BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23886_g1_i1 len=1515 path=[1493:0-664 2158:665-780 2274:781-804
2298:805-810 2304:811-868 4187:869-874 2368:875-904 2398:905-997
2491:998-1201 2695:1202-1234 2728:1235-1289 2783:1290-1338
2832:1339-1376 2870:1377-1443 2937:1444-1514]

Length=1515
                                                                      Score     E

ref|XP_011073652.1|  PREDICTED: transcription factor bHLH18-like        233   1e-67   
emb|CDP21059.1|  unnamed protein product                                226   5e-66   
emb|CDP17177.1|  unnamed protein product                                226   3e-65   
emb|CDP18043.1|  unnamed protein product                                220   4e-63   
emb|CDP17179.1|  unnamed protein product                                218   2e-62   
ref|XP_011100103.1|  PREDICTED: transcription factor bHLH18-like        214   7e-61   
gb|AIA82919.1|  bHLH1                                                   211   3e-59   
ref|XP_002300300.2|  hypothetical protein POPTR_0001s29400g             202   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011030254.1|  PREDICTED: transcription factor bHLH18-like        202   2e-56   
ref|XP_010028032.1|  PREDICTED: transcription factor bHLH18             203   2e-56   
emb|CDP17180.1|  unnamed protein product                                202   4e-56   
ref|XP_006486799.1|  PREDICTED: transcription factor bHLH25-like        200   9e-56   
gb|KDO67951.1|  hypothetical protein CISIN_1g021208mg                   198   6e-55   
ref|XP_002518295.1|  DNA binding protein, putative                      197   7e-55   Ricinus communis
ref|XP_007205404.1|  hypothetical protein PRUPE_ppa007561mg             199   1e-54   
ref|XP_009378561.1|  PREDICTED: transcription factor bHLH18-like        196   8e-54   
ref|XP_007047665.1|  Basic helix-loop-helix DNA-binding superfami...    196   1e-53   
ref|XP_008236876.1|  PREDICTED: transcription factor bHLH18-like        194   4e-53   
ref|XP_006422677.1|  hypothetical protein CICLE_v10028925mg             192   5e-53   
emb|CDP17174.1|  unnamed protein product                                189   8e-53   
ref|XP_011002814.1|  PREDICTED: transcription factor bHLH18-like ...    192   1e-52   
ref|XP_011002806.1|  PREDICTED: transcription factor bHLH18-like ...    192   1e-52   
ref|XP_002313947.2|  hypothetical protein POPTR_0009s08500g             192   2e-52   Populus trichocarpa [western balsam poplar]
gb|KHG02490.1|  Transcription factor bHLH25 -like protein               191   6e-52   
ref|XP_009346450.1|  PREDICTED: transcription factor bHLH18-like        190   1e-51   
ref|XP_008790398.1|  PREDICTED: transcription factor bHLH18-like        190   2e-51   
ref|XP_010936245.1|  PREDICTED: transcription factor bHLH18-like ...    189   2e-51   
ref|XP_010936243.1|  PREDICTED: transcription factor bHLH18-like ...    189   3e-51   
ref|XP_009347092.1|  PREDICTED: transcription factor bHLH18-like        189   6e-51   
ref|XP_008372895.1|  PREDICTED: transcription factor bHLH18-like        188   6e-51   
ref|XP_010107640.1|  hypothetical protein L484_001114                   187   9e-51   
ref|XP_008383369.1|  PREDICTED: transcription factor bHLH18-like        188   1e-50   
gb|KCW56854.1|  hypothetical protein EUGRSUZ_I02518                     186   5e-50   
emb|CAN75020.1|  hypothetical protein VITISV_039940                     185   6e-50   Vitis vinifera
gb|KDP32145.1|  hypothetical protein JCGZ_12606                         186   7e-50   
ref|XP_007041458.1|  Basic helix-loop-helix DNA-binding superfami...    187   1e-49   
ref|XP_002268443.3|  PREDICTED: transcription factor bHLH18             184   1e-49   Vitis vinifera
gb|KDP35918.1|  hypothetical protein JCGZ_09890                         184   1e-49   
ref|XP_010030892.1|  PREDICTED: transcription factor bHLH18-like        185   3e-49   
ref|XP_004504883.1|  PREDICTED: transcription factor bHLH25-like        182   3e-49   
ref|XP_004136916.1|  PREDICTED: transcription factor bHLH25-like        183   5e-49   
ref|XP_007047664.1|  Basic helix-loop-helix DNA-binding superfami...    182   9e-49   
ref|XP_007200351.1|  hypothetical protein PRUPE_ppa008130mg             182   1e-48   
emb|CDO97338.1|  unnamed protein product                                181   2e-48   
ref|XP_008236173.1|  PREDICTED: transcription factor bHLH25-like        181   2e-48   
ref|XP_008785756.1|  PREDICTED: transcription factor bHLH18-like        181   3e-48   
ref|XP_008455093.1|  PREDICTED: transcription factor bHLH18-like ...    180   4e-48   
ref|XP_010271548.1|  PREDICTED: transcription factor bHLH18-like        181   5e-48   
ref|XP_004292144.1|  PREDICTED: transcription factor bHLH25-like        180   6e-48   
ref|XP_008455092.1|  PREDICTED: transcription factor bHLH18-like ...    179   7e-48   
ref|XP_006367079.1|  PREDICTED: transcription factor bHLH25-like        179   1e-47   
ref|XP_002263046.3|  PREDICTED: transcription factor bHLH25-like        174   2e-47   Vitis vinifera
ref|XP_004288301.1|  PREDICTED: transcription factor bHLH25-like        179   2e-47   
ref|XP_011088147.1|  PREDICTED: transcription factor bHLH18-like        179   2e-47   
ref|XP_002528911.1|  DNA binding protein, putative                      178   2e-47   Ricinus communis
emb|CBI23517.3|  unnamed protein product                                173   2e-47   
ref|XP_007148316.1|  hypothetical protein PHAVU_006G198400g             178   3e-47   
ref|XP_010939305.1|  PREDICTED: transcription factor bHLH18-like        177   5e-47   
ref|XP_007206351.1|  hypothetical protein PRUPE_ppa017640mg             177   6e-47   
ref|XP_004230658.1|  PREDICTED: transcription factor bHLH18-like        177   7e-47   
ref|XP_009412275.1|  PREDICTED: transcription factor bHLH18-like        175   1e-46   
ref|XP_009415320.1|  PREDICTED: transcription factor bHLH18-like        175   2e-46   
ref|XP_009616821.1|  PREDICTED: transcription factor bHLH25-like        175   2e-46   
ref|XP_003608328.1|  Transcription factor bHLH25                        175   3e-46   
ref|XP_008236887.1|  PREDICTED: transcription factor bHLH25-like        176   3e-46   
gb|AES90525.2|  helix loop helix DNA-binding domain protein             175   3e-46   
ref|XP_004485646.1|  PREDICTED: transcription factor bHLH25-like ...    175   4e-46   
ref|XP_004485645.1|  PREDICTED: transcription factor bHLH25-like ...    175   4e-46   
ref|XP_009387102.1|  PREDICTED: transcription factor bHLH18-like        174   8e-46   
ref|XP_009779237.1|  PREDICTED: transcription factor bHLH18-like        173   1e-45   
gb|KCW59639.1|  hypothetical protein EUGRSUZ_H02390                     169   3e-45   
emb|CDP18041.1|  unnamed protein product                                172   3e-45   
ref|XP_010026565.1|  PREDICTED: transcription factor bHLH19-like        171   5e-45   
gb|KHG21236.1|  Transcription factor bHLH19 -like protein               171   6e-45   
gb|KDP32144.1|  hypothetical protein JCGZ_12605                         171   6e-45   
ref|XP_010942051.1|  PREDICTED: transcription factor bHLH25-like        171   9e-45   
gb|KDO78768.1|  hypothetical protein CISIN_1g037441mg                   172   9e-45   
gb|KCW59638.1|  hypothetical protein EUGRSUZ_H02389                     171   9e-45   
ref|XP_010666979.1|  PREDICTED: transcription factor bHLH18-like        171   9e-45   
emb|CBI18610.3|  unnamed protein product                                166   1e-44   
ref|XP_006466576.1|  PREDICTED: transcription factor bHLH25-like        172   1e-44   
ref|XP_006426181.1|  hypothetical protein CICLE_v10027158mg             172   1e-44   
ref|XP_008383359.1|  PREDICTED: transcription factor bHLH18-like        171   1e-44   
ref|XP_006573685.1|  PREDICTED: transcription factor bHLH25-like        170   2e-44   
ref|XP_010026566.1|  PREDICTED: transcription factor NAI1-like          168   4e-44   
gb|KCW59640.1|  hypothetical protein EUGRSUZ_H02391                     168   5e-44   
ref|XP_011022082.1|  PREDICTED: transcription factor bHLH25-like        169   5e-44   
ref|XP_009347090.1|  PREDICTED: transcription factor bHLH18-like        170   5e-44   
ref|XP_006852729.1|  hypothetical protein AMTR_s00033p00078670          169   5e-44   
ref|XP_002306398.2|  hypothetical protein POPTR_0005s09810g             167   6e-44   Populus trichocarpa [western balsam poplar]
gb|KHN19045.1|  Transcription factor bHLH25                             169   6e-44   
ref|XP_010683069.1|  PREDICTED: transcription factor bHLH18-like        169   7e-44   
gb|KHN33594.1|  Transcription factor bHLH25                             169   7e-44   
ref|NP_001239843.1|  transcription factor bHLH25-like                   169   8e-44   
ref|XP_006594659.1|  PREDICTED: transcription factor bHLH25-like ...    169   8e-44   
ref|XP_006594658.1|  PREDICTED: transcription factor bHLH25-like ...    169   9e-44   
ref|XP_006597021.1|  PREDICTED: transcription factor bHLH25-like ...    169   9e-44   
gb|KHN46510.1|  Transcription factor bHLH25                             165   1e-43   
ref|XP_003529273.1|  PREDICTED: transcription factor bHLH25-like        167   2e-43   
ref|XP_003543116.2|  PREDICTED: transcription factor bHLH25-like ...    169   2e-43   
ref|XP_011073850.1|  PREDICTED: transcription factor bHLH25-like        161   2e-43   
ref|XP_009411335.1|  PREDICTED: transcription factor bHLH18-like        167   2e-43   
ref|XP_009394296.1|  PREDICTED: transcription factor bHLH18-like        166   4e-43   
ref|XP_010105102.1|  hypothetical protein L484_016091                   167   4e-43   
ref|XP_010026567.1|  PREDICTED: transcription factor NAI1-like          166   4e-43   
ref|XP_007155780.1|  hypothetical protein PHAVU_003G231100g             166   5e-43   
ref|XP_002262815.3|  PREDICTED: transcription factor NAI1               166   6e-43   Vitis vinifera
ref|XP_003549988.1|  PREDICTED: transcription factor bHLH18-like        166   7e-43   
gb|KHN01701.1|  Transcription factor bHLH25                             165   8e-43   
emb|CBI18607.3|  unnamed protein product                                166   9e-43   
ref|XP_010026564.1|  PREDICTED: uncharacterized protein LOC104416928    170   1e-42   
ref|XP_003524708.1|  PREDICTED: transcription factor bHLH18-like        165   1e-42   
ref|XP_002270448.2|  PREDICTED: transcription factor bHLH18-like        166   2e-42   Vitis vinifera
emb|CAN67117.1|  hypothetical protein VITISV_026466                     165   2e-42   Vitis vinifera
emb|CBI38512.3|  unnamed protein product                                164   3e-42   
ref|XP_010691492.1|  PREDICTED: transcription factor bHLH25-like        164   3e-42   
gb|AAM10937.1|  putative bHLH transcription factor                      163   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010023396.1|  PREDICTED: transcription factor bHLH18-like        164   4e-42   
ref|XP_002262764.1|  PREDICTED: transcription factor bHLH18-like        164   5e-42   Vitis vinifera
ref|NP_001147789.1|  symbiotic ammonium transporter                     164   5e-42   Zea mays [maize]
ref|NP_195498.3|  transcription factor bHLH25                           163   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159189.1|  hypothetical protein PHAVU_002G216700g             163   6e-42   
ref|XP_010105103.1|  hypothetical protein L484_016092                   164   8e-42   
ref|XP_004981924.1|  PREDICTED: transcription factor bHLH18-like        163   1e-41   
gb|KDO78769.1|  hypothetical protein CISIN_1g026436mg                   159   1e-41   
ref|XP_006466387.1|  PREDICTED: transcription factor bHLH25-like ...    163   1e-41   
gb|EPS68274.1|  hypothetical protein M569_06497                         157   2e-41   
gb|EAY91717.1|  hypothetical protein OsI_13359                          162   2e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_010943830.1|  PREDICTED: transcription factor bHLH18-like        161   3e-41   
ref|NP_001132631.2|  putative HLH DNA-binding domain superfamily ...    162   3e-41   Zea mays [maize]
ref|XP_009136241.1|  PREDICTED: transcription factor bHLH25-like        159   4e-41   
emb|CDX69336.1|  BnaC01g01170D                                          160   5e-41   
ref|XP_003593344.1|  Transcription factor bHLH25                        159   1e-40   
ref|XP_010943849.1|  PREDICTED: transcription factor bHLH18-like        159   1e-40   
ref|XP_006573686.1|  PREDICTED: transcription factor bHLH25-like ...    160   1e-40   
gb|KHN42604.1|  Transcription factor bHLH25                             160   1e-40   
ref|XP_006573687.1|  PREDICTED: transcription factor bHLH25-like ...    160   2e-40   
gb|EEE59844.1|  hypothetical protein OsJ_12417                          155   2e-40   Oryza sativa Japonica Group [Japonica rice]
emb|CDX93135.1|  BnaA03g38570D                                          157   2e-40   
emb|CBI18608.3|  unnamed protein product                                159   2e-40   
ref|XP_002262843.2|  PREDICTED: transcription factor bHLH18-like        159   2e-40   Vitis vinifera
gb|AES63595.2|  symbiotic ammonium transporter                          159   3e-40   
gb|ACU24264.1|  unknown                                                 155   4e-40   Glycine max [soybeans]
ref|NP_001148121.1|  symbiotic ammonium transporter                     158   4e-40   Zea mays [maize]
ref|XP_006282858.1|  hypothetical protein CARUB_v10006834mg             158   5e-40   
ref|XP_006404738.1|  hypothetical protein EUTSA_v10000426mg             157   5e-40   
dbj|BAJ98794.1|  predicted protein                                      158   5e-40   
ref|XP_006426180.1|  hypothetical protein CICLE_v10027504mg             158   5e-40   
ref|XP_008787362.1|  PREDICTED: transcription factor bHLH25-like        157   6e-40   
gb|KCW54694.1|  hypothetical protein EUGRSUZ_I006341                    152   7e-40   
ref|XP_009392955.1|  PREDICTED: transcription factor bHLH25-like ...    156   9e-40   
gb|AFW67754.1|  putative HLH DNA-binding domain superfamily protein     157   1e-39   
gb|KCW59635.1|  hypothetical protein EUGRSUZ_H02385                     154   1e-39   
ref|XP_009394784.1|  PREDICTED: transcription factor bHLH18-like        157   1e-39   
ref|XP_004511794.1|  PREDICTED: transcription factor bHLH18-like        157   1e-39   
gb|EMT07864.1|  Transcription factor bHLH25                             157   1e-39   
ref|NP_001051131.1|  Os03g0725800                                       157   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009132646.1|  PREDICTED: transcription factor bHLH25             156   2e-39   
ref|XP_009605673.1|  PREDICTED: transcription factor bHLH18             156   4e-39   
emb|CDX89627.1|  BnaC03g45410D                                          154   4e-39   
ref|XP_010683066.1|  PREDICTED: transcription factor bHLH25-like        154   4e-39   
gb|KHN01700.1|  Transcription factor bHLH25                             156   5e-39   
ref|XP_007155781.1|  hypothetical protein PHAVU_003G231200g             155   5e-39   
emb|CDY49678.1|  BnaC03g61210D                                          155   6e-39   
ref|XP_003549987.1|  PREDICTED: transcription factor bHLH18-like        156   6e-39   
ref|XP_009389452.1|  PREDICTED: transcription factor bHLH25-like ...    153   6e-39   
ref|XP_010683065.1|  PREDICTED: transcription factor bHLH18-like        154   7e-39   
ref|XP_003539216.1|  PREDICTED: transcription factor bHLH25-like        154   8e-39   
ref|XP_009396448.1|  PREDICTED: transcription factor bHLH18-like        154   1e-38   
ref|XP_010670988.1|  PREDICTED: transcription factor bHLH18-like ...    153   2e-38   
ref|XP_010670989.1|  PREDICTED: transcription factor bHLH18-like ...    152   2e-38   
gb|KCW59637.1|  hypothetical protein EUGRSUZ_H02387                     154   2e-38   
ref|XP_009354635.1|  PREDICTED: transcription factor bHLH18-like        154   3e-38   
ref|XP_009398315.1|  PREDICTED: transcription factor bHLH18-like        152   3e-38   
gb|KHN13036.1|  Transcription factor bHLH25                             152   3e-38   
gb|KCW59645.1|  hypothetical protein EUGRSUZ_H02398                     152   3e-38   
ref|XP_006478068.1|  PREDICTED: transcription factor bHLH25-like        151   3e-38   
ref|XP_010548842.1|  PREDICTED: transcription factor bHLH25-like        151   3e-38   
ref|XP_010026563.1|  PREDICTED: transcription factor bHLH18-like        152   3e-38   
ref|XP_010417032.1|  PREDICTED: transcription factor bHLH18-like        152   4e-38   
ref|XP_010023398.1|  PREDICTED: transcription factor bHLH18-like        153   5e-38   
gb|EPS58430.1|  hypothetical protein M569_16384                         148   5e-38   
ref|XP_003538782.1|  PREDICTED: transcription factor bHLH25-like        152   5e-38   
ref|XP_003611493.1|  BHLH transcription factor                          152   8e-38   
ref|XP_009109398.1|  PREDICTED: transcription factor bHLH25-like        151   1e-37   
emb|CDY72199.1|  BnaA08g31080D                                          151   1e-37   
gb|KHN42602.1|  Transcription factor bHLH25                             151   1e-37   
ref|XP_006579969.1|  PREDICTED: transcription factor bHLH25-like        152   1e-37   
gb|KHM99702.1|  Transcription factor bHLH25                             152   1e-37   
ref|XP_010026571.1|  PREDICTED: transcription factor bHLH25-like        149   1e-37   
ref|XP_010943836.1|  PREDICTED: transcription factor bHLH25-like        150   2e-37   
ref|XP_003611499.1|  Transcription factor bHLH25                        150   3e-37   
ref|XP_006573684.1|  PREDICTED: transcription factor bHLH25-like        150   3e-37   
ref|XP_010943199.1|  PREDICTED: transcription factor bHLH18-like        149   4e-37   
ref|XP_007155779.1|  hypothetical protein PHAVU_003G231000g             150   4e-37   
gb|KHN42603.1|  Transcription factor bHLH25                             145   5e-37   
ref|XP_008380062.1|  PREDICTED: transcription factor bHLH18-like        150   5e-37   
ref|XP_010683071.1|  PREDICTED: transcription factor bHLH25-like        147   6e-37   
ref|XP_006411845.1|  hypothetical protein EUTSA_v10025715mg             149   7e-37   
ref|XP_009140386.1|  PREDICTED: transcription factor bHLH18             149   9e-37   
ref|XP_009771547.1|  PREDICTED: transcription factor bHLH18-like        149   9e-37   
gb|KDO40734.1|  hypothetical protein CISIN_1g038298mg                   147   1e-36   
ref|XP_010691802.1|  PREDICTED: transcription factor bHLH25-like        149   1e-36   
emb|CAB38933.1|  putative protein                                       148   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006441040.1|  hypothetical protein CICLE_v10023770mg             146   1e-36   
emb|CDY25628.1|  BnaA04g13200D                                          148   1e-36   
ref|XP_010026569.1|  PREDICTED: transcription factor bHLH25-like        145   1e-36   
ref|XP_003525884.2|  PREDICTED: transcription factor bHLH18-like        149   1e-36   
ref|XP_010531324.1|  PREDICTED: transcription factor bHLH18             147   2e-36   
ref|XP_009771544.1|  PREDICTED: transcription factor bHLH18-like        147   2e-36   
ref|XP_002310318.2|  hypothetical protein POPTR_0007s14480g             149   2e-36   Populus trichocarpa [western balsam poplar]
emb|CDX89511.1|  BnaC04g35300D                                          147   3e-36   
ref|XP_004489860.1|  PREDICTED: transcription factor bHLH18-like        145   3e-36   
ref|XP_006295910.1|  hypothetical protein CARUB_v10025041mg             146   3e-36   
ref|XP_004509201.1|  PREDICTED: transcription factor bHLH18-like        148   4e-36   
gb|EYU39093.1|  hypothetical protein MIMGU_mgv1a013585mg                143   5e-36   
ref|XP_006357857.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    146   6e-36   
emb|CDY13737.1|  BnaA09g42390D                                          145   9e-36   
ref|XP_010429208.1|  PREDICTED: transcription factor bHLH18-like        146   1e-35   
ref|XP_010472271.1|  PREDICTED: transcription factor bHLH18             145   1e-35   
emb|CAN64530.1|  hypothetical protein VITISV_041746                     142   1e-35   Vitis vinifera
ref|XP_009594425.1|  PREDICTED: transcription factor bHLH18-like        145   1e-35   
ref|XP_010026570.1|  PREDICTED: transcription factor bHLH25-like        144   1e-35   
ref|XP_009117336.1|  PREDICTED: transcription factor bHLH18-like        145   1e-35   
ref|XP_011021822.1|  PREDICTED: transcription factor bHLH18             147   1e-35   
emb|CDX76899.1|  BnaC08g34850D                                          145   2e-35   
ref|XP_006357745.1|  PREDICTED: transcription factor bHLH25-like        145   2e-35   
gb|KCW59644.1|  hypothetical protein EUGRSUZ_H02396                     144   2e-35   
ref|XP_003608593.1|  Transcription factor bHLH25                        142   2e-35   
ref|XP_008785755.1|  PREDICTED: transcription factor bHLH18-like        144   3e-35   
ref|XP_007156672.1|  hypothetical protein PHAVU_002G007400g             144   3e-35   
ref|XP_004233614.1|  PREDICTED: transcription factor bHLH18-like        144   3e-35   
ref|XP_010531586.1|  PREDICTED: transcription factor bHLH19             143   4e-35   
ref|XP_007156673.1|  hypothetical protein PHAVU_002G007500g             144   4e-35   
ref|XP_010531323.1|  PREDICTED: transcription factor NAI1               143   4e-35   
ref|XP_003560380.1|  PREDICTED: transcription factor bHLH18-like        144   5e-35   
ref|XP_009606580.1|  PREDICTED: transcription factor bHLH25-like        143   5e-35   
ref|XP_002988006.1|  hypothetical protein SELMODRAFT_48361              138   7e-35   
ref|XP_009389454.1|  PREDICTED: transcription factor bHLH25-like ...    142   7e-35   
ref|XP_004509038.1|  PREDICTED: transcription factor bHLH18-like        144   8e-35   
gb|KEH16277.1|  basic helix loop helix (bHLH) DNA-binding family ...    141   9e-35   
ref|XP_009392954.1|  PREDICTED: transcription factor bHLH18-like ...    142   1e-34   
ref|XP_004233615.1|  PREDICTED: transcription factor bHLH18-like        142   2e-34   
ref|XP_006600899.1|  PREDICTED: transcription factor bHLH25-like        143   2e-34   
gb|KHN01702.1|  Transcription factor bHLH25                             143   2e-34   
gb|ACN21641.1|  putative basic helix-loop-helix protein BHLH17          143   3e-34   Lotus japonicus
ref|XP_002262864.2|  PREDICTED: transcription factor bHLH18             142   3e-34   Vitis vinifera
ref|XP_009392953.1|  PREDICTED: transcription factor bHLH18-like ...    141   3e-34   
gb|AAD11428.1|  transporter homolog                                     140   4e-34   Mesembryanthemum crystallinum
gb|KCW59636.1|  hypothetical protein EUGRSUZ_H02386                     141   5e-34   
ref|XP_010023397.1|  PREDICTED: transcription factor bHLH19-like        141   5e-34   
ref|XP_004143425.1|  PREDICTED: transcription factor bHLH25-like        140   6e-34   
ref|XP_010555430.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    140   6e-34   
ref|XP_004511793.1|  PREDICTED: transcription factor bHLH18-like        140   6e-34   
ref|XP_009771545.1|  PREDICTED: transcription factor bHLH18-like        140   1e-33   
gb|EYU18364.1|  hypothetical protein MIMGU_mgv1a026314mg                139   1e-33   
ref|XP_002972921.1|  hypothetical protein SELMODRAFT_34848              134   1e-33   
ref|XP_004509037.1|  PREDICTED: transcription factor NAI1-like          140   1e-33   
ref|XP_009395204.1|  PREDICTED: transcription factor bHLH18-like        140   2e-33   
ref|XP_009611349.1|  PREDICTED: transcription factor bHLH18-like        140   2e-33   
ref|XP_009408579.1|  PREDICTED: transcription factor bHLH18-like        138   3e-33   
gb|ACN21640.1|  putative basic helix-loop-helix protein BHLH19          138   3e-33   Lotus japonicus
gb|EYU39094.1|  hypothetical protein MIMGU_mgv1a013585mg                135   4e-33   
ref|XP_008440467.1|  PREDICTED: transcription factor bHLH18-like        137   6e-33   
gb|EMS60003.1|  Transcription factor bHLH25                             133   6e-33   
ref|XP_004975687.1|  PREDICTED: transcription factor bHLH25-like        137   7e-33   
ref|XP_007150796.1|  hypothetical protein PHAVU_005G181400g             137   7e-33   
ref|XP_010681346.1|  PREDICTED: transcription factor bHLH18-like        138   7e-33   
ref|XP_010939468.1|  PREDICTED: transcription factor bHLH18-like        138   9e-33   
ref|XP_010472272.1|  PREDICTED: transcription factor bHLH19-like ...    136   1e-32   
ref|XP_010429209.1|  PREDICTED: transcription factor bHLH19-like        136   1e-32   
ref|XP_004511795.1|  PREDICTED: transcription factor bHLH25-like        136   1e-32   
ref|XP_003608592.1|  Transcription factor bHLH19                        136   2e-32   
gb|KHN31894.1|  Transcription factor bHLH25                             134   2e-32   
ref|NP_001242066.1|  uncharacterized protein LOC100795184               135   3e-32   
gb|EAZ26147.1|  hypothetical protein OsJ_10013                          134   4e-32   Oryza sativa Japonica Group [Japonica rice]
gb|KEH31549.1|  basic helix loop helix (bHLH) DNA-binding family ...    135   5e-32   
ref|XP_010417033.1|  PREDICTED: transcription factor bHLH19-like        134   5e-32   
gb|AAM10935.1|AF488563_1  putative bHLH transcription factor            134   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003608591.1|  BHLH transcription factor                          135   6e-32   
ref|XP_010451009.1|  PREDICTED: transcription factor bHLH25-like        134   6e-32   
ref|XP_006404739.1|  hypothetical protein EUTSA_v10000494mg             133   7e-32   
gb|KEH17493.1|  basic helix loop helix (bHLH) DNA-binding family ...    135   8e-32   
ref|NP_179861.2|  transcription factor bHLH19                           134   9e-32   
gb|ABK28508.1|  unknown                                                 133   9e-32   
ref|XP_004143535.1|  PREDICTED: transcription factor bHLH25-like        132   1e-31   
ref|XP_003597972.1|  Transcription factor bHLH18                        133   2e-31   
gb|EAY89129.1|  hypothetical protein OsI_10620                          131   2e-31   
emb|CDY52591.1|  BnaC08g49160D                                          133   2e-31   
ref|XP_009117331.1|  PREDICTED: transcription factor NAI1-like          133   2e-31   
ref|XP_006295655.1|  hypothetical protein CARUB_v10024768mg             132   2e-31   
ref|XP_004233616.1|  PREDICTED: transcription factor bHLH25             133   3e-31   
ref|XP_007135790.1|  hypothetical protein PHAVU_010G158600g             132   5e-31   
ref|XP_008440468.1|  PREDICTED: transcription factor bHLH25-like        130   8e-31   
gb|ABK28507.1|  unknown                                                 130   1e-30   
ref|NP_001077944.1|  transcription factor bHLH18                        130   1e-30   
gb|AAM27466.1|AC099732_3  Putative bHLH transcription factor            133   1e-30   
gb|KEH17492.1|  basic helix loop helix (bHLH) DNA-binding family ...    131   1e-30   
ref|XP_006404740.1|  hypothetical protein EUTSA_v10000251mg             130   2e-30   
ref|XP_006595181.1|  PREDICTED: transcription factor bHLH25-like        129   2e-30   
ref|XP_010023400.1|  PREDICTED: transcription factor bHLH18-like        132   2e-30   
ref|XP_003559601.1|  PREDICTED: transcription factor bHLH18-like        130   3e-30   
gb|KEH30290.1|  basic helix loop helix (bHLH) DNA-binding family ...    130   3e-30   
gb|KEH30307.1|  basic helix loop helix (bHLH) DNA-binding family ...    129   4e-30   
gb|KHN01297.1|  Transcription factor bHLH25                             128   4e-30   
ref|XP_002878632.1|  basic helix-loop-helix family protein              129   4e-30   
ref|XP_008787834.1|  PREDICTED: transcription factor bHLH25-like        130   5e-30   
ref|XP_009791053.1|  PREDICTED: transcription factor bHLH18-like        129   6e-30   
ref|XP_007135787.1|  hypothetical protein PHAVU_010G158400g             128   7e-30   
ref|XP_010555452.1|  PREDICTED: transcription factor bHLH19-like        128   8e-30   
ref|XP_010472273.1|  PREDICTED: transcription factor bHLH19-like ...    127   9e-30   
ref|XP_003529789.1|  PREDICTED: transcription factor bHLH18-like        129   1e-29   
ref|NP_001240111.1|  uncharacterized protein LOC100804953               125   1e-29   
ref|XP_003611502.1|  BHLH transcription factor                          127   1e-29   
ref|XP_004982204.1|  PREDICTED: transcription factor bHLH18-like        128   2e-29   
gb|KEH26198.1|  basic helix loop helix (bHLH) DNA-binding family ...    127   2e-29   
ref|XP_003520402.1|  PREDICTED: transcription factor bHLH25-like        127   2e-29   
gb|AES94460.2|  basic helix loop helix (bHLH) DNA-binding family ...    127   2e-29   
ref|XP_003529790.1|  PREDICTED: transcription factor bHLH18-like        127   2e-29   
emb|CDY13735.1|  BnaA09g42370D                                          126   2e-29   
ref|XP_009117332.1|  PREDICTED: transcription factor bHLH19-like        126   2e-29   
ref|XP_002878631.1|  basic helix-loop-helix family protein              126   2e-29   
gb|KHN01298.1|  Transcription factor bHLH25                             127   2e-29   
ref|NP_179860.2|  transcription factor bHLH18                           127   2e-29   
gb|KHN38014.1|  Transcription factor bHLH25                             127   2e-29   
ref|XP_003626782.1|  Transcription factor bHLH25                        127   3e-29   
ref|NP_001140919.1|  putative HLH DNA-binding domain superfamily ...    128   3e-29   
ref|XP_001760360.1|  predicted protein                                  130   3e-29   
ref|XP_006585623.1|  PREDICTED: transcription factor bHLH18-like        127   3e-29   
ref|XP_009392952.1|  PREDICTED: transcription factor bHLH18-like ...    127   4e-29   
ref|XP_003520396.2|  PREDICTED: transcription factor bHLH18-like ...    127   4e-29   
ref|XP_006583521.1|  PREDICTED: transcription factor bHLH18-like        127   5e-29   
ref|XP_003611496.1|  Transcription factor bHLH25                        125   6e-29   
ref|XP_003579101.1|  PREDICTED: transcription factor bHLH18-like        126   8e-29   
gb|AAC63586.1|  putative bHLH transcription factor                      125   8e-29   
ref|XP_011080466.1|  PREDICTED: transcription factor bHLH19-like        125   8e-29   
ref|XP_003530123.1|  PREDICTED: transcription factor bHLH25-like        125   9e-29   
ref|XP_001758246.1|  predicted protein                                  127   9e-29   
ref|XP_009140387.1|  PREDICTED: transcription factor bHLH19             124   1e-28   
gb|AAC63587.1|  putative bHLH transcription factor                      124   1e-28   
emb|CDX89512.1|  BnaC04g35310D                                          124   1e-28   
ref|XP_007135789.1|  hypothetical protein PHAVU_010G158500g             125   1e-28   
ref|NP_001240220.1|  uncharacterized protein LOC100799087               125   1e-28   
ref|XP_009140388.1|  PREDICTED: transcription factor NAI1               125   2e-28   
gb|KEH30289.1|  basic helix loop helix (bHLH) DNA-binding family ...    125   2e-28   
ref|XP_002466687.1|  hypothetical protein SORBIDRAFT_01g012260          125   2e-28   
ref|XP_004963289.1|  PREDICTED: transcription factor ATR2-like is...    125   2e-28   
ref|XP_009768662.1|  PREDICTED: transcription factor bHLH18-like        123   2e-28   
ref|XP_004986324.1|  PREDICTED: transcription factor bHLH25-like        124   2e-28   
ref|XP_003608613.1|  Transcription factor bHLH25                        125   2e-28   
gb|KEH16284.1|  basic helix loop helix (bHLH) DNA-binding family ...    125   2e-28   
ref|XP_002446521.1|  hypothetical protein SORBIDRAFT_06g017460          125   2e-28   
gb|AES86497.2|  helix loop helix DNA-binding domain protein             125   2e-28   
ref|XP_003559602.1|  PREDICTED: transcription factor bHLH19-like        124   2e-28   
ref|XP_004963288.1|  PREDICTED: transcription factor ATR2-like is...    125   3e-28   
gb|KHN22418.1|  Transcription factor bHLH25                             124   3e-28   
gb|EAY84006.1|  hypothetical protein OsI_39237                          124   3e-28   
ref|XP_002528912.1|  DNA binding protein, putative                      124   3e-28   
ref|XP_004963526.1|  PREDICTED: transcription factor NAI1-like          124   3e-28   
ref|XP_003547571.1|  PREDICTED: transcription factor bHLH18-like        123   3e-28   
gb|KHN31892.1|  Transcription factor bHLH25                             125   4e-28   
emb|CDY25630.1|  BnaA04g13220D                                          123   5e-28   
ref|XP_010230206.1|  PREDICTED: transcription factor bHLH18-like        123   5e-28   
emb|CDP00900.1|  unnamed protein product                                120   6e-28   
ref|XP_004515539.1|  PREDICTED: transcription factor bHLH18-like        124   6e-28   
ref|XP_007134385.1|  hypothetical protein PHAVU_010G043400g             123   6e-28   
ref|XP_003604325.1|  Transcription factor bHLH25                        123   6e-28   
gb|KGN48661.1|  hypothetical protein Csa_6G497120                       122   8e-28   
ref|XP_008440466.1|  PREDICTED: transcription factor bHLH18-like        122   1e-27   
ref|NP_001237930.1|  uncharacterized protein LOC100527052               119   1e-27   
gb|KHN38012.1|  Transcription factor bHLH19-like protein                119   1e-27   
gb|KFK32795.1|  hypothetical protein AALP_AA6G289300                    122   2e-27   
gb|EMT27133.1|  Transcription factor bHLH25                             121   2e-27   
ref|XP_004516755.1|  PREDICTED: transcription factor bHLH18-like        121   2e-27   
emb|CDX89513.1|  BnaC04g35320D                                          121   2e-27   
gb|KHN08182.1|  Transcription factor bHLH25                             121   2e-27   
ref|XP_006584525.1|  PREDICTED: uncharacterized protein LOC100527...    119   3e-27   
dbj|BAD44011.1|  putative bHLH transcription factor (bHLH020)           121   3e-27   
ref|NP_850031.2|  transcription factor NAI1                             121   3e-27   
ref|XP_004984147.1|  PREDICTED: transcription factor bHLH25-like        121   3e-27   
ref|XP_007134377.1|  hypothetical protein PHAVU_010G042700g             121   4e-27   
ref|XP_003547558.1|  PREDICTED: transcription factor bHLH25-like        119   5e-27   
ref|XP_009630109.1|  PREDICTED: transcription factor bHLH18-like        120   6e-27   
ref|XP_009607937.1|  PREDICTED: transcription factor bHLH18-like ...    119   7e-27   
ref|XP_010417034.1|  PREDICTED: transcription factor NAI1-like          120   8e-27   
emb|CDP00899.1|  unnamed protein product                                119   8e-27   
ref|XP_004167814.1|  PREDICTED: transcription factor bHLH25-like        116   9e-27   
gb|ABA99937.1|  Helix-loop-helix DNA-binding domain containing pr...    120   9e-27   
gb|EAZ21321.1|  hypothetical protein OsJ_36975                          120   9e-27   
ref|XP_010322787.1|  PREDICTED: transcription factor bHLH18-like        119   9e-27   
ref|XP_006585622.1|  PREDICTED: transcription factor bHLH18-like        120   1e-26   
emb|CDY25629.1|  BnaA04g13210D                                          119   1e-26   
dbj|BAJ95870.1|  predicted protein                                      120   2e-26   
ref|XP_010429210.1|  PREDICTED: transcription factor NAI1-like          119   2e-26   
gb|KHN38016.1|  Transcription factor bHLH19                             120   2e-26   
ref|XP_010472274.1|  PREDICTED: transcription factor NAI1               119   2e-26   
ref|XP_004486628.1|  PREDICTED: transcription factor bHLH25-like        119   2e-26   
gb|KHN01614.1|  Transcription factor bHLH25                             117   3e-26   
gb|KEH28663.1|  helix loop helix DNA-binding domain protein             118   3e-26   
ref|XP_004982203.1|  PREDICTED: transcription factor bHLH25-like        119   4e-26   
ref|XP_010683072.1|  PREDICTED: transcription factor bHLH25-like        117   4e-26   
ref|XP_003529791.2|  PREDICTED: transcription factor bHLH25-like        117   4e-26   
ref|XP_011080799.1|  PREDICTED: transcription factor bHLH18-like        118   4e-26   
ref|XP_007135786.1|  hypothetical protein PHAVU_010G158300g             116   5e-26   
ref|XP_006357746.1|  PREDICTED: transcription factor bHLH25-like        117   6e-26   
ref|XP_003597966.1|  Transcription factor bHLH25                        117   7e-26   
dbj|BAJ84878.1|  predicted protein                                      118   7e-26   
dbj|BAJ95548.1|  predicted protein                                      118   7e-26   
ref|XP_007150795.1|  hypothetical protein PHAVU_005G181300g             117   8e-26   
ref|XP_004143534.1|  PREDICTED: transcription factor bHLH25-like        116   8e-26   
gb|KEH20194.1|  helix loop helix DNA-binding domain protein             115   1e-25   
gb|EMT25485.1|  Transcription factor bHLH25                             117   2e-25   
ref|XP_004960432.1|  PREDICTED: transcription factor NAI1-like          116   2e-25   
gb|KEH16285.1|  basic helix loop helix (bHLH) DNA-binding family ...    116   2e-25   
gb|AET01257.2|  helix loop helix DNA-binding domain protein             115   3e-25   
emb|CDP17176.1|  unnamed protein product                                110   3e-25   
gb|KHN22417.1|  Transcription factor bHLH25                             115   3e-25   
ref|XP_003533078.1|  PREDICTED: transcription factor bHLH25-like        114   3e-25   
gb|KHN22139.1|  Transcription factor bHLH25                             115   4e-25   
ref|XP_006651675.1|  PREDICTED: transcription factor bHLH25-like        114   5e-25   
ref|XP_004492886.1|  PREDICTED: transcription factor bHLH25-like ...    114   8e-25   
emb|CDY52593.1|  BnaC08g49180D                                          113   8e-25   
ref|XP_010229513.1|  PREDICTED: transcription factor bHLH19-like        113   8e-25   
ref|XP_003626781.1|  Transcription factor bHLH25                        115   9e-25   
gb|KHN01615.1|  Transcription factor bHLH25                             113   9e-25   
ref|XP_004987096.1|  PREDICTED: transcription factor bHLH18-like        113   1e-24   
ref|XP_004492885.1|  PREDICTED: transcription factor bHLH25-like ...    114   1e-24   
gb|KEH39615.1|  helix loop helix DNA-binding domain protein             113   1e-24   
ref|XP_003542127.1|  PREDICTED: transcription factor bHLH18-like        111   1e-24   
ref|NP_001168647.1|  putative HLH DNA-binding domain superfamily ...    114   2e-24   
gb|EEC66452.1|  hypothetical protein OsI_32504                          110   2e-24   
ref|XP_002878633.1|  hypothetical protein ARALYDRAFT_481138             113   2e-24   
gb|ACU23740.1|  unknown                                                 111   3e-24   
ref|XP_006294574.1|  hypothetical protein CARUB_v10023610mg             112   3e-24   
gb|EMT10895.1|  Transcription factor bHLH25                             109   4e-24   
gb|KEH16287.1|  basic helix loop helix (bHLH) DNA-binding family ...    112   4e-24   
ref|XP_002466686.1|  hypothetical protein SORBIDRAFT_01g012250          113   4e-24   
ref|XP_003608609.1|  Transcription factor bHLH25                        112   5e-24   
gb|EYU22727.1|  hypothetical protein MIMGU_mgv1a021517mg                112   5e-24   
gb|EMT33188.1|  Transcription factor bHLH19                             112   5e-24   
gb|EMT20704.1|  Transcription factor bHLH25                             111   6e-24   
gb|EMT16739.1|  Transcription factor bHLH25                             111   6e-24   
ref|XP_004978136.1|  PREDICTED: transcription factor bHLH25-like        112   7e-24   
gb|KHN22140.1|  Transcription factor bHLH25                             110   1e-23   
gb|AES68235.2|  helix loop helix DNA-binding domain protein             109   2e-23   
ref|XP_003597984.1|  Transcription factor bHLH25                        110   2e-23   
gb|EMS62465.1|  Transcription factor bHLH19                             109   2e-23   
ref|XP_008665937.1|  PREDICTED: transcription factor bHLH18-like        110   2e-23   
gb|EMS56840.1|  Transcription factor bHLH25                             108   3e-23   
ref|XP_011080798.1|  PREDICTED: transcription factor bHLH25-like        110   3e-23   
ref|XP_010270356.1|  PREDICTED: transcription factor bHLH25-like        105   3e-23   
gb|EMS62464.1|  Transcription factor bHLH25                             108   4e-23   
gb|KHN40506.1|  Transcription factor bHLH25                             108   9e-23   
ref|XP_011073650.1|  PREDICTED: transcription factor bHLH25-like ...    105   1e-22   
ref|NP_001140525.1|  uncharacterized protein LOC100272590               108   1e-22   
tpg|DAA50536.1|  TPA: putative HLH DNA-binding domain superfamily...    108   1e-22   
gb|AAC63588.1|  putative bHLH transcription factor                      107   2e-22   
ref|XP_002466688.1|  hypothetical protein SORBIDRAFT_01g012280          107   2e-22   
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               110   3e-22   
ref|XP_008653082.1|  PREDICTED: transcription factor bHLH18-like        106   4e-22   
ref|XP_002276304.3|  PREDICTED: transcription factor bHLH25-like        105   4e-22   
emb|CBI14775.3|  unnamed protein product                                104   5e-22   
gb|EMT15172.1|  Transcription factor bHLH25                             107   5e-22   
ref|XP_007134383.1|  hypothetical protein PHAVU_010G043200g             104   5e-22   
emb|CDP01402.1|  unnamed protein product                                105   7e-22   
ref|XP_004986762.1|  PREDICTED: transcription factor bHLH19-like        105   8e-22   
dbj|BAJ97198.1|  predicted protein                                      106   9e-22   
ref|XP_008663222.1|  PREDICTED: transcription factor bHLH18-like        105   9e-22   
ref|XP_009607938.1|  PREDICTED: transcription factor bHLH25-like ...    103   2e-21   
ref|XP_003597973.1|  BHLH transcription factor                          102   3e-21   
ref|XP_009774018.1|  PREDICTED: transcription factor bHLH18-like        103   3e-21   
ref|XP_004486629.1|  PREDICTED: transcription factor bHLH18-like        102   4e-21   
ref|XP_011073651.1|  PREDICTED: transcription factor bHLH25-like ...    100   5e-21   
emb|CBI14785.3|  unnamed protein product                                101   7e-21   
ref|XP_008666761.1|  PREDICTED: transcription factor bHLH18-like        102   8e-21   
ref|XP_007134384.1|  hypothetical protein PHAVU_010G043300g             102   1e-20   
gb|ABF98119.1|  Helix-loop-helix DNA-binding domain containing pr...    101   1e-20   
ref|XP_007135788.1|  hypothetical protein PHAVU_010G158400g             102   1e-20   
gb|KHN40507.1|  Transcription factor bHLH25                             101   1e-20   
gb|EAY91336.1|  hypothetical protein OsI_12957                          102   1e-20   
gb|AAP03375.1|  putative ammonium transporter                           101   2e-20   
ref|XP_003597976.1|  Transcription factor bHLH18                        100   3e-20   
ref|XP_006603576.1|  PREDICTED: transcription factor NAI1-like          101   3e-20   
gb|AES68227.2|  helix loop helix DNA-binding domain protein           99.8    3e-20   
ref|XP_003635290.1|  PREDICTED: transcription factor bHLH25-like      99.8    3e-20   
ref|XP_003624236.1|  Transcription factor NAI1                          100   4e-20   
ref|XP_010065723.1|  PREDICTED: transcription factor bHLH25-like      97.8    4e-20   
ref|XP_003624235.1|  Transcription factor NAI1                          100   5e-20   
ref|XP_008662429.1|  PREDICTED: transcription factor MYC3-like          100   7e-20   
ref|XP_002467398.1|  hypothetical protein SORBIDRAFT_01g027411        99.4    1e-19   
tpg|DAA47651.1|  TPA: putative HLH DNA-binding domain superfamily...  99.0    2e-19   
ref|XP_008659077.1|  PREDICTED: transcription factor bHLH18-like      98.6    2e-19   
ref|XP_006576686.1|  PREDICTED: transcription factor bHLH18-like ...  99.0    3e-19   
dbj|BAJ94119.1|  predicted protein                                    97.8    4e-19   
gb|EEE50448.1|  hypothetical protein OsJ_30460                        97.4    5e-19   
ref|XP_003622649.1|  Transcription factor bHLH25                      95.1    6e-19   
ref|XP_006582927.1|  PREDICTED: uncharacterized protein LOC100799...  97.1    6e-19   
gb|AAK00421.2|  Putative bHLH transcription factor                    97.4    8e-19   
ref|XP_002467399.1|  hypothetical protein SORBIDRAFT_01g027416        96.7    1e-18   
gb|AES68218.2|  helix loop helix DNA-binding domain protein           95.5    1e-18   



