIVLKGLCTAERWEDAEELMGEMGQKGCPPNVVTFNMLISFLCRKGLVEPALE  193

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            VL+Q+ +   C P+ ++Y  L+ A   +  + +AM  +D M+SRG  P+I +YN +L  L
Sbjct  194  VLEQIPK-YGCTPNSLSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYNTLLTAL  252

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            CR G VD A E +  L   GC P + SYN ++  L       +  +LL EM S G +P  
Sbjct  253  CRSGEVDVAVELLHQLKDKGCAPVLISYNTVIDGLTKAGKTKEALELLNEMVSKGLQPDI  312

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+   + LCR+ ++  AI     + + G+ PN   Y+ +I   CK      AIDL 
Sbjct  313  ITYSTIAAGLCREDRIEDAIRAFGKVQDMGIRPNTVLYNAIILGLCKRRETHSAIDLF  370


 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/268 (29%), Positives = 132/268 (49%), Gaps = 37/268 (14%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++E+   L+  M + G  P+VV    LI  L      E A++V++ + ++G  PN 
Sbjct  148  CTAERWEDAEELMGEMGQKGCPPNVVTFNMLISFLCRKGLVEPALEVLEQIPKYGCTPNS  207

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L+Y  L+  FCK  +++ A   L+ M SRG +PD+V+YN ++ ++C  G++ +A+++L Q
Sbjct  208  LSYNPLLHAFCKQKKMDKAMAFLDLMVSRGCYPDIVSYNTLLTALCRSGEVDVAVELLHQ  267

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTY-----------  379
            +K D  C P +++Y  +I+         EA++L++EM+S+GL+P+I TY           
Sbjct  268  LK-DKGCAPVLISYNTVIDGLTKAGKTKEALELLNEMVSKGLQPDIITYSTIAAGLCRED  326

Query  378  ------------------------NAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
                                    NAI+ GLC+      A +    +   GC P+  +Y 
Sbjct  327  RIEDAIRAFGKVQDMGIRPNTVLYNAIILGLCKRRETHSAIDLFAYMIGNGCMPNESTYT  386

Query  270  ILLRALLDRRNWDDGEKLLKEMSSMGCE  187
            IL+  L       +   LL E+ S   E
Sbjct  387  ILIEGLAYEGLIKEARDLLDELCSRAGE  414



>ref|XP_007222300.1| hypothetical protein PRUPE_ppa003362mg [Prunus persica]
 gb|EMJ23499.1| hypothetical protein PRUPE_ppa003362mg [Prunus persica]
Length=581

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 133/397 (34%), Positives = 209/397 (53%), Gaps = 60/397 (15%)
 Frame = -1

Query  1023  VKCKKHEFRERNLKN--LQSVKVSTENRNALIQLLDS---------------KEIDIRRR  895
             ++C+ H+  +++ +   L + KV T + NA +Q +++               +E +   +
Sbjct  64    IQCRIHDGYQKHRRKPVLVASKVETLSSNARLQNVENTPHGSLNKMDSSNGFEEFESNNQ  123

Query  894   LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE  715
             L R    G+ EE    L+ MV  G  PD + CT LI+G     K  KA ++M +LE+ G 
Sbjct  124   LRRLVRNGELEEGFKFLETMVFRGDIPDNIACTSLIRGFCKSGKTRKATRIMNILEESGA  183

Query  714   P-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
               +V+ Y  LI G+CK   ++ A  VL+RM      PDVVTYN ++ ++CD GKL  A++
Sbjct  184   ILDVITYNVLISGYCKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDSGKLTQAME  240

Query  537   VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG-  361
             VLD+  +   C PDV+TYT+LIEAT  + G+ +AMKL+DEM S+G +P++ TYN ++ G 
Sbjct  241   VLDRQLQ-RECYPDVITYTILIEATCKEYGVEQAMKLLDEMRSKGCKPDVVTYNVLINGI  299

Query  360   -------------------------------------LCREGMVDRAYEFVRSLPAMGCK  292
                                                  LCR+G++ RA + +  +P  GC 
Sbjct  300   CKEGSTGRWMDAEKLLADMVHRGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCT  359

Query  291   PDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISM  112
             P+  SYN LL      +  D   + L  M S GC P   TYN  +++LC+DGK++ A+ +
Sbjct  360   PNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDNAVGI  419

Query  111   LKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             L  ++ KG +P   TY+ +I    K G+ + AI+LLD
Sbjct  420   LNQLSSKGCSPVLITYNTVIDGLSKVGKTERAIELLD  456


 Score =   187 bits (475),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 163/297 (55%), Gaps = 8/297 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C AG+ +  L +L  M      PDVV    +++ L    K  +A++V+ + L++   P+V
Sbjct  198  CKAGEIDNALRVLDRM---SVSPDVVTYNTILRTLCDSGKLTQAMEVLDRQLQRECYPDV  254

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGL---ALKV  535
            + YT LI   CK   VE A  +L+ MRS+G  PDVVTYN++I  IC  G  G    A K+
Sbjct  255  ITYTILIEATCKEYGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGSTGRWMDAEKL  314

Query  534  LDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLC  355
            L  M     C P VVT+ +LI     K  +  A+ ++++M   G  PN  +YN +L G C
Sbjct  315  LADMVH-RGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFC  373

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            +E  +DRA E++  + + GC PD+ +YN LL AL      D+   +L ++SS GC P   
Sbjct  374  KEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDNAVGILNQLSSKGCSPVLI  433

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            TYN  +  L + GK  +AI +L  M +KGL P+  TY  L+    +EG++D AI  +
Sbjct  434  TYNTVIDGLSKVGKTERAIELLDEMRKKGLKPDIITYSSLVGGLSREGKVDEAIKFV  490


 Score =   170 bits (430),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 97/297 (33%), Positives = 161/297 (54%), Gaps = 5/297 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C +GK  + + +L   ++    PDV+  T LI+        E+A+K++  +   G +P+V
Sbjct  230  CDSGKLTQAMEVLDRQLQRECYPDVITYTILIEATCKEYGVEQAMKLLDEMRSKGCKPDV  289

Query  705  LAYTALIGGFCK---TNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKV  535
            + Y  LI G CK   T R   A  +L  M  RG  P VVT+NI+I  +C +G LG A+ +
Sbjct  290  VTYNVLINGICKEGSTGRWMDAEKLLADMVHRGCSPSVVTFNILINFLCRKGLLGRAIDI  349

Query  534  LDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLC  355
            L++M + + C P+ ++Y  L+     +  +  A++ +D M+SRG  P+I TYN +L  LC
Sbjct  350  LEKMPK-HGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALC  408

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            ++G VD A   +  L + GC P + +YN ++  L      +   +LL EM   G +P   
Sbjct  409  KDGKVDNAVGILNQLSSKGCSPVLITYNTVIDGLSKVGKTERAIELLDEMRKKGLKPDII  468

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            TY+  V  L R+GK+++AI  +  + + G+ PN  T++ ++   CK  +   AID L
Sbjct  469  TYSSLVGGLSREGKVDEAIKFVHDLEDSGIKPNAITFNSVMLGLCKAKQTGRAIDFL  525


 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 149/266 (56%), Gaps = 4/266 (2%)
 Frame = -1

Query  876  AGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLA  700
             G++ +   LL  MV  G  P VV    LI  L       +A+ +++ + + G  PN L+
Sbjct  305  TGRWMDAEKLLADMVHRGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLS  364

Query  699  YTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMK  520
            Y  L+ GFCK  +++ A   L+ M SRG +PD+VTYN ++ ++C  GK+  A+ +L+Q+ 
Sbjct  365  YNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLTALCKDGKVDNAVGILNQL-  423

Query  519  EDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCREGM  343
                C P ++TY  +I+  + K G +E A++L+DEM  +GL+P+I TY++++ GL REG 
Sbjct  424  SSKGCSPVLITYNTVIDG-LSKVGKTERAIELLDEMRKKGLKPDIITYSSLVGGLSREGK  482

Query  342  VDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNI  163
            VD A +FV  L   G KP+  ++N ++  L   +        L  M S GC+P   TY I
Sbjct  483  VDEAIKFVHDLEDSGIKPNAITFNSVMLGLCKAKQTGRAIDFLAYMVSKGCKPTEATYTI  542

Query  162  FVSSLCRDGKLNKAISMLKIMTEKGL  85
             +  +  +G   +A+ +L  +  +G+
Sbjct  543  LIEGIAYEGLAKEALELLNELCCRGV  568



>ref|XP_002986246.1| hypothetical protein SELMODRAFT_123660 [Selaginella moellendorffii]
 gb|EFJ12777.1| hypothetical protein SELMODRAFT_123660 [Selaginella moellendorffii]
Length=725

 Score =   224 bits (570),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 179/298 (60%), Gaps = 1/298 (0%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-  718
            L+  C A + E  L+LL+ MV  G  PDVV  T +I GL  + + ++A +VM  + Q G 
Sbjct  86   LHGFCKANRVENALWLLEQMVMRGCPPDVVSYTTVINGLCKLDQVDEACRVMDKMIQRGC  145

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
            +PNV+ Y  L+ GFC+   ++ A  ++ +M  RG+ P+ +TYN ++  +C   KL  AL+
Sbjct  146  QPNVITYGTLVDGFCRVGDLDGAVELVRKMTERGYRPNAITYNNIMHGLCSGRKLDSALQ  205

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +  +M+E  +C PDV TY+ ++++ +    + +A +LV+ M+S+G  PN+ TY+++L GL
Sbjct  206  LFKEMEESGSCPPDVFTYSTIVDSLVKSGKVDDACRLVEAMVSKGCSPNVVTYSSLLHGL  265

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C+ G +D A   ++ +   GC P++ +YN ++         D+   LL+EM   GC+P+ 
Sbjct  266  CKAGKLDEATALLQRMTRSGCSPNIVTYNTIIDGHCKLGRIDEAYHLLEEMVDGGCQPNV  325

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY + + + C+ GK   AI ++++M EKG  PN FTY+ L+  FCK+  ++ A  LL
Sbjct  326  VTYTVLLDAFCKCGKAEDAIGLVEVMVEKGYVPNLFTYNSLLDMFCKKDEVERACQLL  383


 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 169/296 (57%), Gaps = 4/296 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C AG+  + +   + M K    PD V    +I GL    + + A+++++ +   G  PNV
Sbjct  21   CDAGQCSDAVLHFREMSKT-CPPDSVTYNTMINGLSKSDRLDDAIRLLEEMVDNGFAPNV  79

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  ++ GFCK NRVE A  +L +M  RG  PDVV+Y  +I  +C   ++  A +V+D+
Sbjct  80   FSYNTVLHGFCKANRVENALWLLEQMVMRGCPPDVVSYTTVINGLCKLDQVDEACRVMDK  139

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +   C+P+V+TY  L++       +  A++LV +M  RG  PN  TYN I+ GLC   
Sbjct  140  MIQ-RGCQPNVITYGTLVDGFCRVGDLDGAVELVRKMTERGYRPNAITYNNIMHGLCSGR  198

Query  345  MVDRAYEFVRSLPAMG-CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
             +D A +  + +   G C PDVF+Y+ ++ +L+     DD  +L++ M S GC P+  TY
Sbjct  199  KLDSALQLFKEMEESGSCPPDVFTYSTIVDSLVKSGKVDDACRLVEAMVSKGCSPNVVTY  258

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +  +  LC+ GKL++A ++L+ MT  G +PN  TY+ +I   CK GR+D A  LL+
Sbjct  259  SSLLHGLCKAGKLDEATALLQRMTRSGCSPNIVTYNTIIDGHCKLGRIDEAYHLLE  314


 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 164/295 (56%), Gaps = 3/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGY-KPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPN  709
            C   K +  L L + M + G   PDV   + ++  L    K + A ++++ +   G  PN
Sbjct  195  CSGRKLDSALQLFKEMEESGSCPPDVFTYSTIVDSLVKSGKVDDACRLVEAMVSKGCSPN  254

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V+ Y++L+ G CK  +++ A  +L RM   G  P++VTYN +I   C  G++  A  +L+
Sbjct  255  VVTYSSLLHGLCKAGKLDEATALLQRMTRSGCSPNIVTYNTIIDGHCKLGRIDEAYHLLE  314

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M  D  C+P+VVTYTVL++A        +A+ LV+ M+ +G  PN++TYN++L   C++
Sbjct  315  EMV-DGGCQPNVVTYTVLLDAFCKCGKAEDAIGLVEVMVEKGYVPNLFTYNSLLDMFCKK  373

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
              V+RA + + S+   GC P+V SYN ++  L       +G  LL++M S  C P   T+
Sbjct  374  DEVERACQLLSSMIQKGCVPNVVSYNTVIAGLCKATKVHEGVLLLEQMLSNNCVPDIVTF  433

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            N  + ++C+  +++ A  +  ++ E G TPN  TY+ L+   CK  R D A  LL
Sbjct  434  NTIIDAMCKTYRVDIAYELFNLIQESGCTPNLVTYNSLVHGLCKSRRFDQAEYLL  488


 Score =   179 bits (455),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 150/279 (54%), Gaps = 2/279 (1%)
 Frame = -1

Query  837  MVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVLAYTALIGGFCKTNRV  658
            M + G K    +   +++GL    +   AV   + + +   P+ + Y  +I G  K++R+
Sbjct  1    MNRKGLKAHAGVHKSILRGLCDAGQCSDAVLHFREMSKTCPPDSVTYNTMINGLSKSDRL  60

Query  657  EAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTV  478
            + A  +L  M   GF P+V +YN ++   C   ++  AL +L+QM     C PDVV+YT 
Sbjct  61   DDAIRLLEEMVDNGFAPNVFSYNTVLHGFCKANRVENALWLLEQMVM-RGCPPDVVSYTT  119

Query  477  LIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMG  298
            +I      D + EA +++D+M+ RG +PN+ TY  ++ G CR G +D A E VR +   G
Sbjct  120  VINGLCKLDQVDEACRVMDKMIQRGCQPNVITYGTLVDGFCRVGDLDGAVELVRKMTERG  179

Query  297  CKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMG-CEPHTFTYNIFVSSLCRDGKLNKA  121
             +P+  +YN ++  L   R  D   +L KEM   G C P  FTY+  V SL + GK++ A
Sbjct  180  YRPNAITYNNIMHGLCSGRKLDSALQLFKEMEESGSCPPDVFTYSTIVDSLVKSGKVDDA  239

Query  120  ISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +++ M  KG +PN  TY  L+   CK G+LD A  LL
Sbjct  240  CRLVEAMVSKGCSPNVVTYSSLLHGLCKAGKLDEATALL  278


 Score =   167 bits (424),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 165/329 (50%), Gaps = 38/329 (12%)
 Frame = -1

Query  876  AGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLA  700
            +GK ++   L++ MV  G  P+VV  + L+ GL    K ++A  ++Q + + G  PN++ 
Sbjct  233  SGKVDDACRLVEAMVSKGCSPNVVTYSSLLHGLCKAGKLDEATALLQRMTRSGCSPNIVT  292

Query  699  YTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMK  520
            Y  +I G CK  R++ A  +L  M   G  P+VVTY +++ + C  GK   A+ +++ M 
Sbjct  293  YNTIIDGHCKLGRIDEAYHLLEEMVDGGCQPNVVTYTVLLDAFCKCGKAEDAIGLVEVMV  352

Query  519  EDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCR----  352
            E     P++ TY  L++    KD +  A +L+  M+ +G  PN+ +YN ++ GLC+    
Sbjct  353  EKGYV-PNLFTYNSLLDMFCKKDEVERACQLLSSMIQKGCVPNVVSYNTVIAGLCKATKV  411

Query  351  -EGM------------------------------VDRAYEFVRSLPAMGCKPDVFSYNIL  265
             EG+                              VD AYE    +   GC P++ +YN L
Sbjct  412  HEGVLLLEQMLSNNCVPDIVTFNTIIDAMCKTYRVDIAYELFNLIQESGCTPNLVTYNSL  471

Query  264  LRALLDRRNWDDGEKLLKEMS-SMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
            +  L   R +D  E LL+EM+   GC P   TYN  +  LC+  ++++A  +   M   G
Sbjct  472  VHGLCKSRRFDQAEYLLREMTRKQGCSPDIITYNTVIDGLCKSKRVDRAYKLFLQMLSDG  531

Query  87   LTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            L P+  TY  +IS+ CK   +D A ++L+
Sbjct  532  LAPDDVTYSIVISSLCKWRFMDEANNVLE  560


 Score =   167 bits (423),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/296 (29%), Positives = 161/296 (54%), Gaps = 3/296 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE--PN  709
            C  G  +  + L++ M + GY+P+ +    ++ GL S +K + A+++ + +E+ G   P+
Sbjct  160  CRVGDLDGAVELVRKMTERGYRPNAITYNNIMHGLCSGRKLDSALQLFKEMEESGSCPPD  219

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            V  Y+ ++    K+ +V+ A  ++  M S+G  P+VVTY+ ++  +C  GKL  A  +L 
Sbjct  220  VFTYSTIVDSLVKSGKVDDACRLVEAMVSKGCSPNVVTYSSLLHGLCKAGKLDEATALLQ  279

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +M   + C P++VTY  +I+       I EA  L++EM+  G +PN+ TY  +L   C+ 
Sbjct  280  RMTR-SGCSPNIVTYNTIIDGHCKLGRIDEAYHLLEEMVDGGCQPNVVTYTVLLDAFCKC  338

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G  + A   V  +   G  P++F+YN LL     +   +   +LL  M   GC P+  +Y
Sbjct  339  GKAEDAIGLVEVMVEKGYVPNLFTYNSLLDMFCKKDEVERACQLLSSMIQKGCVPNVVSY  398

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            N  ++ LC+  K+++ + +L+ M      P+  T++ +I A CK  R+D+A +L +
Sbjct  399  NTVIAGLCKATKVHEGVLLLEQMLSNNCVPDIVTFNTIIDAMCKTYRVDIAYELFN  454


 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/299 (29%), Positives = 149/299 (50%), Gaps = 1/299 (0%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            L+  C   + E    LL  M++ G  P+VV    +I GL    K  + V ++ Q+L    
Sbjct  367  LDMFCKKDEVERACQLLSSMIQKGCVPNVVSYNTVIAGLCKATKVHEGVLLLEQMLSNNC  426

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             P+++ +  +I   CKT RV+ A  + N ++  G  P++VTYN ++  +C   +   A  
Sbjct  427  VPDIVTFNTIIDAMCKTYRVDIAYELFNLIQESGCTPNLVTYNSLVHGLCKSRRFDQAEY  486

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L +M     C PD++TY  +I+       +  A KL  +MLS GL P+  TY+ ++  L
Sbjct  487  LLREMTRKQGCSPDIITYNTVIDGLCKSKRVDRAYKLFLQMLSDGLAPDDVTYSIVISSL  546

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C+   +D A   +  +   G  P   +Y  L+       N D   ++L+ + S G  P  
Sbjct  547  CKWRFMDEANNVLELMLKNGFDPGAITYGTLIDGFCKTGNLDKALEILQLLLSKGSYPDV  606

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             T++IF+  L + G+L +A  +L+ M   GL P+  TY+ L+  FC   R + A+DL +
Sbjct  607  VTFSIFIDWLSKRGRLRQAGELLETMLRAGLVPDTVTYNTLLKGFCDASRTEDAVDLFE  665


 Score =   150 bits (379),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 144/279 (52%), Gaps = 3/279 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A K  E + LL+ M+     PD+V    +I  +    + + A ++  L+++ G  PN+
Sbjct  406  CKATKVHEGVLLLEQMLSNNCVPDIVTFNTIIDAMCKTYRVDIAYELFNLIQESGCTPNL  465

Query  705  LAYTALIGGFCKTNRVEAANGVLNRM-RSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
            + Y +L+ G CK+ R + A  +L  M R +G  PD++TYN +I  +C   ++  A K+  
Sbjct  466  VTYNSLVHGLCKSRRFDQAEYLLREMTRKQGCSPDIITYNTVIDGLCKSKRVDRAYKLFL  525

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            QM  D    PD VTY+++I +      + EA  +++ ML  G +P   TY  ++ G C+ 
Sbjct  526  QMLSDG-LAPDDVTYSIVISSLCKWRFMDEANNVLELMLKNGFDPGAITYGTLIDGFCKT  584

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G +D+A E ++ L + G  PDV +++I +  L  R       +LL+ M   G  P T TY
Sbjct  585  GNLDKALEILQLLLSKGSYPDVVTFSIFIDWLSKRGRLRQAGELLETMLRAGLVPDTVTY  644

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLI  52
            N  +   C   +   A+ + ++M + G  P+  TY  L+
Sbjct  645  NTLLKGFCDASRTEDAVDLFEVMRQCGCEPDNATYTTLV  683


 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 124/229 (54%), Gaps = 6/229 (3%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMV-KIGYKPDVVLCTKLIKGLFSVKKAEKAVKV-MQLLEQFGEPN  709
            C + ++++  YLL+ M  K G  PD++    +I GL   K+ ++A K+ +Q+L     P+
Sbjct  476  CKSRRFDQAEYLLREMTRKQGCSPDIITYNTVIDGLCKSKRVDRAYKLFLQMLSDGLAPD  535

Query  708  VLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLD  529
             + Y+ +I   CK   ++ AN VL  M   GF P  +TY  +I   C  G L  AL++L 
Sbjct  536  DVTYSIVISSLCKWRFMDEANNVLELMLKNGFDPGAITYGTLIDGFCKTGNLDKALEIL-  594

Query  528  QMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            Q+       PDVVT+++ I+    +  + +A +L++ ML  GL P+  TYN +LKG C  
Sbjct  595  QLLLSKGSYPDVVTFSIFIDWLSKRGRLRQAGELLETMLRAGLVPDTVTYNTLLKGFCDA  654

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMS  202
               + A +    +   GC+PD  +Y  L+  L+D++++ D   LL E+S
Sbjct  655  SRTEDAVDLFEVMRQCGCEPDNATYTTLVGHLVDKKSYKD---LLAEVS  700


 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 79/160 (49%), Gaps = 3/160 (2%)
 Frame = -1

Query  864  EETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTAL  688
            +E   +L+ M+K G+ P  +    LI G       +KA++++QLL   G  P+V+ ++  
Sbjct  553  DEANNVLELMLKNGFDPGAITYGTLIDGFCKTGNLDKALEILQLLLSKGSYPDVVTFSIF  612

Query  687  IGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNN  508
            I    K  R+  A  +L  M   G  PD VTYN ++   CD  +   A+ + + M++   
Sbjct  613  IDWLSKRGRLRQAGELLETMLRAGLVPDTVTYNTLLKGFCDASRTEDAVDLFEVMRQ-CG  671

Query  507  CKPDVVTYTVLIEATIVKDGISEAMKLVDE-MLSRGLEPN  391
            C+PD  TYT L+   + K    + +  V + M+  G + N
Sbjct  672  CEPDNATYTTLVGHLVDKKSYKDLLAEVSKSMVDTGFKLN  711



>ref|XP_002456450.1| hypothetical protein SORBIDRAFT_03g036550 [Sorghum bicolor]
 gb|EES01570.1| hypothetical protein SORBIDRAFT_03g036550 [Sorghum bicolor]
Length=669

 Score =   220 bits (561),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 163/276 (59%), Gaps = 5/276 (2%)
 Frame = -1

Query  825  GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAA  649
            G  PDV LCTKLI+ L    +   A +V++  E  G P +V AY  L+ G+C+   ++AA
Sbjct  71   GEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAEGSGSPVDVFAYNTLVAGYCRYGHLDAA  130

Query  648  NGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIE  469
              ++  M      PD  TY  +I  +CDRG++  AL +LD M     C+P+VVTYTVL+E
Sbjct  131  RRLIGSMP---VAPDAYTYTPLIRVLCDRGRVADALSLLDDMLR-RGCQPNVVTYTVLLE  186

Query  468  ATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKP  289
            A     G  +AM ++DEM ++G  PNI TYN I+ G+CREG VD A E +  LP+ G +P
Sbjct  187  AMCRNSGFEQAMAVLDEMRAKGCTPNIVTYNVIINGMCREGRVDDARELLNRLPSYGFQP  246

Query  288  DVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISML  109
            D  SY  LL+ L   + WDD E+L  EM    C P+  T+++ +   CR G + +AI +L
Sbjct  247  DTVSYTTLLKGLCASKRWDDVEELFAEMMEKNCMPNEVTFDMLIRFFCRGGMVERAIQVL  306

Query  108  KIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + MTE G   N    + +I++ CK+GR+D A  LL+
Sbjct  307  EQMTEHGCATNTTLCNIVINSICKQGRVDDAFKLLN  342


 Score =   185 bits (470),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/294 (32%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  + L LL  M++ G +P+VV  T L++ +      E+A+ V+  +   G  PN+
Sbjct  154  CDRGRVADALSLLDDMLRRGCQPNVVTYTVLLEAMCRNSGFEQAMAVLDEMRAKGCTPNI  213

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  +I G C+  RV+ A  +LNR+ S GF PD V+Y  ++  +C   +     ++  +
Sbjct  214  VTYNVIINGMCREGRVDDARELLNRLPSYGFQPDTVSYTTLLKGLCASKRWDDVEELFAE  273

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E  NC P+ VT+ +LI        +  A++++++M   G   N    N ++  +C++G
Sbjct  274  MME-KNCMPNEVTFDMLIRFFCRGGMVERAIQVLEQMTEHGCATNTTLCNIVINSICKQG  332

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A++ +  + + GC PD  SY  +L+ L     WDD ++LL EM    C P+  T+N
Sbjct  333  RVDDAFKLLNDMGSYGCNPDTISYTTVLKGLCRAERWDDAKELLNEMVRNNCPPNEVTFN  392

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             F+  LC+ G + +AI +++ M+E G T    TY+ L++ FC +G +D A++L 
Sbjct  393  TFICILCQKGLIEQAIMLIEQMSEHGCTVGVVTYNALVNGFCVQGHIDSALELF  446


 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/299 (30%), Positives = 161/299 (54%), Gaps = 5/299 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++   LL  +   G++PD V  T L+KGL + K+ +   ++  +++E+  
Sbjct  220  INGMCREGRVDDARELLNRLPSYGFQPDTVSYTTLLKGLCASKRWDDVEELFAEMMEKNC  279

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +  LI  FC+   VE A  VL +M   G   +    NI+I SIC +G++  A K
Sbjct  280  MPNEVTFDMLIRFFCRGGMVERAIQVLEQMTEHGCATNTTLCNIVINSICKQGRVDDAFK  339

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +L+ M     C PD ++YT +++     +   +A +L++EM+     PN  T+N  +  L
Sbjct  340  LLNDMGS-YGCNPDTISYTTVLKGLCRAERWDDAKELLNEMVRNNCPPNEVTFNTFICIL  398

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G++++A   +  +   GC   V +YN L+     + + D   +L +   SM C+P+T
Sbjct  399  CQKGLIEQAIMLIEQMSEHGCTVGVVTYNALVNGFCVQGHIDSALELFR---SMPCKPNT  455

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             TY   ++ LC   +L+ A  ++  M      PN  T++ L+S FC++G L+ AI+L++
Sbjct  456  ITYTTLLTGLCNAERLDGAAELVAEMLRGDCPPNVVTFNVLVSFFCQKGFLEEAIELVE  514


 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/298 (27%), Positives = 149/298 (50%), Gaps = 5/298 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++   LL  M   G  PD +  T ++KGL   ++ + A +++ +++    
Sbjct  325  INSICKQGRVDDAFKLLNDMGSYGCNPDTISYTTVLKGLCRAERWDDAKELLNEMVRNNC  384

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +   I   C+   +E A  ++ +M   G    VVTYN ++   C +G +  AL+
Sbjct  385  PPNEVTFNTFICILCQKGLIEQAIMLIEQMSEHGCTVGVVTYNALVNGFCVQGHIDSALE  444

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +   M     CKP+ +TYT L+      + +  A +LV EML     PN+ T+N ++   
Sbjct  445  LFRSMP----CKPNTITYTTLLTGLCNAERLDGAAELVAEMLRGDCPPNVVTFNVLVSFF  500

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G ++ A E V  +   GC P++ +YN LL  +    + +D  +LL  + S G  P  
Sbjct  501  CQKGFLEEAIELVEQMMEHGCTPNLITYNTLLDGITKDCSSEDALELLHGLVSKGVSPDV  560

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             T++  +  L ++ ++ +A+ +  ++ + G+ P    Y+ ++   CK   +D AID  
Sbjct  561  ITFSSIIGILSKEDRIEEAVQLFHVVQDIGMRPKAVVYNKILLGLCKRCEIDNAIDFF  618


 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/294 (29%), Positives = 147/294 (50%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++++   LL  MV+    P+ V     I  L      E+A+ +++ + + G    V
Sbjct  364  CRAERWDDAKELLNEMVRNNCPPNEVTFNTFICILCQKGLIEQAIMLIEQMSEHGCTVGV  423

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y AL+ GFC    +++A   L   RS    P+ +TY  ++  +C+  +L  A +++ +
Sbjct  424  VTYNALVNGFCVQGHIDSA---LELFRSMPCKPNTITYTTLLTGLCNAERLDGAAELVAE  480

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M    +C P+VVT+ VL+     K  + EA++LV++M+  G  PN+ TYN +L G+ ++ 
Sbjct  481  MLR-GDCPPNVVTFNVLVSFFCQKGFLEEAIELVEQMMEHGCTPNLITYNTLLDGITKDC  539

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A E +  L + G  PDV +++ ++  L      ++  +L   +  +G  P    YN
Sbjct  540  SSEDALELLHGLVSKGVSPDVITFSSIIGILSKEDRIEEAVQLFHVVQDIGMRPKAVVYN  599

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  LC+  +++ AI     M   G  PN+ TY  LI     EG L  A DLL
Sbjct  600  KILLGLCKRCEIDNAIDFFAYMVSNGCMPNESTYIILIEGLAHEGLLKEAQDLL  653


 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/273 (28%), Positives = 143/273 (52%), Gaps = 5/273 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVL  703
            C  G  E+ + L++ M + G    VV    L+ G       + A+++ + +    +PN +
Sbjct  399  CQKGLIEQAIMLIEQMSEHGCTVGVVTYNALVNGFCVQGHIDSALELFRSMP--CKPNTI  456

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             YT L+ G C   R++ A  ++  M      P+VVT+N+++   C +G L  A+++++QM
Sbjct  457  TYTTLLTGLCNAERLDGAAELVAEMLRGDCPPNVVTFNVLVSFFCQKGFLEEAIELVEQM  516

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
             E + C P+++TY  L++  I KD  SE A++L+  ++S+G+ P++ T+++I+  L +E 
Sbjct  517  ME-HGCTPNLITYNTLLDG-ITKDCSSEDALELLHGLVSKGVSPDVITFSSIIGILSKED  574

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             ++ A +    +  +G +P    YN +L  L  R   D+       M S GC P+  TY 
Sbjct  575  RIEEAVQLFHVVQDIGMRPKAVVYNKILLGLCKRCEIDNAIDFFAYMVSNGCMPNESTYI  634

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFT  67
            I +  L  +G L +A  +L ++  +G+     T
Sbjct  635  ILIEGLAHEGLLKEAQDLLSVLCSRGVLNKNLT  667


 Score =   114 bits (284),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 102/188 (54%), Gaps = 3/188 (2%)
 Frame = -1

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
            R  L  A++++++    +   PDV   T LI     +   S+A +++      G   +++
Sbjct  53   REDLAGAVRLVERSGSCDGEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAEGSGSPVDVF  112

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
             YN ++ G CR G +D A   + S+P     PD ++Y  L+R L DR    D   LL +M
Sbjct  113  AYNTLVAGYCRYGHLDAARRLIGSMPV---APDAYTYTPLIRVLCDRGRVADALSLLDDM  169

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
               GC+P+  TY + + ++CR+    +A+++L  M  KG TPN  TY+ +I+  C+EGR+
Sbjct  170  LRRGCQPNVVTYTVLLEAMCRNSGFEQAMAVLDEMRAKGCTPNIVTYNVIINGMCREGRV  229

Query  24   DLAIDLLD  1
            D A +LL+
Sbjct  230  DDARELLN  237


 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 54/120 (45%), Gaps = 3/120 (3%)
 Frame = -1

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            + RE +        RS    G  PDV+    L+R L  R    D  ++L+     G    
Sbjct  51   IAREDLAGAVRLVERSGSCDGEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAEGSGSPVD  110

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             F YN  V+  CR G L+ A  ++  M    + P+ +TY PLI   C  GR+  A+ LLD
Sbjct  111  VFAYNTLVAGYCRYGHLDAARRLIGSMP---VAPDAYTYTPLIRVLCDRGRVADALSLLD  167



>ref|XP_011030727.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic [Populus euphratica]
Length=567

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 173/288 (60%), Gaps = 2/288 (1%)
 Frame = -1

Query  861  ETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALI  685
            +  + L+++V  G+KPDV   T+L+  L    K +KA +VM+++ + G  P+  +YT L+
Sbjct  80   DAFFHLEFIVGKGHKPDVAQATQLLYDLCKSNKMKKATRVMEMMIESGIIPDAASYTFLV  139

Query  684  GGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNC  505
               CK   +  A  ++ +M   G+  + VTYN ++  +C  G L  +L++LD++      
Sbjct  140  NNLCKRGNIGYAMQLVEKMEENGYPTNTVTYNSLVRGLCMHGNLNQSLQLLDKLMWKG-L  198

Query  504  KPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYE  325
             P+  TY+ L+EA   + G++EAMKL+DE++++G +PN+ +YN +L GLC+EG  + A +
Sbjct  199  VPNEFTYSFLLEAAYKERGVNEAMKLLDEIIAKGWQPNLVSYNVLLTGLCKEGRTEEAIQ  258

Query  324  FVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLC  145
            F R LP+ G  P+V SYNI+LR+L     W++  +LL EM S    P   TYNI + SL 
Sbjct  259  FFRDLPSKGFNPNVVSYNIILRSLCYEGRWEEANQLLAEMDSEERSPSLVTYNILIGSLA  318

Query  144  RDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              G++  A  +L  M      P+  TY+P+I+  CKEG+LDL I+ LD
Sbjct  319  FHGRIEHAFEVLDEMVRASFKPSAATYNPIIAHLCKEGKLDLVINCLD  366


 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 97/368 (26%), Positives = 167/368 (45%), Gaps = 71/368 (19%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGL---------------------  778
            +N  C  G     + L++ M + GY  + V    L++GL                     
Sbjct  139  VNNLCKRGNIGYAMQLVEKMEENGYPTNTVTYNSLVRGLCMHGNLNQSLQLLDKLMWKGL  198

Query  777  --------FSVKKA--EKAV-KVMQLLEQF----GEPNVLAYTALIGGFCKTNRVEAANG  643
                    F ++ A  E+ V + M+LL++      +PN+++Y  L+ G CK  R E A  
Sbjct  199  VPNEFTYSFLLEAAYKERGVNEAMKLLDEIIAKGWQPNLVSYNVLLTGLCKEGRTEEAIQ  258

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
                + S+GF P+VV+YNI++ S+C  G+   A ++L +M  +    P +VTY +LI + 
Sbjct  259  FFRDLPSKGFNPNVVSYNIILRSLCYEGRWEEANQLLAEMDSEER-SPSLVTYNILIGSL  317

Query  462  IVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD------------------  337
                 I  A +++DEM+    +P+  TYN I+  LC+EG +D                  
Sbjct  318  AFHGRIEHAFEVLDEMVRASFKPSAATYNPIIAHLCKEGKLDLVINCLDQMIHHRCNPNE  377

Query  336  RAYEFVRSLPAMGCKPDVFS----------------YNILLRALLDRRNWDDGEKLLKEM  205
              +  +  L   G  P+ FS                Y  ++ +L  + N     +LL EM
Sbjct  378  GTFNAIAVLCKQGRVPEAFSIIQNLGNKQRSSTHDFYKGVITSLCRKGNTYPAFQLLYEM  437

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
            +  G  P  +TY+  +  LC +G L++A+ + +++ E    P    ++ LI  FCK GR 
Sbjct  438  TKFGFVPDPYTYSSLIRGLCIEGMLDEALEIFRLLEENDYRPILDNFNALILGFCKSGRT  497

Query  24   DLAIDLLD  1
            DL++D+ +
Sbjct  498  DLSLDIFE  505


 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/323 (27%), Positives = 153/323 (47%), Gaps = 38/323 (12%)
 Frame = -1

Query  861  ETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALI  685
            E + LL  ++  G++P++V    L+ GL    + E+A++  + L   G  PNV++Y  ++
Sbjct  220  EAMKLLDEIIAKGWQPNLVSYNVLLTGLCKEGRTEEAIQFFRDLPSKGFNPNVVSYNIIL  279

Query  684  GGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNC  505
               C   R E AN +L  M S    P +VTYNI+IGS+   G++  A +VLD+M   +  
Sbjct  280  RSLCYEGRWEEANQLLAEMDSEERSPSLVTYNILIGSLAFHGRIEHAFEVLDEMVRAS-F  338

Query  504  KPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAI--------------  370
            KP   TY  +I A + K+G +   +  +D+M+     PN  T+NAI              
Sbjct  339  KPSAATYNPII-AHLCKEGKLDLVINCLDQMIHHRCNPNEGTFNAIAVLCKQGRVPEAFS  397

Query  369  --------------------LKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALL  250
                                +  LCR+G    A++ +  +   G  PD ++Y+ L+R L 
Sbjct  398  IIQNLGNKQRSSTHDFYKGVITSLCRKGNTYPAFQLLYEMTKFGFVPDPYTYSSLIRGLC  457

Query  249  DRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKF  70
                 D+  ++ + +      P    +N  +   C+ G+ + ++ + ++M EKG TPN+ 
Sbjct  458  IEGMLDEALEIFRLLEENDYRPILDNFNALILGFCKSGRTDLSLDIFEMMVEKGYTPNET  517

Query  69   TYDPLISAFCKEGRLDLAIDLLD  1
            TY  ++     E   +LA ++L+
Sbjct  518  TYTIIVEGIAHEEEKELAAEVLE  540


 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/262 (23%), Positives = 112/262 (43%), Gaps = 20/262 (8%)
 Frame = -1

Query  954  ENRNALIQLLDSKE-----IDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKL  790
            E  N L+  +DS+E     +     +      G+ E    +L  MV+  +KP       +
Sbjct  289  EEANQLLAEMDSEERSPSLVTYNILIGSLAFHGRIEHAFEVLDEMVRASFKPSAATYNPI  348

Query  789  IKGLFSVKKAEKAVKVM-QLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVL----NRMR  625
            I  L    K +  +  + Q++     PN   + A I   CK  RV  A  ++    N+ R
Sbjct  349  IAHLCKEGKLDLVINCLDQMIHHRCNPNEGTFNA-IAVLCKQGRVPEAFSIIQNLGNKQR  407

Query  624  S--RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKD  451
            S    F+  V+T      S+C +G    A ++L +M +     PD  TY+ LI    ++ 
Sbjct  408  SSTHDFYKGVIT------SLCRKGNTYPAFQLLYEMTKFGFV-PDPYTYSSLIRGLCIEG  460

Query  450  GISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYN  271
             + EA+++   +      P +  +NA++ G C+ G  D + +    +   G  P+  +Y 
Sbjct  461  MLDEALEIFRLLEENDYRPILDNFNALILGFCKSGRTDLSLDIFEMMVEKGYTPNETTYT  520

Query  270  ILLRALLDRRNWDDGEKLLKEM  205
            I++  +      +   ++L+E+
Sbjct  521  IIVEGIAHEEEKELAAEVLEEL  542


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 56/118 (47%), Gaps = 0/118 (0%)
 Frame = -1

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            RE  ++ A+  +  +   G KPDV     LL  L          ++++ M   G  P   
Sbjct  74   REIRLNDAFFHLEFIVGKGHKPDVAQATQLLYDLCKSNKMKKATRVMEMMIESGIIPDAA  133

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +Y   V++LC+ G +  A+ +++ M E G   N  TY+ L+   C  G L+ ++ LLD
Sbjct  134  SYTFLVNNLCKRGNIGYAMQLVEKMEENGYPTNTVTYNSLVRGLCMHGNLNQSLQLLD  191



>ref|XP_002317023.2| hypothetical protein POPTR_0011s14750g [Populus trichocarpa]
 gb|EEE97635.2| hypothetical protein POPTR_0011s14750g [Populus trichocarpa]
Length=567

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 171/288 (59%), Gaps = 2/288 (1%)
 Frame = -1

Query  861  ETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALI  685
            +  + L+++V  G+KPDV   T+L+  L    K +KA +VM+++ + G  P+  +YT L+
Sbjct  80   DAFFHLEFIVGKGHKPDVAQATQLLYDLCKSNKMKKATRVMEMMIESGIIPDAASYTFLV  139

Query  684  GGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNC  505
               CK   +  A  ++ +M   G+  + VTYN ++  +C  G L  +L++LD++      
Sbjct  140  NNLCKRGNIGHAMQLVEKMEENGYPTNTVTYNSLVRGLCMHGNLNQSLQLLDKLMWKG-L  198

Query  504  KPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYE  325
             P+  TY+ L+EA   + G++EAMKL+DE++++G +PN+ +YN +L GLC+EG  + A  
Sbjct  199  VPNEFTYSFLLEAAYKERGVNEAMKLLDEIIAKGWQPNLVSYNVLLTGLCKEGRTEEAIR  258

Query  324  FVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLC  145
            F R LP+ G  P+V SYNI+LR+L     W++  +LL EM S    P   TYNI + SL 
Sbjct  259  FFRDLPSKGFNPNVVSYNIILRSLCHEGRWEEANQLLAEMDSEERSPSLVTYNILIGSLA  318

Query  144  RDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              G++  A  +L  M      P+  TY+P+I+  CKEG+LDL I  LD
Sbjct  319  FHGRIEHAFEVLDEMVRASFKPSATTYNPIIAHLCKEGKLDLVIKCLD  366


 Score =   146 bits (368),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 155/289 (54%), Gaps = 5/289 (2%)
 Frame = -1

Query  861  ETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTALI  685
            E + LL  ++  G++P++V    L+ GL    + E+A++  + L   G  PNV++Y  ++
Sbjct  220  EAMKLLDEIIAKGWQPNLVSYNVLLTGLCKEGRTEEAIRFFRDLPSKGFNPNVVSYNIIL  279

Query  684  GGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNC  505
               C   R E AN +L  M S    P +VTYNI+IGS+   G++  A +VLD+M   +  
Sbjct  280  RSLCHEGRWEEANQLLAEMDSEERSPSLVTYNILIGSLAFHGRIEHAFEVLDEMVRAS-F  338

Query  504  KPDVVTYTVLIEATIVKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAY  328
            KP   TY  +I A + K+G +   +K +D+M+     PN  T+NAI   LC++G V  A+
Sbjct  339  KPSATTYNPII-AHLCKEGKLDLVIKCLDQMIHHRCNPNEGTFNAI-AVLCKQGRVPEAF  396

Query  327  EFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSL  148
              +++L           Y  ++ +L  + N     +LL EM+  G  P  +TY+  +  L
Sbjct  397  SIIQNLGNKQRSSTHDFYKGVITSLCRKGNTYPAFQLLYEMTKFGFVPDPYTYSSLIRGL  456

Query  147  CRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            C +G L++A+ + +++ E    P    ++ LI  FCK GR DL++D+ +
Sbjct  457  CIEGMLDEALEIFRLLEENDYRPILDNFNALILGFCKSGRTDLSLDIFE  505


 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 139/328 (42%), Gaps = 71/328 (22%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G+ EE +   + +   G+ P+VV    +++ L    + E+A +++ ++  +   P++
Sbjct  248  CKEGRTEEAIRFFRDLPSKGFNPNVVSYNIILRSLCHEGRWEEANQLLAEMDSEERSPSL  307

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LIG      R+E A  VL+ M    F P   TYN +I  +C  GKL L +K LDQ
Sbjct  308  VTYNILIGSLAFHGRIEHAFEVLDEMVRASFKPSATTYNPIIAHLCKEGKLDLVIKCLDQ  367

Query  525  MKEDNNCKPDVVTYTVL----------------------------------IEATIVKDG  448
            M   + C P+  T+  +                                  I +   K  
Sbjct  368  MIH-HRCNPNEGTFNAIAVLCKQGRVPEAFSIIQNLGNKQRSSTHDFYKGVITSLCRKGN  426

Query  447  ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNI  268
               A +L+ EM   G  P+ YTY+++++GLC EGM+D A E  R L     +P       
Sbjct  427  TYPAFQLLYEMTKFGFVPDPYTYSSLIRGLCIEGMLDEALEIFRLLEENDYRP-------  479

Query  267  LLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
                +LD                         +N  +   C+ G+ + ++ + ++M EKG
Sbjct  480  ----ILD------------------------NFNALILGFCKSGRTDLSLDIFEMMVEKG  511

Query  87   LTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TPN+ TY  ++     E   +LA ++L
Sbjct  512  YTPNETTYTIIVEGIAHEEEKELAAEVL  539


 Score = 70.9 bits (172),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 110/256 (43%), Gaps = 8/256 (3%)
 Frame = -1

Query  954  ENRNALIQLLDSKE-----IDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKL  790
            E  N L+  +DS+E     +     +      G+ E    +L  MV+  +KP       +
Sbjct  289  EEANQLLAEMDSEERSPSLVTYNILIGSLAFHGRIEHAFEVLDEMVRASFKPSATTYNPI  348

Query  789  IKGLFSVKKAEKAVKVM-QLLEQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGF  613
            I  L    K +  +K + Q++     PN   + A I   CK  RV  A  ++  + ++  
Sbjct  349  IAHLCKEGKLDLVIKCLDQMIHHRCNPNEGTFNA-IAVLCKQGRVPEAFSIIQNLGNKQR  407

Query  612  FPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAM  433
                  Y  +I S+C +G    A ++L +M +     PD  TY+ LI    ++  + EA+
Sbjct  408  SSTHDFYKGVITSLCRKGNTYPAFQLLYEMTKFGFV-PDPYTYSSLIRGLCIEGMLDEAL  466

Query  432  KLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRAL  253
            ++   +      P +  +NA++ G C+ G  D + +    +   G  P+  +Y I++  +
Sbjct  467  EIFRLLEENDYRPILDNFNALILGFCKSGRTDLSLDIFEMMVEKGYTPNETTYTIIVEGI  526

Query  252  LDRRNWDDGEKLLKEM  205
                  +   ++LKE+
Sbjct  527  AHEEEKELAAEVLKEL  542


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 56/118 (47%), Gaps = 0/118 (0%)
 Frame = -1

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            RE  ++ A+  +  +   G KPDV     LL  L          ++++ M   G  P   
Sbjct  74   REIRLNDAFFHLEFIVGKGHKPDVAQATQLLYDLCKSNKMKKATRVMEMMIESGIIPDAA  133

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +Y   V++LC+ G +  A+ +++ M E G   N  TY+ L+   C  G L+ ++ LLD
Sbjct  134  SYTFLVNNLCKRGNIGHAMQLVEKMEENGYPTNTVTYNSLVRGLCMHGNLNQSLQLLD  191



>ref|XP_003564359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Brachypodium distachyon]
Length=665

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/300 (39%), Positives = 169/300 (56%), Gaps = 5/300 (2%)
 Frame = -1

Query  897  RLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG  718
            RL R        E   L++     G  PDV LCTKLI+ L    +   A +V++  E  G
Sbjct  41   RLRRLIARDDLAEAARLVERSTSRGEAPDVYLCTKLIRNLCRRGRTSDAARVLRTAEGSG  100

Query  717  EP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLAL  541
             P +V AY  L+ G+C+  R++AA  ++  M      PD  TY  +I  +CDRG++G AL
Sbjct  101  APVDVFAYNTLVAGYCRYGRLDAARRLIASM---PVPPDAYTYTPLIRGLCDRGRVGDAL  157

Query  540  KVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
             +LD M     C+P VVTYTVL+EA     G  +AMK++DEM ++G  PNI TYN I+ G
Sbjct  158  SLLDDMLR-RECQPSVVTYTVLLEAVCKSSGFGQAMKVLDEMRAKGCTPNIVTYNVIING  216

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            +CRE  VD A + +  L + G +PD  SY  +L+ L   + W+D E L  EM    C P+
Sbjct  217  MCREDRVDDARQILNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEVLFCEMVENNCVPN  276

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              T+++ V   CR G + +AI +L  M+E G T N    + +I++ CK+GR+D A + L+
Sbjct  277  EVTFDMLVRFFCRGGMVERAIEVLDRMSEHGCTANTTLCNIVINSICKQGRVDDAFEFLN  336


 Score =   184 bits (467),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 165/295 (56%), Gaps = 2/295 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  + L LL  M++   +P VV  T L++ +       +A+KV+  +   G  PN+
Sbjct  148  CDRGRVGDALSLLDDMLRRECQPSVVTYTVLLEAVCKSSGFGQAMKVLDEMRAKGCTPNI  207

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  +I G C+ +RV+ A  +LNR+ S GF PD V+Y  ++  +C   K    ++VL  
Sbjct  208  VTYNVIINGMCREDRVDDARQILNRLSSYGFQPDTVSYTTVLKGLC-AAKRWEDVEVLFC  266

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
               +NNC P+ VT+ +L+        +  A++++D M   G   N    N ++  +C++G
Sbjct  267  EMVENNCVPNEVTFDMLVRFFCRGGMVERAIEVLDRMSEHGCTANTTLCNIVINSICKQG  326

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A+EF+ ++ + GC PD  SY  +L+ L     W+D ++LL EM    C P+  T+N
Sbjct  327  RVDDAFEFLNNMGSYGCSPDTISYTTVLKGLCRAGRWEDAKELLNEMVRKNCPPNEVTFN  386

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             F+  LC+ G +++AI +++ M E G +    TY+ L++ FC +GR+D A++L +
Sbjct  387  TFICILCQKGLIDQAILLIEQMPEYGCSVGIVTYNALVNGFCVQGRVDSALELFN  441


 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/333 (29%), Positives = 157/333 (47%), Gaps = 40/333 (12%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKA-VKVMQLLEQFG  718
            +N  C   + ++   +L  +   G++PD V  T ++KGL + K+ E   V   +++E   
Sbjct  214  INGMCREDRVDDARQILNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEVLFCEMVENNC  273

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +  L+  FC+   VE A  VL+RM   G   +    NI+I SIC +G++  A +
Sbjct  274  VPNEVTFDMLVRFFCRGGMVERAIEVLDRMSEHGCTANTTLCNIVINSICKQGRVDDAFE  333

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPN-----------  391
             L+ M     C PD ++YT +++         +A +L++EM+ +   PN           
Sbjct  334  FLNNMGS-YGCSPDTISYTTVLKGLCRAGRWEDAKELLNEMVRKNCPPNEVTFNTFICIL  392

Query  390  ------------------------IYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
                                    I TYNA++ G C +G VD A E   SLP   C+P+ 
Sbjct  393  CQKGLIDQAILLIEQMPEYGCSVGIVTYNALVNGFCVQGRVDSALELFNSLP---CEPNT  449

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +Y  LL  L      D   +LL EM    C  +  T+N+ VS  C+ G + +AI +++ 
Sbjct  450  ITYTTLLTGLCHAERLDAAAELLAEMMQNDCPLNVVTFNVLVSFFCQKGFVEEAIELVQQ  509

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            M E G TPN  T++ L+    ++   + A++LL
Sbjct  510  MMEHGCTPNLITFNTLLDGITEDCNSEEALELL  542


 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 151/298 (51%), Gaps = 5/298 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++    L  M   G  PD +  T ++KGL    + E A +++ +++ +  
Sbjct  319  INSICKQGRVDDAFEFLNNMGSYGCSPDTISYTTVLKGLCRAGRWEDAKELLNEMVRKNC  378

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +   I   C+   ++ A  ++ +M   G    +VTYN ++   C +G++  AL+
Sbjct  379  PPNEVTFNTFICILCQKGLIDQAILLIEQMPEYGCSVGIVTYNALVNGFCVQGRVDSALE  438

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            + + +     C+P+ +TYT L+      + +  A +L+ EM+      N+ T+N ++   
Sbjct  439  LFNSLP----CEPNTITYTTLLTGLCHAERLDAAAELLAEMMQNDCPLNVVTFNVLVSFF  494

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G V+ A E V+ +   GC P++ ++N LL  + +  N ++  +LL  + S G    T
Sbjct  495  CQKGFVEEAIELVQQMMEHGCTPNLITFNTLLDGITEDCNSEEALELLHGLVSKGISLDT  554

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+  V  L R+ ++ +A+ M   + + G+ P    Y+ ++SA CK    D AID  
Sbjct  555  ITYSSIVDVLSREDRIEEAVQMFHAVQDMGMRPKAVMYNKILSALCKRCETDRAIDFF  612


 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/287 (28%), Positives = 144/287 (50%), Gaps = 5/287 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C AG++E+   LL  MV+    P+ V     I  L      ++A+ +++ + ++G    +
Sbjct  358  CRAGRWEDAKELLNEMVRKNCPPNEVTFNTFICILCQKGLIDQAILLIEQMPEYGCSVGI  417

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y AL+ GFC   RV++A  + N +      P+ +TY  ++  +C   +L  A ++L +
Sbjct  418  VTYNALVNGFCVQGRVDSALELFNSLPCE---PNTITYTTLLTGLCHAERLDAAAELLAE  474

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M + N+C  +VVT+ VL+     K  + EA++LV +M+  G  PN+ T+N +L G+  + 
Sbjct  475  MMQ-NDCPLNVVTFNVLVSFFCQKGFVEEAIELVQQMMEHGCTPNLITFNTLLDGITEDC  533

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A E +  L + G   D  +Y+ ++  L      ++  ++   +  MG  P    YN
Sbjct  534  NSEEALELLHGLVSKGISLDTITYSSIVDVLSREDRIEEAVQMFHAVQDMGMRPKAVMYN  593

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
              +S+LC+  + ++AI     M      PN+ TY  LI    +EG L
Sbjct  594  KILSALCKRCETDRAIDFFAHMVSNSCMPNESTYVILIEGLAREGLL  640


 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 136/274 (50%), Gaps = 3/274 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVL  703
            C  G  ++ + L++ M + G    +V    L+ G     + + A+++   L    EPN +
Sbjct  393  CQKGLIDQAILLIEQMPEYGCSVGIVTYNALVNGFCVQGRVDSALELFNSLP--CEPNTI  450

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             YT L+ G C   R++AA  +L  M       +VVT+N+++   C +G +  A++++ QM
Sbjct  451  TYTTLLTGLCHAERLDAAAELLAEMMQNDCPLNVVTFNVLVSFFCQKGFVEEAIELVQQM  510

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGM  343
             E + C P+++T+  L++         EA++L+  ++S+G+  +  TY++I+  L RE  
Sbjct  511  ME-HGCTPNLITFNTLLDGITEDCNSEEALELLHGLVSKGISLDTITYSSIVDVLSREDR  569

Query  342  VDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNI  163
            ++ A +   ++  MG +P    YN +L AL  R   D        M S  C P+  TY I
Sbjct  570  IEEAVQMFHAVQDMGMRPKAVMYNKILSALCKRCETDRAIDFFAHMVSNSCMPNESTYVI  629

Query  162  FVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYD  61
             +  L R+G L +A  +L  +  +G+       D
Sbjct  630  LIEGLAREGLLKEARYVLSELCSRGVLSKSLIED  663



>ref|XP_010062706.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic [Eucalyptus grandis]
 gb|KCW69833.1| hypothetical protein EUGRSUZ_F03183 [Eucalyptus grandis]
Length=567

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 171/283 (60%), Gaps = 2/283 (1%)
 Frame = -1

Query  846  LQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCK  670
            L YMV  G+KPDV   T+L+  L    K ++A++VM+++   G  P+  +YT L+   CK
Sbjct  85   LDYMVARGHKPDVNQATQLLYDLCKANKLKRAIRVMEMMATSGIIPDAASYTYLVNHLCK  144

Query  669  TNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVV  490
               V  A  ++ +M   G+  + VTYN +I  +C  G    +L++LD++       P+  
Sbjct  145  KGNVGHAMQLVEKMEEYGYPTNTVTYNSIIRGLCMHGNFSRSLQLLDKLMR-KGLVPNAF  203

Query  489  TYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSL  310
            TY+ L+EA   + G+ EAM+L+DE++++G +PN+ +YN +L GLC+EG  + A +F R+L
Sbjct  204  TYSFLLEAAYKERGVKEAMRLLDEIVAKGGKPNLVSYNVLLTGLCKEGKTEEAIKFFRNL  263

Query  309  PAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKL  130
            P+ G  P+V SYNILLR+L     W++  +LL EM      P   TYNI ++SL   GK 
Sbjct  264  PSRGFSPNVVSYNILLRSLCCEGRWEEANELLAEMDGGDRAPSIVTYNILITSLALHGKT  323

Query  129  NKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +A+ +L+ MT+    P   +Y+P+I+  CKEG++DL +  LD
Sbjct  324  EQALEVLEEMTQGQFKPTATSYNPIIARLCKEGKVDLVVKCLD  366


 Score =   144 bits (364),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/336 (29%), Positives = 164/336 (49%), Gaps = 44/336 (13%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGL---------------------  778
            +N  C  G     + L++ M + GY  + V    +I+GL                     
Sbjct  139  VNHLCKKGNVGHAMQLVEKMEEYGYPTNTVTYNSIIRGLCMHGNFSRSLQLLDKLMRKGL  198

Query  777  --------FSVKKA--EKAVK-VMQLLEQF----GEPNVLAYTALIGGFCKTNRVEAANG  643
                    F ++ A  E+ VK  M+LL++     G+PN+++Y  L+ G CK  + E A  
Sbjct  199  VPNAFTYSFLLEAAYKERGVKEAMRLLDEIVAKGGKPNLVSYNVLLTGLCKEGKTEEAIK  258

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
                + SRGF P+VV+YNI++ S+C  G+   A ++L +M +  +  P +VTY +LI + 
Sbjct  259  FFRNLPSRGFSPNVVSYNILLRSLCCEGRWEEANELLAEM-DGGDRAPSIVTYNILITSL  317

Query  462  IVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             +     +A+++++EM     +P   +YN I+  LC+EG VD   + +  +    C P+ 
Sbjct  318  ALHGKTEQALEVLEEMTQGQFKPTATSYNPIIARLCKEGKVDLVVKCLDQMIYRRCNPNE  377

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFT---YNIFVSSLCRDGKLNKAISM  112
             +YN +  A+L        ++    + S+G + ++ T   Y   +SSLCR G    A  +
Sbjct  378  GTYNAV--AILCEEG--KTQEAFSIIHSLGSKQNSTTREFYKTVISSLCRKGNTYAAFQL  433

Query  111  LKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            L  MT+ G TP+ +TY  LI   C EG LD AI + 
Sbjct  434  LYEMTKHGFTPDSYTYSSLIRGLCLEGMLDEAITIF  469


 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/363 (25%), Positives = 168/363 (46%), Gaps = 71/363 (20%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G +  +L LL  +++ G  P+    + L++  +  +  ++A++++ +++ + G+PN+
Sbjct  178  CMHGNFSRSLQLLDKLMRKGLVPNAFTYSFLLEAAYKERGVKEAMRLLDEIVAKGGKPNL  237

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++Y  L+ G CK  + E A      + SRGF P+VV+YNI++ S+C  G+   A ++L +
Sbjct  238  VSYNVLLTGLCKEGKTEEAIKFFRNLPSRGFSPNVVSYNILLRSLCCEGRWEEANELLAE  297

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +  +  P +VTY +LI +  +     +A+++++EM     +P   +YN I+  LC+EG
Sbjct  298  M-DGGDRAPSIVTYNILITSLALHGKTEQALEVLEEMTQGQFKPTATSYNPIIARLCKEG  356

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNI---------------LLRALLDRRNWDDGE----  223
             VD   + +  +    C P+  +YN                ++ +L  ++N    E    
Sbjct  357  KVDLVVKCLDQMIYRRCNPNEGTYNAVAILCEEGKTQEAFSIIHSLGSKQNSTTREFYKT  416

Query  222  ---------------KLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI-----  103
                           +LL EM+  G  P ++TY+  +  LC +G L++AI++  I     
Sbjct  417  VISSLCRKGNTYAAFQLLYEMTKHGFTPDSYTYSSLIRGLCLEGMLDEAITIFGILEEYE  476

Query  102  ------------------------------MTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
                                          M EKG  PN+ TY  L+     E  + LA 
Sbjct  477  QKPDVDNYNALLLGFCKSQRTDLSLEAFVMMIEKGNMPNETTYTILVEGLAHEDEMGLAA  536

Query  12   DLL  4
            ++L
Sbjct  537  EVL  539


 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 87/320 (27%), Positives = 139/320 (43%), Gaps = 39/320 (12%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNV  706
            C  GK EE +   + +   G+ P+VV    L++ L    + E+A +++  ++     P++
Sbjct  248  CKEGKTEEAIKFFRNLPSRGFSPNVVSYNILLRSLCCEGRWEEANELLAEMDGGDRAPSI  307

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI       + E A  VL  M    F P   +YN +I  +C  GK+ L +K LDQ
Sbjct  308  VTYNILITSLALHGKTEQALEVLEEMTQGQFKPTATSYNPIIARLCKEGKVDLVVKCLDQ  367

Query  525  MKEDNNCKPDVVTY---TVLIEATIVKDGIS-----------------------------  442
            M     C P+  TY    +L E    ++  S                             
Sbjct  368  MIY-RRCNPNEGTYNAVAILCEEGKTQEAFSIIHSLGSKQNSTTREFYKTVISSLCRKGN  426

Query  441  --EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNI  268
               A +L+ EM   G  P+ YTY+++++GLC EGM+D A      L     KPDV +YN 
Sbjct  427  TYAAFQLLYEMTKHGFTPDSYTYSSLIRGLCLEGMLDEAITIFGILEEYEQKPDVDNYNA  486

Query  267  LLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK-IMTEK  91
            LL      +  D   +    M   G  P+  TY I V  L  + ++  A  +LK ++ ++
Sbjct  487  LLLGFCKSQRTDLSLEAFVMMIEKGNMPNETTYTILVEGLAHEDEMGLAAEVLKELLAKR  546

Query  90   GLTPNKFTYDPLISAFCKEG  31
             L+ N  T + L+  +  EG
Sbjct  547  FLSQN--TVERLVMQYHLEG  564


 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 78/149 (52%), Gaps = 0/149 (0%)
 Frame = -1

Query  447  ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNI  268
            +++A + +D M++RG +P++     +L  LC+   + RA   +  +   G  PD  SY  
Sbjct  78   LNDAFQNLDYMVARGHKPDVNQATQLLYDLCKANKLKRAIRVMEMMATSGIIPDAASYTY  137

Query  267  LLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
            L+  L  + N     +L+++M   G   +T TYN  +  LC  G  ++++ +L  +  KG
Sbjct  138  LVNHLCKKGNVGHAMQLVEKMEEYGYPTNTVTYNSIIRGLCMHGNFSRSLQLLDKLMRKG  197

Query  87   LTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            L PN FTY  L+ A  KE  +  A+ LLD
Sbjct  198  LVPNAFTYSFLLEAAYKERGVKEAMRLLD  226



>ref|XP_008657162.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Zea mays]
 ref|XP_008657163.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Zea mays]
 ref|XP_008657164.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Zea mays]
 ref|XP_008657166.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Zea mays]
 gb|AFW84888.1| hypothetical protein ZEAMMB73_407218 [Zea mays]
Length=668

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 161/276 (58%), Gaps = 5/276 (2%)
 Frame = -1

Query  825  GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAA  649
            G  PDV LCTKLI+ L    +   A +V++  E  G P +V AY  L+ G+C+   ++AA
Sbjct  70   GEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAEGSGSPVDVFAYNTLVAGYCRYGHLDAA  129

Query  648  NGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIE  469
              ++  M      PD  TY  +I  +CDRG++  AL +LD M     C+P+VVTYTVL+E
Sbjct  130  RRLIGSM---PVAPDAYTYTPLIRVLCDRGRVADALSLLDDMLR-RGCQPNVVTYTVLLE  185