>ref|XP_011073652.1| PREDICTED: transcription factor bHLH18-like [Sesamum indicum]
Length=353

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 160/202 (79%), Gaps = 8/202 (4%)
 Frame = -2

Query  1046  EQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDK  867
             EQ   P  TT     K   R RPP+  YDHI+AERKRRE LS++F+ALSTIVPGL+KMDK
Sbjct  155   EQSKRPQPTT-----KKPSRVRPPSQTYDHIIAERKRREQLSQRFVALSTIVPGLKKMDK  209

Query  866   TSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK-GNSDE  690
             TSVLGD IKYLK +QERVK LEE+++K+TMESVV VKKSQ+  +D  E SS EK G+SDE
Sbjct  210   TSVLGDAIKYLKHLQERVKVLEEQATKQTMESVVLVKKSQIMVED--EGSSDEKSGSSDE  267

Query  689   QSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITII  510
             Q LPEIE R+C+NHILLR++C++ KG++  + S+VEKLNL VVN++V  FGSLALDITI+
Sbjct  268   QPLPEIEARVCNNHILLRVHCEKHKGVLVNLLSKVEKLNLTVVNTNVTPFGSLALDITIV  327

Query  509   VEMEKEFDLPMKHIAKILRSAI  444
              EM+KEF+L +K + K LR+A+
Sbjct  328   AEMDKEFNLTVKDVVKRLRAAL  349



>emb|CDP21059.1| unnamed protein product [Coffea canephora]
Length=284

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             KK+  R RPP+  YDHI+AERKRRE LS+QF+ALS IVPGL+KMDKTSVLGDTIKYLK +
Sbjct  90    KKTSSRTRPPSQTYDHIIAERKRREQLSQQFVALSAIVPGLKKMDKTSVLGDTIKYLKHL  149

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             Q+R K LEE+++K+TMES+V VKKSQ+  +D+ E S  ++G  +EQ LPEIE ++CD H+
Sbjct  150   QQREKELEEQATKQTMESLVLVKKSQLLLEDEGESSDEQEGCCNEQPLPEIEAKMCDKHV  209

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             LLRI C++ +G++ KI SE++KLNL V+N++VA FGSLALDITII EM++EF+L MK + 
Sbjct  210   LLRILCEKHRGVLVKILSEMDKLNLDVINTNVAPFGSLALDITIITEMKREFNLSMKELV  269

Query  464   KILRSAIQHA  435
               L S ++ A
Sbjct  270   NSLASGLRRA  279



>emb|CDP17177.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 146/340 (43%), Positives = 207/340 (61%), Gaps = 47/340 (14%)
 Frame = -2

Query  1322  LSQACFSGMGTDDLSFLDQFQILQSIEQEF--AGVLGEDVLCssspeegspPTTCHLG--  1155
             +S + FS +G +D  F DQ+ ++  +++EF  A +  E    +++     P +TC     
Sbjct  5     VSSSWFSELGMEDSFFNDQYDVMDFLDEEFLNANLSPEG---NTNSSTFIPVSTCSTTLS  61

Query  1154  ----------EDDRPLKQLKI--------------HHHPNIDDVNLPELRQEL------L  1065
                         +RP KQ K               H+ P I     P +  E+      L
Sbjct  62    AFSAMDAPPISTERPAKQQKSDDLNSSSLGNIPNHHNQPMILTFGNPVMPAEINPQQINL  121

Query  1064  TSNAIAE--------QETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFL  909
               +A++E           E A  ++ K KK+G R RP +  YDHI+AERKRRE LS++F+
Sbjct  122   EDDAVSEILKSHGSFVNLEEATRSSQKRKKTGGRTRPASQTYDHIVAERKRREQLSQRFV  181

Query  908   ALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDD  729
             ALST+VPGL+KMDKTSVLGD I YLK +QERVKTLEE+++K+ MES+V VK+SQ+    +
Sbjct  182   ALSTLVPGLKKMDKTSVLGDAISYLKHLQERVKTLEEQAAKQNMESMVLVKRSQLLV--E  239

Query  728   DEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSV  549
             DE SS E G SDEQ LPEIE +LC+ +ILLR++C   +G++ KI SEVE  NL V++++V
Sbjct  240   DEGSSDEMGGSDEQPLPEIEAKLCNKNILLRVHCRNYRGVLVKILSEVEMQNLTVIHTTV  299

Query  548   ARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQHAAQ  429
             A FG LALD+T++ EMEKEF+L M+ + K L+SA+Q   Q
Sbjct  300   APFGRLALDVTLMAEMEKEFNLTMQELVKSLQSALQRGKQ  339



>emb|CDP18043.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 163/218 (75%), Gaps = 12/218 (6%)
 Frame = -2

Query  1073  ELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTI  894
             E+LTS  ++    E A  +   PKK   R RP +  YDHI+AERKRRE LS++F+ALS I
Sbjct  124   EVLTSR-VSFPNLEEATKSAPAPKKG--RTRPASQTYDHIIAERKRREQLSQRFVALSAI  180

Query  893   VPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSS  714
             VPGL+KMDKTSVLGD I YLK ++ERVKTLEE+++K+ M+SVV VKKSQ+  +D+     
Sbjct  181   VPGLKKMDKTSVLGDAITYLKHLKERVKTLEEQATKQKMQSVVLVKKSQLVVEDE-----  235

Query  713   GEKGNSDEQ-SLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFG  537
                G+SDEQ  LPEIE +LCD  +LLR++C+  +G++ K+ SE+EKLNLAV N+SVA FG
Sbjct  236   ---GSSDEQRPLPEIEAKLCDKKVLLRVHCENHRGVLVKVLSEIEKLNLAVSNASVAPFG  292

Query  536   SLALDITIIVEMEKEFDLPMKHIAKILRSAIQHAAQTS  423
             SLALDITII EM+KEF L MK + + LRSA+Q AA+ S
Sbjct  293   SLALDITIIAEMDKEFSLTMKELVQGLRSALQRAARDS  330



>emb|CDP17179.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 159/211 (75%), Gaps = 3/211 (1%)
 Frame = -2

Query  1073  ELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTI  894
             E+LTS+  +    E A     K KK+G R RP +  +DHILAERKRRE LS+ F+ALS I
Sbjct  101   EVLTSHG-SFVNLEEAAQNARKKKKTGGRVRPASQIHDHILAERKRREQLSQGFVALSAI  159

Query  893   VPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSS  714
             VPGL+KMDKTSVLGD I YLK +QERVKTLEE+ +++TM+SVV +K+SQ+  +D  E SS
Sbjct  160   VPGLKKMDKTSVLGDAIIYLKHLQERVKTLEEQVAQQTMQSVVLLKRSQLLVED--EGSS  217

Query  713   GEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGS  534
              + G  DEQ LPEIE ++C+ +ILLRI+C++ KG++ KI SEVEK NLAV+N+ VA FG+
Sbjct  218   DDTGGPDEQPLPEIEAKMCNRNILLRIHCEKHKGVLVKILSEVEKHNLAVMNTCVAPFGN  277

Query  533   LALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
              ALDITII EMEKEF L ++ + KIL SA+ 
Sbjct  278   FALDITIIAEMEKEFSLTIQELVKILGSAVH  308



>ref|XP_011100103.1| PREDICTED: transcription factor bHLH18-like [Sesamum indicum]
Length=337

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 153/189 (81%), Gaps = 5/189 (3%)
 Frame = -2

Query  992  RRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERV  813
            RR RPP+  YDHI+AERKRRE LS++FLALS++VPGL+KMDKTSVLGDTIKYLK +QERV
Sbjct  151  RRLRPPSQTYDHIMAERKRREKLSQRFLALSSMVPGLKKMDKTSVLGDTIKYLKYLQERV  210

Query  812  KTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKG-NSDE-QSLPEIETRLCDNHILL  639
            KTLE++++K+T++SVVFVK+S++    +DE SS EK   SDE  SLPEIE R+CD  ILL
Sbjct  211  KTLEDQAAKQTVDSVVFVKRSRIM---EDEGSSYEKNRESDELSSLPEIEARVCDRSILL  267

Query  638  RIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKI  459
            +I C++ K ++ K+ +EVEKLNLAVVN+SV  FGSLALDITII +M+KE  +  K +   
Sbjct  268  KILCEKSKDVLVKVLAEVEKLNLAVVNTSVTPFGSLALDITIIAQMDKEMRVTAKDMVTT  327

Query  458  LRSAIQHAA  432
            LRSA+Q AA
Sbjct  328  LRSALQSAA  336



>gb|AIA82919.1| bHLH1 [Gentiana rigescens]
Length=367

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 144/182 (79%), Gaps = 3/182 (2%)
 Frame = -2

Query  980  PPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLE  801
            PP+  YDHI+AERKRRE LS+QF+ALSTIVPGL+KMDKTSVLGD I YLKQ+QE+VKTLE
Sbjct  183  PPSQTYDHIIAERKRREQLSQQFVALSTIVPGLKKMDKTSVLGDAINYLKQLQEKVKTLE  242

Query  800  EESSKRTMEsvvfvkksqvsFDDDDEMSSG---EKGNSDEQSLPEIETRLCDNHILLRIY  630
            E++S + MES+V VKK+++  +++    +    + G  DEQ LP IE +LCD  +LLRI 
Sbjct  243  EKASNQKMESMVLVKKTKLLIEEEGSSINSDDQQGGTYDEQHLPNIEAKLCDKKVLLRIQ  302

Query  629  CDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRS  450
            C++ KG++GKIFS ++ LN+AV+N++V  FG++ALDITI+ E++KE +L MK + K LRS
Sbjct  303  CEKNKGVLGKIFSVIQMLNMAVINTNVTPFGNMALDITIVAELDKELNLTMKELVKSLRS  362

Query  449  AI  444
            A+
Sbjct  363  AL  364



>ref|XP_002300300.2| hypothetical protein POPTR_0001s29400g [Populus trichocarpa]
 gb|EEE85105.2| hypothetical protein POPTR_0001s29400g [Populus trichocarpa]
Length=330

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 135/322 (42%), Positives = 194/322 (60%), Gaps = 40/322 (12%)
 Frame = -2

Query  1298  MGTDDLSFLDQFQILQSIEQE----FAGVLGEDVLCssspeegspPTTCHLGEDDRPLKQ  1131
             +G +D SF +Q+  + S++      FA   GE++  S S +  +  T+    +  RP KQ
Sbjct  12    LGMEDSSFTNQW-FMNSLDDTSLLPFAAAFGENIHHSFSHQNFNLKTSM---DSVRPTKQ  67

Query  1130  LKIHH--------HPNI---------DDVNLPELRQEL--------LTSNAIAEQETEPA  1026
             L+  H         PNI         + + L + ++E         L S+ +  Q++   
Sbjct  68    LRTDHLSNPQPAFSPNILSFVNSNHANQMGLMKPKEEAVCSKSINNLPSDMVVSQDSFGN  127

Query  1025  DTTTIK----PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSV  858
                  K    PK     G   +   DHI+AERKRRE LS++F+ALS +VPGL+KMDK SV
Sbjct  128   QYYAFKASQGPKMISANGTRLSQSQDHIIAERKRREKLSQRFIALSAVVPGLKKMDKASV  187

Query  857   LGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGE--KGNSDEQS  684
             LGD IKYLKQ+QERVKTLEE++ ++TMESVV VKKS V  D+  E SS +  KG   E +
Sbjct  188   LGDAIKYLKQLQERVKTLEEQTKRKTMESVVIVKKSHVYVDEGGENSSSDVSKGPIHE-T  246

Query  683   LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             LPE+E R CD H+L+RI+C + KG++ K  +EVEKL+L+V+NSSV  FG+ ALD+TII +
Sbjct  247   LPELEARFCDKHVLIRIHCKKNKGVLEKTVAEVEKLHLSVINSSVLTFGTCALDVTIIAQ  306

Query  503   MEKEFDLPMKHIAKILRSAIQH  438
             M+ +F++ +K + K L SA Q+
Sbjct  307   MDIDFNMSVKDLVKTLHSAFQY  328



>ref|XP_011030254.1| PREDICTED: transcription factor bHLH18-like [Populus euphratica]
 ref|XP_011030255.1| PREDICTED: transcription factor bHLH18-like [Populus euphratica]
 ref|XP_011030256.1| PREDICTED: transcription factor bHLH18-like [Populus euphratica]
Length=330

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 135/322 (42%), Positives = 195/322 (61%), Gaps = 40/322 (12%)
 Frame = -2

Query  1298  MGTDDLSFLDQFQILQSIEQE----FAGVLGEDVLCssspeegspPTTCHLGEDDRPLKQ  1131
             +G +D SF +Q+  + S++      FA   GE++  S S +  +  T+    +  RP KQ
Sbjct  12    LGMEDSSFTNQW-FMNSLDDTGLLPFAAAFGENMHHSFSHQNFNLKTSM---DSARPTKQ  67

Query  1130  LKIHH--------HPNI---------DDVNLPELRQEL--------LTSNAIAEQETEPA  1026
             L+  H         PNI         + + L + ++E         L S+ +  Q++   
Sbjct  68    LRTDHLSNPQPAFSPNILSFVNSNHANQMGLMKPKEEAVCSKSINNLPSDMVVSQDSFGN  127

Query  1025  DTTTIK----PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSV  858
                  K    PK     G   +   DHI+AERKRRE LS++F+ALS +VPGL+KMDK SV
Sbjct  128   QNYAFKASQGPKMISANGTRLSQSQDHIIAERKRREKLSQRFIALSAVVPGLKKMDKASV  187

Query  857   LGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGE--KGNSDEQS  684
             LGD IKYLKQ+QERVKTLEE++ ++TMESVV VKKS+V  D+  E SS +  KG   E +
Sbjct  188   LGDAIKYLKQLQERVKTLEEQTKRKTMESVVIVKKSRVYVDEGGENSSSDVSKGPIHE-T  246

Query  683   LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             LPE+E R CD H+L+RI+C + KG++ K  +EVEKL+L+V+NSSV  FG+  LD+TII +
Sbjct  247   LPELEARFCDKHVLIRIHCKKNKGVLEKTVAEVEKLHLSVINSSVLTFGTSVLDVTIIAQ  306

Query  503   MEKEFDLPMKHIAKILRSAIQH  438
             M+ +F++ +K + K LRSA Q+
Sbjct  307   MDIDFNMSVKDLVKTLRSAFQY  328



>ref|XP_010028032.1| PREDICTED: transcription factor bHLH18 [Eucalyptus grandis]
Length=377

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 140/184 (76%), Gaps = 7/184 (4%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R P+   DHILAERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKYLKQ+QERVK+L
Sbjct  191  RTPSSAQDHILAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYLKQLQERVKSL  250

Query  803  EEESSKRTMEsvvfvkksqvsFDDD----DEMSSGEKGNSDEQSLPEIETRLCDNHILLR  636
            EE+S K+TMES VFVKK Q+S DDD    DE S G    S +Q+LPEIE R+ D  +L+R
Sbjct  251  EEQSKKKTMESAVFVKKYQLSNDDDGSSCDESSDGY---SADQALPEIEARVADKDVLIR  307

Query  635  IYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKIL  456
            I+C+ QK I  +IF EVEKLNL++V S+V RFGS  LDITI+ +M+  F L +K I K L
Sbjct  308  IHCENQKAIAARIFGEVEKLNLSIVQSNVVRFGSSTLDITIVAQMDDGFSLTVKEIVKNL  367

Query  455  RSAI  444
            RS++
Sbjct  368  RSSL  371



>emb|CDP17180.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = -2

Query  1073  ELLTSNAIAEQETEPADTTT-IKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALST  897
             E+LTS+    +  E A TT   K KK G R RPP+  YDHI+AERKRRE LS++F+ALS 
Sbjct  128   EVLTSHGSFAKLDEAAKTTVQTKAKKPGGRVRPPSQTYDHIIAERKRREQLSQRFMALSA  187

Query  896   IVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMS  717
             IVPGL+KMDK+S+LGD I+YLK +QERVKTLEE+++++TMESVV VK+SQ+    +DE S
Sbjct  188   IVPGLKKMDKSSILGDAIEYLKHLQERVKTLEEKAARQTMESVVLVKRSQLLL--EDEGS  245

Query  716   SGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFG  537
             S E    +EQ LPE E ++CD ++LLRI+C   KG++ KI S+++KLNLAV+N+ V+ FG
Sbjct  246   SDEVAGPNEQPLPEFEAKVCDKNVLLRIHCKNYKGVLIKILSQIDKLNLAVLNTCVSPFG  305

Query  536   SLALDITIIVEM  501
             + ALDITII E+
Sbjct  306   NFALDITIIAEV  317



>ref|XP_006486799.1| PREDICTED: transcription factor bHLH25-like [Citrus sinensis]
Length=316

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 196/313 (63%), Gaps = 38/313 (12%)
 Frame = -2

Query  1298  MGTDDLSFLDQFQILQSIEQ----EFAGVLGEDVLCssspeegspPTTCHLGEDDRPLKQ  1131
             +G +DLSF++Q+ ++ SI++      A   GE++  S +    +  T       DRP KQ
Sbjct  12    LGMEDLSFMNQWHMMNSIDEFNLLPIAAAFGENLQHSYTHPSFNNNTGI-----DRPQKQ  66

Query  1130  LKIH--------HHPN-IDDVNLPEL-----RQEL---LTSNAIAEQETEPADTTTI-KP  1005
             LK           +PN +  +N+ ++     +QE      S+++  Q +   +   + K 
Sbjct  67    LKTSTWNSSETGFNPNNVSSINMNQMGILKPKQETGAGYPSDSLPSQVSFGNNQNYVFKA  126

Query  1004  KKSGRRGRPP-----THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIK  840
              +  +R  P      ++  DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IK
Sbjct  127   SQGAKRISPGAGNRLSNTQDHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIK  186

Query  839   YLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRL  660
             YLKQ+QERVK LEE+++K+T+ESVVFVKK+Q+S + D+         +  ++LPEIE R 
Sbjct  187   YLKQLQERVKILEEQANKKTIESVVFVKKTQLSDEGDN------PNGAFNEALPEIEARF  240

Query  659   CDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLP  480
             CD  +L+R++C+++KG+  KI +E+EKL+L V+NSSV  FGS  LD+TII +M+ EF++ 
Sbjct  241   CDKSVLIRVHCEKRKGVFEKIVAEIEKLHLTVINSSVMTFGSSVLDVTIIAQMDVEFNMT  300

Query  479   MKHIAKILRSAIQ  441
             +K + K L SA Q
Sbjct  301   VKDLVKNLHSAFQ  313



>gb|KDO67951.1| hypothetical protein CISIN_1g021208mg [Citrus sinensis]
Length=316

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 127/313 (41%), Positives = 194/313 (62%), Gaps = 38/313 (12%)
 Frame = -2

Query  1298  MGTDDLSFLDQFQILQSIEQ----EFAGVLGEDVLCssspeegspPTTCHLGEDDRPLKQ  1131
             +G +DLSF++Q+ ++ SI++      A   GE++  S +    +  T       DRP KQ
Sbjct  12    LGMEDLSFMNQWHMMNSIDEFNLLPIAAAFGENLQHSYTHPSFNNNTGI-----DRPQKQ  66

Query  1130  LKIH--------HHPN-IDDVNLPEL-----RQEL---LTSNAIAEQETEPADTTTI-KP  1005
             LK           +PN +  +N+ ++     +QE      S+ +  Q +   +   + K 
Sbjct  67    LKTSTWNSSETGFNPNNVSSINMNQMGILKPKQETGAGYPSDILPSQVSFGNNQNYVFKA  126

Query  1004  KKSGRRGRPP-----THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIK  840
              +  +R  P      ++  DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IK
Sbjct  127   SQGAKRISPGAGNRLSNTQDHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIK  186

Query  839   YLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRL  660
             YLKQ+QE+VK LEE+++K+T+ESVVFV K+Q+S + D+         +  ++LPEIE R 
Sbjct  187   YLKQLQEKVKILEEQANKKTIESVVFVNKTQLSDEGDN------PNGAFNEALPEIEARF  240

Query  659   CDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLP  480
             CD  +L+R++C+++KG+  KI +E+EKL+L V+NSSV  FGS  LD+TII +M+ EF++ 
Sbjct  241   CDKSVLIRVHCEKRKGVFEKIVAEIEKLHLTVINSSVMTFGSSVLDVTIIAQMDVEFNMT  300

Query  479   MKHIAKILRSAIQ  441
             +K + K L SA Q
Sbjct  301   VKDLVKNLHSAFQ  313



>ref|XP_002518295.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF44055.1| DNA binding protein, putative [Ricinus communis]
Length=309

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 141/177 (80%), Gaps = 4/177 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKYLKQ+QERVKTLEE++ K+
Sbjct  131  DHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYLKQLQERVKTLEEQTKKK  190

Query  782  TMEsvvfvkksqvsFDDDDEMSSGE---KGNSDEQSLPEIETRLCDNHILLRIYCDRQKG  612
            TMESVV VKKS++ F ++D  SS E   KG  DE  LPEIE R+CD H+L+RI+C+++KG
Sbjct  191  TMESVVIVKKSRLVFGEEDTSSSDESFSKGPFDE-PLPEIEARICDKHVLIRIHCEKRKG  249

Query  611  IIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            ++ K  +E+EKL+L+V NSSV  FGS ALD+TII +M+ EF + +K + K L SA +
Sbjct  250  VLEKTIAEIEKLHLSVTNSSVLTFGSSALDVTIIAQMDNEFSMSVKDLVKDLHSAFK  306



>ref|XP_007205404.1| hypothetical protein PRUPE_ppa007561mg [Prunus persica]
 gb|EMJ06603.1| hypothetical protein PRUPE_ppa007561mg [Prunus persica]
Length=363

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 144/182 (79%), Gaps = 3/182 (2%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R P+H  +HI+AERKRRE LS +F+ALS IVPGL+KMDK SVLGD IK++KQ+QERVK L
Sbjct  179  RTPSHAQEHIMAERKRREKLSERFIALSAIVPGLKKMDKASVLGDAIKHVKQLQERVKVL  238

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK--GNSDEQSLPEIETRLCDNHILLRIY  630
            EE++ KRT+ESVVFVKKSQ+S DD    S GE    +SDE SLPEIE ++ +  +L+RI+
Sbjct  239  EEQTKKRTVESVVFVKKSQLSADDGTS-SCGESFDAHSDEASLPEIEAKVSETDVLIRIH  297

Query  629  CDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRS  450
            C++QKG + KI SEVEKL L+VVNSSV  FG+ ALDITII +ME EF++ +K +A+ LR 
Sbjct  298  CEKQKGFVVKILSEVEKLQLSVVNSSVLPFGNSALDITIIAQMEDEFNMSVKDLARNLRG  357

Query  449  AI  444
            A+
Sbjct  358  AL  359



>ref|XP_009378561.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
 ref|XP_009378562.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
Length=341

 Score =   196 bits (497),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 136/335 (41%), Positives = 197/335 (59%), Gaps = 43/335 (13%)
 Frame = -2

Query  1319  SQACFSGMGTDDLSFLDQFQILQSIEQ----EFAGVLGEDVLCssspeegspPTTCHLGE  1152
             S+   S +G +D  F++Q+Q + S+++      A V GE++  S      +  T      
Sbjct  5     SRGGSSELGMEDPFFINQWQYMNSLDELGMLPLAAVFGENLQHSQFHPIFNLKTPIDNAH  64

Query  1151  D--DRPLKQLKI---------HHHPNIDDVNLPELRQELLTSN---------------AI  1050
                DRP KQLK          H   N   V+LP      + S+               A+
Sbjct  65    TAIDRPTKQLKTDGWTSGKTDHLVSNPQVVSLPPNIFSFVNSHHANQMPVLKPKEEAAAV  124

Query  1049  AEQETE--PADT----TTIKPKKSGRRGRPPTHRY----DHILAERKRRELLSRQFLALS  900
               + T   P+D      + + +     G   T R     DHI+AERKRRE LS++F+ALS
Sbjct  125   CSKSTNTLPSDILLSQGSFENRNYSSNGISTTTRLSQTQDHIIAERKRREKLSQRFIALS  184

Query  899   TIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEM  720
              IVPGL+KMDK SVLGD+IKY+KQ+Q++VKTLEE++  ++MESVVFVKK+Q+  + ++  
Sbjct  185   AIVPGLKKMDKASVLGDSIKYIKQLQDKVKTLEEQTRNKSMESVVFVKKTQLFANGNNP-  243

Query  719   SSGEKGNSD--EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVA  546
             SS E G++   + +LPEIE R CDN++L+RI+C+++KGI+ K  +EVEKL L  +NSSV 
Sbjct  244   SSDENGSTGPFDTTLPEIEARFCDNNVLIRIHCEKRKGIVEKTIAEVEKLQLKFINSSVM  303

Query  545   RFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
              FGS ALD+TII +ME EF L +K + K LR+A +
Sbjct  304   TFGSCALDVTIIAQMEAEFSLSVKDLVKNLRAAFE  338



>ref|XP_007047665.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOX91822.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=362

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 145/191 (76%), Gaps = 7/191 (4%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    R P+H  DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+
Sbjct  171   KRTYSMTRSPSHAQDHIMAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYVKQL  230

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS----LPEIETRLC  657
             QER+K LEE++ KRT+ESVVFVKKSQ+S   DDE SS E+ NSD QS    LPEIE R+ 
Sbjct  231   QERLKVLEEQTKKRTVESVVFVKKSQLSA--DDETSSCEE-NSDSQSSDAALPEIEARVS  287

Query  656   DNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPM  477
             DN +L+RI+C++QKG + KI SE+E L+L VVNSSV  FG+  LDITII + + EF + +
Sbjct  288   DNDVLIRIHCEKQKGFVVKILSEIENLHLTVVNSSVLPFGNSTLDITIIAQKDAEFSMTV  347

Query  476   KHIAKILRSAI  444
             K + K LR A 
Sbjct  348   KDLVKDLRVAF  358



>ref|XP_008236876.1| PREDICTED: transcription factor bHLH18-like [Prunus mume]
Length=366

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 146/183 (80%), Gaps = 5/183 (3%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R P+H  +HI+AERKRRE LS +F+ALS IVPGL+KMDK SVLGD IK++KQ+Q+RVK L
Sbjct  182  RTPSHAQEHIMAERKRREKLSERFIALSAIVPGLKKMDKASVLGDAIKHVKQLQDRVKVL  241

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK---GNSDEQSLPEIETRLCDNHILLRI  633
            EE++ KRT+ESVVFVKKSQ+S DD    SS ++   G+SDE SLPEIE ++ +  +L+RI
Sbjct  242  EEQTKKRTVESVVFVKKSQLSADDG--TSSCDESFDGHSDEASLPEIEAKVSETDVLIRI  299

Query  632  YCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
            +C++QKG + KI SEVEKL L+VVNSS+  FG+ ALDITII +ME +F++ +K +A+ LR
Sbjct  300  HCEKQKGFVVKILSEVEKLQLSVVNSSILPFGNSALDITIIAQMEDQFNMSVKDLARNLR  359

Query  452  SAI  444
             A+
Sbjct  360  VAL  362



>ref|XP_006422677.1| hypothetical protein CICLE_v10028925mg [Citrus clementina]
 gb|ESR35917.1| hypothetical protein CICLE_v10028925mg [Citrus clementina]
Length=303

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 185/310 (60%), Gaps = 38/310 (12%)
 Frame = -2

Query  1289  DDLSFLDQFQILQSIEQ----EFAGVLGEDVLCssspeegspPTTCHLGEDDRPLKQLKI  1122
             +DLSF++Q+ ++ SI++      A   GE++  S +    +  T       DRP KQLK 
Sbjct  2     EDLSFMNQWHMMNSIDEFNLLPLAAAFGENLQQSYTHPSFNNNTGI-----DRPQKQLKT  56

Query  1121  H--------HHPN-IDDVNLPEL-----RQEL---LTSNAIAEQETEPADTTTI-KPKKS  996
                       +PN +  +N+ ++     +QE      S+ +  Q +   +   + K  + 
Sbjct  57    STWNSSETGFNPNNVSSINMNQMGILKPKQETGAGYPSDILPSQVSFGNNQNYVFKASQG  116

Query  995   GRRGRPP-----THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
              +R  P      ++  DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKYLK
Sbjct  117   AKRISPGAGNRLSNTQDHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYLK  176

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDN  651
             Q+QE+VK LEE+++K+T+E    V  ++    D+ E  +G    +  ++LPEIE R CD 
Sbjct  177   QLQEKVKILEEQANKKTIE--SVVFVNKTQLSDEGESPNG----AFNEALPEIEARFCDK  230

Query  650   HILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKH  471
              +L+R++C+++KG+  KI +E+EKL L V+NSSV  FGS  LD+TII +M+ EF++ +  
Sbjct  231   SVLIRVHCEKRKGVFEKIVAEIEKLYLTVINSSVMTFGSSVLDVTIIAQMDVEFNMTVMD  290

Query  470   IAKILRSAIQ  441
             + K L SA Q
Sbjct  291   LVKNLHSAFQ  300



>emb|CDP17174.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 131/180 (73%), Gaps = 20/180 (11%)
 Frame = -2

Query  965  YDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSK  786
            YDHI+AERKRRE +S++F+ALS +VPGL+KMDK SVLGD I YLK +QERV+TLEE+++ 
Sbjct  43   YDHIVAERKRREQISQRFVALSALVPGLKKMDKNSVLGDAINYLKHLQERVQTLEEQAAN  102

Query  785  RTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            +  ES +                    G +DEQ LPEIE ++C+ +ILLRI+C   +G++
Sbjct  103  QRRESSM--------------------GCTDEQILPEIEAKVCNKNILLRIHCKNHRGLL  142

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQHAAQT  426
             KI SE+EK NL+VVN++VA FGSLALDI+II EM+KEF+L M+ + + LRSA++   Q+
Sbjct  143  VKILSEIEKRNLSVVNTNVAPFGSLALDISIIAEMDKEFNLTMQELVRRLRSALRQVQQS  202



>ref|XP_011002814.1| PREDICTED: transcription factor bHLH18-like isoform X2 [Populus 
euphratica]
Length=324

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+QE+VKTLEE++ ++
Sbjct  147  DHIIAERKRREKLSQRFIALSAVVPGLKKMDKASVLGDAIKYLKQLQEKVKTLEEQTKRK  206

Query  782  TMEsvvfvkksqvsFDDDD-EMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            TMESVV VKKS +  D+ D   SS E      ++LPEIE R CD H+L+RI+C+++KG++
Sbjct  207  TMESVVIVKKSHIYVDEGDVNSSSDESKGPIHETLPEIEARFCDKHVLIRIHCEKRKGVL  266

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             K  +E+EKL+L+V+NSSV  FG+ AL +T I +M+ +F+L +K + K LRSA +
Sbjct  267  EKTVAEIEKLHLSVINSSVLAFGTSALHVTFIAQMDIDFNLSLKDLVKTLRSAFE  321



>ref|XP_011002806.1| PREDICTED: transcription factor bHLH18-like isoform X1 [Populus 
euphratica]
Length=337

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+QE+VKTLEE++ ++
Sbjct  160  DHIIAERKRREKLSQRFIALSAVVPGLKKMDKASVLGDAIKYLKQLQEKVKTLEEQTKRK  219

Query  782  TMEsvvfvkksqvsFDDDD-EMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            TMESVV VKKS +  D+ D   SS E      ++LPEIE R CD H+L+RI+C+++KG++
Sbjct  220  TMESVVIVKKSHIYVDEGDVNSSSDESKGPIHETLPEIEARFCDKHVLIRIHCEKRKGVL  279

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             K  +E+EKL+L+V+NSSV  FG+ AL +T I +M+ +F+L +K + K LRSA +
Sbjct  280  EKTVAEIEKLHLSVINSSVLAFGTSALHVTFIAQMDIDFNLSLKDLVKTLRSAFE  334



>ref|XP_002313947.2| hypothetical protein POPTR_0009s08500g [Populus trichocarpa]
 gb|EEE87902.2| hypothetical protein POPTR_0009s08500g [Populus trichocarpa]
Length=337

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+QE+VKTLEE++ ++
Sbjct  160  DHIIAERKRREKLSQRFIALSAVVPGLKKMDKASVLGDAIKYLKQLQEKVKTLEEQTKRK  219

Query  782  TMEsvvfvkksqvsFDDDD-EMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            TMESVV VKKS +  D+ D   SS E      ++LPEIE R CD H+L+RI+C+++KG++
Sbjct  220  TMESVVIVKKSHIYVDEGDVNASSDESKGPIHETLPEIEARFCDKHVLIRIHCEKRKGVL  279

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             K  +E+EKL+L+V+NSSV  FG+ AL +T I +M+ +F++ +K + K LRSA +
Sbjct  280  EKTVAEIEKLHLSVINSSVLAFGTSALHVTFIAQMDIDFNMSLKDLVKTLRSAFE  334



>gb|KHG02490.1| Transcription factor bHLH25 -like protein [Gossypium arboreum]
Length=346

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 143/193 (74%), Gaps = 2/193 (1%)
 Frame = -2

Query  1016  TIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKY  837
             T K  +S    R P+H  DHI+AERKRRE L+++F+ALS IVPGL+KMDK SVLGD IKY
Sbjct  150   TAKNSRSYSMTRSPSHAQDHIMAERKRREKLNQRFIALSAIVPGLKKMDKASVLGDAIKY  209

Query  836   LKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK--GNSDEQSLPEIETR  663
             +KQ+QER+K LEE++ KRT+ESVVFVKKSQ+   DD+  S  E   G S + +LPEIE +
Sbjct  210   VKQLQERLKVLEEQTKKRTVESVVFVKKSQLLSADDESSSCEENSDGQSSDAALPEIEAK  269

Query  662   LCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDL  483
             + DN +L+RI+C++ KG I KI SE+E L+L++VN++   FG+  LDITII + + EF++
Sbjct  270   VSDNDVLIRIHCEKHKGFIAKILSEIENLHLSIVNTNALPFGNSTLDITIIAQKDAEFNM  329

Query  482   PMKHIAKILRSAI  444
              +K + K LR A+
Sbjct  330   TVKDLVKDLRMAL  342



>ref|XP_009346450.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
 ref|XP_009346451.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
 ref|XP_009346452.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
 ref|XP_009346453.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
 ref|XP_009346456.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
 ref|XP_009346457.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
 ref|XP_009346459.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
 ref|XP_009346460.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
Length=346

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 195/341 (57%), Gaps = 52/341 (15%)
 Frame = -2

Query  1319  SQACFSGMGTDDLSFLDQFQILQSIEQ----EFAGVLGEDVLCssspeegspPT---TCH  1161
             S+   S +G +D  F++Q+Q + S+++      A  +G+++  S      +  T     H
Sbjct  5     SRGGLSELGMEDPFFINQWQYMNSLDELGMLPLAAEIGDNLQHSHFHPTFNFKTPIDNSH  64

Query  1160  LGEDDRPLKQLKIHHHPNIDDVNLPELRQELLTSNAIAEQETEPADTTTI-KPKK-----  999
              G  DRP KQLK    P+    +L    Q   + N ++   +  A+   + KPK+     
Sbjct  65    TG-IDRPAKQLKTDGWPSCKTDHLVSNPQVASSPNILSFVNSNHANQMAVLKPKEEAAAV  123

Query  998   -------------------------------SGRRGRPP--THRYDHILAERKRRELLSR  918
                                            + R    P  +   DHI+AERKRRE LS+
Sbjct  124   CSKSTNSLPSDLLLSQGSFGNQNCLFKASQGTNRNSTNPRLSATQDHIIAERKRREKLSQ  183

Query  917   QFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsF  738
             +F+ALS I+PGL+KMDK SVLGD+IKY+KQ+Q++VKTLEE++  + MESVVFVKK+Q+  
Sbjct  184   RFIALSAIIPGLKKMDKASVLGDSIKYIKQLQDKVKTLEEQTRNKNMESVVFVKKTQLFA  243

Query  737   DDDDEMSSGEKGNSD---EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLA  567
             + D   +S ++ NS    + +LPEIE R CDN++L+RI+C+++KG++ K  SEVEKL L 
Sbjct  244   NGDK--TSSDENNSTGPFDATLPEIEARFCDNNVLIRIHCEKRKGVVEKTISEVEKLQLK  301

Query  566   VVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
              +NSSV  FGS ALD+TII +ME EF L ++ + K LR+A 
Sbjct  302   FINSSVMTFGSCALDVTIIAQMEAEFSLSVQDLVKNLRTAF  342



>ref|XP_008790398.1| PREDICTED: transcription factor bHLH18-like [Phoenix dactylifera]
 ref|XP_008790399.1| PREDICTED: transcription factor bHLH18-like [Phoenix dactylifera]
 ref|XP_008790400.1| PREDICTED: transcription factor bHLH18-like [Phoenix dactylifera]
 ref|XP_008790401.1| PREDICTED: transcription factor bHLH18-like [Phoenix dactylifera]
 ref|XP_008790402.1| PREDICTED: transcription factor bHLH18-like [Phoenix dactylifera]
Length=353

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 141/190 (74%), Gaps = 0/190 (0%)
 Frame = -2

Query  1007  PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQ  828
             PK+     RP +H  DHI+AERKRRE LS++F+ALS I+PGL+KMDK SVLGD IKYLKQ
Sbjct  162   PKRMNMGARPSSHNQDHIIAERKRREKLSQRFIALSAIIPGLKKMDKASVLGDAIKYLKQ  221

Query  827   IQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNH  648
             +QE+VK+LEE+++KRT+ES V VKKSQ+S DD         G+   +SLPEIE ++ +  
Sbjct  222   LQEKVKSLEEQNTKRTVESAVLVKKSQLSSDDVGSCDENFDGHPSGESLPEIEAKMSEKS  281

Query  647   ILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHI  468
             +L++I+C++ KGI+ +  SE+EKL+L V+N+SV  F S +LDIT++ ++E+EF + +K +
Sbjct  282   VLIKIHCEKSKGILVEALSEIEKLHLTVINASVIPFASSSLDITVVAQVEEEFSMTLKDL  341

Query  467   AKILRSAIQH  438
              K L SA + 
Sbjct  342   VKKLNSAFRQ  351



>ref|XP_010936245.1| PREDICTED: transcription factor bHLH18-like isoform X2 [Elaeis 
guineensis]
Length=342

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 139/192 (72%), Gaps = 0/192 (0%)
 Frame = -2

Query  1007  PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQ  828
             PK+     RP +H  DHI+AERKRRE LS++F+ALS I+PGL+KMDK SVLGD IKYLKQ
Sbjct  151   PKRMNMGARPSSHNQDHIIAERKRREKLSQRFIALSAIIPGLKKMDKASVLGDAIKYLKQ  210

Query  827   IQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNH  648
             +QE+VK+LEE+++KRT+ES V VKKSQ+S DDD        G    +SLPEI  ++ +  
Sbjct  211   LQEKVKSLEEQNAKRTVESAVLVKKSQLSSDDDGSYDENFGGQPSGESLPEIGAKMSEKS  270

Query  647   ILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHI  468
             +L++I+C++ KGI+ K   E+EKL+L V+N+SV  F S  LDIT++ ++++EF + +K +
Sbjct  271   VLIKIHCEKSKGILVKALCEIEKLHLTVINTSVIPFASSLLDITVVAQVDEEFSMTVKEL  330

Query  467   AKILRSAIQHAA  432
              K L SA +  A
Sbjct  331   VKKLNSAFKQFA  342



>ref|XP_010936243.1| PREDICTED: transcription factor bHLH18-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010936244.1| PREDICTED: transcription factor bHLH18-like isoform X1 [Elaeis 
guineensis]
Length=352

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 139/192 (72%), Gaps = 0/192 (0%)
 Frame = -2

Query  1007  PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQ  828
             PK+     RP +H  DHI+AERKRRE LS++F+ALS I+PGL+KMDK SVLGD IKYLKQ
Sbjct  161   PKRMNMGARPSSHNQDHIIAERKRREKLSQRFIALSAIIPGLKKMDKASVLGDAIKYLKQ  220

Query  827   IQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNH  648
             +QE+VK+LEE+++KRT+ES V VKKSQ+S DDD        G    +SLPEI  ++ +  
Sbjct  221   LQEKVKSLEEQNAKRTVESAVLVKKSQLSSDDDGSYDENFGGQPSGESLPEIGAKMSEKS  280

Query  647   ILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHI  468
             +L++I+C++ KGI+ K   E+EKL+L V+N+SV  F S  LDIT++ ++++EF + +K +
Sbjct  281   VLIKIHCEKSKGILVKALCEIEKLHLTVINTSVIPFASSLLDITVVAQVDEEFSMTVKEL  340

Query  467   AKILRSAIQHAA  432
              K L SA +  A
Sbjct  341   VKKLNSAFKQFA  352



>ref|XP_009347092.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
Length=365

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 139/184 (76%), Gaps = 6/184 (3%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R P+H  DHI+AERKRRE LS+QF+ALS IVPGL+KMDK SVLGD IK+ KQ+QERVK L
Sbjct  180  RTPSHAQDHIMAERKRREKLSQQFIALSAIVPGLKKMDKASVLGDAIKHAKQLQERVKVL  239

Query  803  EEESSKRTMEsvvfvkksqvsFDDD----DEMSSGEKGNSDEQSLPEIETRLCDNHILLR  636
            EE S KRT+ESVVFVKKSQ+S DDD    DE   G     DE +LPEIE R+ +  +L+R
Sbjct  240  EERSKKRTVESVVFVKKSQLSADDDTSSCDENFDG--CGPDESALPEIEARVSEKDVLIR  297

Query  635  IYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKIL  456
            I+C++QKG + KI SE+EKL L+VVNSS+  FG+  LDITI  +M+  F++ +K +A+ L
Sbjct  298  IHCEKQKGDVVKILSEIEKLQLSVVNSSIFPFGASTLDITITSQMDDGFNMTVKDLARKL  357

Query  455  RSAI  444
            R A+
Sbjct  358  RVAL  361



>ref|XP_008372895.1| PREDICTED: transcription factor bHLH18-like [Malus domestica]
Length=341

 Score =   188 bits (477),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 133/335 (40%), Positives = 188/335 (56%), Gaps = 43/335 (13%)
 Frame = -2

Query  1319  SQACFSGMGTDDLSFLDQFQILQSIEQ----EFAGVLGEDVLCssspeegspPTTCHLGE  1152
             S+   S +G +D  F++Q+Q + S+++      A   GE++  S      +  T      
Sbjct  5     SRGGLSELGMEDPFFINQWQYMNSLDELGMLPLAAAFGENLQHSQFHPIFNLKTPIDNSH  64

Query  1151  D--DRPLKQLKI---------HHHPNIDDVNLPELRQELLTSN---------------AI  1050
                DRP KQLK          H   N    +LP      + S+               A+
Sbjct  65    TAIDRPTKQLKTDGWTSCKTDHLVSNPQVASLPPNILSFVNSHHANQMPVLKPKGEGAAV  124

Query  1049  AEQETE--PADT----TTIKPKKSGRRGRPPTHRY----DHILAERKRRELLSRQFLALS  900
               + T   P+D      +   +     G   T R     DHI+AERKRRE LS++F+ALS
Sbjct  125   CSKSTNTLPSDILLSQGSFGNRNYSSNGISTTTRLSQTQDHIIAERKRREKLSQRFIALS  184

Query  899   TIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEM  720
              IVPGL+KMDK SVLGD+IKY+KQ+Q++VKTLEE++  + MESVVFVKK+Q+  + D   
Sbjct  185   AIVPGLKKMDKASVLGDSIKYIKQLQDKVKTLEEQTRNKNMESVVFVKKTQLFANSDSSC  244

Query  719   S--SGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVA  546
             S  +   G  D  +LPEIE R CDN++L+RI+C+++KGI+ K  +EVEKL L  +NSSV 
Sbjct  245   SDENSSTGPFD-TTLPEIEARFCDNNVLIRIHCEKRKGIVEKTIAEVEKLQLKFINSSVM  303

Query  545   RFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
              FGS ALD+TII +ME EF L +K + K LR+  +
Sbjct  304   TFGSCALDVTIIAQMEAEFSLSVKDLVKNLRAXFE  338



>ref|XP_010107640.1| hypothetical protein L484_001114 [Morus notabilis]
 gb|EXC54482.1| hypothetical protein L484_001114 [Morus notabilis]
Length=335

 Score =   187 bits (475),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 149/226 (66%), Gaps = 12/226 (5%)
 Frame = -2

Query  1109  NIDDVNLPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPT---HRYDHILAERK  939
             NI+ V +P        S+ +  Q   P     +K  +  +R    T      DHILAERK
Sbjct  113   NINTVTVP--------SDVLVSQGCFPNQNYVLKANQGAKRISTSTKLSQAKDHILAERK  164

Query  938   RRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfv  759
             RRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ++E+VKTLEE+  K+ MESVVFV
Sbjct  165   RREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYMKQLEEKVKTLEEQMRKKNMESVVFV  224

Query  758   kksqvsFDDDDEMS-SGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVE  582
             KKS++   +D+  S     G S  + LPEIE R+CD ++L+RI+C+++KGI+ K  +EVE
Sbjct  225   KKSRIFAVEDNSSSDENVSGGSFSKPLPEIEARVCDKNVLIRIHCEKRKGILEKTIAEVE  284

Query  581   KLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
             K +L V+N+S   FGS +LD+TII +M  EF L +K + K LR A 
Sbjct  285   KFHLTVINTSCMTFGSFSLDVTIIAQMNVEFSLTVKDLVKNLRLAF  330



>ref|XP_008383369.1| PREDICTED: transcription factor bHLH18-like [Malus domestica]
Length=366

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 141/183 (77%), Gaps = 6/183 (3%)
 Frame = -2

Query  980  PPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLE  801
            P +H  DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IK++K++QERVK LE
Sbjct  182  PXSHAQDHIMAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKHVKELQERVKVLE  241

Query  800  EESSKRTMEsvvfvkksqvsFDDD----DEMSSGEKGNSDEQSLPEIETRLCDNHILLRI  633
            E S KRT+ESVVFVKKSQ+S DDD    DE   G     DE +LPEIE R+ +  +L+RI
Sbjct  242  ERSKKRTVESVVFVKKSQLSADDDTSSCDENFDG--CGPDEAALPEIEARVSEKDVLIRI  299

Query  632  YCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
            +C++QKG++ KI SE+EKL L+VVNSSV  FG+  LDITI+ +M+  F++ +K +A+ LR
Sbjct  300  HCEKQKGVVVKILSEIEKLQLSVVNSSVLPFGASTLDITIMSQMDDGFNMTVKDLARKLR  359

Query  452  SAI  444
             A+
Sbjct  360  GAL  362



>gb|KCW56854.1| hypothetical protein EUGRSUZ_I02518 [Eucalyptus grandis]
Length=342

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 138/179 (77%), Gaps = 9/179 (5%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+QER+K LEE++ KR
Sbjct  165  DHIIAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYLKQLQERIKILEEQTRKR  224

Query  782  TMEsvvfvkksqvsFDD-----DDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQ  618
            +MESVVFVKKSQV  D      D+  SSG     DE  LPE+E R+CDN +LL+++C++ 
Sbjct  225  SMESVVFVKKSQVFEDGMNSSTDENFSSGP---CDEL-LPEVEARICDNDVLLKVHCEKS  280

Query  617  KGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            KG++ KI  EVEKL+L ++NSS+  FG+ A+DITI+ +M  EF +P+K + K LR+A +
Sbjct  281  KGVLEKIIGEVEKLHLTIINSSLMTFGTSAVDITILAQMNPEFCMPVKDLVKNLRTAFK  339



>emb|CAN75020.1| hypothetical protein VITISV_039940 [Vitis vinifera]
Length=331

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 136/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKYLKQ+QERVKTLEE++ K+
Sbjct  157  DHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYLKQLQERVKTLEEQTRKK  216

Query  782  TMEsvvfvkksqvsFDDDDEMSSGE-KGNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            T ESVVFVKKSQV  D D+  S  +  G+  ++ LPEIE R  D  +L+RI+C+++KG++
Sbjct  217  TTESVVFVKKSQVFLDGDNSSSDEDFSGSPLDEPLPEIEARFSDKSVLIRIHCEKRKGVV  276

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             K+ +EVE L+L V+NSSV  FG+ ALD+TII EME EF + +K + K L + ++
Sbjct  277  EKLVAEVEGLHLTVINSSVMTFGNSALDVTIIAEMEVEFSMTVKDLVKKLHAGLK  331



>gb|KDP32145.1| hypothetical protein JCGZ_12606 [Jatropha curcas]
Length=357

 Score =   186 bits (471),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 133/180 (74%), Gaps = 0/180 (0%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R P+H  DHILAERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+QERVK L
Sbjct  174  RSPSHAQDHILAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYVKQLQERVKVL  233

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            EE++ KRT+ESVV VKKSQVS DDD            + +LPEIE R  D  +L+RI+CD
Sbjct  234  EEQTKKRTVESVVLVKKSQVSTDDDSSSCDENSDGGSDSALPEIEARASDKDVLIRIHCD  293

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            +Q+GI+ +I +EVE L L++ NS+V  FG+  LD+TII +M+ EF + MK + K LR A 
Sbjct  294  KQQGILPRILNEVENLRLSITNSTVLPFGNSTLDVTIIAQMDTEFSMAMKDLVKNLRLAF  353



>ref|XP_007041458.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOX97289.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=412

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS+ F+ALS IVPGL+KMDK SVL D IKYLKQ+QE+VKTLEE++ K+
Sbjct  236  DHIMAERKRREKLSQSFIALSAIVPGLKKMDKASVLADAIKYLKQLQEKVKTLEEQTRKK  295

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIG  603
            T+ESVVFVKKSQ+  D DD  S        ++ LPEIE R CD  +L+RI+C+++KG+  
Sbjct  296  TIESVVFVKKSQLFADSDDFSSDQNFSGPFDEPLPEIEARFCDKSVLIRIHCEKRKGLPE  355

Query  602  KIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            KI S++EK +L V+NS+V  FGS ALDITI+ +M+ EF + +K + K LRSA +
Sbjct  356  KIMSQIEKCHLTVINSNVMTFGSSALDITIVAQMDMEFCMAVKDLVKKLRSAFK  409



>ref|XP_002268443.3| PREDICTED: transcription factor bHLH18 [Vitis vinifera]
 ref|XP_010647980.1| PREDICTED: transcription factor bHLH18 [Vitis vinifera]
 emb|CBI25069.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 136/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKYLKQ+QERVKTLEE++ K+
Sbjct  170  DHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYLKQLQERVKTLEEQTRKK  229

Query  782  TMEsvvfvkksqvsFDDDDEMSSGE-KGNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            T ESVVFVKKSQV  D D+  S  +  G+  ++ LPEIE R  D  +L+RI+C+++KG++
Sbjct  230  TTESVVFVKKSQVFLDGDNSSSDEDFSGSPLDEPLPEIEARFSDKSVLIRIHCEKRKGVV  289

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             K+ +EVE L+L V+NSSV  FG+ ALD+TII EME EF + +K + K L + ++
Sbjct  290  EKLVAEVEGLHLTVINSSVMTFGNSALDVTIIAEMEVEFSMTVKDLVKKLHAGLK  344



>gb|KDP35918.1| hypothetical protein JCGZ_09890 [Jatropha curcas]
Length=342

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 137/177 (77%), Gaps = 4/177 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKYLKQ+QERVKTLEE++ ++
Sbjct  164  DHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYLKQLQERVKTLEEQTKRK  223

Query  782  TMEsvvfvkksqv---sFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKG  612
            TMESVV VKKSQ+     D      S  KG  DE +LPEIE R+CD H+L+RI+C+ +KG
Sbjct  224  TMESVVIVKKSQLLFCEDDSSSSDESFSKGPFDE-TLPEIEARICDKHVLIRIHCEIRKG  282

Query  611  IIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            ++ K  +EVEKL+L ++NSSV  FGS ALD+TII +M+ E+++ +K + K L SA +
Sbjct  283  VLEKTIAEVEKLHLNIINSSVLTFGSSALDVTIIAQMDSEYEMSVKDLVKNLHSAFK  339



>ref|XP_010030892.1| PREDICTED: transcription factor bHLH18-like [Eucalyptus grandis]
Length=397

 Score =   185 bits (470),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 138/179 (77%), Gaps = 9/179 (5%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+QER+K LEE++ KR
Sbjct  220  DHIIAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYLKQLQERIKILEEQTRKR  279

Query  782  TMEsvvfvkksqvsFDD-----DDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQ  618
            +MESVVFVKKSQV  D      D+  SSG     DE  LPE+E R+CDN +LL+++C++ 
Sbjct  280  SMESVVFVKKSQVFEDGMNSSTDENFSSGP---CDEL-LPEVEARICDNDVLLKVHCEKS  335

Query  617  KGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            KG++ KI  EVEKL+L ++NSS+  FG+ A+DITI+ +M  EF +P+K + K LR+A +
Sbjct  336  KGVLEKIIGEVEKLHLTIINSSLMTFGTSAVDITILAQMNPEFCMPVKDLVKNLRTAFK  394



>ref|XP_004504883.1| PREDICTED: transcription factor bHLH25-like [Cicer arietinum]
Length=303

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 152/222 (68%), Gaps = 4/222 (2%)
 Frame = -2

Query  1106  IDDVNLPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRREL  927
             I+   L + + E++    I++  ++     T++ KK   R +    +Y HI+AERKRRE 
Sbjct  81    INQFGLVKPKDEMVCPKNISKNSSDMISKGTLEAKKIATRPKLSQPQY-HIIAERKRREK  139

Query  926   LSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-KRTMEsvvfvkks  750
             LS +F+ALS +VPGL+KMDK +VLGD IKYL+Q+QE+V+ LEEE + K+ MESVV VKKS
Sbjct  140   LSERFIALSALVPGLQKMDKATVLGDAIKYLRQLQEKVRALEEEQNMKKNMESVVVVKKS  199

Query  749   qvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNL  570
             Q+   DD E SS E   S ++ LPEIE R CD ++L+R++C++  G++ KI  E+E+L+L
Sbjct  200   QLR--DDVENSSSESDGSFDEELPEIEARFCDRNVLIRVHCEKSNGVLEKIIHEIERLHL  257

Query  569   AVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
              V NSSV  FGS ALDITII +M+ EF + +K   + LRSA 
Sbjct  258   KVTNSSVMTFGSCALDITIIAQMDMEFCMTVKDFVRNLRSAF  299



>ref|XP_004136916.1| PREDICTED: transcription factor bHLH25-like [Cucumis sativus]
 ref|XP_004163905.1| PREDICTED: transcription factor bHLH25-like [Cucumis sativus]
 gb|KGN43816.1| hypothetical protein Csa_7G069180 [Cucumis sativus]
Length=340

 Score =   183 bits (464),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 157/219 (72%), Gaps = 13/219 (6%)
 Frame = -2

Query  1094  NLPELRQELLTSNAIAEQ-ETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSR  918
             NLP     L++ +++A Q  T  ++  T  P    R  R P  + DHILAER+RRE LS+
Sbjct  132   NLPS--DMLISQDSLAHQSHTTKSNRGTRSP---SRNSRIPQAQ-DHILAERRRREKLSQ  185

Query  917   QFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsF  738
             +F+ALS IVPGL+KMDK SVLGD IKYLKQ+QE+VK LEE++ ++ +ESVVFVKKS V  
Sbjct  186   RFIALSAIVPGLKKMDKASVLGDAIKYLKQLQEKVKILEEQTRRKDIESVVFVKKSHVFP  245

Query  737   DDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVN  558
             D +D  +S E    +++ LPEIE R+CD ++L+RI+C+++K II K  +E+E L+L +VN
Sbjct  246   DGND--TSKE----EDEPLPEIEARICDKNVLIRIHCEKKKDIIEKTIAEIENLHLTIVN  299

Query  557   SSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             SSV  FGSLALDITII +M+ EF L +K + K L+S ++
Sbjct  300   SSVMSFGSLALDITIIAQMDNEFCLTLKDLVKNLQSTLR  338



>ref|XP_007047664.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOX91821.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=329

 Score =   182 bits (461),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 156/249 (63%), Gaps = 16/249 (6%)
 Frame = -2

Query  1145  RPLKQLKIHHHPN---IDDVNLPELRQELLTSNAIAEQETEPADT-------TTIKPK--  1002
             RP+KQLK +  PN    +++             +     + PA +         +KPK  
Sbjct  78    RPMKQLKTNS-PNSCITENIPPKASSSPSSHIISFDNWNSSPAISQQYYGLDCAVKPKNE  136

Query  1001  ---KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
                + G   R P H  DH++AERKRRE LS++F++LS ++PGL+K DK SVLGD IKYLK
Sbjct  137   VSKRVGSLTRTPLHAQDHVIAERKRREKLSQRFISLSALIPGLKKTDKASVLGDAIKYLK  196

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDN  651
             Q+QERV TLEE+ +K+TMESV+FV+K+Q+  DD+   S     +   + LPEIE R+ D 
Sbjct  197   QLQERVTTLEEQVAKKTMESVIFVRKTQIFADDETSSSDENFDSHSNKPLPEIEARVADK  256

Query  650   HILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKH  471
              +L+RI+C++ KG I  I +EVEKL+L+V+N++V  FG    DITI+ +ME EF + +K 
Sbjct  257   DVLIRIHCEKNKGCIPNIINEVEKLHLSVLNTNVLPFGQATQDITIVAKMEAEFSMTVKD  316

Query  470   IAKILRSAI  444
             + K LR A+
Sbjct  317   LVKSLRMAL  325



>ref|XP_007200351.1| hypothetical protein PRUPE_ppa008130mg [Prunus persica]
 gb|EMJ01550.1| hypothetical protein PRUPE_ppa008130mg [Prunus persica]
Length=344

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 131/333 (39%), Positives = 193/333 (58%), Gaps = 48/333 (14%)
 Frame = -2

Query  1304  SGMGTDDLSFLDQFQILQSIEQ----EFAGVLGEDVLCssspeegspPTT---CHLGEDD  1146
             S +G +D  F++Q+  + S+++      A   GE+   S      +  T+   CH G  D
Sbjct  10    SELGMEDPYFINQWH-MNSLDEVSMLPLAAPFGENFNQSHFHPNFNLKTSMDSCHSG-ID  67

Query  1145  RPLKQLK-----------------IHHHPNI---------DDVNLPELRQEL--------  1068
             RP+KQLK                 +   PNI         + + + + ++E         
Sbjct  68    RPMKQLKTDGWSSCKTDQHGSNPQVASSPNILSFVNSNSTNQMGVLKPKEEAAVCSKSNN  127

Query  1067  -LTSNAIAEQETEPADTTTIKPKKSGRRGRPPTH---RYDHILAERKRRELLSRQFLALS  900
              L S+ +  Q +    +   K  +  +R    T      DHI+AERKRRE LS++F+ALS
Sbjct  128   SLPSDILLSQSSFGNQSYLFKASQGTKRVNTNTRLSTTQDHIIAERKRREKLSQRFIALS  187

Query  899   TIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEM  720
              +VPGL+KMDK SVLGD IKY+KQ+Q++VKTLEE++ K+ MESVVFVKK+Q+  +DD+  
Sbjct  188   AMVPGLKKMDKASVLGDAIKYIKQLQDKVKTLEEQTRKKNMESVVFVKKTQLFANDDNSS  247

Query  719   SSGEKGNSD-EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVAR  543
             S     +   E++LPEIE R CDN++++RI+C+++KG++ K  +EVEKL L  +NSSV  
Sbjct  248   SEENNSSGPFEETLPEIEARFCDNNVMIRIHCEKRKGVVEKTIAEVEKLQLKFINSSVLT  307

Query  542   FGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
             FG  ALD+TII +ME EF L +K + K LRSA 
Sbjct  308   FGGCALDVTIIAQMEVEFSLSVKELVKNLRSAF  340



>emb|CDO97338.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = -2

Query  974  THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEE  795
            T   DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+QE+VKTLEEE
Sbjct  155  TQAQDHIMAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYLKQLQEKVKTLEEE  214

Query  794  SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQK  615
            + + +ME VV+V K  +  D  ++ SS E  N  ++ LPE+E + C+  +L+R++C+++K
Sbjct  215  ARENSMERVVYVSKYTLCDDGHEDSSSDE--NFCDEPLPEVEAKFCNKEVLIRVHCEKRK  272

Query  614  GIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            GI  K  +E+EKL L+V+N+S   FG   LDIT+  +ME+EF +P+K + K LRSA++
Sbjct  273  GIQEKTIAEIEKLPLSVINNSAMTFGGSTLDITVTAKMEEEFAMPIKDLVKHLRSALK  330



>ref|XP_008236173.1| PREDICTED: transcription factor bHLH25-like [Prunus mume]
Length=344

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKY+KQ+Q++VKTLEE++ K+
Sbjct  167  DHIIAERKRREKLSQRFIALSAMVPGLKKMDKASVLGDAIKYIKQLQDKVKTLEEQTRKK  226

Query  782  TMEsvvfvkksq--vsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGI  609
             MESVVFVKK+Q   + D+     +   G  DE +LPEIE R CDN++++RI+C+++KG+
Sbjct  227  NMESVVFVKKTQLFANDDNSSSEENNSSGPFDE-TLPEIEARFCDNNVMIRIHCEKRKGV  285

Query  608  IGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            + K  +EVEKL L  +NSSV  FG  ALD+TII +ME EF L +K + K LRSA 
Sbjct  286  VEKTIAEVEKLQLKFINSSVLTFGGCALDVTIIAQMEVEFSLSVKELVKNLRSAF  340



>ref|XP_008785756.1| PREDICTED: transcription factor bHLH18-like [Phoenix dactylifera]
Length=353

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 140/191 (73%), Gaps = 1/191 (1%)
 Frame = -2

Query  1007  PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQ  828
             PK++    RP +H  DHI+AERKRRE + ++F+ALS ++PGL+KMDK SVLGD I+Y+KQ
Sbjct  161   PKRTNMGARPASHNQDHIIAERKRREKMGQRFIALSALLPGLKKMDKASVLGDAIEYVKQ  220

Query  827   IQERVKTLEEESSKRTMEsvvfvkksqvsFDDD-DEMSSGEKGNSDEQSLPEIETRLCDN  651
             +QE+VKTLEE+++KRT+ES V VKK Q+S +DD        +G    +SLPEIE ++ +N
Sbjct  221   LQEKVKTLEEQNTKRTVESAVLVKKPQLSSEDDGSSWDENCEGLPSGESLPEIEAKMSEN  280

Query  650   HILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKH  471
              +L++IYC+++ G++ K  SE+EKL+L V+N+SV  F S  LDIT++ +++ +F + +K 
Sbjct  281   SVLVKIYCEKRSGVLLKALSEIEKLHLNVINASVIPFASSHLDITVVAQIDADFSMTVKD  340

Query  470   IAKILRSAIQH  438
             + K L SA + 
Sbjct  341   VVKKLNSAFRQ  351



>ref|XP_008455093.1| PREDICTED: transcription factor bHLH18-like isoform X2 [Cucumis 
melo]
Length=334

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 142/193 (74%), Gaps = 12/193 (6%)
 Frame = -2

Query  1001  KSGRRGRPPT------HRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIK  840
             KS R  R P+         DHILAER+RRE LS++F+ALS I+PGL+KMDK SVLGD IK
Sbjct  146   KSNRGTRSPSTNSRIPQAQDHILAERRRREKLSQRFIALSAIIPGLKKMDKASVLGDAIK  205

Query  839   YLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRL  660
             YLKQ+QE+VK LEE++ ++ +ESVVFVKKS V  D +D  +S E    +++ LPEIE R 
Sbjct  206   YLKQLQEKVKILEEQTRRKDIESVVFVKKSHVFADGND--TSKE----EDEPLPEIEARF  259

Query  659   CDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLP  480
             CD ++L+RI+C+++K +I +  +E+EKL+L +VNSSV  FGSLA DITII +M+ EF L 
Sbjct  260   CDKNVLIRIHCEKKKDVIERTVAEIEKLHLIIVNSSVMSFGSLAFDITIIAQMDNEFCLT  319

Query  479   MKHIAKILRSAIQ  441
             +K + K L+S ++
Sbjct  320   LKDLVKNLQSTLR  332



>ref|XP_010271548.1| PREDICTED: transcription factor bHLH18-like [Nelumbo nucifera]
Length=363

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 139/186 (75%), Gaps = 4/186 (2%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            +PP+H  DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKYLKQ+QERVK L
Sbjct  176  KPPSHTQDHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYLKQLQERVKIL  235

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSS----GEKGNSDEQSLPEIETRLCDNHILLR  636
            EE++ K+ +ESVV VK+SQ+S DDD+  S     G   + DE +LPEIE R+ D  +L+R
Sbjct  236  EEQTVKKRVESVVLVKRSQISADDDNSSSDENNLGGGRSDDEAALPEIEARVSDKDVLIR  295

Query  635  IYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKIL  456
            ++ ++QKG++ K  +E+EKL+L VVNSSV  FG  AL+ITI+  ME EF + +K + + L
Sbjct  296  VHSEKQKGVVAKALAEIEKLHLTVVNSSVIPFGKSALNITIVAVMEPEFSMKVKDLVRHL  355

Query  455  RSAIQH  438
             SA + 
Sbjct  356  NSAFRQ  361



>ref|XP_004292144.1| PREDICTED: transcription factor bHLH25-like [Fragaria vesca subsp. 
vesca]
Length=336

 Score =   180 bits (456),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 190/323 (59%), Gaps = 44/323 (14%)
 Frame = -2

Query  1298  MGTDDLSFLDQFQILQSIEQ----EFAGVLGEDVLCssspeegspPTTCHLGED--DRPL  1137
             +G +D  F++Q+  + S+++      A   GE++  S      +P T+ +  ++  DRP+
Sbjct  16    LGMEDSFFINQWH-MNSLDELSMLPLAAAFGENLQHSHCHPILNPKTSTNTSQNSIDRPM  74

Query  1136  KQLKIHHH--PNIDDVNLPELRQELLTSN----AIAEQETE------------PADT---  1020
             KQLK ++   PN     LP L   + + N     +A+ + E            P+D    
Sbjct  75    KQLKPNNWSPPNPQFAALPNLLSFVNSCNTNQVGVAKPKEEKTLCSKSINNHLPSDVLVS  134

Query  1019  -TTIKPKKSGRRGRPPTHRYD----------HILAERKRRELLSRQFLALSTIVPGLRKM  873
               +   + S  +    T+R            HI+AERKRRE LS+QF+ALS +VPGL+K 
Sbjct  135   QASFGNQNSLLKAGHGTNRISTNTRLSQTQVHIMAERKRREKLSQQFIALSAMVPGLKKT  194

Query  872   DKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD  693
             DK SVLGD IKY+KQ+QE++K LEE++  + ME+VV VK+S +  + D+  +      S 
Sbjct  195   DKASVLGDAIKYIKQLQEKLKILEEQTRVKKMETVVSVKRSHLIANGDNNSTV-----SF  249

Query  692   EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITI  513
             E++LP+IE R CDN++L+R++C+++KG++ K  +EVEKL L ++NSSV  FGS  +D+TI
Sbjct  250   EETLPQIEARFCDNNVLIRVHCEKRKGVVEKTIAEVEKLQLKLINSSVMTFGSSVVDVTI  309

Query  512   IVEMEKEFDLPMKHIAKILRSAI  444
             + +ME EF L +K + K LRSA 
Sbjct  310   VAQMEVEFCLTVKDLVKNLRSAF  332



>ref|XP_008455092.1| PREDICTED: transcription factor bHLH18-like isoform X1 [Cucumis 
melo]
Length=340

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 142/193 (74%), Gaps = 12/193 (6%)
 Frame = -2

Query  1001  KSGRRGRPPT------HRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIK  840
             KS R  R P+         DHILAER+RRE LS++F+ALS I+PGL+KMDK SVLGD IK
Sbjct  152   KSNRGTRSPSTNSRIPQAQDHILAERRRREKLSQRFIALSAIIPGLKKMDKASVLGDAIK  211

Query  839   YLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRL  660
             YLKQ+QE+VK LEE++ ++ +ESVVFVKKS V  D +D  +S E    +++ LPEIE R 
Sbjct  212   YLKQLQEKVKILEEQTRRKDIESVVFVKKSHVFADGND--TSKE----EDEPLPEIEARF  265

Query  659   CDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLP  480
             CD ++L+RI+C+++K +I +  +E+EKL+L +VNSSV  FGSLA DITII +M+ EF L 
Sbjct  266   CDKNVLIRIHCEKKKDVIERTVAEIEKLHLIIVNSSVMSFGSLAFDITIIAQMDNEFCLT  325

Query  479   MKHIAKILRSAIQ  441
             +K + K L+S ++
Sbjct  326   LKDLVKNLQSTLR  338



>ref|XP_006367079.1| PREDICTED: transcription factor bHLH25-like [Solanum tuberosum]
Length=353

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 140/188 (74%), Gaps = 17/188 (9%)
 Frame = -2

Query  974  THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEE  795
            T   DHI+AERKRRE LS++F+ALS ++PGL+KMDK SVLGD IKYLKQ+QE+VKTLEE+
Sbjct  170  TQAQDHIIAERKRREKLSQRFIALSALIPGLKKMDKASVLGDAIKYLKQLQEKVKTLEEQ  229

Query  794  SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDE----------QSLPEIETRLCDNHI  645
            + K+++ESVVFVKK ++  D       GE  +SDE          ++LPEIE R+ +  +
Sbjct  230  TKKKSVESVVFVKKYELYGD-------GENSSSDENYSSGTVPVDEALPEIEARISEKDV  282

Query  644  LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
            L+RI+C+++KGI+ K  +E+EKL+L+V+N+    FGS ALDITII +M++EF + +K + 
Sbjct  283  LIRIHCEKRKGIVEKTVAEIEKLHLSVINTCALSFGSSALDITIIAQMDEEFTMTVKDLV  342

Query  464  KILRSAIQ  441
            K LRSA++
Sbjct  343  KNLRSALK  350



>ref|XP_002263046.3| PREDICTED: transcription factor bHLH25-like, partial [Vitis vinifera]
Length=197

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 131/182 (72%), Gaps = 6/182 (3%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R P +  DH++AERKRRE L+++F+ALS IVPGL+K DK SVLGD IKYLKQ+QERVKTL
Sbjct  20   RNPLNNQDHVIAERKRREKLTQRFIALSAIVPGLKKTDKASVLGDAIKYLKQLQERVKTL  79

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            EE+++K+T+ESVV VKKS++S +D +  S        +Q LPEIE R+ +  +L+RI+C 
Sbjct  80   EEQTTKKTVESVVSVKKSKLSDNDQNPDSFS------DQPLPEIEARVSNKDVLIRIHCV  133

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            +QKG   +I  E+EKL L VVNSSV  FG   +DIT++ +ME EF    K + + LR A 
Sbjct  134  KQKGFAVRILGEIEKLRLRVVNSSVLPFGDYIMDITVVAQMEDEFCTTAKDLVRNLRLAF  193

Query  443  QH  438
            QH
Sbjct  194  QH  195



>ref|XP_004288301.1| PREDICTED: transcription factor bHLH25-like [Fragaria vesca subsp. 
vesca]
Length=352

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R P+H  DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+QE VK L
Sbjct  167  RTPSHAQDHIMAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYVKQLQESVKVL  226

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNS--DEQSLPEIETRLCDNHILLRIY  630
            EE++ KRT+ESVVFVKKSQ+   DDD  S  E  +S   ++ LP+IE R+ +  +L+RI+
Sbjct  227  EEQTKKRTVESVVFVKKSQLVSSDDDTSSCDENFDSRCSDEPLPQIEARVSEKDVLIRIH  286

Query  629  CDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRS  450
            C+ QKG + K+ SE+E L L+VVNSSV  FG   LDITI+ +M+ EF++ +  +AK LR 
Sbjct  287  CENQKGYVVKVLSELENLQLSVVNSSVLPFGKSTLDITIVAQMDDEFNMTVTDLAKSLRV  346

Query  449  AI  444
            A+
Sbjct  347  AL  348



>ref|XP_011088147.1| PREDICTED: transcription factor bHLH18-like [Sesamum indicum]
Length=356

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 148/219 (68%), Gaps = 16/219 (7%)
 Frame = -2

Query  1061  SNAIAEQETEPADTTTIKPKKSGRRGRPPT---HRYDHILAERKRRELLSRQFLALSTIV  891
             S +I  Q +       +KP +  +R    T      DHILAERKRRE LS++F+ALST+V
Sbjct  139   SESIVSQASFGNQNYVLKPCQGAKRISTTTRLAQAQDHILAERKRREKLSQRFIALSTLV  198

Query  890   PGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSG  711
             PGL+KMDK SVLGD IKY+KQ+Q++VK+LEE++ KRTMESVVFVKK +V    D      
Sbjct  199   PGLKKMDKASVLGDAIKYMKQLQDKVKSLEEQTKKRTMESVVFVKKYEVHNSGDH----A  254