Query  468  ATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKP  289
            A     G  +AM ++DEM ++G  PNI TYN I+ G+CREG VD A + +  L + GC+P
Sbjct  186  AMCKNSGFEQAMAVLDEMRAKGCTPNIVTYNVIINGMCREGRVDDARDLLNRLFSYGCQP  245

Query  288  DVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISML  109
            D  SY  LL+ L   + WDD E+L  EM    C P+  T+++ +   CR G + +AI +L
Sbjct  246  DTVSYTTLLKGLCASKRWDDVEELFAEMMEKNCMPNEVTFDMLIRFFCRGGMVERAIQVL  305

Query  108  KIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + MTE     N    + +I++ CK+GR+D A   L+
Sbjct  306  QQMTEHECATNTTLCNIVINSICKQGRVDDAFKFLN  341


 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 161/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  + L LL  M++ G +P+VV  T L++ +      E+A+ V+  +   G  PN+
Sbjct  153  CDRGRVADALSLLDDMLRRGCQPNVVTYTVLLEAMCKNSGFEQAMAVLDEMRAKGCTPNI  212

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  +I G C+  RV+ A  +LNR+ S G  PD V+Y  ++  +C   +     ++  +
Sbjct  213  VTYNVIINGMCREGRVDDARDLLNRLFSYGCQPDTVSYTTLLKGLCASKRWDDVEELFAE  272

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E  NC P+ VT+ +LI        +  A++++ +M       N    N ++  +C++G
Sbjct  273  MME-KNCMPNEVTFDMLIRFFCRGGMVERAIQVLQQMTEHECATNTTLCNIVINSICKQG  331

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A++F+ ++ + GC PD  SY  +L+ L     W+D ++LLKEM    C P+  T+N
Sbjct  332  RVDDAFKFLNNMGSYGCNPDTISYTTVLKGLCRAERWNDAKELLKEMVRNNCPPNEVTFN  391

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             F+  LC+ G + +AI +++ M E G T    TY+ L++ FC +G +D A++L 
Sbjct  392  TFICILCQKGLIEQAIMLIEQMQEHGCTVGVVTYNALVNGFCVQGHIDSALELF  445


 Score =   155 bits (392),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/298 (28%), Positives = 148/298 (50%), Gaps = 5/298 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++    L  M   G  PD +  T ++KGL   ++   A +++ +++    
Sbjct  324  INSICKQGRVDDAFKFLNNMGSYGCNPDTISYTTVLKGLCRAERWNDAKELLKEMVRNNC  383

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +   I   C+   +E A  ++ +M+  G    VVTYN ++   C +G +  AL+
Sbjct  384  PPNEVTFNTFICILCQKGLIEQAIMLIEQMQEHGCTVGVVTYNALVNGFCVQGHIDSALE  443

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +   M     CKP+ +TYT L+      + +  A +LV EML R   PN+ T+N ++   
Sbjct  444  LFRSMP----CKPNTITYTTLLTGLCNAERLDAAAELVAEMLHRDCPPNVVTFNVLVNFF  499

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G +D A E V  +   GC P++ +YN L   +    + +D  +LL  + S G  P  
Sbjct  500  CQKGFLDEAIELVEQMMEHGCTPNLITYNTLFDGITKDCSSEDALELLHGLVSKGVSPDV  559

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             T++  +  L ++ ++ +AI M  +  + G+ P    Y+ ++   CK   +D AID L
Sbjct  560  ITFSSIIGILSKEDRVEEAIQMFHLAQDIGMRPKALVYNKILLGLCKRHEIDNAIDFL  617


 Score =   153 bits (387),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/299 (29%), Positives = 159/299 (53%), Gaps = 5/299 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++   LL  +   G +PD V  T L+KGL + K+ +   ++  +++E+  
Sbjct  219  INGMCREGRVDDARDLLNRLFSYGCQPDTVSYTTLLKGLCASKRWDDVEELFAEMMEKNC  278

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +  LI  FC+   VE A  VL +M       +    NI+I SIC +G++  A K
Sbjct  279  MPNEVTFDMLIRFFCRGGMVERAIQVLQQMTEHECATNTTLCNIVINSICKQGRVDDAFK  338

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
             L+ M     C PD ++YT +++     +  ++A +L+ EM+     PN  T+N  +  L
Sbjct  339  FLNNMGS-YGCNPDTISYTTVLKGLCRAERWNDAKELLKEMVRNNCPPNEVTFNTFICIL  397

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G++++A   +  +   GC   V +YN L+     + + D   +L +   SM C+P+T
Sbjct  398  CQKGLIEQAIMLIEQMQEHGCTVGVVTYNALVNGFCVQGHIDSALELFR---SMPCKPNT  454

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             TY   ++ LC   +L+ A  ++  M  +   PN  T++ L++ FC++G LD AI+L++
Sbjct  455  ITYTTLLTGLCNAERLDAAAELVAEMLHRDCPPNVVTFNVLVNFFCQKGFLDEAIELVE  513


 Score =   139 bits (349),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/267 (30%), Positives = 144/267 (54%), Gaps = 5/267 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVL  703
            C  G  E+ + L++ M + G    VV    L+ G       + A+++ + +    +PN +
Sbjct  398  CQKGLIEQAIMLIEQMQEHGCTVGVVTYNALVNGFCVQGHIDSALELFRSMP--CKPNTI  455

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             YT L+ G C   R++AA  ++  M  R   P+VVT+N+++   C +G L  A+++++QM
Sbjct  456  TYTTLLTGLCNAERLDAAAELVAEMLHRDCPPNVVTFNVLVNFFCQKGFLDEAIELVEQM  515

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
             E + C P+++TY  L +  I KD  SE A++L+  ++S+G+ P++ T+++I+  L +E 
Sbjct  516  ME-HGCTPNLITYNTLFDG-ITKDCSSEDALELLHGLVSKGVSPDVITFSSIIGILSKED  573

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             V+ A +       +G +P    YN +L  L  R   D+    L  M S GC P+  TY 
Sbjct  574  RVEEAIQMFHLAQDIGMRPKALVYNKILLGLCKRHEIDNAIDFLAYMVSNGCMPNESTYI  633

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L R+G L +A  +L ++  +G+
Sbjct  634  ILIEGLAREGLLKEAQDLLSMLCSRGV  660


 Score =   139 bits (349),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 148/294 (50%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++ +   LL+ MV+    P+ V     I  L      E+A+ +++ +++ G    V
Sbjct  363  CRAERWNDAKELLKEMVRNNCPPNEVTFNTFICILCQKGLIEQAIMLIEQMQEHGCTVGV  422

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y AL+ GFC    +++A   L   RS    P+ +TY  ++  +C+  +L  A +++ +
Sbjct  423  VTYNALVNGFCVQGHIDSA---LELFRSMPCKPNTITYTTLLTGLCNAERLDAAAELVAE  479

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M    +C P+VVT+ VL+     K  + EA++LV++M+  G  PN+ TYN +  G+ ++ 
Sbjct  480  MLH-RDCPPNVVTFNVLVNFFCQKGFLDEAIELVEQMMEHGCTPNLITYNTLFDGITKDC  538

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A E +  L + G  PDV +++ ++  L      ++  ++      +G  P    YN
Sbjct  539  SSEDALELLHGLVSKGVSPDVITFSSIIGILSKEDRVEEAIQMFHLAQDIGMRPKALVYN  598

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  LC+  +++ AI  L  M   G  PN+ TY  LI    +EG L  A DLL
Sbjct  599  KILLGLCKRHEIDNAIDFLAYMVSNGCMPNESTYIILIEGLAREGLLKEAQDLL  652


 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 100/188 (53%), Gaps = 3/188 (2%)
 Frame = -1

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
            R  L  A ++++     +   PDV   T LI     +   S+A +++      G   +++
Sbjct  52   REDLAGAARLVELSASRDGEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAEGSGSPVDVF  111

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
             YN ++ G CR G +D A   + S+P     PD ++Y  L+R L DR    D   LL +M
Sbjct  112  AYNTLVAGYCRYGHLDAARRLIGSMPV---APDAYTYTPLIRVLCDRGRVADALSLLDDM  168

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
               GC+P+  TY + + ++C++    +A+++L  M  KG TPN  TY+ +I+  C+EGR+
Sbjct  169  LRRGCQPNVVTYTVLLEAMCKNSGFEQAMAVLDEMRAKGCTPNIVTYNVIINGMCREGRV  228

Query  24   DLAIDLLD  1
            D A DLL+
Sbjct  229  DDARDLLN  236



>ref|NP_001044451.1| Os01g0783100 [Oryza sativa Japonica Group]
 dbj|BAB92551.1| putative PPR protein [Oryza sativa Japonica Group]
 dbj|BAF06365.1| Os01g0783100 [Oryza sativa Japonica Group]
Length=684

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/300 (38%), Positives = 168/300 (56%), Gaps = 5/300 (2%)
 Frame = -1

Query  897  RLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG  718
            RL R        E   L+      G  PDV LCTKLI+ L    +   A +V++  E+ G
Sbjct  49   RLRRLIARDDLAEAARLVDRATSRGEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAERSG  108

Query  717  EP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLAL  541
               +V AY  L+ G+C+  +++AA  ++  M      PD  TY  +I  +CDRG++G AL
Sbjct  109  TAVDVFAYNTLVAGYCRYGQLDAARRLIASM---PVAPDAYTYTPIIRGLCDRGRVGEAL  165

Query  540  KVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
             +LD M     C+P VVTYTVL+EA     G  +AM+++DEM ++G  PNI TYN I+ G
Sbjct  166  SLLDDMLH-RGCQPSVVTYTVLLEAVCKSTGFGQAMEVLDEMRAKGCTPNIVTYNVIING  224

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            +CREG VD A EF+  L + G +PD  SY  +L+ L   + W+D E+L  EM    C P+
Sbjct  225  MCREGRVDDAREFLNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEELFAEMMEKNCMPN  284

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              T+++ V   CR G + +AI +L+ M+  G   N    + +I+  CK+GR+D A   L+
Sbjct  285  EVTFDMLVRFFCRGGMVERAIQVLEQMSGHGCAANTTLCNIVINTICKQGRVDDAFQFLN  344


 Score =   184 bits (467),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/294 (32%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  E L LL  M+  G +P VV  T L++ +       +A++V+  +   G  PN+
Sbjct  156  CDRGRVGEALSLLDDMLHRGCQPSVVTYTVLLEAVCKSTGFGQAMEVLDEMRAKGCTPNI  215

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  +I G C+  RV+ A   LNR+ S GF PD V+Y  ++  +C   +     ++  +
Sbjct  216  VTYNVIINGMCREGRVDDAREFLNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEELFAE  275

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E  NC P+ VT+ +L+        +  A++++++M   G   N    N ++  +C++G
Sbjct  276  MME-KNCMPNEVTFDMLVRFFCRGGMVERAIQVLEQMSGHGCAANTTLCNIVINTICKQG  334

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A++F+ ++ + GC PD  SY  +L+ L     W+D ++LLKEM    C P+  T+N
Sbjct  335  RVDDAFQFLNNMGSYGCSPDTISYTTVLKGLCRAERWEDAKELLKEMVRKNCPPNEVTFN  394

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             F+  LC+ G + +A  +++ M+E G   N  TY+ L++ FC +GR+D A++L 
Sbjct  395  TFICILCQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALELF  448


 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 153/298 (51%), Gaps = 5/298 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++    L  M   G  PD +  T ++KGL   ++ E A +++ +++ +  
Sbjct  327  INTICKQGRVDDAFQFLNNMGSYGCSPDTISYTTVLKGLCRAERWEDAKELLKEMVRKNC  386

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +   I   C+   +E A  ++ +M   G   ++VTYN ++   C +G++  AL+
Sbjct  387  PPNEVTFNTFICILCQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALE  446

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +   M     CKP+ +TYT L+      + +  A +L+ EML +   PN+ T+N ++   
Sbjct  447  LFYSMP----CKPNTITYTTLLTGLCNAERLDAAAELLAEMLQKDCAPNVVTFNVLVSFF  502

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G++D A E V  +   GC P++ +YN LL  +    N ++  +LL  + S G  P  
Sbjct  503  CQKGLMDEAIELVEQMMEHGCTPNLITYNTLLDGITKDCNSEEALELLHGLVSNGVSPDI  562

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+  +  L R+ ++ +AI M  I+ + G+ P    Y+ ++ A CK    D AID  
Sbjct  563  VTYSSIIGVLSREDRVEEAIKMFHIVQDLGMRPKAVIYNKILLALCKRCNTDGAIDFF  620


 Score =   159 bits (402),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/299 (29%), Positives = 161/299 (54%), Gaps = 5/299 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++    L  +   G++PD V  T ++KGL + K+ E   ++  +++E+  
Sbjct  222  INGMCREGRVDDAREFLNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEELFAEMMEKNC  281

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +  L+  FC+   VE A  VL +M   G   +    NI+I +IC +G++  A +
Sbjct  282  MPNEVTFDMLVRFFCRGGMVERAIQVLEQMSGHGCAANTTLCNIVINTICKQGRVDDAFQ  341

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
             L+ M     C PD ++YT +++     +   +A +L+ EM+ +   PN  T+N  +  L
Sbjct  342  FLNNMG-SYGCSPDTISYTTVLKGLCRAERWEDAKELLKEMVRKNCPPNEVTFNTFICIL  400

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G++++A   +  +   GC+ ++ +YN L+     +   D   +L     SM C+P+T
Sbjct  401  CQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALELFY---SMPCKPNT  457

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             TY   ++ LC   +L+ A  +L  M +K   PN  T++ L+S FC++G +D AI+L++
Sbjct  458  ITYTTLLTGLCNAERLDAAAELLAEMLQKDCAPNVVTFNVLVSFFCQKGLMDEAIELVE  516


 Score =   141 bits (356),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 85/294 (29%), Positives = 148/294 (50%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++E+   LL+ MV+    P+ V     I  L      E+A  +++ + + G E N+
Sbjct  366  CRAERWEDAKELLKEMVRKNCPPNEVTFNTFICILCQKGLIEQATMLIEQMSEHGCEVNI  425

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y AL+ GFC   RV++A  +   M  +   P+ +TY  ++  +C+  +L  A ++L +
Sbjct  426  VTYNALVNGFCVQGRVDSALELFYSMPCK---PNTITYTTLLTGLCNAERLDAAAELLAE  482

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +  +C P+VVT+ VL+     K  + EA++LV++M+  G  PN+ TYN +L G+ ++ 
Sbjct  483  MLQ-KDCAPNVVTFNVLVSFFCQKGLMDEAIELVEQMMEHGCTPNLITYNTLLDGITKDC  541

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A E +  L + G  PD+ +Y+ ++  L      ++  K+   +  +G  P    YN
Sbjct  542  NSEEALELLHGLVSNGVSPDIVTYSSIIGVLSREDRVEEAIKMFHIVQDLGMRPKAVIYN  601

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              + +LC+    + AI     M   G  PN+ TY  LI     E  L    DLL
Sbjct  602  KILLALCKRCNTDGAIDFFAYMVSNGCMPNELTYITLIEGLANEDFLKETRDLL  655


 Score =   133 bits (334),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 142/267 (53%), Gaps = 5/267 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVL  703
            C  G  E+   L++ M + G + ++V    L+ G     + + A+++   +    +PN +
Sbjct  401  CQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALELFYSMP--CKPNTI  458

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             YT L+ G C   R++AA  +L  M  +   P+VVT+N+++   C +G +  A+++++QM
Sbjct  459  TYTTLLTGLCNAERLDAAAELLAEMLQKDCAPNVVTFNVLVSFFCQKGLMDEAIELVEQM  518

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGIS-EAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
             E + C P+++TY  L++  I KD  S EA++L+  ++S G+ P+I TY++I+  L RE 
Sbjct  519  ME-HGCTPNLITYNTLLDG-ITKDCNSEEALELLHGLVSNGVSPDIVTYSSIIGVLSRED  576

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             V+ A +    +  +G +P    YN +L AL  R N D        M S GC P+  TY 
Sbjct  577  RVEEAIKMFHIVQDLGMRPKAVIYNKILLALCKRCNTDGAIDFFAYMVSNGCMPNELTYI  636

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
              +  L  +  L +   +L+ +  +G+
Sbjct  637  TLIEGLANEDFLKETRDLLRELCSRGV  663


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 58/126 (46%), Gaps = 3/126 (2%)
 Frame = -1

Query  378  NAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSS  199
            NA L+ L     +  A   V    + G  PDV+    L+R L  R    D  ++L+    
Sbjct  47   NARLRRLIARDDLAEAARLVDRATSRGEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAER  106

Query  198  MGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDL  19
             G     F YN  V+  CR G+L+ A  ++  M    + P+ +TY P+I   C  GR+  
Sbjct  107  SGTAVDVFAYNTLVAGYCRYGQLDAARRLIASMP---VAPDAYTYTPIIRGLCDRGRVGE  163

Query  18   AIDLLD  1
            A+ LLD
Sbjct  164  ALSLLD  169



>gb|EAY76069.1| hypothetical protein OsI_03997 [Oryza sativa Indica Group]
Length=684

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/300 (38%), Positives = 168/300 (56%), Gaps = 5/300 (2%)
 Frame = -1

Query  897  RLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG  718
            RL R        E   L+      G  PDV LCTKLI+ L    +   A +V++  E+ G
Sbjct  49   RLRRLIARDDLAEAARLVDRATSRGEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAERSG  108

Query  717  EP-NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLAL  541
               +V AY  L+ G+C+  +++AA  ++  M      PD  TY  +I  +CDRG++G AL
Sbjct  109  TAVDVFAYNTLVAGYCRYGQLDAARRLIASM---PVAPDAYTYTPIIRGLCDRGRVGEAL  165

Query  540  KVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKG  361
             +LD M     C+P VVTYTVL+EA     G  +AM+++DEM ++G  PNI TYN I+ G
Sbjct  166  SLLDDMLH-RGCQPSVVTYTVLLEAVCKSTGFGQAMEVLDEMRAKGCTPNIVTYNVIING  224

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            +CREG VD A EF+  L + G +PD  SY  +L+ L   + W+D E+L  EM    C P+
Sbjct  225  MCREGRVDDAREFLNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEELFAEMMEKNCMPN  284

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              T+++ V   CR G + +AI +L+ M+  G   N    + +I+  CK+GR+D A   L+
Sbjct  285  EVTFDMLVRFFCRGGMVERAIQVLEQMSGHGCAANTTLCNIVINTICKQGRVDDAFQFLN  344


 Score =   184 bits (467),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/294 (32%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  E L LL  M+  G +P VV  T L++ +       +A++V+  +   G  PN+
Sbjct  156  CDRGRVGEALSLLDDMLHRGCQPSVVTYTVLLEAVCKSTGFGQAMEVLDEMRAKGCTPNI  215

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  +I G C+  RV+ A   LNR+ S GF PD V+Y  ++  +C   +     ++  +
Sbjct  216  VTYNVIINGMCREGRVDDAREFLNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEELFAE  275

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E  NC P+ VT+ +L+        +  A++++++M   G   N    N ++  +C++G
Sbjct  276  MME-KNCMPNEVTFDMLVRFFCRGGMVERAIQVLEQMSGHGCAANTTLCNIVINTICKQG  334

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A++F+ ++ + GC PD  SY  +L+ L     W+D ++LLKEM    C P+  T+N
Sbjct  335  RVDDAFQFLNNMGSYGCSPDTISYTTVLKGLCRAERWEDAKELLKEMVRKNCPPNEVTFN  394

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             F+  LC+ G + +A  +++ M+E G   N  TY+ L++ FC +GR+D A++L 
Sbjct  395  TFICILCQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALELF  448


 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 154/298 (52%), Gaps = 5/298 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++    L  M   G  PD +  T ++KGL   ++ E A +++ +++ +  
Sbjct  327  INTICKQGRVDDAFQFLNNMGSYGCSPDTISYTTVLKGLCRAERWEDAKELLKEMVRKNC  386

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +   I   C+   +E A  ++ +M   G   ++VTYN ++   C +G++  AL+
Sbjct  387  PPNEVTFNTFICILCQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALE  446

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +   M     CKP+ +TYT L+      + +  A +L+ EML +   PN+ T+N ++   
Sbjct  447  LFYSMP----CKPNTITYTTLLTGLCNAERLDAAAELLAEMLQKDCAPNVVTFNVLVSFF  502

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G++D A E V  +   GC P++ +YN LL  + +  N ++  +LL  + S G  P  
Sbjct  503  CQKGLMDEAIELVEQMMEHGCTPNLITYNTLLDGITNDCNSEEALELLHGLVSNGVSPDI  562

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+  +  L R+ ++ +AI M  I+ + G+ P    Y+ ++ A CK    D AID  
Sbjct  563  VTYSSIIGVLSREDRVEEAIKMFHIVQDLGMRPKAVIYNKILLALCKRCNTDGAIDFF  620


 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/299 (29%), Positives = 161/299 (54%), Gaps = 5/299 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++    L  +   G++PD V  T ++KGL + K+ E   ++  +++E+  
Sbjct  222  INGMCREGRVDDAREFLNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEELFAEMMEKNC  281

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +  L+  FC+   VE A  VL +M   G   +    NI+I +IC +G++  A +
Sbjct  282  MPNEVTFDMLVRFFCRGGMVERAIQVLEQMSGHGCAANTTLCNIVINTICKQGRVDDAFQ  341