Query  710   EKGNSDE---------QSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVN  558
             E  +SDE         + LPEIE R C+  +L+ I+C+++KG++ K  +E+EKL+L+VVN
Sbjct  255   ENSSSDESFSNGPVITEQLPEIEARFCNKDVLISIHCEKRKGVLEKTVAEIEKLHLSVVN  314

Query  557   SSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             SSV  FG  AL+IT+I + +++F + MK + K LR+ ++
Sbjct  315   SSVMSFGESALNITVIAQKDEDFTMNMKELVKNLRATLK  353



>ref|XP_002528911.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF33491.1| DNA binding protein, putative [Ricinus communis]
Length=331

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 133/180 (74%), Gaps = 0/180 (0%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R  +H  DHILAERKRRE LS++F+ALS +VPGL+KMDK SVLGD IK++KQ+QERVK L
Sbjct  148  RTASHAQDHILAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKHVKQLQERVKML  207

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            E+++ KRTMES++ +KKSQ+S DD+            + +LPEIE R+ D  +L RI+C+
Sbjct  208  EDQTKKRTMESIILIKKSQLSADDESSSCDDNSDGCSDSALPEIEARVSDKDVLFRIHCE  267

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            +Q+G++ KI  EVE L+L+++N++V  FGS  LDITII +M++   + +K + K LR A+
Sbjct  268  KQQGVVPKILHEVENLHLSIINNTVLPFGSSTLDITIIAQMDENNSMAVKDLVKNLRVAL  327



>emb|CBI23517.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 130/180 (72%), Gaps = 6/180 (3%)
 Frame = -2

Query  977  PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEE  798
            P +  DH++AERKRRE L+++F+ALS IVPGL+K DK SVLGD IKYLKQ+QERVKTLEE
Sbjct  2    PLNNQDHVIAERKRREKLTQRFIALSAIVPGLKKTDKASVLGDAIKYLKQLQERVKTLEE  61

Query  797  ESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQ  618
            +++K+T+ESVV VKKS++S +D +  S        +Q LPEIE R+ +  +L+RI+C +Q
Sbjct  62   QTTKKTVESVVSVKKSKLSDNDQNPDSFS------DQPLPEIEARVSNKDVLIRIHCVKQ  115

Query  617  KGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
            KG   +I  E+EKL L VVNSSV  FG   +DIT++ +ME EF    K + + LR A QH
Sbjct  116  KGFAVRILGEIEKLRLRVVNSSVLPFGDYIMDITVVAQMEDEFCTTAKDLVRNLRLAFQH  175



>ref|XP_007148316.1| hypothetical protein PHAVU_006G198400g [Phaseolus vulgaris]
 gb|ESW20310.1| hypothetical protein PHAVU_006G198400g [Phaseolus vulgaris]
Length=346

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 155/231 (67%), Gaps = 18/231 (8%)
 Frame = -2

Query  1112  PNIDDVNLPELRQELLTSNAIAEQE-----TEPADTTTIKPKKSGRRGRPPTHRYDHILA  948
             P ID+ NL E+   L++   +  Q      ++ A     +PK S           DHI+A
Sbjct  128   PEIDNSNLAEM---LISQGTLGNQNYHFKASQEAKKIETRPKLS--------QPQDHIIA  176

Query  947   ERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-KRTMEs  771
             ERKRRE L+++F+ALS +VPGL+KMDK SVLG++IKY+KQ+QE+V TLEEE + KRT+ES
Sbjct  177   ERKRREKLNQRFIALSALVPGLKKMDKASVLGESIKYMKQLQEKVSTLEEEQNRKRTVES  236

Query  770   vvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFS  591
             VV VKK Q+S D +D  SS   G  DE  LPEIE R+C+ ++L+RI+C++ KGII K  S
Sbjct  237   VVTVKKYQLSSDAEDSSSSETGGTLDE-VLPEIEARICERNVLIRIHCEKNKGIIEKTIS  295

Query  590   EVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
             E+EKL+L V NSS   FGS  LDITII +M+ EF + +K + + LRSA  +
Sbjct  296   EIEKLHLKVTNSSALSFGSFILDITIIAQMDMEFCMTVKDLVRSLRSAFSY  346



>ref|XP_010939305.1| PREDICTED: transcription factor bHLH18-like [Elaeis guineensis]
 ref|XP_010939306.1| PREDICTED: transcription factor bHLH18-like [Elaeis guineensis]
Length=353

 Score =   177 bits (450),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 141/191 (74%), Gaps = 1/191 (1%)
 Frame = -2

Query  1007  PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQ  828
             PK+     RP ++  DHI+AERKRRE +S++F+ALS ++PGL+KMDK SVLGD +KYLKQ
Sbjct  161   PKRMNMGARPTSNNQDHIIAERKRREKMSQRFIALSALIPGLKKMDKASVLGDAVKYLKQ  220

Query  827   IQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGE-KGNSDEQSLPEIETRLCDN  651
             +QE+VKTLEE+++KRT+ES V VKKSQ+S +DD        +G    +SLPEIE ++ +N
Sbjct  221   LQEKVKTLEEQNAKRTVESAVVVKKSQLSSEDDGSCCDENFEGFPSGESLPEIEAKMSEN  280

Query  650   HILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKH  471
              +L++I+C+++ G++    SE+EKL+L+V+N+SV  F S  LDIT++ +++ EF + ++ 
Sbjct  281   SVLIKIHCEKRSGVLLMALSEIEKLHLSVINTSVIPFASSHLDITVVAQIDAEFSMTVQD  340

Query  470   IAKILRSAIQH  438
             + K L SA + 
Sbjct  341   LVKKLNSAFRQ  351



>ref|XP_007206351.1| hypothetical protein PRUPE_ppa017640mg [Prunus persica]
 gb|EMJ07550.1| hypothetical protein PRUPE_ppa017640mg [Prunus persica]
Length=346

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    R P H  DH+LAERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKY+K +
Sbjct  157   KRAATVTRSPLHAQDHVLAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYVKHL  216

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QER K LEE++ K+T+E+VVFVK++Q S DDD   S     +S +Q LPEIE R+ D  +
Sbjct  217   QERTKMLEEKAVKKTVEAVVFVKRTQYSADDDISSSDENFESSSDQPLPEIEARVSDKEV  276

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+R++C++ KG + KI SE+E L+L +VNSSV  FG+  LDIT+I +M+ EF + +K + 
Sbjct  277   LIRVHCEKTKGCLAKILSEIESLDLTIVNSSVLPFGNSTLDITVIAQMDAEFSMTVKDLV  336

Query  464   KILR  453
             K LR
Sbjct  337   KNLR  340



>ref|XP_004230658.1| PREDICTED: transcription factor bHLH18-like [Solanum lycopersicum]
Length=351

 Score =   177 bits (449),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 139/188 (74%), Gaps = 17/188 (9%)
 Frame = -2

Query  974  THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEE  795
            T   DHI+AERKRRE LS++F+ALS ++PGL+KMDK SVLGD IKYLKQ+QE+VKTLEE+
Sbjct  168  TQAQDHIIAERKRREKLSQRFIALSALIPGLKKMDKASVLGDAIKYLKQLQEKVKTLEEQ  227

Query  794  SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDE----------QSLPEIETRLCDNHI  645
            + K+++ESVVFVKK ++  D       GE  +SDE          ++LPEIE R+ +  +
Sbjct  228  TKKKSVESVVFVKKYELYGD-------GENSSSDENYSSGTVPVDEALPEIEARISEKDV  280

Query  644  LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
            L+RI+C++ KG++ K  +E+EKL+L+V+N+    FG+ ALDITII +M++EF + +K + 
Sbjct  281  LIRIHCEKSKGVVEKTVAEIEKLHLSVINTCALSFGTSALDITIIAQMDEEFAMTVKDLV  340

Query  464  KILRSAIQ  441
            K LRSA++
Sbjct  341  KNLRSALK  348



>ref|XP_009412275.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
Length=311

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/313 (38%), Positives = 175/313 (56%), Gaps = 20/313 (6%)
 Frame = -2

Query  1331  MMNLSQACFSGMGTDDLSF----LDQFQILQSIEQEFAGVLGEDVLCssspeegspPTTC  1164
             M  L+  C+S MG D   F    L  F +L +  Q+     G D+  S S E  +   + 
Sbjct  1     MEALASPCYSDMGVDQSFFRQWELSAFDLLGA--QQLEAAFGRDLDQSPSSESYTSYPSF  58

Query  1163  H-LGEDDRPLKQLKIHHH-------PNIDDVNLPELRQELLTSNAIAEQETEPADTTTIK  1008
             H     +RP K  K           P I     PE    +  +  +  +E   A      
Sbjct  59    HPAASTERPKKIAKTSSRSSCTTSCPRILSFGNPE--SPICLAATVKPKEEMEALILGQG  116

Query  1007  PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQ  828
              KK     +P     +HI+AERKRRE LS++F+ALS +VPGL+K DK SVLGD ++YLK+
Sbjct  117   AKKVSTGAKPAAQNQEHIMAERKRREKLSQRFIALSAVVPGLKKTDKASVLGDAVEYLKR  176

Query  827   IQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKG---NSDEQSLPEIETRLC  657
             +QE+VK+LE+  SKR +E+ V VK+SQ+  DDDD  S G++        QSLPEIE R+C
Sbjct  177   LQEKVKSLEDRVSKRNVEAAVLVKRSQLCADDDDG-SPGDESFIEGQGGQSLPEIEARVC  235

Query  656   DNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPM  477
             +  IL++I+C+ +KG++ K  SE+E L+L V+N+SV  F   +LDIT++ +ME+ F +  
Sbjct  236   EKAILIKIHCENRKGVLVKALSEIETLHLRVMNTSVVPFSGSSLDITVVTQMEEGFSMTA  295

Query  476   KHIAKILRSAIQH  438
             K + K L SA + 
Sbjct  296   KDLVKKLNSAFRQ  308



>ref|XP_009415320.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
Length=328

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 127/330 (38%), Positives = 189/330 (57%), Gaps = 38/330 (12%)
 Frame = -2

Query  1331  MMNLSQACFSGMGTDDLSFLDQFQIL---QSIEQEFAGVLGEDVLCssspeegspPTTCH  1161
             M  L+  C+S MG D  SFL+Q+++    Q   Q+    LG+D+  S S E  +  ++ H
Sbjct  1     MEALASPCYSDMGMDQ-SFLNQWELTNLDQFGTQQLELALGQDLERSPSSESYTSYSSFH  59

Query  1160  L-GEDDRPLKQLKIHHHPN---------IDDVNLPEL------RQELLTSN---AIAEQE  1038
                  +R  K +K     +         + D + P +         L  SN   A+  ++
Sbjct  60    PPASTERAKKLIKTSSWSSCTTDKNSAALSDASCPRILSFGNPESPLCHSNLSHAVTMKK  119

Query  1037  TEPADTTTIK-----------PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIV  891
              E  D +               K++    RP +H  +HI+AERKRRE LS++F+ LS +V
Sbjct  120   KEETDVSIPSKRNYGAMSGDGTKRANAGARPASHNQEHIMAERKRREKLSQRFIELSAVV  179

Query  890   PGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSG  711
             P L+KMDK SVLGD IKYLKQ+QE+V +L+++ ++R +ES V VKKSQ+  +DD   SS 
Sbjct  180   PDLKKMDKASVLGDAIKYLKQLQEKVTSLQDQVTQRNVESAVLVKKSQLCANDD---SSS  236

Query  710   EKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSL  531
                N DE SLPEIE R+CD  IL++I+C+ +KGI+ K  SE+EKL+L+V N+SV  F S 
Sbjct  237   SDENFDE-SLPEIEARVCDKTILIKIHCENRKGILVKALSEIEKLHLSVTNTSVMPFTSS  295

Query  530   ALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             +LDIT++ + E+EF +  K + K L S  +
Sbjct  296   SLDITVMTQTEEEFSMTAKDLVKKLNSVFR  325



>ref|XP_009616821.1| PREDICTED: transcription factor bHLH25-like [Nicotiana tomentosiformis]
Length=333

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 137/188 (73%), Gaps = 17/188 (9%)
 Frame = -2

Query  974  THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEE  795
            T   DHI+AERKRRE LS++F+ALS ++PGL+KMDK SVLGD IKYLKQ+QERVKTLEE+
Sbjct  150  TQAQDHIIAERKRREKLSQRFIALSALIPGLKKMDKASVLGDAIKYLKQLQERVKTLEEQ  209

Query  794  SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDE----------QSLPEIETRLCDNHI  645
            + K+++ESVVFVKK ++  D       GE  +SDE          + LPEIE R  +  +
Sbjct  210  TKKKSVESVVFVKKYELYGD-------GENSSSDENYSSGTLPIDEPLPEIEARFSERDV  262

Query  644  LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
            L+RI+C+++KG++ K  +E+EKL+L+V+N+    FG+ ALDITII +M++EF + ++   
Sbjct  263  LVRIHCEKKKGLVDKTVAEIEKLHLSVINTCALSFGTSALDITIIAQMDEEFAMTVQDFV  322

Query  464  KILRSAIQ  441
            K LRSA++
Sbjct  323  KNLRSALK  330



>ref|XP_003608328.1| Transcription factor bHLH25 [Medicago truncatula]
Length=327

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-K  786
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK +VLGD IKYLK++QE+VK LEEE + K
Sbjct  152  DHIIAERKRREKLSQRFIALSALVPGLQKMDKVTVLGDAIKYLKKLQEKVKVLEEEQNMK  211

Query  785  RTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            + +E VV VKK Q+   +D E SS E G+  ++ LPEIE R CD ++L+R++C++ KG++
Sbjct  212  KNVEFVVVVKKYQL--SNDVENSSAESGDPFDEELPEIEARFCDRNVLIRVHCEKIKGVV  269

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
             K   ++EKLNL V NSS   FGS ALDITII +M+ EF + +K + + LRS  
Sbjct  270  EKTIHKIEKLNLKVTNSSFMTFGSCALDITIIAQMDVEFCMTVKDLVRNLRSVF  323



>ref|XP_008236887.1| PREDICTED: transcription factor bHLH25-like [Prunus mume]
Length=361

 Score =   176 bits (446),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    R P H  DH+LAERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKY+K +
Sbjct  171   KRAATVTRSPLHAQDHVLAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYVKHL  230

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QER + LEE++ K+T+E+VVFVK++Q S DDD   S     +  +Q LPEIE R+ D  +
Sbjct  231   QERTRMLEEQAVKKTVEAVVFVKRTQYSADDDISSSDENFESCSDQPLPEIEARVSDKEV  290

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+R++C++ KG + KI SE+E L+L +VNSSV  FG+  LDIT+I +M+ EF + +K + 
Sbjct  291   LIRVHCEKTKGCLAKILSEIESLDLTIVNSSVLPFGNSTLDITVIAQMDAEFSMTVKDLV  350

Query  464   KILRSAI  444
             K LR ++
Sbjct  351   KNLRQSL  357



>gb|AES90525.2| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=333

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-K  786
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK +VLGD IKYLK++QE+VK LEEE + K
Sbjct  158  DHIIAERKRREKLSQRFIALSALVPGLQKMDKVTVLGDAIKYLKKLQEKVKVLEEEQNMK  217

Query  785  RTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            + +E VV VKK Q+   +D E SS E G+  ++ LPEIE R CD ++L+R++C++ KG++
Sbjct  218  KNVEFVVVVKKYQL--SNDVENSSAESGDPFDEELPEIEARFCDRNVLIRVHCEKIKGVV  275

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
             K   ++EKLNL V NSS   FGS ALDITII +M+ EF + +K + + LRS  
Sbjct  276  EKTIHKIEKLNLKVTNSSFMTFGSCALDITIIAQMDVEFCMTVKDLVRNLRSVF  329



>ref|XP_004485646.1| PREDICTED: transcription factor bHLH25-like isoform X2 [Cicer 
arietinum]
Length=340

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 134/189 (71%), Gaps = 2/189 (1%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             K K    R    +  +DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLK
Sbjct  148   KAKDVDTRPNKLSQAHDHIVAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYLK  207

Query  830   QIQERVKTLEEESS-KRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCD  654
             Q+QE+V  LEEE   K+T+ESVV VKKSQ+S D +D  S  +    DE +LPEIE R C+
Sbjct  208   QMQEKVNVLEEEQKRKKTVESVVIVKKSQLSNDGEDSCSDTDNSTFDE-TLPEIEARFCE  266

Query  653   NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
              ++L+R++C + +G+I K  SE+EKLNL V NSS   FG+  LDITII +M+  F + +K
Sbjct  267   RNVLIRLHCLKSQGVIEKTISEIEKLNLKVNNSSALTFGNFTLDITIIAQMDVGFCMTLK  326

Query  473   HIAKILRSA  447
              + + LRSA
Sbjct  327   DVVRKLRSA  335



>ref|XP_004485645.1| PREDICTED: transcription factor bHLH25-like isoform X1 [Cicer 
arietinum]
Length=341

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 134/189 (71%), Gaps = 2/189 (1%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             K K    R    +  +DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLK
Sbjct  149   KAKDVDTRPNKLSQAHDHIVAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYLK  208

Query  830   QIQERVKTLEEESS-KRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCD  654
             Q+QE+V  LEEE   K+T+ESVV VKKSQ+S D +D  S  +    DE +LPEIE R C+
Sbjct  209   QMQEKVNVLEEEQKRKKTVESVVIVKKSQLSNDGEDSCSDTDNSTFDE-TLPEIEARFCE  267

Query  653   NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
              ++L+R++C + +G+I K  SE+EKLNL V NSS   FG+  LDITII +M+  F + +K
Sbjct  268   RNVLIRLHCLKSQGVIEKTISEIEKLNLKVNNSSALTFGNFTLDITIIAQMDVGFCMTLK  327

Query  473   HIAKILRSA  447
              + + LRSA
Sbjct  328   DVVRKLRSA  336



>ref|XP_009387102.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387103.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
Length=329

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 134/190 (71%), Gaps = 4/190 (2%)
 Frame = -2

Query  1001  KSGRRG-RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             KSG  G R  +H  +HI+AERKRRE LS++F+ LS +VPGL+KMDK SVL D IKYLKQ+
Sbjct  138   KSGNTGVRSASHNQEHIMAERKRREKLSQRFIELSAVVPGLKKMDKASVLSDAIKYLKQL  197

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDE--QSLPEIETRLCDN  651
             QE VK LE++ +KR +ES V VKK Q+  DDD   S  E  N  +  +SLPEIE R+C+ 
Sbjct  198   QENVKALEDQVAKRNVESAVLVKKYQLCADDDSS-SCTENFNERQSGESLPEIEARVCEK  256

Query  650   HILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKH  471
              IL+RI+C+ +KG++ K   E+EKL+L+V+N+SV  F   +LDIT++ + E+EF +  K 
Sbjct  257   TILIRIHCENRKGVLVKALCEIEKLHLSVMNTSVMPFAGSSLDITVMTQTEEEFSMTAKD  316

Query  470   IAKILRSAIQ  441
             I K L SA +
Sbjct  317   IVKKLNSAFR  326



>ref|XP_009779237.1| PREDICTED: transcription factor bHLH18-like [Nicotiana sylvestris]
Length=333

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 136/188 (72%), Gaps = 17/188 (9%)
 Frame = -2

Query  974  THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEE  795
            T   DHI+AERKRRE LS++F+ALS ++PGL+KMDK SVLGD IKYLKQ+QE+VKTLEE+
Sbjct  150  TQAQDHIIAERKRREKLSQRFIALSALIPGLKKMDKASVLGDAIKYLKQLQEKVKTLEEQ  209

Query  794  SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDE----------QSLPEIETRLCDNHI  645
              K+++ESVVFVKK ++  D       GE  +SDE          + LPEIE R  +  +
Sbjct  210  IKKKSVESVVFVKKYELYGD-------GENSSSDENYSSGTLPIDEPLPEIEARFSEKDV  262

Query  644  LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
            L+RI+C+++KG++ K  +E+EKL+L+V+N+    FG+ ALDITII +M++EF + ++   
Sbjct  263  LVRIHCEKKKGLVDKTVAEIEKLHLSVINTCALSFGTSALDITIIAQMDEEFAMTVQDFV  322

Query  464  KILRSAIQ  441
            K LRSA++
Sbjct  323  KNLRSALK  330



>gb|KCW59639.1| hypothetical protein EUGRSUZ_H02390 [Eucalyptus grandis]
Length=209

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -2

Query  986  GRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKT  807
             RPP    +H++AERKRRE LS+ F+ALS I+PGL+KMDK S+L D I Y+KQ+QERVK 
Sbjct  2    SRPPIDTREHLIAERKRREKLSQSFIALSAIIPGLKKMDKASILSDAINYMKQLQERVKK  61

Query  806  LEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYC  627
            LEEE + RT+ESVV VKKSQV   DD   S  E  N  EQ LPEIE R+ D H+LLRI+ 
Sbjct  62   LEEEVAIRTVESVVIVKKSQVLAFDDI-FSLDENSNHFEQQLPEIEARVLDKHVLLRIHY  120

Query  626  DRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
            ++QKG + +I  E++KLNL+++NSSV  FGS  L++TI+ +M+ +F + ++ + K L ++
Sbjct  121  EKQKGCMTEILREIKKLNLSILNSSVLSFGSSILEMTIVAQMDVDFCMNIEDLVKSLHTS  180



>emb|CDP18041.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 145/197 (74%), Gaps = 5/197 (3%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++G R R P+  YDHI+AERKRR+ L   F +LS+I+PGL+KMDKTSVLGD I  LK +
Sbjct  150   KRTGGRTRSPSQTYDHIMAERKRRKHLGLLFSSLSSILPGLKKMDKTSVLGDAINQLKHL  209

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKG--NSDEQSLPEIETRLCDN  651
             QE+VKTLEE+ +K+T+ESVV VKKSQ    DD  +SS E+G  N+++   P+IE ++CD 
Sbjct  210   QEKVKTLEEQVTKQTVESVVLVKKSQRLVADD--VSSDERGCNNNNQLLFPQIEAKVCDK  267

Query  650   HILLRIYC-DRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
              +L +++C + Q G++ K+ S+VE LNLAV N+SV  FG+ AL++TII EMEKEF++  K
Sbjct  268   EVLPKVHCENHQPGVLIKLLSKVENLNLAVTNTSVTPFGNSALEVTIIAEMEKEFNMTTK  327

Query  473   HIAKILRSAIQHAAQTS  423
              +AK L SA+   AQ S
Sbjct  328   ELAKNLGSALHLVAQES  344



>ref|XP_010026565.1| PREDICTED: transcription factor bHLH19-like [Eucalyptus grandis]
Length=327

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K+ G   RPP    +H++AERKRRE LS+ F+ALS I+PGL+KMDK S+L D I Y+KQ+
Sbjct  114   KRIGAMSRPPIDTREHLIAERKRREKLSQSFIALSAIIPGLKKMDKASILSDAINYMKQL  173

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QERVK LEEE + RT+ESVV VKKSQV   DD   S  E  N  EQ LPEIE R+ D H+
Sbjct  174   QERVKKLEEEVAIRTVESVVIVKKSQVLAFDDI-FSLDENSNHFEQQLPEIEARVLDKHV  232

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             LLRI+ ++QKG + +I  E++KLNL+++NSSV  FGS  L++TI+ +M+ +F + ++ + 
Sbjct  233   LLRIHYEKQKGCMTEILREIKKLNLSILNSSVLSFGSSILEMTIVAQMDVDFCMNIEDLV  292

Query  464   KILRSA  447
             K L ++
Sbjct  293   KSLHTS  298



>gb|KHG21236.1| Transcription factor bHLH19 -like protein [Gossypium arboreum]
Length=312

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 124/191 (65%), Gaps = 1/191 (1%)
 Frame = -2

Query  1013  IKPKKS-GRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKY  837
             +KPK   G   R P H  DH+LAERKRR  LS+ F++LS ++PGL+K DK SVLGD I Y
Sbjct  117   VKPKNEVGSFTRTPLHAQDHVLAERKRRAKLSQSFISLSALIPGLKKTDKASVLGDAITY  176

Query  836   LKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLC  657
             LK++Q+RV  LEE+ +K+TMES +FV+K+Q+  DD+   S            PEIE R+ 
Sbjct  177   LKKLQDRVNVLEEQVAKKTMESGIFVRKTQIYADDETSSSDESVHGQSNNPFPEIEARVS  236

Query  656   DNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPM  477
             D  +L+RI+C   KG I  I +EVEKL+L V+NS V  FG   LDITI  +ME EF +  
Sbjct  237   DKDVLIRIHCKHNKGCISNIINEVEKLHLFVLNSHVLPFGQATLDITITAQMEAEFSMTA  296

Query  476   KHIAKILRSAI  444
             K + K LR A+
Sbjct  297   KDLVKSLRLAL  307



>gb|KDP32144.1| hypothetical protein JCGZ_12605 [Jatropha curcas]
Length=335

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 131/187 (70%), Gaps = 16/187 (9%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             KK+G   R  +H  DH++AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+
Sbjct  161   KKTGAMSRTLSHAQDHVIAERKRREKLSQRFIALSAVVPGLKKMDKASVLGDAIKYLKQL  220

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QERVKTLEE+S+++ MESVVFVKK QV  DD+   +     +  +Q LPEIE R+ +  +
Sbjct  221   QERVKTLEEQSARKNMESVVFVKKCQVYADDESSSTDENCDSCSDQPLPEIEARVSEKDV  280

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+RI+C++QKG + KIFSEVEKL+L V+NSS                M+ +F + MK + 
Sbjct  281   LIRIHCEKQKGYLLKIFSEVEKLHLNVINSS----------------MDSDFSMTMKDVV  324

Query  464   KILRSAI  444
             + LR A+
Sbjct  325   RNLRQAL  331



>ref|XP_010942051.1| PREDICTED: transcription factor bHLH25-like [Elaeis guineensis]
Length=312

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 147/198 (74%), Gaps = 1/198 (1%)
 Frame = -2

Query  1025  DTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDT  846
             +T T +  +  + G  P+   DHI+AERKRRE LS++F+ALS ++PGL+K+DK SVLGD 
Sbjct  113   ETITQQVSRMTKMGPVPSQAQDHIIAERKRRENLSQRFIALSAVIPGLKKVDKASVLGDA  172

Query  845   IKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSG-EKGNSDEQSLPEIE  669
              +++K++QERVKTLE++++ RT+ES V +KKS++S DDD   S+    G S E+ LPEIE
Sbjct  173   ARHIKELQERVKTLEDQNATRTVESKVLIKKSKLSADDDRSSSNEFSNGCSSEEPLPEIE  232

Query  668   TRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEF  489
               L +  +L+RI+C+ Q+G++ ++ SE+EK++LAV N+S+  F + +++IT+  E+E+EF
Sbjct  233   VMLSEKTVLVRIHCENQRGVLARLLSEIEKVHLAVTNASIMPFLTSSINITVAAEVEEEF  292

Query  488   DLPMKHIAKILRSAIQHA  435
              + ++ +A+ L SA++++
Sbjct  293   SMTVEDLARKLNSALRNS  310



>gb|KDO78768.1| hypothetical protein CISIN_1g037441mg [Citrus sinensis]
Length=366

 Score =   172 bits (435),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 8/200 (4%)
 Frame = -2

Query  1019  TTIKPKKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLG  852
             T I P    +R  P    P    DHI+AERKRRE LS++F+ALS I+PGL+KMDK SVLG
Sbjct  163   TVINPNHGTKRSYPVTRTPALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASVLG  222

Query  851   DTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD----EQS  684
             D I+Y+K++QERVK LEE++ KRT+ESVV+VKKSQ+     D+ SS    NS+    + +
Sbjct  223   DAIRYVKELQERVKVLEEQTKKRTVESVVYVKKSQLVVSGTDDESSSCDDNSEISTSDAT  282

Query  683   LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             LPEIE R+ D  +L+RI+C++QKG++ K+ S++E L+L++ N+SV  FG+  LDITII  
Sbjct  283   LPEIEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIAL  342

Query  503   MEKEFDLPMKHIAKILRSAI  444
                EF   MK + K +R A 
Sbjct  343   KNAEFCTTMKDLVKDIRLAF  362



>gb|KCW59638.1| hypothetical protein EUGRSUZ_H02389 [Eucalyptus grandis]
Length=319

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 133/185 (72%), Gaps = 1/185 (1%)
 Frame = -2

Query  1001  KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQ  822
             ++G   RPP H   H++AERKRRE LS+ F+ALS I+PGL+KMDK S+L D I Y+KQ+Q
Sbjct  109   RTGAMSRPPMHTRKHLIAERKRREKLSQSFIALSAIIPGLKKMDKASILSDAIDYMKQLQ  168

Query  821   ERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHIL  642
             ERVK LEEE + RT+ESVV  KKSQVS   DD  S  E  N  EQ LPEIE R+ D H+L
Sbjct  169   ERVKKLEEEVAIRTVESVVIGKKSQVSA-YDDMFSLDENSNHFEQQLPEIEARVLDKHVL  227

Query  641   LRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAK  462
             LRI+ +++KG   +I  E+EKLNL+++NSSV  FGS  L++TI+ +M+ +F + ++ + K
Sbjct  228   LRIHHEKRKGRTTEILREIEKLNLSILNSSVLSFGSSILEMTIVAQMDVDFCMNIEDLVK  287

Query  461   ILRSA  447
              L ++
Sbjct  288   NLHTS  292



>ref|XP_010666979.1| PREDICTED: transcription factor bHLH18-like [Beta vulgaris subsp. 
vulgaris]
Length=342

 Score =   171 bits (434),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 178/310 (57%), Gaps = 36/310 (12%)
 Frame = -2

Query  1268  QFQILQSIEQEF----AGVLGEDVLCssspeegspPTTCHLGEDDRPLKQLKIHHHPNID  1101
             QFQ  +++E  F       LGED          S  T+     D  P++Q  +   P I 
Sbjct  26    QFQQSETVEASFDEQLVATLGEDF--PYPLSIESHTTSPQFDFDCDPIEQFML---PQIT  80

Query  1100  DVNLPELRQELLTSNAIAE--QETEPADTTTIKPKKSG-RRGRPPTHRYDHILAERKRRE  930
               N      + + S+ + E  Q+    + T  +   SG +R R P    DHI+AER+RRE
Sbjct  81    KNNNYNKDNDKIHSSNVQEDRQQCLNKEKTKNQATSSGTKRKRQPNQVQDHIIAERRRRE  140

Query  929   LLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkks  750
             LLS+ F++LSTIVPGL+K+DKTSVLG+ IKY+KQ+QE+VK LE+ ++KRT+ESVV VKKS
Sbjct  141   LLSQMFISLSTIVPGLKKVDKTSVLGEAIKYMKQLQEKVKVLEDVAAKRTVESVVVVKKS  200

Query  749   qvsFDDDDEMSSGEKGNS------------------------DEQSLPEIETRLCDNHIL  642
             Q+  DDD  +   E  ++                         + SLPEIE ++    +L
Sbjct  201   QLIVDDDKGLDDNESSSTVDDNCEHGVIGSNGNGGNSNESNNQDNSLPEIEVKISGKTLL  260

Query  641   LRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAK  462
             LR+YC++QKGI+ K+F+EV+K ++ V N SV  FG++ALDITI  +M+  F+  ++   +
Sbjct  261   LRVYCEQQKGILAKLFAEVDKHDMNVTNCSVIPFGNIALDITIYAQMKNGFNKSVRDFVR  320

Query  461   ILRSAIQHAA  432
              L SA++ A+
Sbjct  321   TLHSALRLAS  330



>emb|CBI18610.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 129/180 (72%), Gaps = 0/180 (0%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R  +H  DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+QERVK+L
Sbjct  3    RTSSHAQDHIMAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYLKQLQERVKSL  62

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            EE+  + T+ESVVF+KKSQ+S DD+            E ++ +IE R+ D ++L+RI+C 
Sbjct  63   EEQMKETTVESVVFIKKSQLSADDETSSCDENFDGCREDAVRDIEARVSDKNVLIRIHCK  122

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            +QKG + K+  E+E+ +L+VVNSSV  FG  A+DIT++ +M  E  + +K +   LR A 
Sbjct  123  KQKGFVAKVLGEIEEHHLSVVNSSVLPFGKHAMDITVVAQMGDELQVTVKDLVNNLRLAF  182



>ref|XP_006466576.1| PREDICTED: transcription factor bHLH25-like [Citrus sinensis]
Length=369

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 8/200 (4%)
 Frame = -2

Query  1019  TTIKPKKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLG  852
             T I P    +R  P    P    DHI+AERKRRE LS++F+ALS I+PGL+KMDK SVLG
Sbjct  166   TVINPNHGTKRSYPVTRTPALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKASVLG  225

Query  851   DTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD----EQS  684
             D I+Y+K++QERVK LEE++ KRT+ESVV+VKKSQ+     D+ SS    NS+    + +
Sbjct  226   DAIRYVKELQERVKVLEEQTKKRTVESVVYVKKSQLVVSGTDDESSSCDDNSEISTSDAT  285

Query  683   LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             LPEIE R+ D  +L+RI+C++QKG++ K+ S++E L+L++ N+SV  FG+  LDITII  
Sbjct  286   LPEIEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDITIIAL  345

Query  503   MEKEFDLPMKHIAKILRSAI  444
                EF   MK + K +R A 
Sbjct  346   KNAEFCTTMKDLVKDIRLAF  365



>ref|XP_006426181.1| hypothetical protein CICLE_v10027158mg [Citrus clementina]
 gb|ESR39421.1| hypothetical protein CICLE_v10027158mg [Citrus clementina]
Length=380

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 139/204 (68%), Gaps = 8/204 (4%)
 Frame = -2

Query  1031  PADTTTIKPKKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKT  864
             P   T I P    +R  P    P    DHI+AERKRRE LS++F+ALS I+PGL+KMDK 
Sbjct  159   PNYETVINPNHGTKRSYPVTRTPALAQDHIMAERKRREKLSQRFIALSAILPGLKKMDKA  218

Query  863   SVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD---  693
             SVLGD I+Y+K++QERVK LEE++ KRT+ESVV+VKKSQ+     D+ SS    NS+   
Sbjct  219   SVLGDAIRYVKELQERVKVLEEQTKKRTVESVVYVKKSQLVVSGTDDESSSCDDNSEIST  278

Query  692   -EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDIT  516
              + +LPEIE R+ D  +L+RI+C++QKG++ K+ S++E L+L++ N+SV  FG+  LDIT
Sbjct  279   SDGTLPEIEARVSDKDVLIRIHCEKQKGLLPKLISQLEMLHLSITNTSVLPFGNSTLDIT  338

Query  515   IIVEMEKEFDLPMKHIAKILRSAI  444
             II     EF   MK + K +R A 
Sbjct  339   IIALKNAEFCTTMKDLVKDIRLAF  362



>ref|XP_008383359.1| PREDICTED: transcription factor bHLH18-like [Malus domestica]
Length=360

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 136/200 (68%), Gaps = 6/200 (3%)
 Frame = -2

Query  1025  DTTTIKPK------KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKT  864
             DT T  PK      ++    R P H  DH+LAERKRRE LS++F+ALS ++PGL+KMDK 
Sbjct  157   DTQTCSPKHGXGIKRAATVTRSPLHAQDHVLAERKRREKLSQRFIALSALLPGLKKMDKA  216

Query  863   SVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS  684
             SVLGD IKY+K +QER K LEE+++K+T E+VVFVK+ Q S DDD   S     +  +Q 
Sbjct  217   SVLGDAIKYVKHLQERTKVLEEQAAKKTGEAVVFVKRMQYSADDDISSSDENSESCSDQP  276

Query  683   LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             LPEIE R+ D  +L+RI+C++ KG +  I SE+EKL L +V+S    FG+  LDIT++ +
Sbjct  277   LPEIEARVSDKEVLIRIHCEKTKGCLTSILSEIEKLGLTIVHSCALPFGNSTLDITVVAQ  336

Query  503   MEKEFDLPMKHIAKILRSAI  444
             M+ +F + +K + K LR A+
Sbjct  337   MDXQFSMTVKDLVKNLRHAL  356



>ref|XP_006573685.1| PREDICTED: transcription factor bHLH25-like [Glycine max]
Length=328

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/270 (42%), Positives = 163/270 (60%), Gaps = 31/270 (11%)
 Frame = -2

Query  1172  TTCHLGEDD-----RPLKQLKIHHHPNIDDVNLPELRQELLTSNAIAEQETEPADTTTIK  1008
             T  +  EDD     RP K LKI    N  +      +++   S  I           T+K
Sbjct  53    TVSNSSEDDKVFGERPAKTLKIGT-SNSSNTEFLSQKKDSSPSYIIFSDNVNQLQAPTLK  111

Query  1007  PKKS----GRRG-----------RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKM  873
             PK      GR+G           R P H  DHI+AER RRE +S+QF+ALS ++P L+KM
Sbjct  112   PKGKVACHGRKGSLENQNFGSVSRSPHHAKDHIIAERMRREKISQQFVALSALIPDLKKM  171

Query  872   DKTSVLGDTIKYLKQIQERVKTLEEESS-KRTMEsvvfvkksqvsFDDD--DEMSSGEKG  702
             DK SVLGD IK++KQ+QE+VK LEE++  KR +ESVV+VKKS++S  +D  +  S+   G
Sbjct  172   DKASVLGDAIKHVKQLQEQVKLLEEKNKRKRVVESVVYVKKSKLSAAEDVFNTFSNSGDG  231

Query  701   NSDE-------QSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVAR  543
             NS +       +S PE+E R+ + H+L+RI+C +QKG+   I  ++E L+L+V+NSS+  
Sbjct  232   NSYDISETKTNESFPEVEARVLEKHVLIRIHCGKQKGLFINILKDIENLHLSVINSSILL  291

Query  542   FGSLALDITIIVEMEKEFDLPMKHIAKILR  453
             FG+  LDITI+ EM++EF L +K +A+ LR
Sbjct  292   FGTSKLDITIVAEMDEEFSLSVKELARKLR  321



>ref|XP_010026566.1| PREDICTED: transcription factor NAI1-like [Eucalyptus grandis]
Length=304

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 134/188 (71%), Gaps = 3/188 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K+ G   R   H  +H++AERKRR+ LS+ F+ALS I+PGL+KMDK S+LGD IKY+KQ+
Sbjct  115   KRDGAMSRSTLHTQEHVIAERKRRQKLSQNFIALSAIIPGLKKMDKASILGDAIKYMKQL  174

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK-GNSDEQSLPEIETRLCDNH  648
             QERVK LEEE + RT+ESVV VKKSQV  DDD  MS  E   +  EQ LPEIE R+ D +
Sbjct  175   QERVKKLEEEVAIRTVESVVIVKKSQVLADDD--MSLDENFYDQFEQRLPEIEARVLDRY  232

Query  647   ILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHI  468
              L RI+ +++KG   +I SE+EKLNL+V+NSSV  FGS  LD+TI+ +M+  F +  + +
Sbjct  233   ALFRIHHEKRKGYTTEILSEIEKLNLSVLNSSVLPFGSSMLDMTIVAQMDVGFCMKAEDL  292

Query  467   AKILRSAI  444
              K LR ++
Sbjct  293   VKNLRQSL  300



>gb|KCW59640.1| hypothetical protein EUGRSUZ_H02391 [Eucalyptus grandis]
Length=310

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 134/188 (71%), Gaps = 3/188 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K+ G   R   H  +H++AERKRR+ LS+ F+ALS I+PGL+KMDK S+LGD IKY+KQ+
Sbjct  121   KRDGAMSRSTLHTQEHVIAERKRRQKLSQNFIALSAIIPGLKKMDKASILGDAIKYMKQL  180

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK-GNSDEQSLPEIETRLCDNH  648
             QERVK LEEE + RT+ESVV VKKSQV  DDD  MS  E   +  EQ LPEIE R+ D +
Sbjct  181   QERVKKLEEEVAIRTVESVVIVKKSQVLADDD--MSLDENFYDQFEQRLPEIEARVLDRY  238

Query  647   ILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHI  468
              L RI+ +++KG   +I SE+EKLNL+V+NSSV  FGS  LD+TI+ +M+  F +  + +
Sbjct  239   ALFRIHHEKRKGYTTEILSEIEKLNLSVLNSSVLPFGSSMLDMTIVAQMDVGFCMKAEDL  298

Query  467   AKILRSAI  444
              K LR ++
Sbjct  299   VKNLRQSL  306



>ref|XP_011022082.1| PREDICTED: transcription factor bHLH25-like [Populus euphratica]
Length=319

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 125/174 (72%), Gaps = 2/174 (1%)
 Frame = -2

Query  959  HILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRT  780
            H + ER RRE LS++F+ALS +VPGL+KMDK SVLGD IKYLK +QERVKTLEE+++K+T
Sbjct  143  HAIEERNRREKLSQRFIALSAVVPGLKKMDKASVLGDAIKYLKYLQERVKTLEEQAAKKT  202

Query  779  MEsvvfvkksqvsFDDDDEMSSGEK--GNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            MES VFVKKS V   DD   S+ E   G   +  LPEIE  + D  +L+RI C+ QKG +
Sbjct  203  MESAVFVKKSMVCIADDSSSSTDENPAGGCRDYPLPEIEITVSDEDVLIRILCENQKGCL  262

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
             KI +E+EKL+L V+NS V  FG+  LD+TI+ +M+ +F + +K + K LR A+
Sbjct  263  TKILTEMEKLHLKVINSVVMPFGNYTLDVTIVAQMDVDFSMTLKDLVKNLRRAL  316



>ref|XP_009347090.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
Length=360

 Score =   170 bits (430),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 134/200 (67%), Gaps = 6/200 (3%)
 Frame = -2

Query  1025  DTTTIKPK------KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKT  864
             DT T  PK      ++    R P H  DH+LAERKRRE LS++F+ALS ++PGLRKMDK 
Sbjct  157   DTQTCSPKHGQGIKRAATVTRSPLHAQDHVLAERKRREKLSQRFIALSALLPGLRKMDKA  216

Query  863   SVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS  684
             SVLGD IKY+  +QER K LE++ +K+T E+VVFVK+ Q S DDD   S     +  +Q 
Sbjct  217   SVLGDAIKYVNHLQERTKVLEDQVAKKTGEAVVFVKRMQYSADDDISSSDENFESCSDQP  276

Query  683   LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             LPEIE R+ D  +L+RI+C++ KG +  I SE+EKL L +V+S    FG+  LDIT++ +
Sbjct  277   LPEIEARVSDKEVLIRIHCEKTKGCLTSILSEIEKLGLTIVHSCALPFGNSTLDITVVAQ  336

Query  503   MEKEFDLPMKHIAKILRSAI  444
             M+ EF +  KH+ K LR A+
Sbjct  337   MDVEFSMTGKHLVKNLRHAL  356



>ref|XP_006852729.1| hypothetical protein AMTR_s00033p00078670, partial [Amborella 
trichopoda]
 gb|ERN14196.1| hypothetical protein AMTR_s00033p00078670, partial [Amborella 
trichopoda]
Length=339

 Score =   169 bits (428),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 127/192 (66%), Gaps = 13/192 (7%)
 Frame = -2

Query  986  GRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKT  807
             +  +H  DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+ Q+QERVK 
Sbjct  146  AKSSSHTQDHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYVTQLQERVKN  205

Query  806  LEEESSKRTMEsvvfvkksqvs-----------FDDDDEMSSGEKGNSDEQSLPEIETRL  660
            LEEE++K+T+ES V V KS V                        GN    SLPEIE R+
Sbjct  206  LEEETAKKTVESAVLVNKSHVYLDDSSSSSSSTSSSSSLSEDDNSGNG--VSLPEIEARV  263

Query  659  CDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLP  480
             D  +L+RI+C+++KGI+ K  +EVEK +L V+N+S   F S ALD+T++ +ME+E+ + 
Sbjct  264  ADKSVLIRIHCEKRKGILAKAIAEVEKFHLYVLNASFMSFASCALDLTLVAQMEEEYSMT  323

Query  479  MKHIAKILRSAI  444
             K + K LR A+
Sbjct  324  AKDLVKALRLAL  335



>ref|XP_002306398.2| hypothetical protein POPTR_0005s09810g [Populus trichocarpa]
 gb|EEE93394.2| hypothetical protein POPTR_0005s09810g [Populus trichocarpa]
Length=269

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 133/190 (70%), Gaps = 3/190 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRY-DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQ  828
             +K+G +    T +   H + ER RRE LS++F+ALS +VPGL+KMDK SVLGD IKYLK 
Sbjct  79    RKAGTKKIAATSKSPSHAIEERNRREKLSQRFIALSAVVPGLKKMDKASVLGDAIKYLKY  138

Query  827   IQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK--GNSDEQSLPEIETRLCD  654
             +QERVKTLEE+++K+TMESVVFVKKS V   DD   S+ E   G   +  LPEIE  + D
Sbjct  139   LQERVKTLEEQAAKKTMESVVFVKKSLVCIADDSSSSTDENSAGGCRDYPLPEIEITVSD  198

Query  653   NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
               +L+RI C+ QKG + KI +E+EKL+L V+NS V  FG+  LD+TI+ +M+ +F + +K
Sbjct  199   EDVLIRILCENQKGCLMKILTEMEKLHLKVINSIVMPFGNYTLDVTIVAQMDVDFSMTLK  258

Query  473   HIAKILRSAI  444
              + K LR A+
Sbjct  259   DLVKNLRRAL  268



>gb|KHN19045.1| Transcription factor bHLH25 [Glycine soja]
Length=343

 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLG+ IKYLKQ+QE+V  LEEE +++
Sbjct  167  DHIIAERKRREKLSQRFIALSALVPGLKKMDKASVLGEAIKYLKQMQEKVSALEEEQNRK  226

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIG  603
                 V + K      D ++ SS E G++ +++LPEIE R  + ++L+RI+C++ KG+I 
Sbjct  227  RTVESVVIVKKSRLSSDAEDSSSSETGDTFDEALPEIEARFYERNVLIRIHCEKNKGVIE  286

Query  602  KIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
            K  SE+EKL+L V+NSS   FGS  LDITII +M+ EF + +K + + LRSA  +
Sbjct  287  KTISEIEKLHLKVINSSALTFGSFILDITIIAQMDMEFCMTVKDLVRSLRSAFSY  341



>ref|XP_010683069.1| PREDICTED: transcription factor bHLH18-like [Beta vulgaris subsp. 
vulgaris]
Length=344

 Score =   169 bits (428),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 141/210 (67%), Gaps = 23/210 (11%)
 Frame = -2

Query  992  RRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERV  813
            +R R P    DHI+AER+RRELLS+ F++LS IVPGL+K+DKTSVLG+ IKY+KQ+QE+V
Sbjct  122  KRKRQPNQVQDHIIAERRRRELLSQMFISLSAIVPGLKKVDKTSVLGEAIKYMKQLQEKV  181

Query  812  KTLEEESSKRTMEsvvfvkksqvsFD-----DDDEMSSGEKGNSDEQ-------------  687
            K LE+ ++KRT+ESVV VKKSQ+  D     DD+E SS    N D               
Sbjct  182  KVLEDVAAKRTVESVVVVKKSQLIVDDDKGGDDNESSSTVDDNCDGGNGSNGNGGNSNES  241

Query  686  -----SLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALD  522
                 SLPEIE ++    +LLR+YC++QKG++ K+F+EV+K ++ V N SV  F SLALD
Sbjct  242  NNMGDSLPEIEIKISGKTLLLRVYCEQQKGVLAKLFAEVDKHDINVTNCSVIPFESLALD  301

Query  521  ITIIVEMEKEFDLPMKHIAKILRSAIQHAA  432
            ITI+ +ME  F+  ++   + L SA++ A+
Sbjct  302  ITIVAQMENGFNKNVRDFVRTLHSALRLAS  331



>gb|KHN33594.1| Transcription factor bHLH25 [Glycine soja]
Length=347

 Score =   169 bits (428),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 153/227 (67%), Gaps = 11/227 (5%)
 Frame = -2

Query  1112  PNIDDVNLPELRQELLTSNAIAEQE-TEPADTTTIKPKKSGRRGRPPTHRYDHILAERKR  936
             P ID+  L ++   L++   +  Q     A+  T K K   +  +P     DHI+AERKR
Sbjct  128   PKIDNNALADM---LISQGTLGNQNYIFKANQETKKIKTRPKLSQPQ----DHIIAERKR  180

Query  935   RELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-KRTMEsvvfv  759
             RE LS++F+ALS +VPGL+KMDK SVLG+ IKYLKQ+QE+V  LEEE + KRT+ESVV V
Sbjct  181   REKLSQRFIALSALVPGLKKMDKASVLGEAIKYLKQMQEKVSALEEEQNRKRTVESVVIV  240

Query  758   kksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEK  579
             KKSQ+S D +D  S    G +  ++LPEIE R  + ++L+RI+C++ KG+I K  SE+EK
Sbjct  241   KKSQLSSDAEDSSSE--TGGTFVEALPEIEARFWERNVLIRIHCEKNKGVIEKTISEIEK  298

Query  578   LNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
             L+L V+NSS   FGS  LDITII +M+ EF + +K + + LRSA  +
Sbjct  299   LHLKVINSSALTFGSFILDITIIAQMDMEFCMTVKDLVRSLRSAFSY  345



>ref|NP_001239843.1| transcription factor bHLH25-like [Glycine max]
 gb|AAC32828.1| symbiotic ammonium transporter [Glycine max]
Length=347

 Score =   169 bits (427),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 156/231 (68%), Gaps = 19/231 (8%)
 Frame = -2

Query  1112  PNIDDVNLPEL---RQELLTSNAI--AEQETEPADTTTIKPKKSGRRGRPPTHRYDHILA  948
             P ID+  L ++   +  L   N I  A QET+   T   +PK S    +P     DHI+A
Sbjct  128   PKIDNNALADMLISQGTLGNQNYIFKASQETKKIKT---RPKLS----QPQ----DHIIA  176

Query  947   ERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-KRTMEs  771
             ERKRRE LS++F+ALS +VPGL+KMDK SVLG+ IKYLKQ+QE+V  LEEE + KRT+ES
Sbjct  177   ERKRREKLSQRFIALSALVPGLKKMDKASVLGEAIKYLKQMQEKVSALEEEQNRKRTVES  236

Query  770   vvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFS  591
             VV VKKSQ+S D +D  S    G +  ++LPEIE R  + ++L+RI+C++ KG+I K  S
Sbjct  237   VVIVKKSQLSSDAEDSSSE--TGGTFVEALPEIEARFWERNVLIRIHCEKNKGVIEKTIS  294

Query  590   EVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
             E+EKL+L V+NSS   FGS  LDITII +M+ EF + +K + + LRSA  +
Sbjct  295   EIEKLHLKVINSSALTFGSFILDITIIAQMDMEFCMTVKDLVRSLRSAFSY  345



>ref|XP_006594659.1| PREDICTED: transcription factor bHLH25-like isoform X3 [Glycine 
max]
Length=348

 Score =   169 bits (427),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLG+ IKYLKQ+QE+V  LEEE +++
Sbjct  172  DHIIAERKRREKLSQRFIALSALVPGLKKMDKASVLGEAIKYLKQMQEKVSALEEEQNRK  231

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIG  603
                 V + K      D ++ SS E G++ +++LPEIE R  + ++L+RI+C++ KG+I 
Sbjct  232  RTVESVVIVKKSRLSSDAEDSSSSETGDTFDEALPEIEARFYERNVLIRIHCEKNKGVIE  291

Query  602  KIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
            K  SE+EKL+L V+NSS   FGS  LDITII +M+ EF + +K + + LRSA  +
Sbjct  292  KTISEIEKLHLKVINSSALTFGSFILDITIIAQMDMEFCMTVKDLVRSLRSAFSY  346



>ref|XP_006594658.1| PREDICTED: transcription factor bHLH25-like isoform X2 [Glycine 
max]
Length=355

 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLG+ IKYLKQ+QE+V  LEEE +++
Sbjct  179  DHIIAERKRREKLSQRFIALSALVPGLKKMDKASVLGEAIKYLKQMQEKVSALEEEQNRK  238

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIG  603
                 V + K      D ++ SS E G++ +++LPEIE R  + ++L+RI+C++ KG+I 
Sbjct  239  RTVESVVIVKKSRLSSDAEDSSSSETGDTFDEALPEIEARFYERNVLIRIHCEKNKGVIE  298

Query  602  KIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
            K  SE+EKL+L V+NSS   FGS  LDITII +M+ EF + +K + + LRSA  +
Sbjct  299  KTISEIEKLHLKVINSSALTFGSFILDITIIAQMDMEFCMTVKDLVRSLRSAFSY  353



>ref|XP_006597021.1| PREDICTED: transcription factor bHLH25-like isoform X1 [Glycine 
max]
Length=369

 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 156/231 (68%), Gaps = 19/231 (8%)
 Frame = -2

Query  1112  PNIDDVNLPEL---RQELLTSNAI--AEQETEPADTTTIKPKKSGRRGRPPTHRYDHILA  948
             P ID+  L ++   +  L   N I  A QET+   T   +PK S    +P     DHI+A
Sbjct  150   PKIDNNALADMLISQGTLGNQNYIFKASQETKKIKT---RPKLS----QPQ----DHIIA  198

Query  947   ERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-KRTMEs  771
             ERKRRE LS++F+ALS +VPGL+KMDK SVLG+ IKYLKQ+QE+V  LEEE + KRT+ES
Sbjct  199   ERKRREKLSQRFIALSALVPGLKKMDKASVLGEAIKYLKQMQEKVSALEEEQNRKRTVES  258

Query  770   vvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFS  591
             VV VKKSQ+S D +D  S    G +  ++LPEIE R  + ++L+RI+C++ KG+I K  S
Sbjct  259   VVIVKKSQLSSDAEDSSSE--TGGTFVEALPEIEARFWERNVLIRIHCEKNKGVIEKTIS  316

Query  590   EVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
             E+EKL+L V+NSS   FGS  LDITII +M+ EF + +K + + LRSA  +
Sbjct  317   EIEKLHLKVINSSALTFGSFILDITIIAQMDMEFCMTVKDLVRSLRSAFSY  367



>gb|KHN46510.1| Transcription factor bHLH25, partial [Glycine soja]
Length=247

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 153/236 (65%), Gaps = 17/236 (7%)
 Frame = -2

Query  1109  NIDDVNLPELRQELLT---SNAIAEQETEPADTTTIKP---KKSGRRGRPPTHRYDHILA  948
             + D++N P ++ E  +   +  +  ++  P+     +P   KK G   R   H  DHI+A
Sbjct  5     SFDNMNPPTIKVESASKPGTKVVNLEKALPSKNEPTRPQENKKMGSFARSSHHTQDHIIA  64

Query  947   ERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsv  768
             ER RRE +S+QF+ALS ++P L+KMDK S+LG+ I+Y+KQ++E+VK LEE+S ++  ESV
Sbjct  65    ERMRREKISQQFIALSALIPDLKKMDKVSLLGEAIRYVKQLKEQVKLLEEQSKRKNEESV  124

Query  767   vfvkksqvsFDDDD----EMSSGEKGNSDEQ-------SLPEIETRLCDNHILLRIYCDR  621
             +F KKSQV   D+D      +S E GNSD+        SLPE+E R+   ++L+RI C++
Sbjct  125   MFAKKSQVFLADEDVSDTSSNSCEFGNSDDPSSKANFLSLPEVEARVSKKNVLIRILCEK  184

Query  620   QKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
             +K ++  IF E+EKL+L+++ SS   FGS  LD TI+ EME EF++ +K +A+ LR
Sbjct  185   EKTVLVNIFREIEKLHLSIIYSSALSFGSSVLDTTIVAEMEDEFNMGVKELARNLR  240



>ref|XP_003529273.1| PREDICTED: transcription factor bHLH25-like [Glycine max]
Length=327

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 136/188 (72%), Gaps = 4/188 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             KK+G+R +  +   DHI+AERKRRE LS++F+ALS +VPGL+K DK SVLGD IKYLKQ+
Sbjct  139   KKTGKRYKH-SQPQDHIIAERKRREKLSQRFIALSALVPGLQKTDKASVLGDAIKYLKQL  197

Query  824   QERVKTLEEESS-KRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNH  648
             QE+V  LEEE + K+ +ESVV VKK Q+S D ++  SS E   S +++LPEIE R C+  
Sbjct  198   QEKVNALEEEQNMKKNVESVVIVKKCQLSNDVNN--SSSEHDGSFDEALPEIEARFCERS  255

Query  647   ILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHI  468
             +L+R++C++ KG++      +EKL+L V+NS+   FG  ALDIT+I +M+ EF + +K +
Sbjct  256   VLIRVHCEKSKGVVENTIQGIEKLHLKVINSNTMTFGRCALDITVIAQMDMEFCMGVKDL  315

Query  467   AKILRSAI  444
              + LRSA 
Sbjct  316   VRNLRSAF  323



>ref|XP_003543116.2| PREDICTED: transcription factor bHLH25-like isoform X1 [Glycine 
max]
Length=376

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLG+ IKYLKQ+QE+V  LEEE +++
Sbjct  200  DHIIAERKRREKLSQRFIALSALVPGLKKMDKASVLGEAIKYLKQMQEKVSALEEEQNRK  259

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIG  603
                 V + K      D ++ SS E G++ +++LPEIE R  + ++L+RI+C++ KG+I 
Sbjct  260  RTVESVVIVKKSRLSSDAEDSSSSETGDTFDEALPEIEARFYERNVLIRIHCEKNKGVIE  319

Query  602  KIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
            K  SE+EKL+L V+NSS   FGS  LDITII +M+ EF + +K + + LRSA  +
Sbjct  320  KTISEIEKLHLKVINSSALTFGSFILDITIIAQMDMEFCMTVKDLVRSLRSAFSY  374



>ref|XP_011073850.1| PREDICTED: transcription factor bHLH25-like [Sesamum indicum]
Length=145

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -2

Query  875  MDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNS  696
            MDKTSVLGD I YLK +QERVKTLEE++  +TMES V VK+SQV+ +D+   + GE G+ 
Sbjct  1    MDKTSVLGDAITYLKHLQERVKTLEEQARMQTMESAVLVKRSQVTAEDES-CTDGESGSY  59

Query  695  DEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDIT  516
            DE  LPEIE R+C+NHILLR+ C++ KG++  + S+VEKLNLA+++++VA FGSLALDIT
Sbjct  60   DEHPLPEIEARVCNNHILLRVQCEKHKGVLVDLLSKVEKLNLAILHTNVATFGSLALDIT  119

Query  515  IIVEMEKEFDLPMKHIAKILRSAIQ  441
            II +ME+EF+L  K + K LR+A++
Sbjct  120  IIADMEREFNLTAKEVVKRLRAALR  144



>ref|XP_009411335.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
Length=334

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 140/199 (70%), Gaps = 7/199 (4%)
 Frame = -2

Query  1025  DTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDT  846
             + T  +  K    G   T+  +HI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD 
Sbjct  136   EATVGQGSKGVNTGTRSTYHKEHIIAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDA  195

Query  845   IKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQ----SLP  678
             IKYLKQ++E+VK LE++++KRT+ES V VKKSQ+  DDD   SS    N D Q    SL 
Sbjct  196   IKYLKQLEEKVKILEDQAAKRTVESAVLVKKSQLCADDD---SSSCDENFDGQQCGDSLQ  252

Query  677   EIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEME  498
             EIE ++ +  +L++I+C+ +KG++ K  SE+EKL+L+VVN+SV  F   +LDIT++ ++E
Sbjct  253   EIEAKMSEKAVLVKIHCENRKGVLVKALSEIEKLHLSVVNTSVIPFAGSSLDITVMAQIE  312

Query  497   KEFDLPMKHIAKILRSAIQ  441
             + FD+ +  + K L SA +
Sbjct  313   EGFDMTVTDLVKKLNSAFR  331



>ref|XP_009394296.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009394297.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
Length=324

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 135/180 (75%), Gaps = 5/180 (3%)
 Frame = -2

Query  971  HRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEES  792
            H  DHI+AERKRRE L+++F+ALS IVPGL+K DK SVLGD IKYLKQ++E+VK LEE++
Sbjct  147  HNKDHIMAERKRREKLNQRFIALSAIVPGLKKTDKASVLGDAIKYLKQLEEKVKVLEEQA  206

Query  791  SKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQ---SLPEIETRLCDNHILLRIYCDR  621
            +KRT+ES V VKKSQ+  DDD   SS ++     Q   SLPEIE ++ +  IL++I+C+ 
Sbjct  207  AKRTVESAVLVKKSQLRADDDS--SSCDENFEVRQCGDSLPEIEAKISEKAILVKIHCEN  264

Query  620  QKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            +KG++ K  SE+E+L+L+VV++SV  FG+ +LD+T++ ++E+ FD+    + K L SA +
Sbjct  265  RKGVLVKALSEIEQLHLSVVSASVMPFGTYSLDMTVMAQIEEGFDMNATDVVKKLSSAFR  324



>ref|XP_010105102.1| hypothetical protein L484_016091 [Morus notabilis]
 gb|EXC03887.1| hypothetical protein L484_016091 [Morus notabilis]
Length=380

 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             + +    R P H  DH++AER+RRE L+++++ALS +VPGL+KMDK SVLGD I Y+K +
Sbjct  189   RPAAAMSRSPLHAQDHVIAERRRREKLNQRYIALSAVVPGLKKMDKASVLGDAITYIKTL  248

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QERV  LEE+++K+T+ESVVFVK+S +S DD+   S     +S +Q LPEIE R+    +
Sbjct  249   QERVSILEEQAAKKTVESVVFVKRSHLSADDEISSSDENFDSSSDQPLPEIEARVSGKDV  308

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+RI+C++QKG +  I  E+EKL+L +VNSSV  FG     ITI+ +M+ E+ +  K + 
Sbjct  309   LIRIHCEKQKGCLSNILCEIEKLHLTIVNSSVLPFGGSTTHITIVAQMDVEYSMNAKDLV  368

Query  464   KILRSAI  444
             + +R A+
Sbjct  369   RNIRQAL  375



>ref|XP_010026567.1| PREDICTED: transcription factor NAI1-like [Eucalyptus grandis]
Length=304

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K+ G   RP  H  +H++AERKRR+ LS+ F+ALS I+PGL+KMDK S+LGD IKY KQ+
Sbjct  115   KRVGAMSRPTVHTQEHVIAERKRRQKLSQSFIALSAIIPGLKKMDKASILGDAIKYTKQL  174

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QERVK LE E + +T+ESVV VKKSQVS + D+ + +    N  EQ LPE+E R+ D ++
Sbjct  175   QERVKKLEAEVANKTVESVVIVKKSQVSANYDESLDNNFY-NQFEQQLPEVEARVLDKYV  233

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L RI+ +++KG   +I SE+EKLNL+++NS+V  FGS  LD+TI+ +M   F   ++ I 
Sbjct  234   LFRIHHEKRKGYTTEILSEIEKLNLSILNSNVLPFGSSILDMTIVAQMNAGFCTKVEDIV  293

Query  464   KILRSAI  444
               LR  +
Sbjct  294   SNLRQTL  300



>ref|XP_007155780.1| hypothetical protein PHAVU_003G231100g [Phaseolus vulgaris]
 gb|ESW27774.1| hypothetical protein PHAVU_003G231100g [Phaseolus vulgaris]
Length=346

 Score =   166 bits (421),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 147/236 (62%), Gaps = 17/236 (7%)
 Frame = -2

Query  1109  NIDDVNLPELRQELLT------SNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILA  948
             + D+ N P  + E L       +  IA          T + KK+G   R   H  DHI+A
Sbjct  104   SFDNTNPPTAKVESLVKPETKVNRGIALPSKNEPKRVTQESKKTGSSARSSHHTQDHIIA  163

Query  947   ERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsv  768
             ER RRE +S+QF+ALS ++P L+KMDK SVLG+ I+Y+K+++E+VK +EE+  +++ E V
Sbjct  164   ERMRREKISQQFIALSALIPDLKKMDKVSVLGEAIRYVKELKEKVKVMEEQGKRKSQEPV  223

Query  767   vfvkksqvsFDDDDEMS-----SGEKGNSDEQ------SLPEIETRLCDNHILLRIYCDR  621
             +  KKSQV    D+++S     S E GNSD+       SLPE+E R+   ++L+RI C++
Sbjct  224   MRGKKSQVCATADEDVSDTSSNSCELGNSDDPSSKTNLSLPEVEARVSKKNVLIRILCEK  283

Query  620   QKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
             +K ++  IF E+EKL+L+V+NSS   FGS  LD TI+ EME EF + +K +A  LR
Sbjct  284   EKVVLVNIFREIEKLHLSVINSSALSFGSSVLDTTIVAEMEDEFKMSVKELAGNLR  339



>ref|XP_002262815.3| PREDICTED: transcription factor NAI1 [Vitis vinifera]
Length=326

 Score =   166 bits (420),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 133/211 (63%), Gaps = 4/211 (2%)
 Frame = -2

Query  1076  QELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALST  897
             + L++ ++  +Q+  P   T  +  KS    R P+   +H++AERKRRE L+ QF+ALS 
Sbjct  116   ESLISQDSYQKQDHSP---TYGQGTKSLSSTRNPSQNQEHVIAERKRREKLNLQFIALSA  172

Query  896   IVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMS  717
             I+PGL+K DK SVLGD +KY+KQ+QERVK LEE+++K+ +E  V   K     DD+  +S
Sbjct  173   IIPGLKKTDKASVLGDAVKYVKQLQERVKMLEEQTTKKMVE-SVVTVKKYQLSDDETSLS  231

Query  716   SGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFG  537
               +  +S  Q L EIE R+ +  +L+RI+C ++KG   KI  EVEKL+L V+NSS   FG
Sbjct  232   YHDSDSSSNQPLLEIEARVSNKDVLIRIHCQKEKGFAVKILGEVEKLHLTVINSSFTAFG  291

Query  536   SLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
                +DITI+ +M+  F    K + K LR A 
Sbjct  292   DYIMDITIVAQMDNGFCTTAKDLVKNLRLAF  322



>ref|XP_003549988.1| PREDICTED: transcription factor bHLH18-like [Glycine max]
Length=341

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 148/237 (62%), Gaps = 18/237 (8%)
 Frame = -2

Query  1109  NIDDVNLPELRQE--------LLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHI  954
             + D+ N P +  E        +L    +   + EP    T + KK G       H  DHI
Sbjct  98    SFDNTNPPPVTVESASKPGTKVLNLEKVLPSKNEPRRVVTQQNKKMGSFAGSSHHTQDHI  157

Query  953   LAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTME  774
             +AER RRE +S++ +ALS ++P L+KMDK SVLG+ I+Y+KQ++E+VK LEE+S ++  E
Sbjct  158   IAERMRREKISQKLIALSALIPDLKKMDKVSVLGEAIRYVKQLKEQVKVLEEQSKRKNEE  217

Query  773   svvfvkksqvsFDDDD----EMSSGEKGNSDE------QSLPEIETRLCDNHILLRIYCD  624
             SVVF KKSQV   D+D      +S E GNSD+       SLPE+E R+    +L+RI C+
Sbjct  218   SVVFAKKSQVFPADEDVSDTSSNSCEFGNSDDISTKATLSLPEVEARVSKKSVLIRILCE  277

Query  623   RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
             ++K ++  IF E+EKL+L+VVNSS   FGS  LD TI+ EME EF++ +K +A+ LR
Sbjct  278   KEKAVLVNIFREIEKLHLSVVNSSALSFGSSVLDTTIVAEMEDEFNMGVKELARNLR  334



>gb|KHN01701.1| Transcription factor bHLH25 [Glycine soja]
Length=319

 Score =   165 bits (418),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 138/206 (67%), Gaps = 10/206 (5%)
 Frame = -2

Query  1040  ETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTS  861
             + EP    T + KK G       H  DHI+AER RRE +S++ +ALS ++P L+KMDK S
Sbjct  107   KNEPRRVVTQQNKKMGSFAGSSHHTQDHIIAERMRREKISQKLIALSALIPDLKKMDKVS  166

Query  860   VLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDD----EMSSGEKGNSD  693
             VLG+ I+Y+KQ++E+VK LEE+S ++  ESVVF KKSQV   D+D      +S E GNSD
Sbjct  167   VLGEAIRYVKQLKEQVKLLEEQSKRKNEESVVFAKKSQVFPADEDVSDTSSNSCEFGNSD  226

Query  692   E------QSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSL  531
             +       SLPE+E R+    +L+RI C+++K ++  IF E+EKL+L+VVNSS   FGS 
Sbjct  227   DISTKATLSLPEVEARVSKKSVLIRILCEKEKAVLVNIFREIEKLHLSVVNSSALSFGSS  286

Query  530   ALDITIIVEMEKEFDLPMKHIAKILR  453
              LD TI+ EME EF++ +K +A+ LR
Sbjct  287   VLDTTIVAEMEDEFNMGVKELARNLR  312



>emb|CBI18607.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 133/211 (63%), Gaps = 4/211 (2%)
 Frame = -2

Query  1076  QELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALST  897
             + L++ ++  +Q+  P   T  +  KS    R P+   +H++AERKRRE L+ QF+ALS 
Sbjct  128   ESLISQDSYQKQDHSP---TYGQGTKSLSSTRNPSQNQEHVIAERKRREKLNLQFIALSA  184

Query  896   IVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMS  717
             I+PGL+K DK SVLGD +KY+KQ+QERVK LEE+++K+ +E  V   K     DD+  +S
Sbjct  185   IIPGLKKTDKASVLGDAVKYVKQLQERVKMLEEQTTKKMVE-SVVTVKKYQLSDDETSLS  243

Query  716   SGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFG  537
               +  +S  Q L EIE R+ +  +L+RI+C ++KG   KI  EVEKL+L V+NSS   FG
Sbjct  244   YHDSDSSSNQPLLEIEARVSNKDVLIRIHCQKEKGFAVKILGEVEKLHLTVINSSFTAFG  303

Query  536   SLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
                +DITI+ +M+  F    K + K LR A 
Sbjct  304   DYIMDITIVAQMDNGFCTTAKDLVKNLRLAF  334



>ref|XP_010026564.1| PREDICTED: uncharacterized protein LOC104416928 [Eucalyptus grandis]
Length=585

 Score =   170 bits (431),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 133/185 (72%), Gaps = 1/185 (1%)
 Frame = -2

Query  1001  KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQ  822
             ++G   RPP H   H++AERKRRE LS+ F+ALS I+PGL+KMDK S+L D I Y+KQ+Q
Sbjct  375   RTGAMSRPPMHTRKHLIAERKRREKLSQSFIALSAIIPGLKKMDKASILSDAIDYMKQLQ  434

Query  821   ERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHIL  642
             ERVK LEEE + RT+ESVV  KKSQVS   DD  S  E  N  EQ LPEIE R+ D H+L
Sbjct  435   ERVKKLEEEVAIRTVESVVIGKKSQVSA-YDDMFSLDENSNHFEQQLPEIEARVLDKHVL  493

Query  641   LRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAK  462
             LRI+ +++KG   +I  E+EKLNL+++NSSV  FGS  L++TI+ +M+ +F + ++ + K
Sbjct  494   LRIHHEKRKGRTTEILREIEKLNLSILNSSVLSFGSSILEMTIVAQMDVDFCMNIEDLVK  553

Query  461   ILRSA  447
              L ++
Sbjct  554   NLHTS  558



>ref|XP_003524708.1| PREDICTED: transcription factor bHLH18-like [Glycine max]
Length=336

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 153/236 (65%), Gaps = 17/236 (7%)
 Frame = -2

Query  1109  NIDDVNLPELRQELLT---SNAIAEQETEPADTTTIKP---KKSGRRGRPPTHRYDHILA  948
             + D++N P ++ E  +   +  +  ++  P+     +P   KK G   R   H  DHI+A
Sbjct  94    SFDNMNPPTIKVESASKPGTKVVNLEKALPSKNEPTRPQENKKMGSFARSSHHTQDHIIA  153

Query  947   ERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsv  768
             ER RRE +S+QF+ALS ++P L+KMDK S+LG+ I+Y+KQ++E+VK LEE+S ++  ESV
Sbjct  154   ERMRREKISQQFIALSALIPDLKKMDKVSLLGEAIRYVKQLKEQVKLLEEQSKRKNEESV  213

Query  767   vfvkksqvsFDDDD----EMSSGEKGNSDEQ-------SLPEIETRLCDNHILLRIYCDR  621
             +F KKSQV   D+D      +S E GNSD+        SLPE+E R+   ++L+RI C++
Sbjct  214   MFAKKSQVFLADEDVSDTSSNSCEFGNSDDPSSKANFLSLPEVEARVSKKNVLIRILCEK  273

Query  620   QKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
             +K ++  IF E+EKL+L+++ SS   FGS  LD TI+ EME EF++ +K +A+ LR
Sbjct  274   EKTVLVNIFREIEKLHLSIIYSSALSFGSSVLDTTIVAEMEDEFNMGVKELARNLR  329



>ref|XP_002270448.2| PREDICTED: transcription factor bHLH18-like [Vitis vinifera]
Length=365

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 129/180 (72%), Gaps = 0/180 (0%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R  +H  DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+QERVK+L
Sbjct  182  RTSSHAQDHIMAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYLKQLQERVKSL  241

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            EE+  + T+ESVVF+KKSQ+S DD+            E ++ +IE R+ D ++L+RI+C 
Sbjct  242  EEQMKETTVESVVFIKKSQLSADDETSSCDENFDGCREDAVRDIEARVSDKNVLIRIHCK  301

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            +QKG + K+  E+E+ +L+VVNSSV  FG  A+DIT++ +M  E  + +K +   LR A 
Sbjct  302  KQKGFVAKVLGEIEEHHLSVVNSSVLPFGKHAMDITVVAQMGDELQVTVKDLVNNLRLAF  361



>emb|CAN67117.1| hypothetical protein VITISV_026466 [Vitis vinifera]
Length=365

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 129/180 (72%), Gaps = 0/180 (0%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R  +H  DHI+AERKRRE LS++F+ALS +VPGL+KMDK SVLGD IKYLKQ+QERVK+L
Sbjct  182  RTSSHAQDHIMAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYLKQLQERVKSL  241

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            EE+  + T+ESVVF+KKSQ+S DD+            E ++ +IE R+ D ++L+RI+C 
Sbjct  242  EEQMKETTVESVVFIKKSQLSADDETSSCDENFDGCREDAVRDIEARVSDKNVLIRIHCK  301

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            +QKG + K+  E+E+ +L+VVNSSV  FG  A+DIT++ +M  E  + +K +   LR A 
Sbjct  302  KQKGFVAKVLGEIEEHHLSVVNSSVLPFGKHAMDITVVAQMGDEXQVTVKDLVNNLRLAF  361



>emb|CBI38512.3| unnamed protein product [Vitis vinifera]
Length=334

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 135/190 (71%), Gaps = 3/190 (2%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             + K+     R P + +DH++AERKRRE L+++F+ALS +VPGLRK DK SVLG+ +KYLK
Sbjct  141   RTKRVSSTTRNPLNNHDHVVAERKRREKLTQRFIALSALVPGLRKTDKVSVLGEAVKYLK  200

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNS-DEQSLPEIETRLCD  654
             Q+QERVK LE +++ +TMESVV VKKSQ+   D+D  SS +  +S   Q+L EIE R+ +
Sbjct  201   QLQERVKMLEVQTATKTMESVVSVKKSQLC--DNDHSSSDQNSDSCSNQTLLEIEARVFN  258

Query  653   NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
               +L+RI+C+RQKG   KI  E+EKL+L VVNSS   FG+  + IT++ +ME EF + ++
Sbjct  259   KDVLIRIHCERQKGFTVKILDEIEKLHLTVVNSSSLPFGNYIMVITVVAQMEDEFCMTVE  318

Query  473   HIAKILRSAI  444
              + + LR A 
Sbjct  319   DLVRNLRLAF  328



>ref|XP_010691492.1| PREDICTED: transcription factor bHLH25-like [Beta vulgaris subsp. 
vulgaris]
Length=353

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 145/218 (67%), Gaps = 1/218 (0%)
 Frame = -2

Query  1094  NLPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQ  915
             N+     E++ S A  E++    +       +S +    P    DHILAER+RRE LS++
Sbjct  134   NMTYPSHEMIASQASPEKKRSQLEARPRVDNRSSKLSSIPQQSMDHILAERRRREKLSQR  193

Query  914   FLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFD  735
             F+ALS I+PGL+KMDK SVLGD IKY+KQ+QERVK LEEE+ K+ +ES VFVK+S VS +
Sbjct  194   FIALSAIIPGLKKMDKASVLGDAIKYVKQMQERVKILEEEAKKKPVESAVFVKRSYVSVE  253

Query  734   DDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNS  555
             DDD+  S EK  SD  S P+IE R  D  +L+RI+C+++KGI  KI S++E+ +L V++S
Sbjct  254   DDDDHLSPEKMFSD-GSYPDIEVRFSDKDVLIRIHCEKKKGIFEKIISQIEEFHLVVISS  312

Query  554   SVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             S   FGS AL +TII +M  EF +  K + + + + ++
Sbjct  313   SSLAFGSSALAVTIIAQMNSEFSMTSKDLVRKIHTTLR  350



>gb|AAM10937.1| putative bHLH transcription factor [Arabidopsis thaliana]
Length=304

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 142/207 (69%), Gaps = 8/207 (4%)
 Frame = -2

Query  1046  EQETEPADTTTIKPKKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLR  879
             E + +P   +    +K  +R +P     ++  DHI+AERKRRE L+++F+ALS +VPGL+
Sbjct  96    EAQVQPHQKSDEFNRKGTKRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLK  155

Query  878   KMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDE--MSSGEK  705
             KMDK SVLGD +K++K +QERV  LEE+  +R +ES+V VKKS++  DD+++   SS E 
Sbjct  156   KMDKASVLGDALKHIKYLQERVGELEEQKKERRLESMVLVKKSKLILDDNNQSFSSSCED  215

Query  704   GNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLAL  525
             G SD   LPEIE R  D  +L++I C++QKG + KI +E+EKL++ + NSSV  FG   L
Sbjct  216   GFSD-LDLPEIEVRFSDEDVLIKILCEKQKGHLAKIMAEIEKLHILITNSSVLNFGP-TL  273

Query  524   DITIIVEMEKEFDLPMKHIAKILRSAI  444
             DITII + E +FD+ +  + K LRSA+
Sbjct  274   DITIIAKKESDFDMTLMDVVKSLRSAL  300



>ref|XP_010023396.1| PREDICTED: transcription factor bHLH18-like [Eucalyptus grandis]
Length=351

 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 133/199 (67%), Gaps = 7/199 (4%)
 Frame = -2

Query  1025  DTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDT  846
             D    K K +    R P H  +H+LAERKRRE +S +F+ALS ++P L KMDK S+L D 
Sbjct  151   DCEGPKMKSASPMSRTPAHAQEHVLAERKRREKISERFIALSAVIPNLSKMDKASILEDA  210

Query  845   IKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQ-----SL  681
             IKYLK++Q+RVK LEEE + +T+ESV+ VKKS+++  D+  MSS   GNS  Q     SL
Sbjct  211   IKYLKELQQRVKALEEEVATKTVESVIVVKKSELAAADN--MSSLSDGNSCNQIDQQLSL  268

Query  680   PEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEM  501
             PEIE R+    +L++I+C+++ G I K+  E+EKLNL V NS V  FGS  LD+TI+ +M
Sbjct  269   PEIEARVSGKCVLIKIHCEKRNGFISKLIGEIEKLNLTVENSCVMPFGSSFLDVTILAQM  328

Query  500   EKEFDLPMKHIAKILRSAI  444
             +  F L ++ + K LR A+
Sbjct  329   DVGFSLNVRDLVKNLRQAL  347



>ref|XP_002262764.1| PREDICTED: transcription factor bHLH18-like [Vitis vinifera]
 ref|XP_010647474.1| PREDICTED: transcription factor bHLH18-like [Vitis vinifera]
Length=358