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
             L+ M     C PD ++YT +++     +   +A +L+ EM+ +   PN  T+N  +  L
Sbjct  342  FLNNMG-SYGCSPDTISYTTVLKGLCRAERWEDAKELLKEMVRKNCPPNEVTFNTFICIL  400

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G++++A   +  +   GC+ ++ +YN L+     +   D   +L     SM C+P+T
Sbjct  401  CQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALELFY---SMPCKPNT  457

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             TY   ++ LC   +L+ A  +L  M +K   PN  T++ L+S FC++G +D AI+L++
Sbjct  458  ITYTTLLTGLCNAERLDAAAELLAEMLQKDCAPNVVTFNVLVSFFCQKGLMDEAIELVE  516


 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/294 (29%), Positives = 147/294 (50%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++E+   LL+ MV+    P+ V     I  L      E+A  +++ + + G E N+
Sbjct  366  CRAERWEDAKELLKEMVRKNCPPNEVTFNTFICILCQKGLIEQATMLIEQMSEHGCEVNI  425

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y AL+ GFC   RV++A  +   M  +   P+ +TY  ++  +C+  +L  A ++L +
Sbjct  426  VTYNALVNGFCVQGRVDSALELFYSMPCK---PNTITYTTLLTGLCNAERLDAAAELLAE  482

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +  +C P+VVT+ VL+     K  + EA++LV++M+  G  PN+ TYN +L G+  + 
Sbjct  483  MLQ-KDCAPNVVTFNVLVSFFCQKGLMDEAIELVEQMMEHGCTPNLITYNTLLDGITNDC  541

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A E +  L + G  PD+ +Y+ ++  L      ++  K+   +  +G  P    YN
Sbjct  542  NSEEALELLHGLVSNGVSPDIVTYSSIIGVLSREDRVEEAIKMFHIVQDLGMRPKAVIYN  601

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              + +LC+    + AI     M   G  PN+ TY  LI     E  L    DLL
Sbjct  602  KILLALCKRCNTDGAIDFFAYMVSNGCMPNELTYITLIEGLANEDFLKETRDLL  655


 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/266 (28%), Positives = 138/266 (52%), Gaps = 3/266 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVL  703
            C  G  E+   L++ M + G + ++V    L+ G     + + A+++   +    +PN +
Sbjct  401  CQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALELFYSMP--CKPNTI  458

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             YT L+ G C   R++AA  +L  M  +   P+VVT+N+++   C +G +  A+++++QM
Sbjct  459  TYTTLLTGLCNAERLDAAAELLAEMLQKDCAPNVVTFNVLVSFFCQKGLMDEAIELVEQM  518

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGM  343
             E + C P+++TY  L++         EA++L+  ++S G+ P+I TY++I+  L RE  
Sbjct  519  ME-HGCTPNLITYNTLLDGITNDCNSEEALELLHGLVSNGVSPDIVTYSSIIGVLSREDR  577

Query  342  VDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNI  163
            V+ A +    +  +G +P    YN +L AL  R N D        M S GC P+  TY  
Sbjct  578  VEEAIKMFHIVQDLGMRPKAVIYNKILLALCKRCNTDGAIDFFAYMVSNGCMPNELTYIT  637

Query  162  FVSSLCRDGKLNKAISMLKIMTEKGL  85
             +  L  +  L +   +L+ +  +G+
Sbjct  638  LIEGLANEDFLKETRDLLRELCSRGV  663


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 58/126 (46%), Gaps = 3/126 (2%)
 Frame = -1

Query  378  NAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSS  199
            NA L+ L     +  A   V    + G  PDV+    L+R L  R    D  ++L+    
Sbjct  47   NARLRRLIARDDLAEAARLVDRATSRGEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAER  106

Query  198  MGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDL  19
             G     F YN  V+  CR G+L+ A  ++  M    + P+ +TY P+I   C  GR+  
Sbjct  107  SGTAVDVFAYNTLVAGYCRYGQLDAARRLIASMP---VAPDAYTYTPIIRGLCDRGRVGE  163

Query  18   AIDLLD  1
            A+ LLD
Sbjct  164  ALSLLD  169



>ref|XP_006585428.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic-like isoform X2 [Glycine max]
Length=405

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/304 (37%), Positives = 178/304 (59%), Gaps = 7/304 (2%)
 Frame = -1

Query  897  RLNRSCGAGK----YEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLL  730
            R+ R+   GK    Y+  L+L +Y+V  G KP+V   T+L+  L    KA KAV+VM+++
Sbjct  67   RVGRNDQKGKELRIYDAFLHL-EYLVGKGQKPEVNQATQLLYDLCKFNKARKAVRVMEMM  125

Query  729  EQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKL  553
               G  P+  +YT L+   CK   V  A  ++ +M   GF  + VTYN ++  +C  G L
Sbjct  126  VGSGIIPDAASYTHLVNFLCKRGNVGYAIQLVEKMEGHGFPTNTVTYNTLVKGLCMHGNL  185

Query  552  GLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNA  373
              +L++LD++ +     P+  TY+ L+EA   + G+ EAMKL+D+++++G EPN+ +YN 
Sbjct  186  NQSLQLLDRLTKKG-LIPNAFTYSFLLEAAYKERGVDEAMKLLDDIIAKGGEPNLVSYNV  244

Query  372  ILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMG  193
            +L GLC+EG  + A +  + LP  G  P V S+NILLR+L     W++  +LL EM    
Sbjct  245  LLTGLCKEGRTEEAIKLFQELPVKGFSPSVVSFNILLRSLCYEGRWEEANELLAEMDKED  304

Query  192  CEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              P   TYNI ++SL  +G+  +A  +L  MT  G   +  +Y+P+I+  CKEG++DL +
Sbjct  305  QPPSVVTYNILITSLSLNGRTEQAFKVLDEMTRSGFKASATSYNPIIARLCKEGKVDLVL  364

Query  12   DLLD  1
              LD
Sbjct  365  KCLD  368



>ref|XP_010667980.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=566

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 175/291 (60%), Gaps = 2/291 (1%)
 Frame = -1

Query  870  KYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYT  694
            K  +    L+YMV  G+KP+    T+L+  L  + K  KA++VM+++   G +P+  +YT
Sbjct  76   KVNDAFLYLEYMVDKGHKPEKGQATQLLYDLCKLSKVRKAIRVMEMMVSSGVKPDATSYT  135

Query  693  ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
             L+   CK   V  A  ++ +M   G+  + VTYN ++  +C  G L  +L++LD++++ 
Sbjct  136  FLVNHLCKRGNVGYAMQLVEKMEECGYPTNTVTYNSLVKGLCMLGNLKKSLQLLDRLRK-  194

Query  513  NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
               +P+V TY+ L+EA   + G+ EAMKL+DE++++G +PN+ +YN ++ GLC+EG  + 
Sbjct  195  KGLEPNVFTYSFLLEAAYKEQGVDEAMKLLDEIIAKGGKPNLVSYNVLVTGLCKEGRTEE  254

Query  333  AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVS  154
            A  F R+LP  G +P+V +YNILLR L     W++  +LL EM      P   TYNI VS
Sbjct  255  AITFFRNLPQKGFEPNVVTYNILLRTLCCEGRWNEAYELLAEMDDGDRAPSVVTYNILVS  314

Query  153  SLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            SL   G+L+ A  +L+ M   G  P   TY+P+++  CKEG++D  +  LD
Sbjct  315  SLALHGQLDHAFEVLEEMMRVGFKPTGATYNPIVTHLCKEGKVDQVMKCLD  365


 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 91/334 (27%), Positives = 162/334 (49%), Gaps = 40/334 (12%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKV---------  742
            +N  C  G     + L++ M + GY  + V    L+KGL  +   +K++++         
Sbjct  138  VNHLCKRGNVGYAMQLVEKMEECGYPTNTVTYNSLVKGLCMLGNLKKSLQLLDRLRKKGL  197

Query  741  -----------------------MQLLEQF----GEPNVLAYTALIGGFCKTNRVEAANG  643
                                   M+LL++     G+PN+++Y  L+ G CK  R E A  
Sbjct  198  EPNVFTYSFLLEAAYKEQGVDEAMKLLDEIIAKGGKPNLVSYNVLVTGLCKEGRTEEAIT  257

Query  642  VLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEAT  463
                +  +GF P+VVTYNI++ ++C  G+   A ++L +M +D +  P VVTY +L+ + 
Sbjct  258  FFRNLPQKGFEPNVVTYNILLRTLCCEGRWNEAYELLAEM-DDGDRAPSVVTYNILVSSL  316

Query  462  IVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             +   +  A ++++EM+  G +P   TYN I+  LC+EG VD+  + +  +    C P+ 
Sbjct  317  ALHGQLDHAFEVLEEMMRVGFKPTGATYNPIVTHLCKEGKVDQVMKCLDQMILQHCHPNE  376

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSS-MGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
             +YN  +  L +     +   +++ + S      H F Y   ++SLCR      A+ +L 
Sbjct  377  GTYNA-IAVLCEEGLVQEAFSIIQSLGSKSNLAIHDF-YRAVITSLCRKNNTYPALKLLN  434

Query  105  IMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             MT+ G TP+ + Y  L+   C EG LD A+++ 
Sbjct  435  EMTKFGFTPDSYMYSTLLRGLCMEGMLDAAVEIF  468


 Score =   143 bits (361),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 90/364 (25%), Positives = 168/364 (46%), Gaps = 71/364 (20%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +++L LL  + K G +P+V   + L++  +  +  ++A+K++ +++ + G+PN+
Sbjct  177  CMLGNLKKSLQLLDRLRKKGLEPNVFTYSFLLEAAYKEQGVDEAMKLLDEIIAKGGKPNL  236

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++Y  L+ G CK  R E A      +  +GF P+VVTYNI++ ++C  G+   A ++L +
Sbjct  237  VSYNVLVTGLCKEGRTEEAITFFRNLPQKGFEPNVVTYNILLRTLCCEGRWNEAYELLAE  296

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +D +  P VVTY +L+ +  +   +  A ++++EM+  G +P   TYN I+  LC+EG
Sbjct  297  M-DDGDRAPSVVTYNILVSSLALHGQLDHAFEVLEEMMRVGFKPTGATYNPIVTHLCKEG  355

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNIL---------------------------------  265
             VD+  + +  +    C P+  +YN +                                 
Sbjct  356  KVDQVMKCLDQMILQHCHPNEGTYNAIAVLCEEGLVQEAFSIIQSLGSKSNLAIHDFYRA  415

Query  264  -LRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM----  100
             + +L  + N     KLL EM+  G  P ++ Y+  +  LC +G L+ A+ + K+M    
Sbjct  416  VITSLCRKNNTYPALKLLNEMTKFGFTPDSYMYSTLLRGLCMEGMLDAAVEIFKLMEDNE  475

Query  99   -------------------------------TEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
                                            +KG  PN+ TY  ++     E   +LA 
Sbjct  476  CRPDVDNCNALILGLCKSQRTDLSLDIFQMMVDKGYKPNEMTYTIIVEGIAHEEETELAA  535

Query  12   DLLD  1
             +L+
Sbjct  536  KVLE  539


 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 83/319 (26%), Positives = 147/319 (46%), Gaps = 37/319 (12%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNV  706
            C  G+ EE +   + + + G++P+VV    L++ L    +  +A +++  ++     P+V
Sbjct  247  CKEGRTEEAITFFRNLPQKGFEPNVVTYNILLRTLCCEGRWNEAYELLAEMDDGDRAPSV  306

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+       +++ A  VL  M   GF P   TYN ++  +C  GK+   +K LDQ
Sbjct  307  VTYNILVSSLALHGQLDHAFEVLEEMMRVGFKPTGATYNPIVTHLCKEGKVDQVMKCLDQ  366

Query  525  MKEDNNCKPDVVTY---TVLIEATIVKDGIS-----------------------------  442
            M   + C P+  TY    VL E  +V++  S                             
Sbjct  367  MILQH-CHPNEGTYNAIAVLCEEGLVQEAFSIIQSLGSKSNLAIHDFYRAVITSLCRKNN  425

Query  441  --EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNI  268
               A+KL++EM   G  P+ Y Y+ +L+GLC EGM+D A E  + +    C+PDV + N 
Sbjct  426  TYPALKLLNEMTKFGFTPDSYMYSTLLRGLCMEGMLDAAVEIFKLMEDNECRPDVDNCNA  485

Query  267  LLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
            L+  L   +  D    + + M   G +P+  TY I V  +  + +   A  +L+ + E+ 
Sbjct  486  LILGLCKSQRTDLSLDIFQMMVDKGYKPNEMTYTIIVEGIAHEEETELAAKVLEELYERK  545

Query  87   LTPNKFTYDPLISAFCKEG  31
            +  ++ T + L+  +  EG
Sbjct  546  IV-SRNTMERLVMQYDLEG  563



>gb|KEH38355.1| PPR containing plant-like protein [Medicago truncatula]
Length=573

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 193/327 (59%), Gaps = 6/327 (2%)
 Frame = -1

Query  978  LQSVKVSTENRNALIQLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLC  799
            L S  ++  +++++  L + K+     + +R     +  +    L+ +V  G KP+V   
Sbjct  51   LASTHITIPSKDSVFNLPNWKD----GKNDRKSKEMRLNDAFLQLEQIVGKGNKPEVTQA  106

Query  798  TKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRS  622
            T+L+  L    KA KAV+VM+++   G  P+  +YT L+   C+   V  A  ++ +M +
Sbjct  107  TQLLYDLCRSGKARKAVRVMEIMVSSGIIPDAASYTFLVNYLCRRGNVGYAMQLVEKMEA  166

Query  621  RGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGIS  442
             GF  + VTYN ++  +C  GKL  ++++LD++ +     P+VVTY++LIEA   + G+ 
Sbjct  167  NGFPTNTVTYNTLVKGLCMYGKLNQSMQILDRLIK-KGLVPNVVTYSILIEAAYKERGVD  225

Query  441  EAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILL  262
            EAMKL+D+++++G +PN+ +YN +L GLC+EG  + A +  + LP  G KP V S+NILL
Sbjct  226  EAMKLLDDIIAKGGKPNLVSYNVLLTGLCKEGRTEDAIKLFKELPEKGFKPCVVSHNILL  285

Query  261  RALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLT  82
            R+L     WD+  +L+  M   G  P   TYN+ ++SL  DG++ +A  +L  MT+ G  
Sbjct  286  RSLCYEGRWDEAYELMAGMDRDGQAPSVVTYNVLITSLSIDGRIEQAFKVLDEMTKSGFK  345

Query  81   PNKFTYDPLISAFCKEGRLDLAIDLLD  1
             +  +Y+P+I+  CKEGR+DL +  LD
Sbjct  346  VSANSYNPIIARLCKEGRVDLVVQCLD  372


 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 165/364 (45%), Gaps = 71/364 (20%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNV  706
            C  GK  +++ +L  ++K G  P+VV  + LI+  +  +  ++A+K++  ++ + G+PN+
Sbjct  184  CMYGKLNQSMQILDRLIKKGLVPNVVTYSILIEAAYKERGVDEAMKLLDDIIAKGGKPNL  243

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++Y  L+ G CK  R E A  +   +  +GF P VV++NI++ S+C  G+   A +++  
Sbjct  244  VSYNVLLTGLCKEGRTEDAIKLFKELPEKGFKPCVVSHNILLRSLCYEGRWDEAYELMAG  303

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDE------------------------  418
            M  D    P VVTY VLI +  +   I +A K++DE                        
Sbjct  304  MDRDGQA-PSVVTYNVLITSLSIDGRIEQAFKVLDEMTKSGFKVSANSYNPIIARLCKEG  362

Query  417  -----------MLSRGLEPNIYTYNAI---------------------------------  370
                       M++R    N  TYNAI                                 
Sbjct  363  RVDLVVQCLDQMINRRFHLNGGTYNAIALLCERGMVKEAFLILERLGKKQNYPISDFYKN  422

Query  369  -LKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMG  193
             +  LCR+G    A++ +  +   G  PD ++Y+ L+R +      D+  ++   +   G
Sbjct  423  VITLLCRKGNTYPAFQILYEMTVHGFTPDSYTYSSLIRGMCREGMLDEALQIFGILEEHG  482

Query  192  CEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              PH   YN  +  LC+  +++ +I + ++M  KG  PN+ TY+ L+ A   E  ++LA 
Sbjct  483  YVPHVDNYNALILGLCKSQRIDMSIEIFQMMVNKGCMPNEMTYNILVEALAFEEEMELAA  542

Query  12   DLLD  1
             LL+
Sbjct  543  TLLN  546


 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/296 (29%), Positives = 158/296 (53%), Gaps = 5/296 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NV  706
            C +GK  + + +++ MV  G  PD    T L+  L        A+++++ +E  G P N 
Sbjct  114  CRSGKARKAVRVMEIMVSSGIIPDAASYTFLVNYLCRRGNVGYAMQLVEKMEANGFPTNT  173

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  L+ G C   ++  +  +L+R+  +G  P+VVTY+I+I +      +  A+K+LD 
Sbjct  174  VTYNTLVKGLCMYGKLNQSMQILDRLIKKGLVPNVVTYSILIEAAYKERGVDEAMKLLDD  233

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            +      KP++V+Y VL+   + K+G +E A+KL  E+  +G +P + ++N +L+ LC E
Sbjct  234  IIAKGG-KPNLVSYNVLLTG-LCKEGRTEDAIKLFKELPEKGFKPCVVSHNILLRSLCYE  291

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTY  169
            G  D AYE +  +   G  P V +YN+L+ +L      +   K+L EM+  G +    +Y
Sbjct  292  GRWDEAYELMAGMDRDGQAPSVVTYNVLITSLSIDGRIEQAFKVLDEMTKSGFKVSANSY  351

Query  168  NIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            N  ++ LC++G+++  +  L  M  +    N  TY+  I+  C+ G +  A  +L+
Sbjct  352  NPIIARLCKEGRVDLVVQCLDQMINRRFHLNGGTYNA-IALLCERGMVKEAFLILE  406


 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/267 (30%), Positives = 136/267 (51%), Gaps = 3/267 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+++E   L+  M + G  P VV    LI  L    + E+A KV+  + + G + + 
Sbjct  289  CYEGRWDEAYELMAGMDRDGQAPSVVTYNVLITSLSIDGRIEQAFKVLDEMTKSGFKVSA  348

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
             +Y  +I   CK  RV+     L++M +R F  +  TYN  I  +C+RG +  A  +L++
Sbjct  349  NSYNPIIARLCKEGRVDLVVQCLDQMINRRFHLNGGTYN-AIALLCERGMVKEAFLILER  407

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            + +  N  P    Y  +I     K     A +++ EM   G  P+ YTY+++++G+CREG
Sbjct  408  LGKKQN-YPISDFYKNVITLLCRKGNTYPAFQILYEMTVHGFTPDSYTYSSLIRGMCREG  466

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
            M+D A +    L   G  P V +YN L+  L   +  D   ++ + M + GC P+  TYN
Sbjct  467  MLDEALQIFGILEEHGYVPHVDNYNALILGLCKSQRIDMSIEIFQMMVNKGCMPNEMTYN  526

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I V +L  + ++  A ++L  +  KG+
Sbjct  527  ILVEALAFEEEMELAATLLNELYLKGV  553



>ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=567

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 193/329 (59%), Gaps = 10/329 (3%)
 Frame = -1

Query  978  LQSVKVSTENRNALIQLLD--SKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVV  805
            L S +++   ++++I L +  S + D R R  R   A       + L+++VK G+KPDVV
Sbjct  45   LASTQITISPKDSVITLPNWRSGKNDQRNRDMRISDA------FFHLEHIVKNGHKPDVV  98

Query  804  LCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRM  628
              T+L+  L    K +KA++VM+++   G  P+  +YT L+   CK   V  A  ++ +M
Sbjct  99   QATQLLYDLCKSNKMKKAIRVMEMMISCGIIPDAASYTFLVNHLCKRGNVGYAMQLVEKM  158

Query  627  RSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDG  448
               G+  + VTYN ++  +C  G L  +L+ LD++ +     P+  TY+ L+EA   + G
Sbjct  159  EDSGYPANTVTYNTLVKGLCMHGNLNKSLQFLDRLMQ-KGLVPNAFTYSSLLEAAYKERG  217

Query  447  ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNI  268
            ++EAM+L+DE++++G +PN+ +YN +L GLC+EG ++ A    ++LP+ G  P+V SYNI
Sbjct  218  VNEAMRLLDEIIAKGGQPNLVSYNVLLTGLCKEGRIEEAIRLFKNLPSKGFSPNVVSYNI  277

Query  267  LLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
            LLR+L     W++  +LL EM+     P   TYNI + SL   GK+ +A+ ++  M    
Sbjct  278  LLRSLCYEGRWEEANELLAEMNGRERSPSIVTYNILIGSLAFHGKIEQALQVIDEMMMGP  337

Query  87   LTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              P   +Y+P+I+  CKEG+++  ++ LD
Sbjct  338  FKPTATSYNPIIARLCKEGKVEAVVNCLD  366


 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/329 (26%), Positives = 167/329 (51%), Gaps = 36/329 (11%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G   ++L  L  +++ G  P+    + L++  +  +   +A++++ +++ + G+PN+
Sbjct  178  CMHGNLNKSLQFLDRLMQKGLVPNAFTYSSLLEAAYKERGVNEAMRLLDEIIAKGGQPNL  237