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 135/190 (71%), Gaps = 3/190 (2%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             + K+     R P + +DH++AERKRRE L+++F+ALS +VPGLRK DK SVLG+ +KYLK
Sbjct  165   RTKRVSSTTRNPLNNHDHVVAERKRREKLTQRFIALSALVPGLRKTDKVSVLGEAVKYLK  224

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNS-DEQSLPEIETRLCD  654
             Q+QERVK LE +++ +TMESVV VKKSQ+   D+D  SS +  +S   Q+L EIE R+ +
Sbjct  225   QLQERVKMLEVQTATKTMESVVSVKKSQLC--DNDHSSSDQNSDSCSNQTLLEIEARVFN  282

Query  653   NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
               +L+RI+C+RQKG   KI  E+EKL+L VVNSS   FG+  + IT++ +ME EF + ++
Sbjct  283   KDVLIRIHCERQKGFTVKILDEIEKLHLTVVNSSSLPFGNYIMVITVVAQMEDEFCMTVE  342

Query  473   HIAKILRSAI  444
              + + LR A 
Sbjct  343   DLVRNLRLAF  352



>ref|NP_001147789.1| symbiotic ammonium transporter [Zea mays]
 gb|ACG28714.1| symbiotic ammonium transporter [Zea mays]
Length=359

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 131/184 (71%), Gaps = 2/184 (1%)
 Frame = -2

Query  986  GRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKT  807
             RP +   DHILAERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+Q++VK 
Sbjct  173  ARPASQNQDHILAERKRREKLSQRFIALSKIVPGLKKMDKASVLGDAIKYVKQLQDQVKG  232

Query  806  LEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS--LPEIETRLCDNHILLRI  633
            LE+++ +R +E+ V VKKSQ+S DDD+  S  E   + E S  LPEIE R+ D  +L+RI
Sbjct  233  LEDDARRRPVEAAVLVKKSQLSADDDEGSSCDENFVATEASGTLPEIEARVSDRTVLVRI  292

Query  632  YCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
            +C+ +KG++    SEVE+L L+++N++V  F + +LDITI+     +F L +K I K L 
Sbjct  293  HCENRKGVLIAALSEVERLGLSIMNTNVLPFTASSLDITIMAMAGDDFCLSVKDIVKKLN  352

Query  452  SAIQ  441
             A +
Sbjct  353  QAFK  356



>ref|NP_195498.3| transcription factor bHLH25 [Arabidopsis thaliana]
 sp|Q9T072.2|BH025_ARATH RecName: Full=Transcription factor bHLH25; AltName: Full=Basic 
helix-loop-helix protein 25; Short=AtbHLH25; Short=bHLH 25; 
AltName: Full=Transcription factor EN 29; AltName: Full=bHLH 
transcription factor bHLH025 [Arabidopsis thaliana]
 gb|AEE86845.1| transcription factor bHLH25 [Arabidopsis thaliana]
Length=328

 Score =   163 bits (413),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 142/207 (69%), Gaps = 8/207 (4%)
 Frame = -2

Query  1046  EQETEPADTTTIKPKKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLR  879
             E + +P   +    +K  +R +P     ++  DHI+AERKRRE L+++F+ALS +VPGL+
Sbjct  120   EAQVQPHQKSDEFNRKGTKRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLK  179

Query  878   KMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDE--MSSGEK  705
             KMDK SVLGD +K++K +QERV  LEE+  +R +ES+V VKKS++  DD+++   SS E 
Sbjct  180   KMDKASVLGDALKHIKYLQERVGELEEQKKERRLESMVLVKKSKLILDDNNQSFSSSCED  239

Query  704   GNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLAL  525
             G SD   LPEIE R  D  +L++I C++QKG + KI +E+EKL++ + NSSV  FG   L
Sbjct  240   GFSD-LDLPEIEVRFSDEDVLIKILCEKQKGHLAKIMAEIEKLHILITNSSVLNFGP-TL  297

Query  524   DITIIVEMEKEFDLPMKHIAKILRSAI  444
             DITII + E +FD+ +  + K LRSA+
Sbjct  298   DITIIAKKESDFDMTLMDVVKSLRSAL  324



>ref|XP_007159189.1| hypothetical protein PHAVU_002G216700g [Phaseolus vulgaris]
 gb|ESW31183.1| hypothetical protein PHAVU_002G216700g [Phaseolus vulgaris]
Length=328

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 124/190 (65%), Gaps = 7/190 (4%)
 Frame = -2

Query  1004  KKSGRRGR---PPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYL  834
             KK GRR +   PP    DHI+AERKRRE LS++F+ALS +VPGL+K DK S+LGD I YL
Sbjct  139   KKIGRRSKIYQPP----DHIIAERKRREKLSQRFIALSALVPGLQKTDKASILGDAINYL  194

Query  833   KQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCD  654
             KQ+QE+VK LEEE + +     V + K     +D +  SS   G   + ++PEI  R C+
Sbjct  195   KQLQEKVKALEEERNMKKTVESVVILKKPQLSNDGNTSSSEYDGPLFDGTIPEIAARFCE  254

Query  653   NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
              ++L+ ++C++ KG++ K   E+E L+L V NS+   FG  A+DITII +M+ EF + +K
Sbjct  255   RNVLITVHCEKTKGVVEKTIHEIENLHLKVTNSNAMTFGRCAIDITIIAQMDMEFCMEVK  314

Query  473   HIAKILRSAI  444
              + + LRSA 
Sbjct  315   DVVRNLRSAF  324



>ref|XP_010105103.1| hypothetical protein L484_016092 [Morus notabilis]
 gb|EXC03888.1| hypothetical protein L484_016092 [Morus notabilis]
Length=382

 Score =   164 bits (415),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 146/213 (69%), Gaps = 18/213 (8%)
 Frame = -2

Query  1028  ADTTTIKPKKSGRRG--RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVL  855
             A  T+IK  K       R P+H  +HI+AER+RRE LS++F+ALS I+PGL+KMDK SVL
Sbjct  166   APKTSIKGTKRSFSSMTRTPSHAQEHIMAERRRREKLSQRFIALSAILPGLKKMDKASVL  225

Query  854   GDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksq----vsFDDDDEMSSGEKGNSDEQ  687
             GD IKY+K++QER+KTLEE++ KRT+ESVVFVKKSQ     + DD    +     +SDE 
Sbjct  226   GDAIKYVKELQERMKTLEEQNKKRTVESVVFVKKSQLMISSTDDDTSSSNDSHDSHSDEV  285

Query  686   SLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIV  507
              LPEIE R+ +  +L+RI+C++QKG + K+ SE+EKL+L++VN+SV  FG+   DIT+I 
Sbjct  286   LLPEIEARVSEKDVLIRIHCEKQKGFMVKMLSEIEKLHLSIVNTSVLPFGNSTFDITVIA  345

Query  506   E------------MEKEFDLPMKHIAKILRSAI  444
             +            ME EF++ +K + K LR A+
Sbjct  346   QDEPLYKELAIKLMENEFNMTVKDLVKNLRQAL  378



>ref|XP_004981924.1| PREDICTED: transcription factor bHLH18-like [Setaria italica]
Length=351

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 137/226 (61%), Gaps = 16/226 (7%)
 Frame = -2

Query  1100  DVNLPELRQELLTSNA----IAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRR  933
             D   P   QE     +    +AE    P   TT          RP +   DHILAERKRR
Sbjct  133   DAGAPSFHQERQAKRSYDAMVAEAAKVPVPATT----------RPASQNQDHILAERKRR  182

Query  932   ELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkk  753
             E LS++F+ALS IVPGL+KMDK SVL D IKY+KQ+Q++VK LE+E+ +R +E+ V VKK
Sbjct  183   EKLSQRFIALSKIVPGLKKMDKASVLSDAIKYVKQLQDQVKGLEDEARRRPVEAAVLVKK  242

Query  752   sqvsFDDDDEMSSGEK--GNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEK  579
             SQ+S DDDD  S  E   G     +LPEIE R+ D  +L+RI+C+ +KG +    SEVE+
Sbjct  243   SQLSADDDDGSSCDENFVGAEAAGTLPEIEARVSDRTVLVRIHCENRKGALIAALSEVER  302

Query  578   LNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             L L ++N++V  F + +LDITI+     +F L  K I K L  A +
Sbjct  303   LGLTIMNTNVLPFTTSSLDITIMAMAGDDFCLSAKDIVKKLNQAFK  348



>gb|KDO78769.1| hypothetical protein CISIN_1g026436mg [Citrus sinensis]
Length=238

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 142/195 (73%), Gaps = 8/195 (4%)
 Frame = -2

Query  1007  PKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQ  828
             P++     R P+H  DH++AERKRRE L+++F+ALS +VPGL+K DK S+LGD+IKYLKQ
Sbjct  43    PRRVSSVIRDPSHAQDHVIAERKRREKLNQRFIALSALVPGLKKTDKASILGDSIKYLKQ  102

Query  827   IQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS---LPEIETRLC  657
             +QERVK LEE++SK+T+ES++ VKKSQ+ + DD+  +S    N D QS   LPEIE R+ 
Sbjct  103   LQERVKALEEQTSKKTVESMIIVKKSQMIYTDDE--TSPTDINFDAQSNQYLPEIEVRVS  160

Query  656   DNHILLRIYCDR--QKGIIGKIFSEVEKL-NLAVVNSSVARFGSLALDITIIVEMEKEFD  486
             D  +L+RI+C++   KG +  I SE+E + +L+V++ +V  FG+  +DIT++ +M+ E D
Sbjct  161   DRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVESD  220

Query  485   LPMKHIAKILRSAIQ  441
             + +K + K L+ A++
Sbjct  221   VTVKDLVKNLQPALR  235



>ref|XP_006466387.1| PREDICTED: transcription factor bHLH25-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466388.1| PREDICTED: transcription factor bHLH25-like isoform X2 [Citrus 
sinensis]
Length=362

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 144/196 (73%), Gaps = 8/196 (4%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             +P++     R P+H  DH++AERKRRE L+++F+ALS +VPGL+K DK S+LGD+IKYLK
Sbjct  166   EPRRVSSVTRGPSHAQDHVIAERKRREKLNQRFIALSALVPGLKKTDKASILGDSIKYLK  225

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS---LPEIETRL  660
             Q+QERVKTLEE++SK+T+ES++ VKKSQ+ + DD+  +S    N D QS   LPEIE R+
Sbjct  226   QLQERVKTLEEQTSKKTVESMIIVKKSQMIYTDDE--TSPTDINFDAQSNQYLPEIEVRV  283

Query  659   CDNHILLRIYCDR--QKGIIGKIFSEVEKL-NLAVVNSSVARFGSLALDITIIVEMEKEF  489
              D  +L+RI+C++   KG +  I SE+E + +L+V++ +V  FG+  +DIT++ +M+ E 
Sbjct  284   SDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVVAQMDVES  343

Query  488   DLPMKHIAKILRSAIQ  441
             D+ +K + K L+ A++
Sbjct  344   DVTVKDLVKNLQPALR  359



>gb|EPS68274.1| hypothetical protein M569_06497, partial [Genlisea aurea]
Length=175

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = -2

Query  965  YDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSK  786
            YDHI+AERK RE L + FLALSTIVPGL+K+DK+SVLGD IKY+K +QE+VK LEE ++K
Sbjct  4    YDHIIAERKCREQLGQCFLALSTIVPGLKKLDKSSVLGDAIKYMKFLQEKVKLLEEHATK  63

Query  785  RTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGII  606
            ++ ESV+ +KK+  +  D +E       + +E+SLPEIE R  ++ IL++I+C   +GI+
Sbjct  64   KSFESVILLKKNNPTPADGNEFRVS--NSPEERSLPEIEARSHNSQILIKIHCAHHRGIL  121

Query  605  GKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
              I   VEKLNL ++N+S   F  ++L +T+  EMEKEF+  +K +   +R+A+
Sbjct  122  ANIIYNVEKLNLRILNTSTTSFARISLHVTLHAEMEKEFNSTVKEVVVRIRAAL  175



>gb|EAY91717.1| hypothetical protein OsI_13359 [Oryza sativa Indica Group]
Length=359

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 126/183 (69%), Gaps = 2/183 (1%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            RP +   +HILAERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+Q++VK L
Sbjct  174  RPASQNQEHILAERKRREKLSQRFIALSKIVPGLKKMDKASVLGDAIKYVKQLQDQVKGL  233

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK--GNSDEQSLPEIETRLCDNHILLRIY  630
            EEE+ +R +E+ V VKKSQ+S DDDD  S  E   G      LPEIE R+ +  +L++I+
Sbjct  234  EEEARRRPVEAAVLVKKSQLSADDDDGSSCDENFDGGEATAGLPEIEARVSERTVLVKIH  293

Query  629  CDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRS  450
            C+ +KG +    SEVE + L ++N++V  F S +LDITI+    + F L +K I K L  
Sbjct  294  CENRKGALITALSEVETIGLTIMNTNVLPFTSSSLDITIMATAGENFSLSVKDIVKKLNQ  353

Query  449  AIQ  441
            A +
Sbjct  354  AFK  356



>ref|XP_010943830.1| PREDICTED: transcription factor bHLH18-like [Elaeis guineensis]
Length=317

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = -2

Query  974  THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEE  795
            +  ++HI+AERKRRE LS++F+ALS ++PGL+K DK SVLGD +KY+K+++ RVK LE++
Sbjct  143  SQAHEHIIAERKRREKLSQRFIALSAVIPGLKKKDKASVLGDAVKYVKELEARVKNLEDQ  202

Query  794  SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQK  615
            ++KRT+ESVV VKKS++S D D    S   G S E+ LPEIE  L +  +L+RI+CD  K
Sbjct  203  NAKRTVESVVLVKKSKLSADAD---GSSSNGCSAEKPLPEIEAMLSEKTVLVRIHCDNHK  259

Query  614  GIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            G++G++ SE+EK++L V N+SV  F S ++ IT+  ++E+EF + +  + + L SA+
Sbjct  260  GVLGRLVSEIEKVHLTVTNASVMPFPSSSIHITLTAKVEEEFSMAVGDLVRKLHSAL  316



>ref|NP_001132631.2| putative HLH DNA-binding domain superfamily protein [Zea mays]
 ref|XP_008660704.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 ref|XP_008660752.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 gb|ACF81557.2| unknown [Zea mays]
 tpg|DAA51106.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04354.1| bHLH transcription factor, partial [Zea mays]
Length=364

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            RP +   DHILAERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+Q++VK L
Sbjct  179  RPASQNQDHILAERKRREKLSQRFIALSKIVPGLKKMDKASVLGDAIKYVKQLQDQVKGL  238

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS--LPEIETRLCDNHILLRIY  630
            E+++ +R +E+ V VKKSQ+S DDD+  S  E   + E S  LPEIE R+ D  +L+RI+
Sbjct  239  EDDARRRPVEAAVLVKKSQLSADDDEGSSCDENFVATEASGTLPEIEARVSDRTVLVRIH  298

Query  629  CDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRS  450
            C+ +KG++    SEVE+L L+++N++V  F + +LDITI+     +F   +K I K L  
Sbjct  299  CENRKGVLIAALSEVERLGLSIMNTNVLPFTASSLDITIMAMAGDDFCWSVKDIVKKLNQ  358

Query  449  AIQ  441
            A +
Sbjct  359  AFK  361



>ref|XP_009136241.1| PREDICTED: transcription factor bHLH25-like [Brassica rapa]
Length=282

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 139/198 (70%), Gaps = 11/198 (6%)
 Frame = -2

Query  1034  EPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVL  855
             +P    T+  +++  RG   +   DHI+AERKRRE LS++F+ALSTIVPGL+K DK SVL
Sbjct  88    QPKKEPTLLAQRNVSRG--VSQARDHIMAERKRREKLSQRFIALSTIVPGLKKTDKASVL  145

Query  854   GDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPE  675
             G TIKYLK +Q+RV+ LEE++S+RT+ESVV++ KS++S  D +          +  +LPE
Sbjct  146   GGTIKYLKHLQDRVRFLEEQASQRTIESVVYLNKSRLSVADTE---------LECMALPE  196

Query  674   IETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEK  495
             IE R    ++L+R++C+R+KG++    +E+EKL L V+NSSV  FGS +L +TII +M +
Sbjct  197   IEARSSGKNVLIRVHCERRKGVVEITMAEIEKLKLTVINSSVVTFGSSSLHLTIISQMGE  256

Query  494   EFDLPMKHIAKILRSAIQ  441
              F++  K +A  ++S+++
Sbjct  257   GFNITTKDVATSIKSSLE  274



>emb|CDX69336.1| BnaC01g01170D [Brassica napus]
Length=338

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 132/193 (68%), Gaps = 7/193 (4%)
 Frame = -2

Query  1004  KKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKY  837
             +K  +R +P     T+  DHI+AERKRRE L+++F+ALS +VPGL+KMDK SVLGD +K+
Sbjct  143   RKGTKRAQPLYRNQTNAQDHIMAERKRREKLTQRFVALSALVPGLKKMDKASVLGDALKH  202

Query  836   LKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS--LPEIETR  663
             +K +QERV  LEE+  ++ +ESVV V KS++  DD+++ SS            LPEIE R
Sbjct  203   IKYLQERVGELEEQKREKRLESVVLVNKSKLILDDNNQSSSSSCCEDGSSGLELPEIEVR  262

Query  662   LCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDL  483
               DN +L++I C++QKG + KI +E+EK N ++ NSSV  FG   LDITII + E +FD+
Sbjct  263   FSDNDVLIKILCEKQKGHVAKIMAEIEKFNFSITNSSVLPFGP-TLDITIIAKKENDFDM  321

Query  482   PMKHIAKILRSAI  444
              +  + K LRSA+
Sbjct  322   TLMDVVKSLRSAL  334



>ref|XP_003593344.1| Transcription factor bHLH25 [Medicago truncatula]
Length=338

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 129/174 (74%), Gaps = 2/174 (1%)
 Frame = -2

Query  965  YDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-  789
            +DHI+ ERKRRE LS++F+ALS +VP L+KMDK SVLG+ I+YLKQ++E+V  LEEE   
Sbjct  161  HDHIVTERKRREKLSQRFIALSALVPNLKKMDKASVLGEAIRYLKQMEEKVSVLEEEQKR  220

Query  788  KRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGI  609
            K+T+ESVV VKKSQ+S ++ ++ +       DE +LPEIE R C+  +L+R++C + +G+
Sbjct  221  KKTVESVVIVKKSQLSMNEAEDRADTNNSTYDE-TLPEIEARFCERSVLIRLHCLKSQGV  279

Query  608  IGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
            I KI SE+EKL+L V+NSS   FG+  LDITII +M+  F + +K + + +RSA
Sbjct  280  IEKIMSEIEKLHLKVINSSSLTFGNFTLDITIIAQMDVGFCMTVKDLVRKIRSA  333



>ref|XP_010943849.1| PREDICTED: transcription factor bHLH18-like [Elaeis guineensis]
Length=317

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 141/208 (68%), Gaps = 7/208 (3%)
 Frame = -2

Query  1067  LTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVP  888
             L SNA A+      +T   +  K  + G   +   +HI+AERKRRE LSR+F+ LS ++P
Sbjct  116   LVSNASAQN----YETLARQGSKMRKMGSTLSQAQEHIIAERKRREKLSRRFIELSAVIP  171

Query  887   GLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGE  708
             GL+K+DK SVLGD +KY+K+++ RVKTLE++++KRT+ESVV VKKS++S D D    S  
Sbjct  172   GLKKVDKASVLGDAVKYVKELEARVKTLEDQNAKRTVESVVLVKKSKLSADAD---GSSS  228

Query  707   KGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLA  528
              G S E+ LPEIE  L +  +L+RI+CD  +G++ ++ SE+EK +L V N+SV  F S +
Sbjct  229   NGCSAEKPLPEIEAMLSEKTVLIRIHCDNHRGVLARLVSEIEKAHLTVTNASVMPFPSSS  288

Query  527   LDITIIVEMEKEFDLPMKHIAKILRSAI  444
             + IT+  ++++EF + M  + + L SA+
Sbjct  289   IHITVTAKVQEEFSVEMGDLVRKLNSAL  316



>ref|XP_006573686.1| PREDICTED: transcription factor bHLH25-like isoform X1 [Glycine 
max]
Length=368

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 139/217 (64%), Gaps = 13/217 (6%)
 Frame = -2

Query  1097  VNLPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSR  918
             V+LP  R+ L + N   E E+           K  R  + P+H  DHI+AERKRRE LS+
Sbjct  159   VSLPHTRKRL-SENQNFEAES----------PKGHRSYKSPSHVRDHIIAERKRREKLSQ  207

Query  917   QFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsF  738
               +AL+ ++PGL+KMDK SVLGD IKY+K++QER++ LEEE   R +ESVV VKK ++S 
Sbjct  208   SLIALAALIPGLKKMDKASVLGDAIKYVKELQERMRMLEEEDKNRDVESVVMVKKQRLSC  267

Query  737   DDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVN  558
              DD   S  ++ NS+   LP +E R+ +  +LLRI+C +QKG++  I  E++ L+L VVN
Sbjct  268   CDDGSASHEDEENSER--LPRVEARVLEKDVLLRIHCQKQKGLLLNILVEIQNLHLFVVN  325

Query  557   SSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
             SSV  FG   LDITI+ +M   ++L +  + K LR A
Sbjct  326   SSVLPFGDSVLDITIVAQMGTGYNLTINDLVKNLRVA  362



>gb|KHN42604.1| Transcription factor bHLH25 [Glycine soja]
Length=365

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 139/217 (64%), Gaps = 13/217 (6%)
 Frame = -2

Query  1097  VNLPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSR  918
             V+LP  R+ L + N   E E+           K  R  + P+H  DHI+AERKRRE LS+
Sbjct  156   VSLPHTRKRL-SENQNFEAES----------PKGHRSYKSPSHVRDHIIAERKRREKLSQ  204

Query  917   QFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsF  738
               +AL+ ++PGL+KMDK SVLGD IKY+K++QER++ LEEE   R +ESVV VKK ++S 
Sbjct  205   SLIALAALIPGLKKMDKASVLGDAIKYVKELQERMRMLEEEDKNRDVESVVMVKKQRLSC  264

Query  737   DDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVN  558
              DD   S  ++ NS+   LP +E R+ +  +LLRI+C +QKG++  I  E++ L+L VVN
Sbjct  265   CDDGSASHEDEENSER--LPRVEARVLEKDVLLRIHCQKQKGLLLNILVEIQNLHLFVVN  322

Query  557   SSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
             SSV  FG   LDITI+ +M   ++L +  + K LR A
Sbjct  323   SSVLPFGDSVLDITIVAQMGTGYNLTINDLVKNLRVA  359



>ref|XP_006573687.1| PREDICTED: transcription factor bHLH25-like isoform X2 [Glycine 
max]
Length=365

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 139/217 (64%), Gaps = 13/217 (6%)
 Frame = -2

Query  1097  VNLPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSR  918
             V+LP  R+ L + N   E E+           K  R  + P+H  DHI+AERKRRE LS+
Sbjct  156   VSLPHTRKRL-SENQNFEAES----------PKGHRSYKSPSHVRDHIIAERKRREKLSQ  204

Query  917   QFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsF  738
               +AL+ ++PGL+KMDK SVLGD IKY+K++QER++ LEEE   R +ESVV VKK ++S 
Sbjct  205   SLIALAALIPGLKKMDKASVLGDAIKYVKELQERMRMLEEEDKNRDVESVVMVKKQRLSC  264

Query  737   DDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVN  558
              DD   S  ++ NS+   LP +E R+ +  +LLRI+C +QKG++  I  E++ L+L VVN
Sbjct  265   CDDGSASHEDEENSER--LPRVEARVLEKDVLLRIHCQKQKGLLLNILVEIQNLHLFVVN  322

Query  557   SSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
             SSV  FG   LDITI+ +M   ++L +  + K LR A
Sbjct  323   SSVLPFGDSVLDITIVAQMGTGYNLTINDLVKNLRVA  359



>gb|EEE59844.1| hypothetical protein OsJ_12417 [Oryza sativa Japonica Group]
Length=201

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 123/176 (70%), Gaps = 2/176 (1%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            +HILAERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+Q++VK LEEE+ +R
Sbjct  23   EHILAERKRREKLSQRFIALSKIVPGLKKMDKASVLGDAIKYVKQLQDQVKGLEEEARRR  82

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEK--GNSDEQSLPEIETRLCDNHILLRIYCDRQKGI  609
             +E+ V VKKSQ+S DDDD  S  E   G      LPEIE R+ +  +L++I+C+ +KG 
Sbjct  83   PVEAAVLVKKSQLSADDDDGSSCDENFDGGEATAGLPEIEARVSERTVLVKIHCENRKGA  142

Query  608  IGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            +    SEVE + L ++N++V  F S +LDITI+    + F L +K I K L  A +
Sbjct  143  LITALSEVETIGLTIMNTNVLPFTSSSLDITIMATAGENFSLSVKDIVKKLNQAFK  198



>emb|CDX93135.1| BnaA03g38570D [Brassica napus]
Length=267

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 129/174 (74%), Gaps = 9/174 (5%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AER+RRE LS++F+ALSTIVPGL+K DK SVLG TIKYLK +Q+RV+ LEE++S+R
Sbjct  95   DHIMAERRRREKLSQRFIALSTIVPGLKKTDKASVLGGTIKYLKHLQDRVRFLEEQASQR  154

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIG  603
            T+ESVV++ KS++S  D +          +  +LPEIE R    ++L+R++C+R+KG++ 
Sbjct  155  TIESVVYLNKSRLSVADTE---------LERIALPEIEARSSGKNVLIRVHCERRKGVVE  205

Query  602  KIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
               +E+EKL L V+NSSV  FGS +L +TII +M + F++  K +A  ++S+++
Sbjct  206  ITMAEIEKLKLTVINSSVITFGSSSLHLTIISQMGEGFNITTKDVATSIKSSLE  259



>emb|CBI18608.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 131/180 (73%), Gaps = 7/180 (4%)
 Frame = -2

Query  974  THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEE  795
            T+ +DH++AERKRR  L+++F+ALS +VPGLRKMDK SVLGD  KYLKQ+QERV+ LEE+
Sbjct  169  TNNHDHVIAERKRRGKLTQRFIALSALVPGLRKMDKISVLGDAAKYLKQLQERVQKLEEQ  228

Query  794  SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD---EQSLPEIETRLCDNHILLRIYCD  624
            ++ +TMESVVFVKKSQ+    DDE+SS ++ NSD    Q+L EIE R+ +  +L+RI+C+
Sbjct  229  TATKTMESVVFVKKSQLC---DDELSSSDQ-NSDSCSNQTLLEIEARVSNKDVLIRIHCE  284

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            RQKG   KI  E+EKL+L VV+ S   FG   +  T++  ME +F + +K + + LR A 
Sbjct  285  RQKGFTAKILDEIEKLHLTVVHCSSLPFGDYIMVTTVVARMEDKFCMTVKDLVRNLRLAF  344



>ref|XP_002262843.2| PREDICTED: transcription factor bHLH18-like [Vitis vinifera]
 ref|XP_010652694.1| PREDICTED: transcription factor bHLH18-like [Vitis vinifera]
 ref|XP_010652695.1| PREDICTED: transcription factor bHLH18-like [Vitis vinifera]
Length=351

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 131/180 (73%), Gaps = 7/180 (4%)
 Frame = -2

Query  974  THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEE  795
            T+ +DH++AERKRR  L+++F+ALS +VPGLRKMDK SVLGD  KYLKQ+QERV+ LEE+
Sbjct  170  TNNHDHVIAERKRRGKLTQRFIALSALVPGLRKMDKISVLGDAAKYLKQLQERVQKLEEQ  229

Query  794  SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD---EQSLPEIETRLCDNHILLRIYCD  624
            ++ +TMESVVFVKKSQ+    DDE+SS ++ NSD    Q+L EIE R+ +  +L+RI+C+
Sbjct  230  TATKTMESVVFVKKSQLC---DDELSSSDQ-NSDSCSNQTLLEIEARVSNKDVLIRIHCE  285

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            RQKG   KI  E+EKL+L VV+ S   FG   +  T++  ME +F + +K + + LR A 
Sbjct  286  RQKGFTAKILDEIEKLHLTVVHCSSLPFGDYIMVTTVVARMEDKFCMTVKDLVRNLRLAF  345



>gb|AES63595.2| symbiotic ammonium transporter [Medicago truncatula]
Length=353

 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 129/174 (74%), Gaps = 2/174 (1%)
 Frame = -2

Query  965  YDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-  789
            +DHI+ ERKRRE LS++F+ALS +VP L+KMDK SVLG+ I+YLKQ++E+V  LEEE   
Sbjct  176  HDHIVTERKRREKLSQRFIALSALVPNLKKMDKASVLGEAIRYLKQMEEKVSVLEEEQKR  235

Query  788  KRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGI  609
            K+T+ESVV VKKSQ+S ++ ++ +       DE +LPEIE R C+  +L+R++C + +G+
Sbjct  236  KKTVESVVIVKKSQLSMNEAEDRADTNNSTYDE-TLPEIEARFCERSVLIRLHCLKSQGV  294

Query  608  IGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
            I KI SE+EKL+L V+NSS   FG+  LDITII +M+  F + +K + + +RSA
Sbjct  295  IEKIMSEIEKLHLKVINSSSLTFGNFTLDITIIAQMDVGFCMTVKDLVRKIRSA  348



>gb|ACU24264.1| unknown [Glycine max]
Length=222

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 128/203 (63%), Gaps = 9/203 (4%)
 Frame = -2

Query  1031  PADTTTIKPK------KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMD  870
             P  T    PK      K+    R P H  DHI+AERKRRE LS+ F+AL+ +VPGL+KMD
Sbjct  15    PTQTPKGSPKYQNFETKTSHAKRSPAHAQDHIMAERKRREKLSQSFIALAALVPGLKKMD  74

Query  869   KTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD-  693
             K SVLGD I+Y+K+++ER+  LEE+ SK+T    + V        D+D  S  E  ++D 
Sbjct  75    KASVLGDAIEYVKELKERLTVLEEQ-SKKTRAESIVVLNKPDLSGDNDSSSCDESIDADS  133

Query  692   -EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDIT  516
                SL E+E+R+    +LL+I+C +Q+G++ K+ +E++  +L V NSSV  FG+  LDIT
Sbjct  134   VSDSLFEVESRVSGKEMLLKIHCQKQRGLLVKLLAEIQSNHLFVANSSVLPFGNSILDIT  193

Query  515   IIVEMEKEFDLPMKHIAKILRSA  447
             I+ +M + ++L  K +AK LR A
Sbjct  194   IVAQMGESYNLTTKELAKNLRVA  216



>ref|NP_001148121.1| symbiotic ammonium transporter [Zea mays]
 gb|ACG29797.1| symbiotic ammonium transporter [Zea mays]
Length=340

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 126/178 (71%), Gaps = 4/178 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHILAERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+Q++VK LE+++ +R
Sbjct  160  DHILAERKRREKLSQRFIALSKIVPGLKKMDKASVLGDAIKYVKQLQDQVKGLEDDARRR  219

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS----LPEIETRLCDNHILLRIYCDRQK  615
             +E+ V VKKSQ+S DDD+  S  +     E +    LPEIE RL D  +L+R++CD +K
Sbjct  220  PVEAAVLVKKSQLSADDDEGSSCDDNSVGAEAASATLLPEIEARLSDRTVLVRVHCDNRK  279

Query  614  GIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            G++    SEVE+L L+V+N++V  F + +LDITI+     +F L  K I K L  A +
Sbjct  280  GVLIAALSEVERLGLSVMNTNVLPFTASSLDITIMAMAGDDFCLSAKDIVKKLNQAFK  337



>ref|XP_006282858.1| hypothetical protein CARUB_v10006834mg [Capsella rubella]
 gb|EOA15756.1| hypothetical protein CARUB_v10006834mg [Capsella rubella]
Length=332

 Score =   158 bits (399),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 138/205 (67%), Gaps = 7/205 (3%)
 Frame = -2

Query  1040  ETEPADTTTIKPKKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKM  873
             E E       +P+K  +R +P     ++  DHI+AERKRRE L+++F+ALS +VPGL+KM
Sbjct  125   EVEVPPNRNSEPRKETKRVQPLPRSQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKM  184

Query  872   DKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGE--KGN  699
             DK SVLGD +K++K +QE+V  LEE+  +R +ES+V VKKS++  DD+++ SS    +  
Sbjct  185   DKASVLGDALKHIKYLQEKVGELEEQKKERRLESMVLVKKSKLILDDNNQSSSSSSCEDG  244

Query  698   SDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDI  519
             S+   LPEIE R  D  +L++I C++QKG I KI +E+EK   ++ NSSV  FG   LDI
Sbjct  245   SEGMDLPEIEVRFSDKDVLIKILCEKQKGHIAKIMAEIEKFRFSITNSSVLPFGP-TLDI  303

Query  518   TIIVEMEKEFDLPMKHIAKILRSAI  444
             TI+ + E +FD+ +  + K LRSA+
Sbjct  304   TIVAKKESDFDMTLMDVVKSLRSAL  328



>ref|XP_006404738.1| hypothetical protein EUTSA_v10000426mg [Eutrema salsugineum]
 gb|ESQ46191.1| hypothetical protein EUTSA_v10000426mg [Eutrema salsugineum]
Length=298

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 136/205 (66%), Gaps = 4/205 (2%)
 Frame = -2

Query  1049  AEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMD  870
             A++E    +  T + K++    R P++  DHILAERKRRE LS++F+ALS ++PGL+KMD
Sbjct  91    AKEEAGSPELITRETKRAQPLTRSPSNSQDHILAERKRREKLSQRFVALSALIPGLKKMD  150

Query  869   KTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDE-MSSGEKGNSD  693
             K SVLGD IK++K +QE VK  EE+  +RTMES+V VKKSQ   +D D+  SS   GN +
Sbjct  151   KASVLGDAIKHIKNLQESVKEFEEQKKERTMESMVLVKKSQFVLNDYDQPPSSSSDGNHE  210

Query  692   EQS--LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDI  519
               S  LPE+E R+    +L+++ CD+QKG + KI  E+EKL+L++ NS V  FG    DI
Sbjct  211   FSSLNLPEMEVRVSGKEVLIKMLCDKQKGHVIKIMDEIEKLDLSITNSIVLPFGP-TFDI  269

Query  518   TIIVEMEKEFDLPMKHIAKILRSAI  444
             TII +   +FD+ ++ + K L   +
Sbjct  270   TIIAQKNNDFDMKIEDVTKSLSCGL  294



>dbj|BAJ98794.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score =   158 bits (399),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 138/215 (64%), Gaps = 4/215 (2%)
 Frame = -2

Query  1079  RQELLTSNAIA--EQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLA  906
             +QE+  +  +A  +Q     D    +P ++    RP     DHILAERKRRE LS +F+A
Sbjct  126   KQEVDAAAVVAPFQQVKRSYDAMVAEPARAP--SRPAAQNQDHILAERKRREKLSERFIA  183

Query  905   LSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDD  726
             LS IVPGL+KMDK SVLGD IKY+K +QE+VK +EE + +R +ES V VKKSQ++ D+DD
Sbjct  184   LSKIVPGLKKMDKASVLGDAIKYVKTLQEQVKGMEEVARRRPVESAVLVKKSQLAADEDD  243

Query  725   EMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVA  546
               S  E     +  LPEIE R+ D  +L++I+C+ ++G++    SE+E ++L ++N++V 
Sbjct  244   GSSCDENFEGADAGLPEIEARMSDRTVLVKIHCENRRGVLVAALSELESMDLTIMNTNVL  303

Query  545   RFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
              F + ++DITI+    + F L +K I + L  A +
Sbjct  304   PFTTSSIDITIMATAGEHFSLSVKDIVRKLHQAFK  338



>ref|XP_006426180.1| hypothetical protein CICLE_v10027504mg [Citrus clementina]
 gb|ESR39420.1| hypothetical protein CICLE_v10027504mg [Citrus clementina]
Length=349

 Score =   158 bits (400),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 142/196 (72%), Gaps = 8/196 (4%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             +P++     R P+H  DH++AERKRRE L+++F+ALS +VPGL+K DK S+LGD+IKYLK
Sbjct  153   EPRRVSSVIRDPSHAKDHVIAERKRREKLNQRFIALSALVPGLKKTDKASILGDSIKYLK  212

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS---LPEIETRL  660
             Q+QERVK LEE++SK+T+ES++ VKKSQ+ + DD+  +S    N D QS   LPEIE R+
Sbjct  213   QLQERVKALEEQTSKKTVESMIIVKKSQMIYTDDE--TSPTDINFDAQSNQYLPEIEVRV  270

Query  659   CDNHILLRIYCDR--QKGIIGKIFSEVEKL-NLAVVNSSVARFGSLALDITIIVEMEKEF  489
              D  +L+RI+C++   KG +  I SE+E + +L+V++ +V  FG+  +DIT+  +M+ E 
Sbjct  271   SDRDVLIRIHCEKNNNKGHLANILSEIENVHHLSVLSCNVLPFGNSTVDITVAAQMDVES  330

Query  488   DLPMKHIAKILRSAIQ  441
             D+ +K + K L+ A++
Sbjct  331   DVTVKDLVKNLQPALR  346



>ref|XP_008787362.1| PREDICTED: transcription factor bHLH25-like [Phoenix dactylifera]
Length=310

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 142/195 (73%), Gaps = 1/195 (1%)
 Frame = -2

Query  1025  DTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDT  846
             +T T +  K+ + G   +   DHI+AERKRRE L ++F+ALS ++P L+K+DK SVLGD 
Sbjct  115   ETITQQVSKTTKMGPVLSQAQDHIIAERKRREKLGQRFIALSAVIPRLKKVDKASVLGDA  174

Query  845   IKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSG-EKGNSDEQSLPEIE  669
             ++Y+K+++ERVKTLE++++ RT+ES+V VKKS++S DDD   S+    G S E+SLPEIE
Sbjct  175   VEYIKELKERVKTLEDQNATRTVESMVLVKKSKLSVDDDGSSSNEFSNGCSSEESLPEIE  234

Query  668   TRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEF  489
               L +   L++I+C+ ++G++G++ SE+EK++L V N+++  F S ++ IT+  ++E EF
Sbjct  235   VMLSEKTALMKIHCENRRGVLGRLLSEIEKVHLTVTNANIMPFLSSSIFITVAAKVEGEF  294

Query  488   DLPMKHIAKILRSAI  444
              + ++ +A+ L SA+
Sbjct  295   SITLEDLARKLNSAL  309



>gb|KCW54694.1| hypothetical protein EUGRSUZ_I006341, partial [Eucalyptus grandis]
Length=151

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 110/148 (74%), Gaps = 7/148 (5%)
 Frame = -2

Query  875  MDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDD----DEMSSGE  708
            MDK SVLGD IKYLKQ+QERVK+LEE+S K+TMES VFVKK Q+S DDD    DE S G 
Sbjct  1    MDKASVLGDAIKYLKQLQERVKSLEEQSKKKTMESAVFVKKYQLSNDDDGSSCDESSDG-  59

Query  707  KGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLA  528
               S +Q+LPEIE R+ D  +L+RI+C+ QK I  +IF EVEKLNL++V S+V RFGS  
Sbjct  60   --YSADQALPEIEARVADKDVLIRIHCENQKAIAARIFGEVEKLNLSIVQSNVVRFGSST  117

Query  527  LDITIIVEMEKEFDLPMKHIAKILRSAI  444
            LDITI+ +M+  F L +K I K LRS++
Sbjct  118  LDITIVAQMDDGFSLTVKEIVKNLRSSL  145



>ref|XP_009392955.1| PREDICTED: transcription factor bHLH25-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=305

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 133/189 (70%), Gaps = 3/189 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    R  +H  +H++AERKRRE LS++F+ALS +VPGL+KMDK SVLGD I+YLK++
Sbjct  116   KRANMAARTASHNPEHVVAERKRREKLSQRFIALSAVVPGLKKMDKASVLGDAIEYLKRL  175

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             +E+VK+LE++ +KR  E  V VKKS++  DDDD  S            P+IE R+CD  +
Sbjct  176   EEQVKSLEDQVAKRQAEKAVLVKKSRLCADDDDSSSDEHPCGG---PAPQIEARVCDKAV  232

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L++I+C+ +KG++ K  SE+EKL+L+V N+SV  F + +LDIT++ +ME+EF +  K + 
Sbjct  233   LIKIHCENRKGVLVKALSEIEKLHLSVGNTSVIPFAAASLDITVMTQMEEEFCVTAKEVV  292

Query  464   KILRSAIQH  438
             K L SA + 
Sbjct  293   KKLNSAFRQ  301



>gb|AFW67754.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=341

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHILAERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+Q++VK LE+++ +R
Sbjct  162  DHILAERKRREKLSQRFIALSKIVPGLKKMDKASVLGDAIKYVKQLQDQVKGLEDDARRR  221

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS---LPEIETRLCDNHILLRIYCDRQKG  612
             +E+ V VKKSQ+S DDD+  S  +     E S   LPEIE RL    +L+R++CD +KG
Sbjct  222  PVEAAVLVKKSQLSADDDEGSSCDDNSVGAEASATLLPEIEARLSGRTVLVRVHCDNRKG  281

Query  611  IIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            ++    SEVE+L L+V+N++V  F + +LDITI+     +F L  K I K L  A +
Sbjct  282  VLIAALSEVERLGLSVMNTNVLPFTASSLDITIMAMAGDDFCLSAKDIVKKLNQAFK  338



>gb|KCW59635.1| hypothetical protein EUGRSUZ_H02385, partial [Eucalyptus grandis]
Length=219

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 120/174 (69%), Gaps = 7/174 (4%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             K K +    R P H  +H+LAERKRRE +S +F+ALS ++P L KMDK S+L D IKYLK
Sbjct  48    KMKSASPMSRTPAHAQEHVLAERKRREKISERFIALSAVIPNLSKMDKASILEDAIKYLK  107

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQ-----SLPEIET  666
             ++Q+RVK LEEE + +T+ESV+ VKKS+++  D+  MSS   GNS  Q     SLPEIE 
Sbjct  108   ELQQRVKALEEEVATKTVESVIVVKKSELAAADN--MSSLSDGNSCNQIDQQLSLPEIEA  165

Query  665   RLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             R+    +L++I+C+++ G I K+  E+EKLNL V NS V  FGS  LD+TI+ +
Sbjct  166   RVSGKCVLIKIHCEKRNGFISKLIGEIEKLNLTVENSCVMPFGSSFLDVTILAQ  219



>ref|XP_009394784.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
Length=327

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 137/208 (66%), Gaps = 19/208 (9%)
 Frame = -2

Query  1058  NAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLR  879
              A+AEQ ++     T          R   H  +HI+AERKRRE L+++F+ALS +VPGL+
Sbjct  134   GAMAEQRSKAVSNGT----------RSTYHNKEHIIAERKRREKLTQRFIALSAVVPGLK  183

Query  878   KMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGN  699
             KMDK SVLGD I YLK+++E+VK LE++++KRT+ES V VK+S++  D D         +
Sbjct  184   KMDKASVLGDAINYLKRLEEKVKMLEDQAAKRTVESAVLVKRSRLRVDVDSS-------S  236

Query  698   SDEQ--SLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLAL  525
              DE    LP+IE ++    +L++I+CD +KG++ K+ SE+EKL+L+V N+S   F   +L
Sbjct  237   RDESLDGLPQIEAKMSGKTVLVKIHCDNRKGLLVKVLSEIEKLHLSVANTSAISFVGSSL  296

Query  524   DITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             DIT++ ++E+ FD+ +K +   L SA +
Sbjct  297   DITVMAQVEEGFDMTVKDVVTQLSSAFR  324



>ref|XP_004511794.1| PREDICTED: transcription factor bHLH18-like [Cicer arietinum]
Length=352

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 133/194 (69%), Gaps = 8/194 (4%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             K KK+    R   H  DH+LAERKRRE LS+QF+ALS ++PGL+KMDK SVL D + ++K
Sbjct  150   KRKKNDSFTRSSQHNQDHVLAERKRREKLSQQFIALSALIPGLKKMDKASVLSDAVNHVK  209

Query  830   QIQERVKTLEEESSK-RTMEs-----vvfvkksqvsFDDDDEMSSGEKGN--SDEQSLPE  675
             Q+QE+VK LEE++++ + +ES         KKS    D  D  S+   GN   + +++PE
Sbjct  210   QLQEQVKVLEEKNTRFKNVESVVYVEKNKNKKSYSHEDVSDTSSNSGYGNCYHESETMPE  269

Query  674   IETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEK  495
             +E R+ + ++L+RI+C+++K ++ KI  E+E L+L+V +SS  +FG+  LDIT+I +M++
Sbjct  270   VEARVSEKNVLIRIHCEKKKEVLVKIMKEIENLHLSVTSSSTLQFGNTNLDITVIAQMDE  329

Query  494   EFDLPMKHIAKILR  453
             EF L ++ +A+ LR
Sbjct  330   EFSLSVQELARNLR  343



>gb|EMT07864.1| Transcription factor bHLH25 [Aegilops tauschii]
Length=335

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            RP     DHI+AERKRRE LS +F+ALS IVPGL+KMDK SVLGD IKY+K +QE+VK +
Sbjct  152  RPAAQNQDHIMAERKRREKLSERFIALSKIVPGLKKMDKASVLGDAIKYVKTLQEQVKGM  211

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            EE + +R +ES V VKKSQ++ ++DD  S  E     +  LPEIE R+ D  +L++I+C+
Sbjct  212  EEVARRRPVESAVLVKKSQLAAEEDDGSSCDENFEGADAGLPEIEARMSDRTVLVKIHCE  271

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
             ++G++    SE+E ++LA++N++V  F + ++DITI+    ++F L +K I + L  A 
Sbjct  272  NRRGVLVAALSELESIDLAIMNTNVLPFTASSIDITIMATAGEDFSLSVKDIVRKLHQAF  331

Query  443  Q  441
            +
Sbjct  332  K  332



>ref|NP_001051131.1| Os03g0725800 [Oryza sativa Japonica Group]
 gb|AAS07165.1| putative symbiotic ammonium transport protein [Oryza sativa Japonica 
Group]
 gb|AAT77090.1| putative transcription factor [Oryza sativa Japonica Group]
 gb|ABF98639.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13045.1| Os03g0725800 [Oryza sativa Japonica Group]
 dbj|BAH00059.1| unnamed protein product [Oryza sativa Japonica Group]
Length=359

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 123/176 (70%), Gaps = 2/176 (1%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            +HILAERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+Q++VK LEEE+ +R
Sbjct  181  EHILAERKRREKLSQRFIALSKIVPGLKKMDKASVLGDAIKYVKQLQDQVKGLEEEARRR  240

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEK--GNSDEQSLPEIETRLCDNHILLRIYCDRQKGI  609
             +E+ V VKKSQ+S DDDD  S  E   G      LPEIE R+ +  +L++I+C+ +KG 
Sbjct  241  PVEAAVLVKKSQLSADDDDGSSCDENFDGGEATAGLPEIEARVSERTVLVKIHCENRKGA  300

Query  608  IGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
            +    SEVE + L ++N++V  F S +LDITI+    + F L +K I K L  A +
Sbjct  301  LITALSEVETIGLTIMNTNVLPFTSSSLDITIMATAGENFSLSVKDIVKKLNQAFK  356



>ref|XP_009132646.1| PREDICTED: transcription factor bHLH25 [Brassica rapa]
 emb|CDX75679.1| BnaA01g00230D [Brassica napus]
Length=336

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 131/193 (68%), Gaps = 7/193 (4%)
 Frame = -2

Query  1004  KKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKY  837
             +K  +R +P     T+  DHI+AERKRRE L+++F+ALS +VPGL+KMDK SVLGD +K+
Sbjct  141   RKGTKRAQPLCRNQTNAQDHIIAERKRREKLTQRFVALSALVPGLKKMDKASVLGDALKH  200

Query  836   LKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS--LPEIETR  663
             +K +QERV   EE+  +R +ESVV VKKS++  DD+++ SS            LPEIE +
Sbjct  201   IKYLQERVGEFEEQKRERRLESVVLVKKSKLILDDNNQSSSSSCCEDGSSGLELPEIEVK  260

Query  662   LCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDL  483
               D  +L++I C++QKG + KI +E+EK N ++ NSSV  FG   LDITII + E +FD+
Sbjct  261   FSDKDVLIKILCEKQKGHVAKIMAEIEKFNFSITNSSVLPFGP-TLDITIIAKKESDFDM  319

Query  482   PMKHIAKILRSAI  444
              +  + K LRSA+
Sbjct  320   TLMDVVKSLRSAL  332



>ref|XP_009605673.1| PREDICTED: transcription factor bHLH18 [Nicotiana tomentosiformis]
 ref|XP_009605674.1| PREDICTED: transcription factor bHLH18 [Nicotiana tomentosiformis]
Length=357

 Score =   156 bits (394),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 132/189 (70%), Gaps = 2/189 (1%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             +K     R P    DH+L+ERKRRE L+++F++LST++P L+K+DK S+LGD IKY+KQ+
Sbjct  159   QKKSTYSRTPLQAQDHVLSERKRRERLTQRFISLSTLIPNLKKLDKASILGDAIKYIKQL  218

Query  824   QERVKTLEEESSKRTMEsvvfvkksq--vsFDDDDEMSSGEKGNSDEQSLPEIETRLCDN  651
             + +VK+LEEE+ K + E VV VK+++   ++D+          +S  +S+P+IE R  D 
Sbjct  219   ENQVKSLEEETKKFSEEPVVAVKRTRLLSTYDNSSSSDENSNTSSTNKSVPDIEVRAADG  278

Query  650   HILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKH  471
             ++L+RIYC +Q  II +IFS+VEK NL ++++SV  FG ++  ITI+ +M+ + ++  ++
Sbjct  279   NVLIRIYCKKQATIIKEIFSQVEKFNLTIISNSVMPFGDISTYITIVAKMDYQLNMTAEY  338

Query  470   IAKILRSAI  444
             +AK +R AI
Sbjct  339   VAKRIREAI  347



>emb|CDX89627.1| BnaC03g45410D [Brassica napus]
Length=267

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 138/198 (70%), Gaps = 11/198 (6%)
 Frame = -2

Query  1034  EPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVL  855
             +P    T+  +++  RG   +   DHI+AER+RRE LS++F+ALSTIVPGL+K DK SVL
Sbjct  73    QPKKEHTVLAQRNVSRG--VSQARDHIMAERRRREKLSQRFIALSTIVPGLKKTDKASVL  130

Query  854   GDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPE  675
             G TIKYLK +Q+RV+ LEE++S+RT+ESVV++ KS++S  D +          +  +LPE
Sbjct  131   GGTIKYLKHLQDRVRFLEEQASQRTIESVVYLNKSRLSVADTE---------LECIALPE  181

Query  674   IETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEK  495
             IE R    ++L+R++C+R+KG++    +E+EKL L V+NSSV  FGS +L +TII +M +
Sbjct  182   IEARSSGINVLIRVHCERRKGVVEITMAEIEKLKLTVINSSVITFGSSSLHLTIISQMGE  241

Query  494   EFDLPMKHIAKILRSAIQ  441
              F++  K +   ++S+++
Sbjct  242   GFNITTKDVVTSIKSSLE  259



>ref|XP_010683066.1| PREDICTED: transcription factor bHLH25-like [Beta vulgaris subsp. 
vulgaris]
Length=302

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 139/212 (66%), Gaps = 24/212 (11%)
 Frame = -2

Query  992  RRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERV  813
            +R R PT   DHI+AERKRRE+L + F++LSTI+PGL+KMDKT+VLG+ IKY+KQ+QE V
Sbjct  91   KRKRQPTQVQDHIIAERKRREILGQMFISLSTIIPGLKKMDKTTVLGEAIKYMKQLQETV  150

Query  812  KTLEEESSKRTMEsvvfvkksqvsFDD-------------DDEM------SSGEKGNSDE  690
            KTLEE ++K+ +ES+V VKKS++  +D             DD        S+ + G+  E
Sbjct  151  KTLEEVAAKKIVESIVVVKKSKLMVNDNEGGNDNASSSTVDDNCAIDMCGSTAKDGSRYE  210

Query  689  -QSL----PEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLAL  525
             Q+L    PEIET++    +L+R+ C++ KGI+ K+ +EVE  ++ V N S   F SL L
Sbjct  211  GQNLNDLKPEIETKISGQSLLIRVSCEQHKGILAKLITEVENHDMRVTNCSAVPFESLGL  270

Query  524  DITIIVEMEKEFDLPMKHIAKILRSAIQHAAQ  429
            DITI+ ++EK F   +K   + L S++Q A++
Sbjct  271  DITIVTQIEKGFTKNVKKCIRRLHSSLQLASR  302



>gb|KHN01700.1| Transcription factor bHLH25 [Glycine soja]
Length=371

 Score =   156 bits (394),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 128/203 (63%), Gaps = 9/203 (4%)
 Frame = -2

Query  1031  PADTTTIKPK------KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMD  870
             P  T    PK      K+    R P H  DHI+AERKRRE LS+ F+AL+ +VPGL+KMD
Sbjct  164   PTQTPKGSPKYQNFETKTSHAKRSPAHAQDHIMAERKRREKLSQSFIALAALVPGLKKMD  223

Query  869   KTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD-  693
             K SVLGD I+Y+K+++ER+  LEE+ SK+T    + V        D+D  S  E  ++D 
Sbjct  224   KASVLGDAIEYVKELKERLTVLEEQ-SKKTRAESIVVLNKPDLSGDNDSSSCDESIDADS  282

Query  692   -EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDIT  516
                SL E+E+R+    +LL+I+C +Q+G++ K+ +E++  +L V NSSV  FG+  LDIT
Sbjct  283   VSDSLFEVESRVSGKEMLLKIHCQKQRGLLVKLLAEIQSNHLFVANSSVLPFGNSILDIT  342

Query  515   IIVEMEKEFDLPMKHIAKILRSA  447
             I+ +M + ++L  K +AK LR A
Sbjct  343   IVAQMGESYNLTTKELAKNLRVA  365



>ref|XP_007155781.1| hypothetical protein PHAVU_003G231200g [Phaseolus vulgaris]
 gb|ESW27775.1| hypothetical protein PHAVU_003G231200g [Phaseolus vulgaris]
Length=360

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 125/183 (68%), Gaps = 4/183 (2%)
 Frame = -2

Query  986  GRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKT  807
             R PT   DH++AERKRRE LS++F+ALS +VPGL+KMDK +VL D IKY+KQ+QERVK 
Sbjct  180  ARNPTQAQDHVIAERKRREKLSQRFIALSALVPGLKKMDKATVLEDAIKYVKQLQERVKI  239

Query  806  LEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYC  627
            LEE++  +T+ES VFVK+S V   DD   SS    NS+ QSLPEIE R+    +L+R++C
Sbjct  240  LEEQTVDKTVESAVFVKRSVVFTRDD---SSYSDENSN-QSLPEIEARISGKEVLVRLHC  295

Query  626  DRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
            D+  G    I  E+EK NL V +SS   FG+  LDITI+ +M+K++ L  K + + L   
Sbjct  296  DKHSGRAAAILRELEKHNLTVQSSSFLPFGNNTLDITIVAKMDKDYCLTAKDLIRNLSQC  355

Query  446  IQH  438
            ++ 
Sbjct  356  LRQ  358



>emb|CDY49678.1| BnaC03g61210D [Brassica napus]
Length=334

 Score =   155 bits (391),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 147/246 (60%), Gaps = 14/246 (6%)
 Frame = -2

Query  1142  PLKQLKIHHHPNIDDVNLPELRQELL-------TSNAIAEQETEPADTTTIKPKKSGRRG  984
             P  +   HH P+   ++     Q ++         N+I   E E          K  +R 
Sbjct  86    PYSKPHFHHQPSSKILSFENATQNVMDYELSPTYQNSIFSPEVEAEVPPNWMNGKGAKRA  145

Query  983   RP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQER  816
             +P     ++  DHI+AERKRRE L+++F+ALS +VPGL+KMDK SVLGD  K++K +QE+
Sbjct  146   QPLYKSQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMDKASVLGDAQKHIKYLQEK  205

Query  815   VKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS--LPEIETRLCDNHIL  642
             V   EE+  +R +ES+V VKKS++  DD+++ SS      D  +  LPEIE +  D  +L
Sbjct  206   VGEFEEQKRERRLESMVLVKKSKLILDDNNQSSSSSCCEDDSSTLDLPEIEVKFSDKDVL  265

Query  641   LRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAK  462
             ++I C++QKG + KI +EVEK + ++ NSSV  FG   LDITII + E +FD+ +  + K
Sbjct  266   IKILCEKQKGHVAKIMAEVEKFHFSITNSSVLPFGP-TLDITIIAKKESDFDMTLMDVVK  324

Query  461   ILRSAI  444
              LRSA+
Sbjct  325   SLRSAL  330



>ref|XP_003549987.1| PREDICTED: transcription factor bHLH18-like [Glycine max]
Length=371

 Score =   156 bits (394),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 128/203 (63%), Gaps = 9/203 (4%)
 Frame = -2

Query  1031  PADTTTIKPK------KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMD  870
             P  T    PK      K+    R P H  DHI+AERKRRE LS+ F+AL+ +VPGL+KMD
Sbjct  164   PTQTPKGSPKYQNFETKTSHAKRSPAHAQDHIMAERKRREKLSQSFIALAALVPGLKKMD  223

Query  869   KTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD-  693
             K SVLGD I+Y+K+++ER+  LEE+ SK+T    + V        D+D  S  E  ++D 
Sbjct  224   KASVLGDAIEYVKELKERLTVLEEQ-SKKTRAESIVVLNKPDLSGDNDSSSCDESIDADS  282

Query  692   -EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDIT  516
                SL E+E+R+    +LL+I+C +Q+G++ K+ +E++  +L V NSSV  FG+  LDIT
Sbjct  283   VSDSLFEVESRVSGKEMLLKIHCQKQRGLLVKLLAEIQSNHLFVANSSVLPFGNSILDIT  342

Query  515   IIVEMEKEFDLPMKHIAKILRSA  447
             I+ +M + ++L  K +AK LR A
Sbjct  343   IVAQMGESYNLTTKELAKNLRVA  365



>ref|XP_009389452.1| PREDICTED: transcription factor bHLH25-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389453.1| PREDICTED: transcription factor bHLH25-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=279

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 166/316 (53%), Gaps = 58/316 (18%)
 Frame = -2

Query  1331  MMNLSQACFSGMGTDDLSF-------LDQFQILQSIEQEFAGVLGEDVLCssspeegspP  1173
             M  L+  C+S MG D  SF       LDQF       Q+    LG       S E  +  
Sbjct  1     MEALASPCYSDMGMDQSSFKRWELSALDQFS-----AQQLEVALGSP-----SSESYTSL  50

Query  1172  TTCHLGEDDRPLKQLKIHHHPNIDDVNLPELRQELLTSNAIAEQETEPADTTTIKPKKSG  993
              +CH      P + +    H ++ D            + A A+ + E  D   +   K  
Sbjct  51    PSCH-----PPNEIVTAAWHSDLHD-----------GAAATAKMKAEMKDVLVLDGSKRK  94

Query  992   -----RRG--RP------PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLG  852
                  R G  RP       +H  +H++AERKRRE L+++F+ALS +VPGL+KMDK SVLG
Sbjct  95    WDIMIRHGTKRPSMGNSSASHNQEHVMAERKRREKLTQRFIALSAVVPGLKKMDKASVLG  154

Query  851   DTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEI  672
             D IKYLKQ+QE+VK+LE++ +KR  ES V  K+S      D+    G         L EI
Sbjct  155   DAIKYLKQLQEKVKSLEDQVAKRNTESTVLAKRSY-----DERQRCGSL-------LVEI  202

Query  671   ETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKE  492
             E R+    IL++I+C+ QKG++ K  SE+EKL+L+V+ +S   F   +LDIT++ ++E+E
Sbjct  203   EARVFQKSILIKIHCENQKGVLVKALSEIEKLHLSVICTSAMSFAISSLDITVMTQIEEE  262

Query  491   FDLPMKHIAKILRSAI  444
             F +  K + K L SA+
Sbjct  263   FCMTAKDLVKKLNSAL  278



>ref|XP_010683065.1| PREDICTED: transcription factor bHLH18-like [Beta vulgaris subsp. 
vulgaris]
Length=326

 Score =   154 bits (390),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 135/211 (64%), Gaps = 24/211 (11%)
 Frame = -2

Query  992  RRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERV  813
            +R R PT   DHI+AERKRRE+L + F++LSTI+PGL+K DKT+VLG+ IKY+KQ+QE V
Sbjct  115  KRKRQPTQVQDHIIAERKRREILGQMFISLSTIIPGLKKTDKTTVLGEAIKYMKQLQETV  174

Query  812  KTLEEESSKRTMEsvvfvkksqvsFDDDD-----------------EM--SSGEKGNSDE  690
            KTLEE + K+ +ES+V VKKS++   DD+                 +M  SS + G+  E
Sbjct  175  KTLEEVAEKKIVESIVVVKKSKLIVSDDEGGNDNASSSTVDDNCAIDMCGSSAKDGSRYE  234

Query  689  QS-----LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLAL  525
                    PEIET++    +L+R+YC++ KGI+ K+ +EVE  ++ V N S   F SL L
Sbjct  235  AKNLNDLKPEIETKISGQTLLIRVYCEQHKGILAKLITEVENHDMRVTNCSAVPFESLGL  294

Query  524  DITIIVEMEKEFDLPMKHIAKILRSAIQHAA  432
            DITI+ ++EK F   +K   + L S++Q A+
Sbjct  295  DITIVTQIEKGFTENVKECVRRLHSSLQLAS  325



>ref|XP_003539216.1| PREDICTED: transcription factor bHLH25-like [Glycine max]
 gb|KHN13037.1| Transcription factor bHLH25 [Glycine soja]
Length=313

 Score =   154 bits (389),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 139/217 (64%), Gaps = 18/217 (8%)
 Frame = -2

Query  1097  VNLPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSR  918
             V+LP+ R+          + +E  +  T  PK   R  + P++  DHI+AERKRRE LS+
Sbjct  109   VSLPQTRK----------RSSENHNFQTESPK-GPRSYKSPSYARDHIIAERKRREKLSQ  157

Query  917   QFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsF  738
               +AL+ ++PGL+KMD+ SVLG+ IKY+K++QER++ LEEE+        V V K+++S 
Sbjct  158   SLIALAALIPGLKKMDRASVLGNAIKYVKELQERLRMLEEEN-------KVMVNKAKLSC  210

Query  737   DDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVN  558
             +DD + S+  +     + LP +E R+ +  +LLRI+C +QKG++ KI  E++K +L VV+
Sbjct  211   EDDIDGSASREDEEGSERLPRVEARVSEKDVLLRIHCQKQKGLLLKILVEIQKFHLFVVS  270

Query  557   SSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
             SSV  FG   LDITI+ +MEK ++L +  I K LR A
Sbjct  271   SSVLPFGDSILDITIVAQMEKGYNLTINDIVKNLRVA  307



>ref|XP_009396448.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
Length=341

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 131/187 (70%), Gaps = 3/187 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             +K     RPP+   DH++AERKRRE L+ QF+ALSTI+PGL+K DK ++LGD + Y++Q+
Sbjct  154   EKKSMGSRPPSSAQDHVIAERKRRERLNLQFIALSTIIPGLKKTDKATLLGDAVNYIRQL  213

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             +E+VKTLEE++S+RT+ES + VKK+ +   D    +S  +G+   ++ P+I   L  N I
Sbjct  214   EEKVKTLEEKASERTVESTILVKKTHIPTGDH---TSDAEGSPFSEAFPKITASLNGNSI  270

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+R+ C+++KG+  K+ SE+E+ +L+V+N++V  F S +L+IT+  ++E+ F +    + 
Sbjct  271   LVRVQCEKRKGLFVKVLSEIERHHLSVINTNVMPFASSSLNITVTAQIEEGFSMTTTDLV  330

Query  464   KILRSAI  444
             K + SA+
Sbjct  331   KDIDSAL  337



>ref|XP_010670988.1| PREDICTED: transcription factor bHLH18-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=299

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 142/213 (67%), Gaps = 12/213 (6%)
 Frame = -2

Query  1070  LLTSNAIAEQETEPADTTTIKPKKSG-RRGRPPTHRYDHILAERKRRELLSRQFLALSTI  894
             ++ SN   +Q  +  + T  + +  G +R R P    DHI+AERKRRELLS+ F++LST+
Sbjct  75    IMGSNVQEKQRCKNKEMTEKQAECGGTKRKRRPDQVQDHIIAERKRRELLSQMFISLSTM  134

Query  893   VPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFD----DDD  726
             VPGL+K+DKTSVLG+ I Y+K++QERVK LE  ++KRT+ES+V VKKSQ+  D    D +
Sbjct  135   VPGLKKVDKTSVLGEAITYIKKLQERVKILEGVAAKRTVESMVVVKKSQIIVDGNDGDGN  194

Query  725   EMSSGEKGNS---DEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNS  555
             E SS    N+   +  SLPEIE ++ +  +LLR++C++Q+G + K+ +E+ K  + + N 
Sbjct  195   ESSSDVDDNAASNNNGSLPEIEIKMSEKTLLLRVHCEQQRGTLRKLMAEIHKHEMNITNF  254

Query  554   SVARFGSLALDITIIVEMEKEFDLPMKHIAKIL  456
             SV  F SL L+ITI+ +MEK F    K   KIL
Sbjct  255   SVIPFESLTLEITIVAQMEKGF----KKTWKIL  283



>ref|XP_010670989.1| PREDICTED: transcription factor bHLH18-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=297

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 138/202 (68%), Gaps = 8/202 (4%)
 Frame = -2

Query  1070  LLTSNAIAEQETEPADTTTIKPKKSG-RRGRPPTHRYDHILAERKRRELLSRQFLALSTI  894
             ++ SN   +Q  +  + T  + +  G +R R P    DHI+AERKRRELLS+ F++LST+
Sbjct  73    IMGSNVQEKQRCKNKEMTEKQAECGGTKRKRRPDQVQDHIIAERKRRELLSQMFISLSTM  132

Query  893   VPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFD----DDD  726
             VPGL+K+DKTSVLG+ I Y+K++QERVK LE  ++KRT+ES+V VKKSQ+  D    D +
Sbjct  133   VPGLKKVDKTSVLGEAITYIKKLQERVKILEGVAAKRTVESMVVVKKSQIIVDGNDGDGN  192

Query  725   EMSSGEKGNS---DEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNS  555
             E SS    N+   +  SLPEIE ++ +  +LLR++C++Q+G + K+ +E+ K  + + N 
Sbjct  193   ESSSDVDDNAASNNNGSLPEIEIKMSEKTLLLRVHCEQQRGTLRKLMAEIHKHEMNITNF  252

Query  554   SVARFGSLALDITIIVEMEKEF  489
             SV  F SL L+ITI+ +MEK F
Sbjct  253   SVIPFESLTLEITIVAQMEKGF  274



>gb|KCW59637.1| hypothetical protein EUGRSUZ_H02387 [Eucalyptus grandis]
Length=349

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 138/203 (68%), Gaps = 5/203 (2%)
 Frame = -2

Query  1043  QETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKT  864
             QETE    +  K K +G   R P +  +++LAERKRRE +S+ F+ALS ++P L+KMDK 
Sbjct  145   QETE--ALSEPKMKSAGATSRKPVYTQENVLAERKRREKISKLFIALSAVIPNLKKMDKA  202

Query  863   SVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK--GNSDE  690
             S+L + I+Y K++Q+RV+ LEEE + +T+ESVV  KK +++  DD   SS EK  G+ + 
Sbjct  203   SILEEAIRYSKELQQRVEALEEEVAAKTVESVVVAKKPRLTMYDDTSSSSNEKSCGHLNR  262

Query  689   Q-SLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITI  513
             Q SLP+IE R+    +L++++C+++KG+I KI  + EKLNL VV+S V  FGS   D+TI
Sbjct  263   QLSLPDIEARISGKCVLIKVHCEKRKGLISKIIGQTEKLNLIVVSSCVLPFGSSTQDVTI  322

Query  512   IVEMEKEFDLPMKHIAKILRSAI  444
             + ++++ F L M  + + LR A+
Sbjct  323   LAQVDEGFSLKMGDLVRNLRQAL  345



>ref|XP_009354635.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
 ref|XP_009354636.1| PREDICTED: transcription factor bHLH18-like [Pyrus x bretschneideri]
Length=366

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 129/187 (69%), Gaps = 0/187 (0%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    R P    DH+LAERKRRE LS++F+ALS ++PGL+K DK SVLGD IKY+K +
Sbjct  172   KRAATVTRSPLDAQDHVLAERKRRENLSQRFIALSALLPGLKKTDKASVLGDAIKYVKHL  231

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QE  K LE++++K+T+E+VVFVK++Q S DDD   S     +   Q LPEIE R+ D  +
Sbjct  232   QELTKMLEKQAAKKTVEAVVFVKRTQYSADDDISSSDENSESCSNQPLPEIEARVSDKEV  291

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+RI+ ++ KG +  I SE+EKL+L +V+S     G+  LDIT++ +M+ EF + +K + 
Sbjct  292   LIRIHSEKTKGCLASILSEIEKLDLTIVHSCALPLGNSTLDITVVAQMDVEFSMTVKDLV  351

Query  464   KILRSAI  444
             K LR A+
Sbjct  352   KNLRQAL  358



>ref|XP_009398315.1| PREDICTED: transcription factor bHLH18-like [Musa acuminata subsp. 
malaccensis]
Length=323

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 127/175 (73%), Gaps = 2/175 (1%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            +HI+AER RRE L+++F+ALS I+PGL+K DK S+LGD ++YLK++Q RVK LE+++ +R
Sbjct  148  EHIIAERNRREKLNQKFIALSAIIPGLKKADKASILGDAVRYLKELQGRVKALEDQNMER  207

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEK--GNSDEQSLPEIETRLCDNHILLRIYCDRQKGI  609
            T+ESVV V K+Q+S DDD   SS E   G   ++  PEIE ++    +L+RI+C+ +KG+
Sbjct  208  TVESVVLVTKAQLSADDDGGSSSDENFDGQPWQKPFPEIEAKVSGKMVLVRIHCENRKGV  267

Query  608  IGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            + KI SE+E LNL + N++V  F   +++IT+  ++E++F +  K + + L+SA+
Sbjct  268  LVKILSEIEHLNLTITNTNVMPFLGSSINITVTAQIEEKFSMTAKDLVRKLKSAL  322



>gb|KHN13036.1| Transcription factor bHLH25 [Glycine soja]
Length=324

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 122/188 (65%), Gaps = 12/188 (6%)
 Frame = -2

Query  995  GRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQER  816
            G   R P    +H++AERKRRE LS++F+ALS I+PGL+KMDK SVLGD +KY+KQ+QER
Sbjct  143  GITSRNPIQAQEHVIAERKRREKLSQRFIALSAILPGLKKMDKASVLGDAVKYVKQLQER  202

Query  815  VKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD---EQSLPEIETRLCDNHI  645
            V+TLEE+++KRT  S V VK+S +  DD+         NSD   E SLPEIE R+    +
Sbjct  203  VQTLEEQAAKRTAGSRVLVKRSILFADDE---------NSDSHCEHSLPEIEVRVSGKDV  253

Query  644  LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
            L+R  CD+  G    I SE+EKL+  V +SS   FG+   D+TII +M KE  +  K + 
Sbjct  254  LIRTQCDKHSGHAAMILSELEKLHFIVQSSSFLPFGNNNTDVTIIAQMNKENCMTAKDLL  313

Query  464  KILRSAIQ  441
              LR A++
Sbjct  314  GRLRQALK  321



>gb|KCW59645.1| hypothetical protein EUGRSUZ_H02398, partial [Eucalyptus grandis]
Length=308

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 132/200 (66%), Gaps = 6/200 (3%)
 Frame = -2

Query  1025  DTTTIKPKKSGRRG---RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVL  855
             D   +K K+SG  G   R   H  +H++AERKRRE LS++F+ALS+I+PGL K+DK SVL
Sbjct  96    DGENMKMKRSGDGGTFSRTTLHGPEHVIAERKRREKLSQRFIALSSIIPGLTKLDKASVL  155

Query  854   GDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD---EQS  684
             GDTIKYLKQ++ERVK LEEE + RT+ESV+F KK  +   D     S +  + D   EQ 
Sbjct  156   GDTIKYLKQLEERVKILEEEVATRTVESVIFAKKPSLQRGDGVICFSSDGKSYDPLIEQQ  215

Query  683   LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             LPE+E ++   + L+++ C++ KG I ++  ++E +NL  +N SV  FGS  LDI I+ +
Sbjct  216   LPEVEAQVSGKNFLIKVQCEKHKGCIKELMKQMEDMNLTTLNISVLAFGSSLLDIIIMAQ  275

Query  503   MEKEFDLPMKHIAKILRSAI  444
             +E E  L ++ I + LR A+
Sbjct  276   IENENCLTLEEIVEKLRDAL  295



>ref|XP_006478068.1| PREDICTED: transcription factor bHLH25-like [Citrus sinensis]
Length=259

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 127/191 (66%), Gaps = 21/191 (11%)
 Frame = -2

Query  1010  KPKKSGR-RGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYL  834
             KP +  R   R P    +H++AERKRRE +++QF+ALS ++PG+++M+K SVL  TIK+L
Sbjct  81    KPGQGNRVASRSPLQAQEHVIAERKRREKMNQQFIALSAVIPGIKQMNKASVLEGTIKHL  140

Query  833   KQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCD  654
             K++QER K L E++ ++ +ESVV V                 KG+  +Q+LP+I  R+ D
Sbjct  141   KELQEREKKLVEQTKRKALESVVSV-----------------KGS--QQTLPDIVVRVSD  181

Query  653   NHILLRIYCDRQK-GIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPM  477
             N++L+RI+C++Q  G I  I SE+EKL+L V+NS    FG+ ALDIT++ +ME EF L +
Sbjct  182   NNVLIRIHCEKQNIGFISNIVSEIEKLHLVVINSRTIPFGNYALDITVVAQMEVEFCLTV  241

Query  476   KHIAKILRSAI  444
             K + K LR A+
Sbjct  242   KELVKNLRLAL  252



>ref|XP_010548842.1| PREDICTED: transcription factor bHLH25-like [Tarenaya hassleriana]
Length=284

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AER+RRE LS++F+ALST+VPGL+K DK SVLG++IKYLK +QE+V+ LE ++ ++
Sbjct  106  DHIIAERRRREKLSQRFIALSTLVPGLKKTDKASVLGESIKYLKHLQEKVRFLEGQAIQK  165

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIG  603
            TMESVV+V KS++S     E     +  + E+ LPEIE R    ++++RI+C+R+KG++ 
Sbjct  166  TMESVVYVSKSRLSATAGSE---DYEAVAVEEPLPEIEARFSGRNVMIRIHCERRKGVVE  222

Query  602  KIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
               +E+E++ L V+NSSV  FGS  L + II EM  +F +  K +AK ++S+++
Sbjct  223  TTSAEIERIQLTVINSSVMTFGSNFLHLIIIAEMGMDFSMTAKDVAKSIKSSLE  276



>ref|XP_010026563.1| PREDICTED: transcription factor bHLH18-like [Eucalyptus grandis]
Length=324

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 125/180 (69%), Gaps = 9/180 (5%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            RPP    DH+LAERKRRE LS+ F+ALS ++P L+K DK+SVL D IKYLK++Q  VKTL
Sbjct  153  RPP----DHMLAERKRREKLSQHFIALSAVIPNLKKRDKSSVLEDAIKYLKELQRSVKTL  208

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            EEE++ +T+ESVV V+KSQ + D +   S G++    + SLPEIE R+    +L++I+C 
Sbjct  209  EEEAAVKTVESVVMVRKSQPTMDANS-FSQGDQ----QLSLPEIEARVSGKCVLIKIHCK  263

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            ++ G   K+  E+EK+NL VVNS V  FG+  LD+TI+ +M+ E+ + M  + + LR A 
Sbjct  264  KRNGFFFKMIGEIEKMNLTVVNSCVLPFGTSILDVTILAQMDAEYSMKMGDLVRNLRRAF  323



>ref|XP_010417032.1| PREDICTED: transcription factor bHLH18-like [Camelina sativa]
Length=334

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 130/191 (68%), Gaps = 6/191 (3%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    R P++  DHILAERKRRE L+++F+ALS +VPGL+KMDK SVLGD IK++K +
Sbjct  142   KRAQTLTRSPSNAQDHILAERKRREKLTQRFVALSALVPGLKKMDKASVLGDAIKHIKYL  201

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSS----GEKGNSDEQSLPEIETRLC  657
             QE+VK  EE+  +RTMES+V VKKSQ+  D++ + SS    G +G S   +LPEIE RL 
Sbjct  202   QEKVKEYEEQKQERTMESMVLVKKSQLVLDENHQSSSSFSDGNRGCSS-SNLPEIEVRLS  260

Query  656   DNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPM  477
                +L++I C++QKG + KI  E+EKL L + NS+V  FG    DI+II +    FD+ +
Sbjct  261   GKDVLIKILCEKQKGNLIKIMGEIEKLGLLITNSNVLPFGP-TFDISIIAQRNINFDMKI  319

Query  476   KHIAKILRSAI  444
             + + K L   +
Sbjct  320   EDVVKNLSCGL  330



>ref|XP_010023398.1| PREDICTED: transcription factor bHLH18-like [Eucalyptus grandis]
Length=358

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 133/192 (69%), Gaps = 3/192 (2%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             K K +G   R P +  +++LAERKRRE +S+ F+ALS ++P L+KMDK S+L + I+Y K
Sbjct  163   KMKSAGATSRKPVYTQENVLAERKRREKISKLFIALSAVIPNLKKMDKASILEEAIRYSK  222

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK--GNSDEQ-SLPEIETRL  660
             ++Q+RV+ LEEE + +T+ESVV  KK +++  DD   SS EK  G+ + Q SLP+IE R+
Sbjct  223   ELQQRVEALEEEVAAKTVESVVVAKKPRLTMYDDTSSSSNEKSCGHLNRQLSLPDIEARI  282

Query  659   CDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLP  480
                 +L++++C+++KG+I KI  + EKLNL VV+S V  FGS   D+TI+ ++++ F L 
Sbjct  283   SGKCVLIKVHCEKRKGLISKIIGQTEKLNLIVVSSCVLPFGSSTQDVTILAQVDEGFSLK  342

Query  479   MKHIAKILRSAI  444
             M  + + LR A+
Sbjct  343   MGDLVRNLRQAL  354



>gb|EPS58430.1| hypothetical protein M569_16384, partial [Genlisea aurea]
Length=185

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 125/190 (66%), Gaps = 11/190 (6%)
 Frame = -2

Query  998  SGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQE  819
            S  R R P+  YDH+L+E+KRR+ L ++FL LS IVPGL KMDKTSVLG  IKYLK +QE
Sbjct  1    SNARLRQPSQPYDHVLSEKKRRQRLRQRFLDLSAIVPGLEKMDKTSVLGGAIKYLKYLQE  60

Query  818  RVKTLEE-----ESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCD  654
            R K LEE     ++++ T+             +D++E+SS       + SLPE+  R+ D
Sbjct  61   RAKFLEEKVTNHQNTESTVRVRQTHITVTGDGEDEEEVSS------VDSSLPEVVGRISD  114

Query  653  NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
             H+LL I+C+ QKG++  +  +VE LNL V++++V  FGSLALDITI+ ++EK F   ++
Sbjct  115  GHVLLVIHCEIQKGVLANLVKQVENLNLTVISTNVTSFGSLALDITILAQVEKGFAATIE  174

Query  473  HIAKILRSAI  444
             + +ILRS +
Sbjct  175  EVVRILRSTL  184



>ref|XP_003538782.1| PREDICTED: transcription factor bHLH25-like [Glycine max]
Length=349

 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 122/188 (65%), Gaps = 12/188 (6%)
 Frame = -2