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++Y  L+ G CK  R+E A  +   + S+GF P+VV+YNI++ S+C  G+   A ++L +
Sbjct  238  VSYNVLLTGLCKEGRIEEAIRLFKNLPSKGFSPNVVSYNILLRSLCYEGRWEEANELLAE  297

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M       P +VTY +LI +      I +A++++DEM+    +P   +YN I+  LC+EG
Sbjct  298  MNGRER-SPSIVTYNILIGSLAFHGKIEQALQVIDEMMMGPFKPTATSYNPIIARLCKEG  356

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNI---------------LLRALLDRRNWDDGEK---  220
             V+     +  +    C P+  ++N                L+++L +++N    +    
Sbjct  357  KVEAVVNCLDQMIFGRCSPNEGTFNAIAVLCYEGKVQEAFSLIQSLGNKQNSSIHDYYKG  416

Query  219  ----------------LLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
                            LL EM+  G  P ++TY+  +  LC +G L +A+ + K++ E  
Sbjct  417  VVSCLCKKGNTYPAFLLLYEMTKYGFTPDSYTYSSLIRGLCIEGMLYEAMEIFKLLEEDH  476

Query  87   LTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              P+   ++ LI  FCK  R DL++++ +
Sbjct  477  YRPDIDNFNALILGFCKSHRTDLSLEVFE  505


 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 127/298 (43%), Gaps = 44/298 (15%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG---EP  712
            C  G+ EE + L + +   G+ P+VV    L++ L    + E+A ++  L E  G    P
Sbjct  248  CKEGRIEEAIRLFKNLPSKGFSPNVVSYNILLRSLCYEGRWEEANEL--LAEMNGRERSP  305

Query  711  NVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVL  532
            +++ Y  LIG      ++E A  V++ M    F P   +YN +I  +C  GK+   +  L
Sbjct  306  SIVTYNILIGSLAFHGKIEQALQVIDEMMMGPFKPTATSYNPIIARLCKEGKVEAVVNCL  365

Query  531  DQMKEDNNCKPDVVTYTVLIEATIVKDG-ISEAMKLVD----------------------  421
            DQM     C P+  T+  +  A +  +G + EA  L+                       
Sbjct  366  DQMI-FGRCSPNEGTFNAI--AVLCYEGKVQEAFSLIQSLGNKQNSSIHDYYKGVVSCLC  422

Query  420  -------------EMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
                         EM   G  P+ YTY+++++GLC EGM+  A E  + L     +PD+ 
Sbjct  423  KKGNTYPAFLLLYEMTKYGFTPDSYTYSSLIRGLCIEGMLYEAMEIFKLLEEDHYRPDID  482

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
            ++N L+         D   ++ + M   G  P   TY I V  +  + +   A  +L+
Sbjct  483  NFNALILGFCKSHRTDLSLEVFEMMIEKGYTPSETTYTILVEGIIHEEEKELAAEVLR  540



>gb|EAZ13767.1| hypothetical protein OsJ_03693 [Oryza sativa Japonica Group]
Length=715

 Score =   213 bits (542),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 162/276 (59%), Gaps = 5/276 (2%)
 Frame = -1

Query  825  GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAA  649
            G  PDV LCTKLI+ L    +   A +V++  E+ G   +V AY  L+ G+C+  +++AA
Sbjct  104  GEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAERSGTAVDVFAYNTLVAGYCRYGQLDAA  163

Query  648  NGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIE  469
              ++  M      PD  TY  +I  +CDRG++G AL +LD M     C+P VVTYTVL+E
Sbjct  164  RRLIASM---PVAPDAYTYTPIIRGLCDRGRVGEALSLLDDMLH-RGCQPSVVTYTVLLE  219

Query  468  ATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKP  289
            A     G  +AM+++DEM ++G  PNI TYN I+ G+CREG VD A EF+  L + G +P
Sbjct  220  AVCKSTGFGQAMEVLDEMRAKGCTPNIVTYNVIINGMCREGRVDDAREFLNRLSSYGFQP  279

Query  288  DVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISML  109
            D  SY  +L+ L   + W+D E+L  EM    C P+  T+++ V   CR G + +AI +L
Sbjct  280  DTVSYTTVLKGLCAAKRWEDVEELFAEMMEKNCMPNEVTFDMLVRFFCRGGMVERAIQVL  339

Query  108  KIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + M+  G   N    + +I+  CK+GR+D A   L+
Sbjct  340  EQMSGHGCAANTTLCNIVINTICKQGRVDDAFQFLN  375


 Score =   184 bits (468),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/294 (32%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  E L LL  M+  G +P VV  T L++ +       +A++V+  +   G  PN+
Sbjct  187  CDRGRVGEALSLLDDMLHRGCQPSVVTYTVLLEAVCKSTGFGQAMEVLDEMRAKGCTPNI  246

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  +I G C+  RV+ A   LNR+ S GF PD V+Y  ++  +C   +     ++  +
Sbjct  247  VTYNVIINGMCREGRVDDAREFLNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEELFAE  306

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E  NC P+ VT+ +L+        +  A++++++M   G   N    N ++  +C++G
Sbjct  307  MME-KNCMPNEVTFDMLVRFFCRGGMVERAIQVLEQMSGHGCAANTTLCNIVINTICKQG  365

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A++F+ ++ + GC PD  SY  +L+ L     W+D ++LLKEM    C P+  T+N
Sbjct  366  RVDDAFQFLNNMGSYGCSPDTISYTTVLKGLCRAERWEDAKELLKEMVRKNCPPNEVTFN  425

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             F+  LC+ G + +A  +++ M+E G   N  TY+ L++ FC +GR+D A++L 
Sbjct  426  TFICILCQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALELF  479


 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 153/298 (51%), Gaps = 5/298 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++    L  M   G  PD +  T ++KGL   ++ E A +++ +++ +  
Sbjct  358  INTICKQGRVDDAFQFLNNMGSYGCSPDTISYTTVLKGLCRAERWEDAKELLKEMVRKNC  417

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +   I   C+   +E A  ++ +M   G   ++VTYN ++   C +G++  AL+
Sbjct  418  PPNEVTFNTFICILCQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALE  477

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +   M     CKP+ +TYT L+      + +  A +L+ EML +   PN+ T+N ++   
Sbjct  478  LFYSMP----CKPNTITYTTLLTGLCNAERLDAAAELLAEMLQKDCAPNVVTFNVLVSFF  533

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G++D A E V  +   GC P++ +YN LL  +    N ++  +LL  + S G  P  
Sbjct  534  CQKGLMDEAIELVEQMMEHGCTPNLITYNTLLDGITKDCNSEEALELLHGLVSNGVSPDI  593

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             TY+  +  L R+ ++ +AI M  I+ + G+ P    Y+ ++ A CK    D AID  
Sbjct  594  VTYSSIIGVLSREDRVEEAIKMFHIVQDLGMRPKAVIYNKILLALCKRCNTDGAIDFF  651


 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/299 (29%), Positives = 161/299 (54%), Gaps = 5/299 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++    L  +   G++PD V  T ++KGL + K+ E   ++  +++E+  
Sbjct  253  INGMCREGRVDDAREFLNRLSSYGFQPDTVSYTTVLKGLCAAKRWEDVEELFAEMMEKNC  312

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +  L+  FC+   VE A  VL +M   G   +    NI+I +IC +G++  A +
Sbjct  313  MPNEVTFDMLVRFFCRGGMVERAIQVLEQMSGHGCAANTTLCNIVINTICKQGRVDDAFQ  372

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
             L+ M     C PD ++YT +++     +   +A +L+ EM+ +   PN  T+N  +  L
Sbjct  373  FLNNMG-SYGCSPDTISYTTVLKGLCRAERWEDAKELLKEMVRKNCPPNEVTFNTFICIL  431

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G++++A   +  +   GC+ ++ +YN L+     +   D   +L     SM C+P+T
Sbjct  432  CQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALELFY---SMPCKPNT  488

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             TY   ++ LC   +L+ A  +L  M +K   PN  T++ L+S FC++G +D AI+L++
Sbjct  489  ITYTTLLTGLCNAERLDAAAELLAEMLQKDCAPNVVTFNVLVSFFCQKGLMDEAIELVE  547


 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/294 (29%), Positives = 148/294 (50%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++E+   LL+ MV+    P+ V     I  L      E+A  +++ + + G E N+
Sbjct  397  CRAERWEDAKELLKEMVRKNCPPNEVTFNTFICILCQKGLIEQATMLIEQMSEHGCEVNI  456

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y AL+ GFC   RV++A  +   M  +   P+ +TY  ++  +C+  +L  A ++L +
Sbjct  457  VTYNALVNGFCVQGRVDSALELFYSMPCK---PNTITYTTLLTGLCNAERLDAAAELLAE  513

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M +  +C P+VVT+ VL+     K  + EA++LV++M+  G  PN+ TYN +L G+ ++ 
Sbjct  514  MLQ-KDCAPNVVTFNVLVSFFCQKGLMDEAIELVEQMMEHGCTPNLITYNTLLDGITKDC  572

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A E +  L + G  PD+ +Y+ ++  L      ++  K+   +  +G  P    YN
Sbjct  573  NSEEALELLHGLVSNGVSPDIVTYSSIIGVLSREDRVEEAIKMFHIVQDLGMRPKAVIYN  632

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              + +LC+    + AI     M   G  PN+ TY  LI     E  L    DLL
Sbjct  633  KILLALCKRCNTDGAIDFFAYMVSNGCMPNELTYITLIEGLANEDFLKETRDLL  686


 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 142/267 (53%), Gaps = 5/267 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVL  703
            C  G  E+   L++ M + G + ++V    L+ G     + + A+++   +    +PN +
Sbjct  432  CQKGLIEQATMLIEQMSEHGCEVNIVTYNALVNGFCVQGRVDSALELFYSMP--CKPNTI  489

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             YT L+ G C   R++AA  +L  M  +   P+VVT+N+++   C +G +  A+++++QM
Sbjct  490  TYTTLLTGLCNAERLDAAAELLAEMLQKDCAPNVVTFNVLVSFFCQKGLMDEAIELVEQM  549

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGIS-EAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
             E + C P+++TY  L++  I KD  S EA++L+  ++S G+ P+I TY++I+  L RE 
Sbjct  550  ME-HGCTPNLITYNTLLDG-ITKDCNSEEALELLHGLVSNGVSPDIVTYSSIIGVLSRED  607

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             V+ A +    +  +G +P    YN +L AL  R N D        M S GC P+  TY 
Sbjct  608  RVEEAIKMFHIVQDLGMRPKAVIYNKILLALCKRCNTDGAIDFFAYMVSNGCMPNELTYI  667

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
              +  L  +  L +   +L+ +  +G+
Sbjct  668  TLIEGLANEDFLKETRDLLRELCSRGV  694


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 81/178 (46%), Gaps = 32/178 (18%)
 Frame = -1

Query  438  AMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNIL--  265
            A +LVD   SRG  P++Y    +++ LCR G    A   +R+    G   DVF+YN L  
Sbjct  93   AARLVDRATSRGEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAERSGTAVDVFAYNTLVA  152

Query  264  ------------------------------LRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
                                          +R L DR    +   LL +M   GC+P   
Sbjct  153  GYCRYGQLDAARRLIASMPVAPDAYTYTPIIRGLCDRGRVGEALSLLDDMLHRGCQPSVV  212

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TY + + ++C+     +A+ +L  M  KG TPN  TY+ +I+  C+EGR+D A + L+
Sbjct  213  TYTVLLEAVCKSTGFGQAMEVLDEMRAKGCTPNIVTYNVIINGMCREGRVDDAREFLN  270


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 53/112 (47%), Gaps = 3/112 (3%)
 Frame = -1

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFV  157
            RA   V    + G  PDV+    L+R L  R    D  ++L+     G     F YN  V
Sbjct  92   RAARLVDRATSRGEAPDVYLCTKLIRNLCRRGRTSDAARVLRAAERSGTAVDVFAYNTLV  151

Query  156  SSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +  CR G+L+ A  ++  M    + P+ +TY P+I   C  GR+  A+ LLD
Sbjct  152  AGYCRYGQLDAARRLIASMP---VAPDAYTYTPIIRGLCDRGRVGEALSLLD  200



>ref|XP_008645840.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Zea mays]
Length=735

 Score =   213 bits (542),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 171/302 (57%), Gaps = 8/302 (3%)
 Frame = -1

Query  903  RRRLNRSCGAGKYEETLYLLQYMVKIGYK--PDVVLCTKLIKGLFSVKKAEKAVKVMQLL  730
            +RRL      G+ +E L L   M   G +  P VV C  LIK L S  +   A +V   L
Sbjct  71   KRRLRSLVQRGEIDEALVLFDSMASGGGRNCPPVVPCNILIKRLCSDGRVSDAERVFAAL  130

Query  729  EQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLG  550
                   V+ Y  ++ G+C+  R+E A  ++N M    F PD  T+N +I ++C RG++ 
Sbjct  131  GPSA--TVVTYNTMVNGYCRAGRIEDARRLINGMP---FPPDTFTFNPLIRALCVRGRIP  185

Query  549  LALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAI  370
             AL V D M     C P VVTY++L++AT  + G  +AM L+DEM ++G EP+I TYN +
Sbjct  186  DALAVFDDMLH-RGCSPSVVTYSILLDATCKESGYRQAMALLDEMRAKGCEPDIVTYNVL  244

Query  369  LKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGC  190
            +  +C EG VD A   + +LP+ GCKPD  +Y  +L++L     W + E+LL EM+S  C
Sbjct  245  INAMCNEGDVDEALNILSNLPSHGCKPDAVTYTPVLKSLCGSERWKEVEELLAEMTSNNC  304

Query  189  EPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAID  10
             P   T+N  V+SLC+ G +++AI ++  M+E G   +  TY  ++   C  GR+D A++
Sbjct  305  APDEVTFNTIVTSLCQQGLVDRAIEVVDHMSEHGCVADIVTYSSILDGLCDVGRVDDAVE  364

Query  9    LL  4
            LL
Sbjct  365  LL  366


 Score =   190 bits (482),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 94/294 (32%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CG+ +++E   LL  M      PD V    ++  L      ++A++V+  + + G   ++
Sbjct  284  CGSERWKEVEELLAEMTSNNCAPDEVTFNTIVTSLCQQGLVDRAIEVVDHMSEHGCVADI  343

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y++++ G C   RV+ A  +L+R++S G  PD + Y  ++  +C   +   A +++ +
Sbjct  344  VTYSSILDGLCDVGRVDDAVELLSRLKSYGCKPDTIAYTTVLKGLCSTEQWERAEELMAE  403

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   ++C PD VT+  ++ +   K  +  A+++V++M   G  P+I TYN I+ GLC E 
Sbjct  404  MLC-SDCPPDEVTFNTVVASLCQKGLVDRAIRVVEQMSENGCSPDIVTYNCIIDGLCNES  462

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A E +  L + GCKPD+ ++N LL+ L     W+D E+L+  M    C P   T+N
Sbjct  463  CIDDAMELLSDLQSCGCKPDIVTFNTLLKGLCGVDRWEDAEQLMANMMRSNCPPDELTFN  522

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              ++SLC+ G L +AI  LKIM E G  PN  TY  ++ A  K G+   A++LL
Sbjct  523  TVITSLCQKGLLTQAIETLKIMAENGCVPNSSTYSIVVDALLKAGKAQAALELL  576


 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/333 (31%), Positives = 171/333 (51%), Gaps = 40/333 (12%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFG  718
            +N  C AG+ E+   L+  M    + PD      LI+ L    +   A+ V   +L +  
Sbjct  143  VNGYCRAGRIEDARRLINGM---PFPPDTFTFNPLIRALCVRGRIPDALAVFDDMLHRGC  199

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             P+V+ Y+ L+   CK +    A  +L+ MR++G  PD+VTYN++I ++C+ G +  AL 
Sbjct  200  SPSVVTYSILLDATCKESGYRQAMALLDEMRAKGCEPDIVTYNVLINAMCNEGDVDEALN  259

Query  537  VLDQMKEDNNCKPDVVTYTVLIEA----------------------------------TI  460
            +L  +   + CKPD VTYT ++++                                  ++
Sbjct  260  ILSNLPS-HGCKPDAVTYTPVLKSLCGSERWKEVEELLAEMTSNNCAPDEVTFNTIVTSL  318

Query  459  VKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             + G +  A+++VD M   G   +I TY++IL GLC  G VD A E +  L + GCKPD 
Sbjct  319  CQQGLVDRAIEVVDHMSEHGCVADIVTYSSILDGLCDVGRVDDAVELLSRLKSYGCKPDT  378

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +Y  +L+ L     W+  E+L+ EM    C P   T+N  V+SLC+ G +++AI +++ 
Sbjct  379  IAYTTVLKGLCSTEQWERAEELMAEMLCSDCPPDEVTFNTVVASLCQKGLVDRAIRVVEQ  438

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            M+E G +P+  TY+ +I   C E  +D A++LL
Sbjct  439  MSENGCSPDIVTYNCIIDGLCNESCIDDAMELL  471


 Score =   176 bits (446),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/294 (32%), Positives = 169/294 (57%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  +  + ++ +M + G   D+V  + ++ GL  V + + AV+++  L+ +G +P+ 
Sbjct  319  CQQGLVDRAIEVVDHMSEHGCVADIVTYSSILDGLCDVGRVDDAVELLSRLKSYGCKPDT  378

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            +AYT ++ G C T + E A  ++  M      PD VT+N ++ S+C +G +  A++V++Q
Sbjct  379  IAYTTVLKGLCSTEQWERAEELMAEMLCSDCPPDEVTFNTVVASLCQKGLVDRAIRVVEQ  438

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E N C PD+VTY  +I+    +  I +AM+L+ ++ S G +P+I T+N +LKGLC   
Sbjct  439  MSE-NGCSPDIVTYNCIIDGLCNESCIDDAMELLSDLQSCGCKPDIVTFNTLLKGLCGVD  497

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A + + ++    C PD  ++N ++ +L  +       + LK M+  GC P++ TY+
Sbjct  498  RWEDAEQLMANMMRSNCPPDELTFNTVITSLCQKGLLTQAIETLKIMAENGCVPNSSTYS  557

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            I V +L + GK   A+ +L  MT    TP+  TY+ +IS   K G+++ A+DLL
Sbjct  558  IVVDALLKAGKAQAALELLSGMTNG--TPDLITYNTVISNLTKAGKMEEALDLL  609


 Score =   137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 125/238 (53%), Gaps = 7/238 (3%)
 Frame = -1

Query  714  PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKV  535
            P V+    LI   C   RV  A  V   +   G    VVTYN M+   C  G++  A ++
Sbjct  102  PPVVPCNILIKRLCSDGRVSDAERVFAAL---GPSATVVTYNTMVNGYCRAGRIEDARRL  158

Query  534  LDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLC  355
            ++ M       PD  T+  LI A  V+  I +A+ + D+ML RG  P++ TY+ +L   C
Sbjct  159  INGMPF----PPDTFTFNPLIRALCVRGRIPDALAVFDDMLHRGCSPSVVTYSILLDATC  214

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            +E    +A   +  + A GC+PD+ +YN+L+ A+ +  + D+   +L  + S GC+P   
Sbjct  215  KESGYRQAMALLDEMRAKGCEPDIVTYNVLINAMCNEGDVDEALNILSNLPSHGCKPDAV  274

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TY   + SLC   +  +   +L  MT     P++ T++ ++++ C++G +D AI+++D
Sbjct  275  TYTPVLKSLCGSERWKEVEELLAEMTSNNCAPDEVTFNTIVTSLCQQGLVDRAIEVVD  332


 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/294 (28%), Positives = 146/294 (50%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  +  + +++ M + G  PD+V    +I GL +    + A++++  L+  G +P++
Sbjct  424  CQKGLVDRAIRVVEQMSENGCSPDIVTYNCIIDGLCNESCIDDAMELLSDLQSCGCKPDI  483

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + +  L+ G C  +R E A  ++  M      PD +T+N +I S+C +G L  A++ L  
Sbjct  484  VTFNTLLKGLCGVDRWEDAEQLMANMMRSNCPPDELTFNTVITSLCQKGLLTQAIETLKI  543

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E N C P+  TY+++++A +       A++L+  M +    P++ TYN ++  L + G
Sbjct  544  MAE-NGCVPNSSTYSIVVDALLKAGKAQAALELLSGMTNG--TPDLITYNTVISNLTKAG  600

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             ++ A + +R + + G  PD  +Y  L   +      D   ++L+ +   G  P T  YN
Sbjct  601  KMEEALDLLRVMVSNGLCPDTTTYRSLAYGVCREDGTDRAVRMLRRVQDTGLSPDTTFYN  660

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +   CRD + + AI     M   G  P++ TY  L+ A    G LD A  LL
Sbjct  661  DVLLGFCRDRRTDLAIDCFAHMVSSGCMPDESTYVILLEALAYGGLLDEAKRLL  714


 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/272 (30%), Positives = 126/272 (46%), Gaps = 4/272 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C     ++ + LL  +   G KPD+V    L+KGL  V + E A ++M  ++     P+ 
Sbjct  459  CNESCIDDAMELLSDLQSCGCKPDIVTFNTLLKGLCGVDRWEDAEQLMANMMRSNCPPDE  518

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L +  +I   C+   +  A   L  M   G  P+  TY+I++ ++   GK   AL++L  
Sbjct  519  LTFNTVITSLCQKGLLTQAIETLKIMAENGCVPNSSTYSIVVDALLKAGKAQAALELLSG  578

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M    N  PD++TY  +I        + EA+ L+  M+S GL P+  TY ++  G+CRE 
Sbjct  579  M---TNGTPDLITYNTVISNLTKAGKMEEALDLLRVMVSNGLCPDTTTYRSLAYGVCRED  635

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              DRA   +R +   G  PD   YN +L      R  D        M S GC P   TY 
Sbjct  636  GTDRAVRMLRRVQDTGLSPDTTFYNDVLLGFCRDRRTDLAIDCFAHMVSSGCMPDESTYV  695

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKF  70
            I + +L   G L++A  +L  +   G+   K 
Sbjct  696  ILLEALAYGGLLDEAKRLLASLCSLGVLDKKL  727



>gb|AFW71875.1| hypothetical protein ZEAMMB73_225396 [Zea mays]
Length=818

 Score =   213 bits (542),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 171/302 (57%), Gaps = 8/302 (3%)
 Frame = -1

Query  903  RRRLNRSCGAGKYEETLYLLQYMVKIGYK--PDVVLCTKLIKGLFSVKKAEKAVKVMQLL  730
            +RRL      G+ +E L L   M   G +  P VV C  LIK L S  +   A +V   L
Sbjct  154  KRRLRSLVQRGEIDEALVLFDSMASGGGRNCPPVVPCNILIKRLCSDGRVSDAERVFAAL  213

Query  729  EQFGEPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLG  550
                   V+ Y  ++ G+C+  R+E A  ++N M    F PD  T+N +I ++C RG++ 
Sbjct  214  GPSA--TVVTYNTMVNGYCRAGRIEDARRLINGMP---FPPDTFTFNPLIRALCVRGRIP  268

Query  549  LALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAI  370
             AL V D M     C P VVTY++L++AT  + G  +AM L+DEM ++G EP+I TYN +
Sbjct  269  DALAVFDDMLH-RGCSPSVVTYSILLDATCKESGYRQAMALLDEMRAKGCEPDIVTYNVL  327

Query  369  LKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGC  190
            +  +C EG VD A   + +LP+ GCKPD  +Y  +L++L     W + E+LL EM+S  C
Sbjct  328  INAMCNEGDVDEALNILSNLPSHGCKPDAVTYTPVLKSLCGSERWKEVEELLAEMTSNNC  387

Query  189  EPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAID  10
             P   T+N  V+SLC+ G +++AI ++  M+E G   +  TY  ++   C  GR+D A++
Sbjct  388  APDEVTFNTIVTSLCQQGLVDRAIEVVDHMSEHGCVADIVTYSSILDGLCDVGRVDDAVE  447

Query  9    LL  4
            LL
Sbjct  448  LL  449


 Score =   189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/294 (32%), Positives = 162/294 (55%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            CG+ +++E   LL  M      PD V    ++  L      ++A++V+  + + G   ++
Sbjct  367  CGSERWKEVEELLAEMTSNNCAPDEVTFNTIVTSLCQQGLVDRAIEVVDHMSEHGCVADI  426

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y++++ G C   RV+ A  +L+R++S G  PD + Y  ++  +C   +   A +++ +
Sbjct  427  VTYSSILDGLCDVGRVDDAVELLSRLKSYGCKPDTIAYTTVLKGLCSTEQWERAEELMAE  486

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M   ++C PD VT+  ++ +   K  +  A+++V++M   G  P+I TYN I+ GLC E 
Sbjct  487  MLC-SDCPPDEVTFNTVVASLCQKGLVDRAIRVVEQMSENGCSPDIVTYNCIIDGLCNES  545

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             +D A E +  L + GCKPD+ ++N LL+ L     W+D E+L+  M    C P   T+N
Sbjct  546  CIDDAMELLSDLQSCGCKPDIVTFNTLLKGLCGVDRWEDAEQLMANMMRSNCPPDELTFN  605

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              ++SLC+ G L +AI  LKIM E G  PN  TY  ++ A  K G+   A++LL
Sbjct  606  TVITSLCQKGLLTQAIETLKIMAENGCVPNSSTYSIVVDALLKAGKAQAALELL  659


 Score =   180 bits (456),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 103/333 (31%), Positives = 171/333 (51%), Gaps = 40/333 (12%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFG  718
            +N  C AG+ E+   L+  M    + PD      LI+ L    +   A+ V   +L +  
Sbjct  226  VNGYCRAGRIEDARRLINGM---PFPPDTFTFNPLIRALCVRGRIPDALAVFDDMLHRGC  282

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             P+V+ Y+ L+   CK +    A  +L+ MR++G  PD+VTYN++I ++C+ G +  AL 
Sbjct  283  SPSVVTYSILLDATCKESGYRQAMALLDEMRAKGCEPDIVTYNVLINAMCNEGDVDEALN  342

Query  537  VLDQMKEDNNCKPDVVTYTVLIEA----------------------------------TI  460
            +L  +   + CKPD VTYT ++++                                  ++
Sbjct  343  ILSNLPS-HGCKPDAVTYTPVLKSLCGSERWKEVEELLAEMTSNNCAPDEVTFNTIVTSL  401

Query  459  VKDG-ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDV  283
             + G +  A+++VD M   G   +I TY++IL GLC  G VD A E +  L + GCKPD 
Sbjct  402  CQQGLVDRAIEVVDHMSEHGCVADIVTYSSILDGLCDVGRVDDAVELLSRLKSYGCKPDT  461

Query  282  FSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKI  103
             +Y  +L+ L     W+  E+L+ EM    C P   T+N  V+SLC+ G +++AI +++ 
Sbjct  462  IAYTTVLKGLCSTEQWERAEELMAEMLCSDCPPDEVTFNTVVASLCQKGLVDRAIRVVEQ  521

Query  102  MTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            M+E G +P+  TY+ +I   C E  +D A++LL
Sbjct  522  MSENGCSPDIVTYNCIIDGLCNESCIDDAMELL  554


 Score =   175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/294 (32%), Positives = 169/294 (57%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  +  + ++ +M + G   D+V  + ++ GL  V + + AV+++  L+ +G +P+ 
Sbjct  402  CQQGLVDRAIEVVDHMSEHGCVADIVTYSSILDGLCDVGRVDDAVELLSRLKSYGCKPDT  461

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            +AYT ++ G C T + E A  ++  M      PD VT+N ++ S+C +G +  A++V++Q
Sbjct  462  IAYTTVLKGLCSTEQWERAEELMAEMLCSDCPPDEVTFNTVVASLCQKGLVDRAIRVVEQ  521

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E N C PD+VTY  +I+    +  I +AM+L+ ++ S G +P+I T+N +LKGLC   
Sbjct  522  MSE-NGCSPDIVTYNCIIDGLCNESCIDDAMELLSDLQSCGCKPDIVTFNTLLKGLCGVD  580

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A + + ++    C PD  ++N ++ +L  +       + LK M+  GC P++ TY+
Sbjct  581  RWEDAEQLMANMMRSNCPPDELTFNTVITSLCQKGLLTQAIETLKIMAENGCVPNSSTYS  640

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
            I V +L + GK   A+ +L  MT    TP+  TY+ +IS   K G+++ A+DLL
Sbjct  641  IVVDALLKAGKAQAALELLSGMTNG--TPDLITYNTVISNLTKAGKMEEALDLL  692


 Score =   137 bits (344),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 125/238 (53%), Gaps = 7/238 (3%)
 Frame = -1

Query  714  PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKV  535
            P V+    LI   C   RV  A  V   +   G    VVTYN M+   C  G++  A ++
Sbjct  185  PPVVPCNILIKRLCSDGRVSDAERVFAAL---GPSATVVTYNTMVNGYCRAGRIEDARRL  241

Query  534  LDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLC  355
            ++ M       PD  T+  LI A  V+  I +A+ + D+ML RG  P++ TY+ +L   C
Sbjct  242  INGMPF----PPDTFTFNPLIRALCVRGRIPDALAVFDDMLHRGCSPSVVTYSILLDATC  297

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            +E    +A   +  + A GC+PD+ +YN+L+ A+ +  + D+   +L  + S GC+P   
Sbjct  298  KESGYRQAMALLDEMRAKGCEPDIVTYNVLINAMCNEGDVDEALNILSNLPSHGCKPDAV  357

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            TY   + SLC   +  +   +L  MT     P++ T++ ++++ C++G +D AI+++D
Sbjct  358  TYTPVLKSLCGSERWKEVEELLAEMTSNNCAPDEVTFNTIVTSLCQQGLVDRAIEVVD  415


 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/294 (28%), Positives = 146/294 (50%), Gaps = 4/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G  +  + +++ M + G  PD+V    +I GL +    + A++++  L+  G +P++
Sbjct  507  CQKGLVDRAIRVVEQMSENGCSPDIVTYNCIIDGLCNESCIDDAMELLSDLQSCGCKPDI  566

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + +  L+ G C  +R E A  ++  M      PD +T+N +I S+C +G L  A++ L  
Sbjct  567  VTFNTLLKGLCGVDRWEDAEQLMANMMRSNCPPDELTFNTVITSLCQKGLLTQAIETLKI  626

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E N C P+  TY+++++A +       A++L+  M +    P++ TYN ++  L + G
Sbjct  627  MAE-NGCVPNSSTYSIVVDALLKAGKAQAALELLSGMTNG--TPDLITYNTVISNLTKAG  683

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             ++ A + +R + + G  PD  +Y  L   +      D   ++L+ +   G  P T  YN
Sbjct  684  KMEEALDLLRVMVSNGLCPDTTTYRSLAYGVCREDGTDRAVRMLRRVQDTGLSPDTTFYN  743

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +   CRD + + AI     M   G  P++ TY  L+ A    G LD A  LL
Sbjct  744  DVLLGFCRDRRTDLAIDCFAHMVSSGCMPDESTYVILLEALAYGGLLDEAKRLL  797


 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/272 (30%), Positives = 126/272 (46%), Gaps = 4/272 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C     ++ + LL  +   G KPD+V    L+KGL  V + E A ++M  ++     P+ 
Sbjct  542  CNESCIDDAMELLSDLQSCGCKPDIVTFNTLLKGLCGVDRWEDAEQLMANMMRSNCPPDE  601

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L +  +I   C+   +  A   L  M   G  P+  TY+I++ ++   GK   AL++L  
Sbjct  602  LTFNTVITSLCQKGLLTQAIETLKIMAENGCVPNSSTYSIVVDALLKAGKAQAALELLSG  661

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M    N  PD++TY  +I        + EA+ L+  M+S GL P+  TY ++  G+CRE 
Sbjct  662  M---TNGTPDLITYNTVISNLTKAGKMEEALDLLRVMVSNGLCPDTTTYRSLAYGVCRED  718

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              DRA   +R +   G  PD   YN +L      R  D        M S GC P   TY 
Sbjct  719  GTDRAVRMLRRVQDTGLSPDTTFYNDVLLGFCRDRRTDLAIDCFAHMVSSGCMPDESTYV  778

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKF  70
            I + +L   G L++A  +L  +   G+   K 
Sbjct  779  ILLEALAYGGLLDEAKRLLASLCSLGVLDKKL  810



>ref|XP_004972201.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Setaria italica]
Length=675

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 159/276 (58%), Gaps = 5/276 (2%)
 Frame = -1

Query  825  GYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NVLAYTALIGGFCKTNRVEAA  649
            G  PDV LCTKLI+ L    +   A +V++  E  G P +V AY  L+ G+C+   ++AA
Sbjct  75   GEPPDVYLCTKLIRNLCRRGRTSDAARVLRAAETSGSPVDVFAYNTLVAGYCRYGHLDAA  134

Query  648  NGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIE  469
              ++  M      PD  TY  +I  +CDRG++  AL +LD M     C+P VVTYTVL+E
Sbjct  135  RRLIASM---PVAPDAYTYTPLIRGLCDRGRVADALSLLDDMLR-RGCQPSVVTYTVLLE  190

Query  468  ATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKP  289
            A     G  +AM ++DEM  +G  PNI TYN I+ G+CREG VD A E +  L + G +P
Sbjct  191  ALCKNSGFGQAMAVLDEMRVKGCMPNIVTYNVIINGMCREGRVDDARELLDRLSSYGFQP  250

Query  288  DVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISML  109
            D  SY  LL+ L   + WDD E+L  EM    C P+  T+++ +   CR G + +AI +L
Sbjct  251  DTVSYTTLLKGLCAAKRWDDVEELFAEMMERNCMPNEVTFDMLIRFFCRGGMVERAIQVL  310

Query  108  KIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + MT  G + N    + +I++ CK+GR+D A   L+
Sbjct  311  EQMTWHGCSANTTLCNIVINSICKQGRVDDAFKFLN  346


 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/294 (33%), Positives = 164/294 (56%), Gaps = 2/294 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G+  + L LL  M++ G +P VV  T L++ L       +A+ V+  +   G  PN+
Sbjct  158  CDRGRVADALSLLDDMLRRGCQPSVVTYTVLLEALCKNSGFGQAMAVLDEMRVKGCMPNI  217

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  +I G C+  RV+ A  +L+R+ S GF PD V+Y  ++  +C   +     ++  +
Sbjct  218  VTYNVIINGMCREGRVDDARELLDRLSSYGFQPDTVSYTTLLKGLCAAKRWDDVEELFAE  277

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M E  NC P+ VT+ +LI        +  A++++++M   G   N    N ++  +C++G
Sbjct  278  MME-RNCMPNEVTFDMLIRFFCRGGMVERAIQVLEQMTWHGCSANTTLCNIVINSICKQG  336

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A++F+ ++ + GC PD  SY  +L+ L     WDD ++LLKEM    C P+  T+N
Sbjct  337  RVDDAFKFLNNMGSYGCNPDTISYTTVLKGLCRAERWDDAKELLKEMVRKNCPPNEVTFN  396

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             F+  LC+ G + KAI +++ M+E G T    TY+ L++ FC +GR+D A++L 
Sbjct  397  TFICILCQKGLIEKAIMLIEQMSEHGCTVGVVTYNALVNGFCVQGRIDSALELF  450


 Score =   159 bits (401),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/299 (30%), Positives = 160/299 (54%), Gaps = 5/299 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++   LL  +   G++PD V  T L+KGL + K+ +   ++  +++E+  
Sbjct  224  INGMCREGRVDDARELLDRLSSYGFQPDTVSYTTLLKGLCAAKRWDDVEELFAEMMERNC  283

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +  LI  FC+   VE A  VL +M   G   +    NI+I SIC +G++  A K
Sbjct  284  MPNEVTFDMLIRFFCRGGMVERAIQVLEQMTWHGCSANTTLCNIVINSICKQGRVDDAFK  343

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
             L+ M     C PD ++YT +++     +   +A +L+ EM+ +   PN  T+N  +  L
Sbjct  344  FLNNMGS-YGCNPDTISYTTVLKGLCRAERWDDAKELLKEMVRKNCPPNEVTFNTFICIL  402

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G++++A   +  +   GC   V +YN L+     +   D   +L +   SM C+P+T
Sbjct  403  CQKGLIEKAIMLIEQMSEHGCTVGVVTYNALVNGFCVQGRIDSALELFR---SMPCKPNT  459

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             TY   ++ LC   +L+ A  ++  M  +   PN  T++ L+S FC++G L+ AI+L++
Sbjct  460  ITYTTLLTGLCNAERLDDAAELIAEMLRRDCPPNAVTFNVLVSFFCQKGFLEEAIELVE  518


 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/298 (27%), Positives = 152/298 (51%), Gaps = 5/298 (2%)
 Frame = -1

Query  894  LNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFG  718
            +N  C  G+ ++    L  M   G  PD +  T ++KGL   ++ + A +++ +++ +  
Sbjct  329  INSICKQGRVDDAFKFLNNMGSYGCNPDTISYTTVLKGLCRAERWDDAKELLKEMVRKNC  388

Query  717  EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALK  538
             PN + +   I   C+   +E A  ++ +M   G    VVTYN ++   C +G++  AL+
Sbjct  389  PPNEVTFNTFICILCQKGLIEKAIMLIEQMSEHGCTVGVVTYNALVNGFCVQGRIDSALE  448

Query  537  VLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGL  358
            +   M     CKP+ +TYT L+      + + +A +L+ EML R   PN  T+N ++   
Sbjct  449  LFRSMP----CKPNTITYTTLLTGLCNAERLDDAAELIAEMLRRDCPPNAVTFNVLVSFF  504

Query  357  CREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHT  178
            C++G ++ A E V  +   GC P++ +YN LL  +    + +D  +LL+ + S G  P  
Sbjct  505  CQKGFLEEAIELVEQMMEHGCTPNLITYNTLLDGITKDCSSEDALELLQGLVSKGVSPDI  564

Query  177  FTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
             T++  +  L ++ ++ +AI M  ++ + G+ P    Y+ ++   CK   +D AID  
Sbjct  565  ITFSSIIGVLSKEDRVEEAIQMFHVVQDIGMRPKAVVYNKILLGLCKRCEIDNAIDFF  622


 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 149/294 (51%), Gaps = 5/294 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C A ++++   LL+ MV+    P+ V     I  L      EKA+ +++ + + G    V
Sbjct  368  CRAERWDDAKELLKEMVRKNCPPNEVTFNTFICILCQKGLIEKAIMLIEQMSEHGCTVGV  427

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y AL+ GFC   R+++A   L   RS    P+ +TY  ++  +C+  +L  A +++ +
Sbjct  428  VTYNALVNGFCVQGRIDSA---LELFRSMPCKPNTITYTTLLTGLCNAERLDDAAELIAE  484

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M    +C P+ VT+ VL+     K  + EA++LV++M+  G  PN+ TYN +L G+ ++ 
Sbjct  485  MLR-RDCPPNAVTFNVLVSFFCQKGFLEEAIELVEQMMEHGCTPNLITYNTLLDGITKDC  543

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
              + A E ++ L + G  PD+ +++ ++  L      ++  ++   +  +G  P    YN
Sbjct  544  SSEDALELLQGLVSKGVSPDIITFSSIIGVLSKEDRVEEAIQMFHVVQDIGMRPKAVVYN  603

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
              +  LC+  +++ AI     M   G  PN+ TY  LI     EG L  A DLL
Sbjct  604  KILLGLCKRCEIDNAIDFFAYMVSNGCMPNESTYIILIEGLAHEGLLKEARDLL  657


 Score =   130 bits (327),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 77/267 (29%), Positives = 142/267 (53%), Gaps = 5/267 (2%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEPNVL  703
            C  G  E+ + L++ M + G    VV    L+ G     + + A+++ + +    +PN +
Sbjct  403  CQKGLIEKAIMLIEQMSEHGCTVGVVTYNALVNGFCVQGRIDSALELFRSMP--CKPNTI  460

Query  702  AYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQM  523
             YT L+ G C   R++ A  ++  M  R   P+ VT+N+++   C +G L  A+++++QM
Sbjct  461  TYTTLLTGLCNAERLDDAAELIAEMLRRDCPPNAVTFNVLVSFFCQKGFLEEAIELVEQM  520

Query  522  KEDNNCKPDVVTYTVLIEATIVKDGISE-AMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
             E + C P+++TY  L++  I KD  SE A++L+  ++S+G+ P+I T+++I+  L +E 
Sbjct  521  ME-HGCTPNLITYNTLLDG-ITKDCSSEDALELLQGLVSKGVSPDIITFSSIIGVLSKED  578

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             V+ A +    +  +G +P    YN +L  L  R   D+       M S GC P+  TY 
Sbjct  579  RVEEAIQMFHVVQDIGMRPKAVVYNKILLGLCKRCEIDNAIDFFAYMVSNGCMPNESTYI  638

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L  +G L +A  +L  +  +G+
Sbjct  639  ILIEGLAHEGLLKEARDLLSELCSRGV  665


 Score =   113 bits (282),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 100/188 (53%), Gaps = 3/188 (2%)
 Frame = -1

Query  564  RGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIY  385
            R  L  A +++++    +   PDV   T LI     +   S+A +++    + G   +++
Sbjct  57   REDLAGAARLVERSASRDGEPPDVYLCTKLIRNLCRRGRTSDAARVLRAAETSGSPVDVF  116

Query  384  TYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
             YN ++ G CR G +D A   + S+P     PD ++Y  L+R L DR    D   LL +M
Sbjct  117  AYNTLVAGYCRYGHLDAARRLIASMPV---APDAYTYTPLIRGLCDRGRVADALSLLDDM  173

Query  204  SSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRL  25
               GC+P   TY + + +LC++    +A+++L  M  KG  PN  TY+ +I+  C+EGR+
Sbjct  174  LRRGCQPSVVTYTVLLEALCKNSGFGQAMAVLDEMRVKGCMPNIVTYNVIINGMCREGRV  233

Query  24   DLAIDLLD  1
            D A +LLD
Sbjct  234  DDARELLD  241


 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 56/120 (47%), Gaps = 3/120 (3%)
 Frame = -1

Query  360  LCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPH  181
            + RE +   A    RS    G  PDV+    L+R L  R    D  ++L+   + G    
Sbjct  55   IAREDLAGAARLVERSASRDGEPPDVYLCTKLIRNLCRRGRTSDAARVLRAAETSGSPVD  114

Query  180  TFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
             F YN  V+  CR G L+ A  ++  M    + P+ +TY PLI   C  GR+  A+ LLD
Sbjct  115  VFAYNTLVAGYCRYGHLDAARRLIASMP---VAPDAYTYTPLIRGLCDRGRVADALSLLD  171



>ref|XP_010246803.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic [Nelumbo nucifera]
Length=562

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/291 (37%), Positives = 169/291 (58%), Gaps = 2/291 (1%)
 Frame = -1

Query  870  KYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGE-PNVLAYT  694
            K  +    L+YMV+ G++PD+   T+L+  L    K  KA++VM +L   G  P+V +Y 
Sbjct  77   KLNDAFLYLEYMVEKGHRPDLAQSTQLLYDLCKSNKIRKAIRVMGILVSSGNTPDVGSYI  136

Query  693  ALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKED  514
             L+   CK   V  A  ++ +M   GF P+ +TYN ++  +C  G L  + ++LD++ + 
Sbjct  137  FLVNQLCKRGNVGYAMQLVEKMEEYGFPPNTITYNSLVRGLCMHGNLQKSFQLLDRLMQ-  195

Query  513  NNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDR  334
                P+V TY+ L+EA   + G+ EAM+L+DE++++G  PN+ +YN +L GLC+E  +  
Sbjct  196  KGLVPNVFTYSFLLEAAYKERGVDEAMRLLDEIIAKGGRPNLVSYNVLLTGLCKEDRIGE  255

Query  333  AYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVS  154
            A +F R LP  G  P+V SYNILL++L     W++  +LL EM      P   TYNI + 
Sbjct  256  AIKFFRDLPMKGFNPNVVSYNILLKSLCYEGRWEEANELLAEMDGEDRTPSLITYNILIG  315

Query  153  SLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            SL   G+ + A  +L  M      PN  +Y+PLI+ +CKEG++DL +  LD
Sbjct  316  SLALHGRTDDAYEVLVEMLRNRYKPNAASYNPLIAQYCKEGKVDLVVKCLD  366


 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/329 (25%), Positives = 165/329 (50%), Gaps = 36/329 (11%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNV  706
            C  G  +++  LL  +++ G  P+V   + L++  +  +  ++A++++ +++ + G PN+
Sbjct  178  CMHGNLQKSFQLLDRLMQKGLVPNVFTYSFLLEAAYKERGVDEAMRLLDEIIAKGGRPNL  237

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++Y  L+ G CK +R+  A      +  +GF P+VV+YNI++ S+C  G+   A ++L +
Sbjct  238  VSYNVLLTGLCKEDRIGEAIKFFRDLPMKGFNPNVVSYNILLKSLCYEGRWEEANELLAE  297

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            M  ++   P ++TY +LI +  +     +A +++ EML    +PN  +YN ++   C+EG
Sbjct  298  MDGEDR-TPSLITYNILIGSLALHGRTDDAYEVLVEMLRNRYKPNAASYNPLIAQYCKEG  356

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNIL---------------LRALLDRRNWDDGE----  223
             VD   + +  +    C P+  +YN L               L++L +++N    +    
Sbjct  357  KVDLVVKCLDQMMYRHCSPNEGTYNALAVLCKEGKVQESFSILQSLGNKQNSSMHDFYRN  416

Query  222  ---------------KLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKG  88
                            LL EM+  G  P ++T +  +  LC +G L +A+ +  +M E  
Sbjct  417  VVSSLCRKGNTLAAFHLLYEMTKSGFTPDSYTNSSLIRGLCLEGMLAEAMEIFTVMEEND  476

Query  87   LTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
              P+   Y+ LI   CK  R DL++++ +
Sbjct  477  CRPDIDNYNALILGLCKAQRTDLSLEVFE  505


 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 144/322 (45%), Gaps = 36/322 (11%)
 Frame = -1

Query  864  EETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNVLAYTAL  688
            +E + LL  ++  G +P++V    L+ GL    +  +A+K  + L   G  PNV++Y  L
Sbjct  219  DEAMRLLDEIIAKGGRPNLVSYNVLLTGLCKEDRIGEAIKFFRDLPMKGFNPNVVSYNIL  278

Query  687  IGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNN  508
            +   C   R E AN +L  M      P ++TYNI+IGS+   G+   A +VL +M   N 
Sbjct  279  LKSLCYEGRWEEANELLAEMDGEDRTPSLITYNILIGSLALHGRTDDAYEVLVEMLR-NR  337

Query  507  CKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNA---------------  373
             KP+  +Y  LI     +  +   +K +D+M+ R   PN  TYNA               
Sbjct  338  YKPNAASYNPLIAQYCKEGKVDLVVKCLDQMMYRHCSPNEGTYNALAVLCKEGKVQESFS  397

Query  372  -------------------ILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALL  250
                               ++  LCR+G    A+  +  +   G  PD ++ + L+R L 
Sbjct  398  ILQSLGNKQNSSMHDFYRNVVSSLCRKGNTLAAFHLLYEMTKSGFTPDSYTNSSLIRGLC  457

Query  249  DRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKF  70
                  +  ++   M    C P    YN  +  LC+  + + ++ + ++M EKG  PN+ 
Sbjct  458  LEGMLAEAMEIFTVMEENDCRPDIDNYNALILGLCKAQRTDLSLEVFEMMIEKGYMPNET  517

Query  69   TYDPLISAFCKEGRLDLAIDLL  4
            +Y  L+     E  ++LA ++L
Sbjct  518  SYTILVEGIAHEEEIELAAEVL  539


 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 66/132 (50%), Gaps = 1/132 (1%)
 Frame = -1

Query  903  RRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQ  724
            R  ++  C  G      +LL  M K G+ PD    + LI+GL       +A+++  ++E+
Sbjct  415  RNVVSSLCRKGNTLAAFHLLYEMTKSGFTPDSYTNSSLIRGLCLEGMLAEAMEIFTVMEE  474

Query  723  FG-EPNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGL  547
                P++  Y ALI G CK  R + +  V   M  +G+ P+  +Y I++  I    ++ L
Sbjct  475  NDCRPDIDNYNALILGLCKAQRTDLSLEVFEMMIEKGYMPNETSYTILVEGIAHEEEIEL  534

Query  546  ALKVLDQMKEDN  511
            A +VL ++ + +
Sbjct  535  AAEVLRELYQKH  546


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (47%), Gaps = 0/118 (0%)
 Frame = -1

Query  354  REGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTF  175
            RE  ++ A+ ++  +   G +PD+     LL  L          +++  + S G  P   
Sbjct  74   RELKLNDAFLYLEYMVEKGHRPDLAQSTQLLYDLCKSNKIRKAIRVMGILVSSGNTPDVG  133

Query  174  TYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            +Y   V+ LC+ G +  A+ +++ M E G  PN  TY+ L+   C  G L  +  LLD
Sbjct  134  SYIFLVNQLCKRGNVGYAMQLVEKMEEYGFPPNTITYNSLVRGLCMHGNLQKSFQLLD  191



>ref|XP_006598186.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic-like [Glycine max]
Length=571

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/304 (37%), Positives = 177/304 (58%), Gaps = 7/304 (2%)
 Frame = -1

Query  897  RLNRSCGAGK----YEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLL  730
            R+ R+   GK    Y+  L+L +Y+V  G KP+V   T+L+  L    KA KAV+VM+++
Sbjct  67   RIGRNDQKGKELRIYDAFLHL-EYLVGKGQKPEVNQATQLLYDLCKFNKARKAVRVMEMM  125

Query  729  EQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKL  553
               G  P+  +YT L+   CK   V  A  ++ +M   GF  + VTYN ++  +C  G L
Sbjct  126  VGSGIIPDAASYTHLVNFLCKRGNVGYAIQLVEKMEGHGFPTNTVTYNTLVKGLCMHGNL  185

Query  552  GLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNA  373
              +L++LD++ +     P+  TY+ L+EA   + G+ EAM+L+D+++++G EPN+ +YN 
Sbjct  186  NQSLQLLDRLTK-KGLVPNAFTYSFLLEAAYKERGVDEAMELLDDIIAKGGEPNLVSYNV  244

Query  372  ILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMG  193
            +L GLC+EG  + A +  R LPA G  P V S+NILLR+L     W++  +LL EM    
Sbjct  245  LLTGLCKEGRTEEAIKLFRELPAKGFSPSVVSFNILLRSLCYEGRWEEANELLAEMDKED  304

Query  192  CEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              P   TYNI ++SL   G+  +A  +L  MT  G   +  +Y+P+I+  C EG++DL +
Sbjct  305  QPPSVVTYNILITSLSLHGRTEQAFKVLDEMTRSGFKASATSYNPIIARLCNEGKVDLVL  364

Query  12   DLLD  1
              LD
Sbjct  365  QCLD  368


 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/329 (27%), Positives = 169/329 (51%), Gaps = 38/329 (12%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNV  706
            C  G   ++L LL  + K G  P+    + L++  +  +  ++A++++  ++ + GEPN+
Sbjct  180  CMHGNLNQSLQLLDRLTKKGLVPNAFTYSFLLEAAYKERGVDEAMELLDDIIAKGGEPNL  239

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++Y  L+ G CK  R E A  +   + ++GF P VV++NI++ S+C  G+   A ++L +
Sbjct  240  VSYNVLLTGLCKEGRTEEAIKLFRELPAKGFSPSVVSFNILLRSLCYEGRWEEANELLAE  299

Query  525  M-KEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M KED    P VVTY +LI +  +     +A K++DEM   G + +  +YN I+  LC E
Sbjct  300  MDKEDQ--PPSVVTYNILITSLSLHGRTEQAFKVLDEMTRSGFKASATSYNPIIARLCNE  357

Query  348  GMVDRAYEFVRSLPAMGCKPDVFSYN---------------ILLRALLDRRNWDDGE---  223
            G VD   + +  +    C P+  +Y+                ++++L  ++N+   +   
Sbjct  358  GKVDLVLQCLDQMIHRRCHPNEGTYSAIAMLCEQGKVQEAFFIIQSLGSKQNFPMHDFYK  417

Query  222  ----------------KLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEK  91
                            ++L EM   G  P ++TY+  +  +CR+G L++A+++ +I+ E 
Sbjct  418  NLIASLCRKGNTYPAFQMLYEMIKYGFTPDSYTYSSLIRGMCREGMLDEALNIFRILEEN  477

Query  90   GLTPNKFTYDPLISAFCKEGRLDLAIDLL  4
               P+   Y+ LI  FCK  R DL+I++ 
Sbjct  478  DHRPDIDNYNALILGFCKAQRTDLSIEIF  506


 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 134/294 (46%), Gaps = 36/294 (12%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFGEP-NV  706
            C  G+ EE + L + +   G+ P VV    L++ L    + E+A +++  +++  +P +V
Sbjct  250  CKEGRTEEAIKLFRELPAKGFSPSVVSFNILLRSLCYEGRWEEANELLAEMDKEDQPPSV  309

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            + Y  LI       R E A  VL+ M   GF     +YN +I  +C+ GK+ L L+ LDQ
Sbjct  310  VTYNILITSLSLHGRTEQAFKVLDEMTRSGFKASATSYNPIIARLCNEGKVDLVLQCLDQ  369

Query  525  MKEDNNCKPDVVTYTV----------------------------------LIEATIVKDG  448
            M     C P+  TY+                                   LI +   K  
Sbjct  370  MIH-RRCHPNEGTYSAIAMLCEQGKVQEAFFIIQSLGSKQNFPMHDFYKNLIASLCRKGN  428

Query  447  ISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNI  268
               A +++ EM+  G  P+ YTY+++++G+CREGM+D A    R L     +PD+ +YN 
Sbjct  429  TYPAFQMLYEMIKYGFTPDSYTYSSLIRGMCREGMLDEALNIFRILEENDHRPDIDNYNA  488

Query  267  LLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLK  106
            L+      +  D   ++   M + GC P+  TY I V  L  + + + A  ++K
Sbjct  489  LILGFCKAQRTDLSIEIFLMMVNKGCVPNENTYTILVEGLAFEEETDIAADLMK  542


 Score = 79.3 bits (194),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 103/224 (46%), Gaps = 3/224 (1%)
 Frame = -1

Query  873  GKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVM-QLLEQFGEPNVLAY  697
            G+ E+   +L  M + G+K        +I  L +  K +  ++ + Q++ +   PN   Y
Sbjct  323  GRTEQAFKVLDEMTRSGFKASATSYNPIIARLCNEGKVDLVLQCLDQMIHRRCHPNEGTY  382

Query  696  TALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKE  517
            +A I   C+  +V+ A  ++  + S+  FP    Y  +I S+C +G    A ++L +M +
Sbjct  383  SA-IAMLCEQGKVQEAFFIIQSLGSKQNFPMHDFYKNLIASLCRKGNTYPAFQMLYEMIK  441

Query  516  DNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVD  337
                 PD  TY+ LI     +  + EA+ +   +      P+I  YNA++ G C+    D
Sbjct  442  -YGFTPDSYTYSSLIRGMCREGMLDEALNIFRILEENDHRPDIDNYNALILGFCKAQRTD  500

Query  336  RAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEM  205
             + E    +   GC P+  +Y IL+  L      D    L+KE+
Sbjct  501  LSIEIFLMMVNKGCVPNENTYTILVEGLAFEEETDIAADLMKEL  544



>ref|XP_002527349.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF35021.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=443

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/311 (36%), Positives = 172/311 (55%), Gaps = 2/311 (1%)
 Frame = -1

Query  933  QLLDSKEIDIRRRLNRSCGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEK  754
             L + +EI+    L++    G+ EE    L+ MV  G  PD++ CT LI+G   + K  K
Sbjct  78   SLTNFEEIESNNNLSKLVRNGELEEGFRFLESMVYRGDIPDIIPCTSLIRGFCKIGKTRK  137

Query  753  AVKVMQLLEQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIG  577
            A ++M+++E  G  P+V+ Y  LI G C T R   A  +L  M  RG  P VVT+NI+I 
Sbjct  138  ATRIMEIIEDSGAVPDVITYNVLISGMCSTGRWMDAEKLLADMVRRGCSPSVVTFNILIN  197

Query  576  SICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLE  397
             +C +G LG A+ VL++M + + C P+ ++Y  L+     +  +  A++ + +M SRG  
Sbjct  198  FLCRKGLLGRAIDVLEKMPK-HGCTPNSLSYNPLLHGFCKEKKMERAIEYLGKMTSRGCY  256

Query  396  PNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKL  217
            P+I TYN +L  LC++G VD A E +  L + GC P + +YN ++  L      D   KL
Sbjct  257  PDIVTYNTLLTALCKDGKVDAAVELLNQLSSKGCSPVLITYNTVIDGLSKVGKTDQAAKL  316

Query  216  LKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCK  37
            L EM + G +P   TY+  V  L R+GK+++AI     +   G+ PN  TY+ ++   CK
Sbjct  317  LDEMRAKGLKPDIITYSSLVGGLSREGKVDEAIKFFHDLEVLGVKPNAITYNAIMLGLCK  376

Query  36   EGRLDLAIDLL  4
              + D AID L
Sbjct  377  ARKTDRAIDFL  387


 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 148/267 (55%), Gaps = 2/267 (1%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLLEQFG-EPNV  706
            C  G++ +   LL  MV+ G  P VV    LI  L       +A+ V++ + + G  PN 
Sbjct  165  CSTGRWMDAEKLLADMVRRGCSPSVVTFNILINFLCRKGLLGRAIDVLEKMPKHGCTPNS  224

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            L+Y  L+ GFCK  ++E A   L +M SRG +PD+VTYN ++ ++C  GK+  A+++L+Q
Sbjct  225  LSYNPLLHGFCKEKKMERAIEYLGKMTSRGCYPDIVTYNTLLTALCKDGKVDAAVELLNQ  284

Query  525  MKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREG  346
            +     C P ++TY  +I+         +A KL+DEM ++GL+P+I TY++++ GL REG
Sbjct  285  L-SSKGCSPVLITYNTVIDGLSKVGKTDQAAKLLDEMRAKGLKPDIITYSSLVGGLSREG  343

Query  345  MVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYN  166
             VD A +F   L  +G KP+  +YN ++  L   R  D     L  M   GC+P   +Y 
Sbjct  344  KVDEAIKFFHDLEVLGVKPNAITYNAIMLGLCKARKTDRAIDFLAYMVQRGCKPTEASYT  403

Query  165  IFVSSLCRDGKLNKAISMLKIMTEKGL  85
            I +  L  +G   +A+ +L  +  +G+
Sbjct  404  ILIEGLAYEGLAKEALELLNELCLRGV  430


 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 119/213 (56%), Gaps = 1/213 (0%)
 Frame = -1

Query  639  LNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQMKEDNNCKPDVVTYTVLIEATI  460
            L  M  RG  PD++    +I   C  GK   A +++ ++ ED+   PDV+TY VLI    
Sbjct  107  LESMVYRGDIPDIIPCTSLIRGFCKIGKTRKATRIM-EIIEDSGAVPDVITYNVLISGMC  165

Query  459  VKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCREGMVDRAYEFVRSLPAMGCKPDVF  280
                  +A KL+ +M+ RG  P++ T+N ++  LCR+G++ RA + +  +P  GC P+  
Sbjct  166  STGRWMDAEKLLADMVRRGCSPSVVTFNILINFLCRKGLLGRAIDVLEKMPKHGCTPNSL  225

Query  279  SYNILLRALLDRRNWDDGEKLLKEMSSMGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIM  100
            SYN LL      +  +   + L +M+S GC P   TYN  +++LC+DGK++ A+ +L  +
Sbjct  226  SYNPLLHGFCKEKKMERAIEYLGKMTSRGCYPDIVTYNTLLTALCKDGKVDAAVELLNQL  285

Query  99   TEKGLTPNKFTYDPLISAFCKEGRLDLAIDLLD  1
            + KG +P   TY+ +I    K G+ D A  LLD
Sbjct  286  SSKGCSPVLITYNTVIDGLSKVGKTDQAAKLLD  318


 Score = 66.6 bits (161),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = -1

Query  378  NAILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSS  199
            N  L  L R G ++  + F+ S+   G  PD+     L+R            ++++ +  
Sbjct  88   NNNLSKLVRNGELEEGFRFLESMVYRGDIPDIIPCTSLIRGFCKIGKTRKATRIMEIIED  147

Query  198  MGCEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDL  19
             G  P   TYN+ +S +C  G+   A  +L  M  +G +P+  T++ LI+  C++G L  
Sbjct  148  SGAVPDVITYNVLISGMCSTGRWMDAEKLLADMVRRGCSPSVVTFNILINFLCRKGLLGR  207

Query  18   AIDLLD  1
            AID+L+
Sbjct  208  AIDVLE  213



>ref|XP_003531505.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic-like isoform X1 [Glycine max]
 gb|KHN26812.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=572

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/304 (37%), Positives = 178/304 (59%), Gaps = 7/304 (2%)
 Frame = -1

Query  897  RLNRSCGAGK----YEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQLL  730
            R+ R+   GK    Y+  L+L +Y+V  G KP+V   T+L+  L    KA KAV+VM+++
Sbjct  67   RVGRNDQKGKELRIYDAFLHL-EYLVGKGQKPEVNQATQLLYDLCKFNKARKAVRVMEMM  125

Query  729  EQFGE-PNVLAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKL  553
               G  P+  +YT L+   CK   V  A  ++ +M   GF  + VTYN ++  +C  G L
Sbjct  126  VGSGIIPDAASYTHLVNFLCKRGNVGYAIQLVEKMEGHGFPTNTVTYNTLVKGLCMHGNL  185

Query  552  GLALKVLDQMKEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNA  373
              +L++LD++ +     P+  TY+ L+EA   + G+ EAMKL+D+++++G EPN+ +YN 
Sbjct  186  NQSLQLLDRLTK-KGLIPNAFTYSFLLEAAYKERGVDEAMKLLDDIIAKGGEPNLVSYNV  244

Query  372  ILKGLCREGMVDRAYEFVRSLPAMGCKPDVFSYNILLRALLDRRNWDDGEKLLKEMSSMG  193
            +L GLC+EG  + A +  + LP  G  P V S+NILLR+L     W++  +LL EM    
Sbjct  245  LLTGLCKEGRTEEAIKLFQELPVKGFSPSVVSFNILLRSLCYEGRWEEANELLAEMDKED  304

Query  192  CEPHTFTYNIFVSSLCRDGKLNKAISMLKIMTEKGLTPNKFTYDPLISAFCKEGRLDLAI  13
              P   TYNI ++SL  +G+  +A  +L  MT  G   +  +Y+P+I+  CKEG++DL +
Sbjct  305  QPPSVVTYNILITSLSLNGRTEQAFKVLDEMTRSGFKASATSYNPIIARLCKEGKVDLVL  364

Query  12   DLLD  1
              LD
Sbjct  365  KCLD  368


 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 169/364 (46%), Gaps = 73/364 (20%)
 Frame = -1

Query  882  CGAGKYEETLYLLQYMVKIGYKPDVVLCTKLIKGLFSVKKAEKAVKVMQ-LLEQFGEPNV  706
            C  G   ++L LL  + K G  P+    + L++  +  +  ++A+K++  ++ + GEPN+
Sbjct  180  CMHGNLNQSLQLLDRLTKKGLIPNAFTYSFLLEAAYKERGVDEAMKLLDDIIAKGGEPNL  239

Query  705  LAYTALIGGFCKTNRVEAANGVLNRMRSRGFFPDVVTYNIMIGSICDRGKLGLALKVLDQ  526
            ++Y  L+ G CK  R E A  +   +  +GF P VV++NI++ S+C  G+   A ++L +
Sbjct  240  VSYNVLLTGLCKEGRTEEAIKLFQELPVKGFSPSVVSFNILLRSLCYEGRWEEANELLAE  299

Query  525  M-KEDNNCKPDVVTYTVLIEATIVKDGISEAMKLVDEMLSRGLEPNIYTYNAILKGLCRE  349
            M KED    P VVTY +LI +  +