Query  995  GRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQER  816
            G   R P    +H++AERKRRE LS++F+ALS I+PGL+KMDK SVLGD IKY+KQ+QER
Sbjct  168  GITSRNPIQAQEHVIAERKRREKLSQRFIALSAILPGLKKMDKASVLGDAIKYVKQLQER  227

Query  815  VKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD---EQSLPEIETRLCDNHI  645
            V+TLEE+++KRT  S V VK+S +  DD+         NSD   E SLPEIE R+    +
Sbjct  228  VQTLEEQAAKRTAGSRVLVKRSILFADDE---------NSDSHCEHSLPEIEVRVSGKDV  278

Query  644  LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
            L+R  CD+  G    I SE+EKL+  V +SS   FG+   D+TII +M KE  +  K + 
Sbjct  279  LIRTQCDKHSGHAAMILSELEKLHFIVQSSSFLPFGNNNTDVTIIAQMNKENCMTAKDLL  338

Query  464  KILRSAIQ  441
              LR A++
Sbjct  339  GRLRQALK  346



>ref|XP_003611493.1| BHLH transcription factor [Medicago truncatula]
 gb|AES94451.1| basic helix loop helix (bHLH) DNA-binding family protein [Medicago 
truncatula]
Length=333

 Score =   152 bits (383),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 130/215 (60%), Gaps = 11/215 (5%)
 Frame = -2

Query  1091  LPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQF  912
             LP+ R+  L    I E         TIKP+  G + R   H  DHI+AERKRRE LS+  
Sbjct  124   LPQNRKGSLQKQNIVE---------TIKPQGQGTK-RSVAHNQDHIIAERKRREKLSQCL  173

Query  911   LALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDD  732
             +AL+ ++PGL+KMDK SVLGD IKY+K++QER++ LEE+ +K +    V     Q    D
Sbjct  174   IALAALIPGLKKMDKASVLGDAIKYVKELQERLRVLEEQ-NKNSHVQSVVTVDEQQLSYD  232

Query  731   DDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSS  552
                    E  + + ++LP +E ++ D  +L+RI+C +QKG++ KI  E++KL+L VVN+S
Sbjct  233   SSNSDDSEVASGNNETLPHVEAKVLDKDVLIRIHCQKQKGLLLKILVEIQKLHLFVVNNS  292

Query  551   VARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
             V  FG   LDITI+ +M   ++L    + K LR A
Sbjct  293   VLPFGDSILDITIVAQMGIGYNLTRNDLVKKLRVA  327



>ref|XP_009109398.1| PREDICTED: transcription factor bHLH25-like [Brassica rapa]
 ref|XP_009109399.1| PREDICTED: transcription factor bHLH25-like [Brassica rapa]
Length=334

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 131/192 (68%), Gaps = 7/192 (4%)
 Frame = -2

Query  1001  KSGRRGRPP----THRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYL  834
             K  +R +P     ++  DHI+AERKRRE L+++F+ALS +VPGL+KMDK SVLGD  K++
Sbjct  140   KGTKRAQPSYKSQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMDKASVLGDAQKHI  199

Query  833   KQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS--LPEIETRL  660
             K +QE+V   EE+  +R +ES+V VKKS++  DD+++ +S      D  +  LPEIE + 
Sbjct  200   KYLQEKVGEFEEQKRERRLESMVLVKKSKLILDDNNQSTSSSCCEDDSSTLDLPEIEVKF  259

Query  659   CDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLP  480
              D  +L++I C++QKG + KI +EVEK + ++ NSSV  FG   LDITII + E +FD+ 
Sbjct  260   SDKDVLIKILCEKQKGHVAKIMAEVEKFHFSITNSSVLPFGP-TLDITIIAKKESDFDMT  318

Query  479   MKHIAKILRSAI  444
             +  + K LRSA+
Sbjct  319   LMDVVKSLRSAL  330



>emb|CDY72199.1| BnaA08g31080D [Brassica napus]
Length=334

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 131/192 (68%), Gaps = 7/192 (4%)
 Frame = -2

Query  1001  KSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYL  834
             K  +R +P     ++  DHI+AERKRRE L+++F+ALS +VPGL+KMDK SVLGD  K++
Sbjct  140   KGTKRAQPLYKSQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMDKASVLGDAQKHI  199

Query  833   KQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQS--LPEIETRL  660
             K +QE+V   EE+  +R +ES+V VKKS++  DD+++ +S      D  +  LPEIE + 
Sbjct  200   KYLQEKVGEFEEQKRERRLESMVLVKKSKLILDDNNQSTSSSCCEDDSSTLDLPEIEVKF  259

Query  659   CDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLP  480
              D  +L++I C++QKG + KI +EVEK + ++ NSSV  FG   LDITII + E +FD+ 
Sbjct  260   SDKDVLIKILCEKQKGHVAKIMAEVEKFHFSITNSSVLPFGP-TLDITIIAKKESDFDMT  318

Query  479   MKHIAKILRSAI  444
             +  + K LRSA+
Sbjct  319   LMDVVKSLRSAL  330



>gb|KHN42602.1| Transcription factor bHLH25 [Glycine soja]
Length=341

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 119/184 (65%), Gaps = 6/184 (3%)
 Frame = -2

Query  995  GRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQER  816
            G   R P    +HI+AERKRRE LS++F+ALS I+PGL+KMDK SVLGD +KY+KQ+QER
Sbjct  160  GITTRNPIQAQEHIIAERKRRENLSKRFIALSAILPGLKKMDKASVLGDAVKYVKQLQER  219

Query  815  VKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLR  636
            V+TLEE+++KRT+ S V VK+S +  DD+   S        E SLPE+E R+    +L+R
Sbjct  220  VQTLEEQAAKRTLGSGVLVKRSIIFADDETSDSHC------EHSLPEVEVRVSGKDVLIR  273

Query  635  IYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKIL  456
              CD+  G    I SE+EKL   V +SS   FG+   D+TII +M KE  +  K +   L
Sbjct  274  TQCDKHSGHAAMILSELEKLYFIVQSSSFLPFGNSKTDVTIIAQMNKENCMTAKDLLGRL  333

Query  455  RSAI  444
            R A+
Sbjct  334  RQAL  337



>ref|XP_006579969.1| PREDICTED: transcription factor bHLH25-like [Glycine max]
Length=382

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 128/202 (63%), Gaps = 7/202 (3%)
 Frame = -2

Query  1031  PADTTTIKPK------KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMD  870
             P  T    PK      K+    R P H  DHI+AERKRRE LS+ F+AL+ +VPGL+KMD
Sbjct  175   PTQTAKGSPKNQNFETKTSHGKRSPAHAQDHIMAERKRREKLSQSFIALAALVPGLKKMD  234

Query  869   KTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKG-NSD  693
             K SVLGD IKY+K+++ER+  LEE+S K   ESVV + K  +S DDD        G +S 
Sbjct  235   KASVLGDAIKYVKELKERLTVLEEQSKKSRAESVVVLNKPDLSGDDDSSSCDESIGADSV  294

Query  692   EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITI  513
               SL E+E+R+    +LLRI+C +QKG++ K+ +E++  +L V NSSV  FG   LDITI
Sbjct  295   SDSLFEVESRVSGKEMLLRIHCQKQKGLLVKLLAEIQSHHLFVANSSVLPFGDSILDITI  354

Query  512   IVEMEKEFDLPMKHIAKILRSA  447
             + +M + ++L  K + K LR A
Sbjct  355   VAQMGESYNLTTKELVKNLRVA  376



>gb|KHM99702.1| Transcription factor bHLH25 [Glycine soja]
Length=382

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 128/202 (63%), Gaps = 7/202 (3%)
 Frame = -2

Query  1031  PADTTTIKPK------KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMD  870
             P  T    PK      K+    R P H  DHI+AERKRRE LS+ F+AL+ +VPGL+KMD
Sbjct  175   PTQTAKGSPKNQNFETKTSHGKRSPAHAQDHIMAERKRREKLSQSFIALAALVPGLKKMD  234

Query  869   KTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKG-NSD  693
             K SVLGD IKY+K+++ER+  LEE+S K   ESVV + K  +S DDD        G +S 
Sbjct  235   KASVLGDAIKYVKELKERLTVLEEQSKKSRAESVVVLNKPDLSGDDDSSSCDESIGADSV  294

Query  692   EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITI  513
               SL E+E+R+    +LLRI+C +QKG++ K+ +E++  +L V NSSV  FG   LDITI
Sbjct  295   SDSLFEVESRVSGKEMLLRIHCQKQKGLLVKLLAEIQSHHLFVANSSVLPFGDSILDITI  354

Query  512   IVEMEKEFDLPMKHIAKILRSA  447
             + +M + ++L  K + K LR A
Sbjct  355   VAQMGESYNLTTKELVKNLRVA  376



>ref|XP_010026571.1| PREDICTED: transcription factor bHLH25-like [Eucalyptus grandis]
Length=281

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 129/193 (67%), Gaps = 6/193 (3%)
 Frame = -2

Query  1004  KKSGRRG---RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYL  834
             K+SG  G   R   H  +H++AERKRRE LS++F+ALS+I+PGL K+DK SVLGDTIKYL
Sbjct  2     KRSGDGGTFSRTTLHGPEHVIAERKRREKLSQRFIALSSIIPGLTKLDKASVLGDTIKYL  61

Query  833   KQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD---EQSLPEIETR  663
             KQ++ERVK LEEE + RT+ESV+F KK  +   D     S +  + D   EQ LPE+E +
Sbjct  62    KQLEERVKILEEEVATRTVESVIFAKKPSLQRGDGVICFSSDGKSYDPLIEQQLPEVEAQ  121

Query  662   LCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDL  483
             +   + L+++ C++ KG I ++  ++E +NL  +N SV  FGS  LDI I+ ++E E  L
Sbjct  122   VSGKNFLIKVQCEKHKGCIKELMKQMEDMNLTTLNISVLAFGSSLLDIIIMAQIENENCL  181

Query  482   PMKHIAKILRSAI  444
              ++ I + LR A+
Sbjct  182   TLEEIVEKLRDAL  194



>ref|XP_010943836.1| PREDICTED: transcription factor bHLH25-like [Elaeis guineensis]
Length=317

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            +HI+AERKRRE LS++F+ALS ++PGL+K+DK SVLGD +KY+K+++ RVKTLE++++KR
Sbjct  147  EHIIAERKRREKLSQRFIALSAVIPGLKKVDKASVLGDAVKYVKELEARVKTLEDQNAKR  206

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIG  603
            T+ES+V VKKS++S D D   SSG      E+ LPEIE  L +  +L+RI+CD  KG++G
Sbjct  207  TVESMVLVKKSKLSADADGSSSSGCPA---EKPLPEIEAMLSEKTVLIRIHCDNHKGVLG  263

Query  602  KIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            ++ SE+EK++L V N+SV  F S ++ IT+  ++E+EF + +  + + L SA+
Sbjct  264  RLVSEIEKVHLTVTNASVMPFPSSSIHITLTAKVEEEFSMAVGDLVRKLNSAL  316



>ref|XP_003611499.1| Transcription factor bHLH25 [Medicago truncatula]
 gb|AES94457.1| basic helix loop helix (bHLH) DNA-binding family protein [Medicago 
truncatula]
Length=334

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 120/182 (66%), Gaps = 12/182 (7%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE +S++F+ALS ++P L+KMDK SVLGD I ++KQ+QE+VK LEE++ K 
Sbjct  149  DHIIAERKRREKISQKFIALSALLPDLKKMDKASVLGDAINHVKQLQEKVKLLEEKNQKN  208

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSD------------EQSLPEIETRLCDNHILL  639
             +ESV  V   +      DE  S    NS              +SLPE+E R+ + ++L+
Sbjct  209  NVESVSMVYVEKTKSYSSDEDVSETSSNSGYGNCCHTHTSKPSRSLPEVEARVSEKNVLI  268

Query  638  RIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKI  459
            R++C++ KG +  I  E+E L+L+V +SS   FG+  LDITII EM+++F L ++ +A+ 
Sbjct  269  RVHCEKHKGALMNIIQEIENLHLSVTSSSALLFGTTKLDITIIAEMDEKFSLSVQELARK  328

Query  458  LR  453
            LR
Sbjct  329  LR  330



>ref|XP_006573684.1| PREDICTED: transcription factor bHLH25-like [Glycine max]
Length=341

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 119/184 (65%), Gaps = 6/184 (3%)
 Frame = -2

Query  995  GRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQER  816
            G   R P    +HI+AERKRRE +S++F+ALS I+PGL+KMDK SVLGD +KY+KQ+QER
Sbjct  160  GITTRNPIQAQEHIIAERKRRENISKRFIALSAILPGLKKMDKASVLGDAVKYVKQLQER  219

Query  815  VKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLR  636
            V+TLEE+++KRT+ S V VK+S +  DD+   S        E SLPE+E R+    +L+R
Sbjct  220  VQTLEEQAAKRTLGSGVLVKRSIIFADDETSDSHC------EHSLPEVEVRVSGKDVLIR  273

Query  635  IYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKIL  456
              CD+  G    I SE+EKL   V +SS   FG+   D+TII +M KE  +  K +   L
Sbjct  274  TQCDKHSGHAAMILSELEKLYFIVQSSSFLPFGNSKTDVTIIAQMNKENCMTAKDLLGRL  333

Query  455  RSAI  444
            R A+
Sbjct  334  RQAL  337



>ref|XP_010943199.1| PREDICTED: transcription factor bHLH18-like [Elaeis guineensis]
Length=320

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 142/212 (67%), Gaps = 10/212 (5%)
 Frame = -2

Query  1112  PNIDDVNLPELRQE---LLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAER  942
             PN + +  P  R++   L+ S+  +EQ  E   T T +  K+   G  P+H  DHI+AER
Sbjct  110   PNWEVIGGPVKRKDKMGLVVSHG-SEQNLE---TVTHQGSKAASLG--PSHAQDHIIAER  163

Query  941   KRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvf  762
              RRE LS++F+ LS +VPGL+K DK SVLGD +KY+K++QERVKTLE +++KRT+ESV  
Sbjct  164   HRREKLSQRFIELSAVVPGLKKKDKASVLGDAVKYVKELQERVKTLEYQTAKRTIESVTL  223

Query  761   vkksqvsFDDDDEMSSGEKGNSD-EQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEV  585
             VKKS++S DD    S+ +  +   E S+PEIE RL D  IL+RI+C+  KG++ K+ SE+
Sbjct  224   VKKSKLSVDDGGSSSNDDNNSDGLENSIPEIEARLSDKTILVRIHCENHKGVMVKVLSEI  283

Query  584   EKLNLAVVNSSVARFGSLALDITIIVEMEKEF  489
             EKL++ V ++S+  F   +++IT++ +    F
Sbjct  284   EKLHVTVTDASIMSFAGSSINITVMAQASSYF  315



>ref|XP_007155779.1| hypothetical protein PHAVU_003G231000g [Phaseolus vulgaris]
 gb|ESW27773.1| hypothetical protein PHAVU_003G231000g [Phaseolus vulgaris]
Length=380

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 119/187 (64%), Gaps = 1/187 (1%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K S    R P H  DHI+AERKRRE LS+ F+AL+ +VPGL+KMDK SVLGD IKY+K +
Sbjct  188   KPSSHAKRSPAHAQDHIMAERKRREKLSQSFIALAALVPGLKKMDKASVLGDAIKYVKDL  247

Query  824   QERVKTLEEESSK-RTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNH  648
             +ER+  LEE+S K R    VV  K      DD          +S   SL E+E+R+    
Sbjct  248   KERLAVLEEQSKKTRGESVVVLNKPDLSGDDDSSSCDESIDADSVSDSLFELESRVSGKE  307

Query  647   ILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHI  468
             +LLRI+C +QKG++ K+ +E+++ NL V+NSS+  FG   +DIT++ +M + ++L  K +
Sbjct  308   MLLRIHCRKQKGLLVKLLAEIQRNNLFVINSSILPFGDSIIDITVVAQMGENYNLTTKGL  367

Query  467   AKILRSA  447
              K LR A
Sbjct  368   VKNLRVA  374



>gb|KHN42603.1| Transcription factor bHLH25 [Glycine soja]
Length=180

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 126/172 (73%), Gaps = 10/172 (6%)
 Frame = -2

Query  938  RRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-KRTMEsvvf  762
            RRE +S+QF+ALS ++P L+KMDK SVLGD IK++KQ+QE+VK LEE++  KR +ESVV+
Sbjct  2    RREKISQQFVALSALIPDLKKMDKASVLGDAIKHVKQLQEQVKLLEEKNKRKRVVESVVY  61

Query  761  vkksqvsFDDD--DEMSSGEKGNSDE-------QSLPEIETRLCDNHILLRIYCDRQKGI  609
            VKKS++S  +D  +  S+   GNS +       +S PE+E R+ + H+L+RI+C +QKG+
Sbjct  62   VKKSKLSAAEDVFNTFSNSGDGNSYDISETKTNESFPEVEARVLEKHVLIRIHCGKQKGL  121

Query  608  IGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
               I  ++E L+L+V+NSS+  FG+  LDITI+ EM++EF L +K +A+ LR
Sbjct  122  FINILKDIENLHLSVINSSILLFGTSKLDITIVAEMDEEFSLSVKELARKLR  173



>ref|XP_008380062.1| PREDICTED: transcription factor bHLH18-like [Malus domestica]
Length=387

 Score =   150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 129/187 (69%), Gaps = 0/187 (0%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    + P    DH+LAERKRRE LS++F+ALS ++PGL+K DK SVLGD IKY+K +
Sbjct  193   KRAATVTKSPLDAQDHVLAERKRRENLSQRFIALSALLPGLKKTDKASVLGDAIKYVKHL  252

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QE  K LE++++K+T+E+VVFVK++Q S DDD   S     +   Q LPEIE R+ D  +
Sbjct  253   QELTKMLEKQAAKKTVEAVVFVKRTQYSADDDISSSDENSESCSNQPLPEIEARVSDKEV  312

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+RI+ ++ KG +  I SE+EKL+L +V+S     G+  LDIT++ +M+ EF + +K + 
Sbjct  313   LIRIHSEKTKGSLASILSEIEKLDLTIVHSCALPLGNSTLDITVVAQMDVEFRMTVKDLV  372

Query  464   KILRSAI  444
             K LR A+
Sbjct  373   KNLRQAL  379



>ref|XP_010683071.1| PREDICTED: transcription factor bHLH25-like [Beta vulgaris subsp. 
vulgaris]
Length=275

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 139/209 (67%), Gaps = 8/209 (4%)
 Frame = -2

Query  1052  IAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKM  873
             + +Q  +    TT+  +K  RR   P   ++HI+AER+RR+ LS +F+ALS ++PGL+K+
Sbjct  70    VEDQGMKHGGNTTVALRKRPRRL--PEQCHNHIIAERQRRQTLSERFIALSALIPGLKKI  127

Query  872   DKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGN--  699
             DKTSVLG  I +++Q++ER+K LEE ++K+ MES+V +K+  +  ++ +  SS    N  
Sbjct  128   DKTSVLGAAIIHMQQLKERIKILEEGNAKKQMESIVVLKQPHIILENSECNSSTCNHNLS  187

Query  698   ---SDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLA  528
                SDEQ LP+IE R  ++++L++++C+ QKGI+ KI SE+EKL L V  ++   F    
Sbjct  188   SKFSDEQ-LPDIEARFSNDNVLIKVHCEMQKGILIKIMSELEKLQLLVTTTNAMPFNGRT  246

Query  527   LDITIIVEMEKEFDLPMKHIAKILRSAIQ  441
             LDITI+ +ME +F++  + + + LRS  Q
Sbjct  247   LDITIMTQMEADFNMRPQDVVQNLRSIFQ  275



>ref|XP_006411845.1| hypothetical protein EUTSA_v10025715mg [Eutrema salsugineum]
 gb|ESQ53298.1| hypothetical protein EUTSA_v10025715mg [Eutrema salsugineum]
Length=324

 Score =   149 bits (375),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 131/207 (63%), Gaps = 9/207 (4%)
 Frame = -2

Query  1049  AEQETEPADTTTIKPKKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGL  882
              E E  P        +K  +R +P     ++  DHI+AERKRRE L+++F+ALS +VPGL
Sbjct  114   VEAEVPPQRLNESINRKGTKRAQPFYRSQSNAQDHIIAERKRREKLTQRFVALSALVPGL  173

Query  881   RKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSG---  711
             +KMDK SVLGD +K++K +QERV   EE+  +R +ES+V VKKS++  DD +  +S    
Sbjct  174   KKMDKASVLGDALKHIKYLQERVGEFEEQKKERRLESMVLVKKSKLILDDSNLTASSSCC  233

Query  710   EKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSL  531
             E G+S  + LPEIE R  D  +L++I C+R  G I KI + +EK   ++ NSSV  FG  
Sbjct  234   EDGSSGLE-LPEIEVRFSDKDVLIKILCERHNGHITKIMAAIEKFRFSITNSSVFPFGP-  291

Query  530   ALDITIIVEMEKEFDLPMKHIAKILRS  450
              LDITII + E +FD+ +  + K LRS
Sbjct  292   TLDITIIAKKESDFDMTLIDVVKSLRS  318



>ref|XP_009140386.1| PREDICTED: transcription factor bHLH18 [Brassica rapa]
Length=322

 Score =   149 bits (375),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 133/204 (65%), Gaps = 4/204 (2%)
 Frame = -2

Query  1046  EQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDK  867
             ++E    D  T   K++    R  ++  DHILAERKRRE L+++F+ALS  +PGL+KMDK
Sbjct  119   KKEVGSPDLITRGTKRAQPLTRSQSNAQDHILAERKRREKLTQRFVALSAQIPGLKKMDK  178

Query  866   TSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK-GNSDE  690
              SVLGD IK++K +QE VK  EE+  +RTMES+V VKKSQ+  D++ ++SS    GN D 
Sbjct  179   ASVLGDAIKHIKYLQESVKEYEEQKKERTMESMVLVKKSQLVLDENYQLSSSSSDGNRDC  238

Query  689   QS--LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDIT  516
              S  LPE+E R+  N +L++I C++Q   + KI SEVEKL L++ NSSV  FG    DI+
Sbjct  239   SSSNLPEMEVRVSGNDVLIKILCEKQNCNLIKIMSEVEKLGLSITNSSVLPFGP-TFDIS  297

Query  515   IIVEMEKEFDLPMKHIAKILRSAI  444
             II +    FD+ ++ + K L   +
Sbjct  298   IISQKTSNFDMKVEDVVKSLSCGL  321



>ref|XP_009771547.1| PREDICTED: transcription factor bHLH18-like [Nicotiana sylvestris]
Length=356

 Score =   149 bits (377),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 126/189 (67%), Gaps = 2/189 (1%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             +K     R P    DH+L+ERKRRE L++ F++LST++P L+K+DK S+LGD IKY+KQ+
Sbjct  158   QKKSTYSRTPLQAQDHVLSERKRRERLTQCFISLSTLIPNLKKLDKASILGDAIKYIKQL  217

Query  824   QERVKTLEEESSKRTMEsvvfvkks--qvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDN  651
             + +VK+LEEE+ K + E VV VK++    ++ +          +S  +S+PEIE R  D 
Sbjct  218   ENQVKSLEEETKKFSKEPVVAVKRTGLLSTYVNSSSSEENSNISSTNKSVPEIEVRAADG  277

Query  650   HILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKH  471
             + L+RIYC +Q  II +IFS+VEK NL +++SSV  FG ++  ITI+ +M+ + ++  ++
Sbjct  278   NALIRIYCKKQATIIKEIFSQVEKFNLTIISSSVMPFGDISTYITIVAKMDHQLNMTAEY  337

Query  470   IAKILRSAI  444
              AK +R  I
Sbjct  338   AAKRIRETI  346



>gb|KDO40734.1| hypothetical protein CISIN_1g038298mg [Citrus sinensis]
Length=259

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 124/191 (65%), Gaps = 21/191 (11%)
 Frame = -2

Query  1010  KPKKSGR-RGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYL  834
             KP +  R   R P    +H++AERKRRE +++QF+ALS ++PG+++M+K SVL  TIK+L
Sbjct  81    KPGQGNRVASRSPLQAQEHVIAERKRREKMNQQFIALSAVIPGIKQMNKASVLEGTIKHL  140

Query  833   KQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCD  654
             K++QER K L E + ++  ESVV VK+                    +Q+LP+I  R+ D
Sbjct  141   KELQERGKKLVEHTKRKAPESVVSVKR-------------------SQQTLPDIVVRVSD  181

Query  653   NHILLRIYCDRQK-GIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPM  477
             N++L+RI+C++Q  G I  I SE+EKL+L V+NS    FG+ ALDIT++ +ME EF L +
Sbjct  182   NNVLIRIHCEKQNIGFISNIVSEIEKLHLVVINSRTIPFGNYALDITVVAQMEVEFCLTV  241

Query  476   KHIAKILRSAI  444
             K + K LR A+
Sbjct  242   KELVKNLRLAL  252



>ref|XP_010691802.1| PREDICTED: transcription factor bHLH25-like [Beta vulgaris subsp. 
vulgaris]
Length=340

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 118/179 (66%), Gaps = 6/179 (3%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            DHI+AERKRRE L+++F  L+TI+PGL+KMDK SVLGD  KY+KQ+QE+VK LEE +  +
Sbjct  159  DHIIAERKRREKLNQRFRVLTTIIPGLKKMDKASVLGDAFKYVKQLQEQVKKLEEGTKMK  218

Query  782  TMEsv--vfvkksqvsFDDDDEMSSGEKGN----SDEQSLPEIETRLCDNHILLRIYCDR  621
            T+ES   V   K     +DDD  SS E       S   S PEIE R  +  +L+RI+C++
Sbjct  219  TIESTVLVKRSKVVSEEEDDDNQSSMENHAIFDCSCTASFPEIEVRFSNKDVLIRIHCEK  278

Query  620  QKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            + G+  ++ S++E L+L V+NSS   +G  +LD TII ++  EF++  K + + L +A+
Sbjct  279  KNGVFEELLSQIESLHLVVINSSSLVYGCASLDATIIAQIGAEFNMTTKDLVRHLYTAL  337



>emb|CAB38933.1| putative protein [Arabidopsis thaliana]
 emb|CAB80450.1| putative protein [Arabidopsis thaliana]
Length=314

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 131/190 (69%), Gaps = 8/190 (4%)
 Frame = -2

Query  1046  EQETEPADTTTIKPKKSGRRGRP----PTHRYDHILAERKRRELLSRQFLALSTIVPGLR  879
             E + +P   +    +K  +R +P     ++  DHI+AERKRRE L+++F+ALS +VPGL+
Sbjct  96    EAQVQPHQKSDEFNRKGTKRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLK  155

Query  878   KMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDE--MSSGEK  705
             KMDK SVLGD +K++K +QERV  LEE+  +R +ES+V VKKS++  DD+++   SS E 
Sbjct  156   KMDKASVLGDALKHIKYLQERVGELEEQKKERRLESMVLVKKSKLILDDNNQSFSSSCED  215

Query  704   GNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLAL  525
             G SD   LPEIE R  D  +L++I C++QKG + KI +E+EKL++ + NSSV  FG   L
Sbjct  216   GFSD-LDLPEIEVRFSDEDVLIKILCEKQKGHLAKIMAEIEKLHILITNSSVLNFGP-TL  273

Query  524   DITIIVEMEK  495
             DITII ++ K
Sbjct  274   DITIIAKVCK  283



>ref|XP_006441040.1| hypothetical protein CICLE_v10023770mg [Citrus clementina]
 gb|ESR54280.1| hypothetical protein CICLE_v10023770mg [Citrus clementina]
Length=259

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 125/191 (65%), Gaps = 21/191 (11%)
 Frame = -2

Query  1010  KPKKSGR-RGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYL  834
             KP +  R   R P    +H++AERKRRE +++QF+ALS ++PG+++M+K SVL  TIK+L
Sbjct  81    KPGQGNRVASRSPLQAQEHVIAERKRREKMNQQFIALSAVIPGIKQMNKASVLEGTIKHL  140

Query  833   KQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCD  654
             K++QER K L E++ ++  ESVV V                 KG+  +Q+LP+I  R+ D
Sbjct  141   KELQERGKKLVEQTKRKAPESVVSV-----------------KGS--QQTLPDIVVRVSD  181

Query  653   NHILLRIYCDRQK-GIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPM  477
             N++L+RI+C++Q  G I  I SE+EKL+L V+NS     G+ ALDIT++ +ME EF L +
Sbjct  182   NNVLIRIHCEKQNIGFISNIVSEIEKLHLVVINSRTIPLGNYALDITVVAQMEVEFCLTV  241

Query  476   KHIAKILRSAI  444
             K + K LR A+
Sbjct  242   KELVKNLRLAL  252



>emb|CDY25628.1| BnaA04g13200D [Brassica napus]
Length=322

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 133/204 (65%), Gaps = 4/204 (2%)
 Frame = -2

Query  1046  EQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDK  867
             ++E    D  T   K++    R  ++  DHILAERKRRE L+++F+ALS  +PGL+KMDK
Sbjct  119   KKEVGSPDQITRGTKRAQPLTRSQSNAQDHILAERKRREKLTQRFVALSAQIPGLKKMDK  178

Query  866   TSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEK-GNSDE  690
              SVLGD IK++K +QE VK  EE+  +RTMES+V VKKSQ+  D++ ++SS    GN D 
Sbjct  179   ASVLGDAIKHIKYLQESVKEYEEQKKERTMESMVLVKKSQLVLDENYQLSSSSSDGNRDC  238

Query  689   QS--LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDIT  516
              S  LPE+E R+  N +L++I C++Q   + KI SEVEKL L++ NSSV  FG    DI+
Sbjct  239   SSSNLPEMEVRVSGNDVLIKILCEKQNCNLIKIMSEVEKLGLSITNSSVLPFGP-TFDIS  297

Query  515   IIVEMEKEFDLPMKHIAKILRSAI  444
             II +    FD+ ++ + K L   +
Sbjct  298   IISQKTSNFDMKVEDLVKSLSCGL  321



>ref|XP_010026569.1| PREDICTED: transcription factor bHLH25-like [Eucalyptus grandis]
Length=217

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 126/195 (65%), Gaps = 6/195 (3%)
 Frame = -2

Query  1010  KPKKSGRRG---RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIK  840
             K K+SG  G   R   H  +HI+AERKRRE +S +F ALS+I+PGL K+DK SVLGDTIK
Sbjct  18    KMKRSGSGGTFSRTTLHAQEHIIAERKRREKMSLRFTALSSIIPGLTKLDKASVLGDTIK  77

Query  839   YLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD---EQSLPEIE  669
             YLKQ++ER K LEEE+  RT+ES +F K   +         S E+   +   +Q LPE+E
Sbjct  78    YLKQLEERAKFLEEEAVTRTVESAIFTKNPSLQRGGGFVSFSSEEKQYNPIIDQQLPEVE  137

Query  668   TRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEF  489
              R+   ++L+++ C++ +G I ++  ++E +NL  ++ SV  FGS  LD+TI+ ++E E+
Sbjct  138   ARVSGKNVLIKVQCEKHEGCIKEVTKQMEDMNLTTLSISVLTFGSSLLDVTIVAQIENEY  197

Query  488   DLPMKHIAKILRSAI  444
                ++ I + LR A+
Sbjct  198   CPAIEEIVEKLRCAL  212



>ref|XP_003525884.2| PREDICTED: transcription factor bHLH18-like [Glycine max]
 gb|KHN47568.1| Transcription factor bHLH25 [Glycine soja]
Length=361

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 121/183 (66%), Gaps = 4/183 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K +    R PT   DH+++ERKRRE LS++F+ALS I+PGL+KMDK +VL D IKY+KQ+
Sbjct  176   KAAASLTRNPTQAQDHVISERKRREKLSQRFIALSAIIPGLKKMDKATVLEDAIKYVKQL  235

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QERVKTLEE++  +T+ES VFVK+S V   DD   SS    NSD QSLP+IE R+    +
Sbjct  236   QERVKTLEEQAVDKTVESAVFVKRSVVFAGDD---SSDNDENSD-QSLPKIEARISGKEV  291

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+RI+ D+  G    I  E+EK +L V +SS   FG+   DITI+ +M  ++    K + 
Sbjct  292   LIRIHSDKHSGGAAAILRELEKHHLTVQSSSFLPFGNNTFDITIVAKMNMDYCFTAKDLI  351

Query  464   KIL  456
             + L
Sbjct  352   RSL  354



>ref|XP_010531324.1| PREDICTED: transcription factor bHLH18 [Tarenaya hassleriana]
Length=316

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 130/194 (67%), Gaps = 14/194 (7%)
 Frame = -2

Query  1001  KSGRRG--------RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDT  846
             + GRRG        R   H  DH+LAERKRRE L+++F+ALS +VPGL+KMDK SVLGD 
Sbjct  125   RYGRRGTKRAHQSTRIQPHGQDHVLAERKRREKLTQRFVALSAMVPGLKKMDKASVLGDA  184

Query  845   IKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIET  666
             IK++K +Q+RVK  EEE  +R+MESV  +KKS++  D++D     +K +S   +LPEIE 
Sbjct  185   IKHIKHLQDRVKEFEEEKKERSMESVALIKKSRLVLDEED-----DKSDSSNSALPEIEV  239

Query  665   RLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFD  486
             R+     +++I C++QKG   KI SE+EKL+L ++N+++  FG   LDIT+I   E++FD
Sbjct  240   RVSGKDAMIKILCEKQKGHATKILSEIEKLHLCILNNNILPFGP-TLDITVIARKERDFD  298

Query  485   LPMKHIAKILRSAI  444
             +    + K LR A 
Sbjct  299   MTTVDVVKNLRLAF  312



>ref|XP_009771544.1| PREDICTED: transcription factor bHLH18-like [Nicotiana sylvestris]
Length=316

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 135/197 (69%), Gaps = 4/197 (2%)
 Frame = -2

Query  1028  ADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGD  849
             ADTTT   KKS    R      DH++AERKRRE L+++F+ALST++P L+K+DK SVLGD
Sbjct  112   ADTTTTTQKKS--YNRTSLQAQDHVVAERKRRERLTQRFIALSTLIPNLKKLDKASVLGD  169

Query  848   TIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqv--sFDDDDEMSSGEKGNSDEQSLPE  675
              IKY+KQ++E+VKTLEE++   + ESVV VK+++V  S+DD    S      S ++S P+
Sbjct  170   AIKYIKQLEEQVKTLEEKAKNCSEESVVAVKRARVLSSYDDYSSSSDENSSISTDRSFPD  229

Query  674   IETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEK  495
             IE R+ D + ++ IYC +Q GII +I++EVEKL+L++++SSV  FG     +TII  ++ 
Sbjct  230   IEVRVSDGNFMISIYCKKQSGIIKEIYNEVEKLHLSIISSSVMPFGYNTTHMTIIALIDY  289

Query  494   EFDLPMKHIAKILRSAI  444
             +  +   H+A  +R+ +
Sbjct  290   KLSMTPNHVANRIRAVM  306



>ref|XP_002310318.2| hypothetical protein POPTR_0007s14480g [Populus trichocarpa]
 gb|EEE90768.2| hypothetical protein POPTR_0007s14480g [Populus trichocarpa]
Length=367

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 130/183 (71%), Gaps = 8/183 (4%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R   H  DHI+AERKRRE LS+QF+ALS +VPGL+KMDK SVL   +KY+KQ+QE++K L
Sbjct  173  RSAMHVQDHIMAERKRREKLSQQFIALSALVPGLKKMDKASVLDGAMKYMKQLQEQLKQL  232

Query  803  EEESSKRTMEsvvfvkksqvsFDDD----DEMSSGEKGNSDEQSLPEIETRLCDNHILLR  636
            ++++  +TMESVV +KKS++S DD+    DE   G  G+     LPEIE R  D  +L+R
Sbjct  233  QDQTKTKTMESVVLLKKSKLSVDDECTSSDETFDGLPGS----PLPEIEARTTDKDVLIR  288

Query  635  IYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKIL  456
            I+C  Q+G+  KI SE+E L+L+VVNSSV  FG+  LD+T+I +M+ +F L MK + K L
Sbjct  289  IHCKNQQGVGIKILSEIENLHLSVVNSSVLVFGNSTLDVTVIAQMDNDFSLTMKDLVKKL  348

Query  455  RSA  447
            R A
Sbjct  349  RLA  351



>emb|CDX89511.1| BnaC04g35300D [Brassica napus]
Length=321

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 134/200 (67%), Gaps = 4/200 (2%)
 Frame = -2

Query  1046  EQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDK  867
             +QE    D      K++    R  ++  DHILAERKRRE L+++F+ALS ++PGL+KMDK
Sbjct  118   KQEAGSPDLIARGTKRAQPLARSHSNAQDHILAERKRREKLTQRFVALSDLIPGLKKMDK  177

Query  866   TSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEM-SSGEKGNSDE  690
              SVLGD IK++K +QE VK  EE+  +RTMES+V VKKSQ+  D++ ++ SS  +GN D 
Sbjct  178   ASVLGDAIKHIKYLQESVKEYEEQKKERTMESMVLVKKSQLVLDENHQLSSSSSEGNRDC  237

Query  689   QS--LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDIT  516
              S  LPE+E ++    +L++I C++QK  + KI +E+E+L L++ NSSV  FG    DI+
Sbjct  238   SSSNLPEMEVKVSGKDVLIKILCEKQKSNLIKIMAEIERLGLSITNSSVLPFGP-TFDIS  296

Query  515   IIVEMEKEFDLPMKHIAKIL  456
             II +   +FD+ ++ + K L
Sbjct  297   IIAQKTSDFDMKVEDVVKSL  316



>ref|XP_004489860.1| PREDICTED: transcription factor bHLH18-like [Cicer arietinum]
Length=251

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 135/207 (65%), Gaps = 17/207 (8%)
 Frame = -2

Query  1067  LTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVP  888
             LTS    E + +       + KK+    R   H  DHI+AERKRR+ +S+ F+ALS ++P
Sbjct  52    LTSKGSLENQRKETKRNIEENKKTDSITRSSQHNKDHIIAERKRRQNISQHFIALSALIP  111

Query  887   GLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSK-RTMEsvvfvkksqvsFDDDDEMSSG  711
             GL+KMDK SVL D IK++KQ+QE+VK LEE++ + + +E VV+V           E +SG
Sbjct  112   GLKKMDKASVLRDAIKHVKQLQEQVKLLEEKNQRLQNVEYVVYV-----------ESNSG  160

Query  710   EKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSL  531
                 + ++SLPE+E R+ + ++L+RI+C++QKG++  I  E+E LNL++ +++   FG+ 
Sbjct  161   ----NGKRSLPEVEARMSEKNVLIRIHCEKQKGVLVNIIKEIENLNLSITSATSLLFGTT  216

Query  530   A-LDITIIVEMEKEFDLPMKHIAKILR  453
               LDIT+I EM++EF L ++ + + LR
Sbjct  217   KLLDITVIAEMDEEFSLCVQELVRNLR  243



>ref|XP_006295910.1| hypothetical protein CARUB_v10025041mg [Capsella rubella]
 gb|EOA28808.1| hypothetical protein CARUB_v10025041mg [Capsella rubella]
Length=305

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 144/236 (61%), Gaps = 26/236 (11%)
 Frame = -2

Query  1121  HHHPNI------DDVNLPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYD  960
             H+ PN+      ++  LP+ R+  L         T+ A T+T          R   +  +
Sbjct  82    HNSPNLIFSPKEEETGLPDQRKSKLVIRG-----TKRAQTST----------RSQANAQE  126

Query  959   HILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKRT  780
             HILAERKRRE L+++F+ALS +VPGL+KMDK SVLGD IK++K +QE VK  EE+  +RT
Sbjct  127   HILAERKRREKLTQRFVALSALVPGLKKMDKASVLGDAIKHIKHLQEIVKEYEEQKQERT  186

Query  779   MEsvvfvkksqvsFDDDDE--MSSGEKGNSD--EQSLPEIETRLCDNHILLRIYCDRQKG  612
             MES++ VKKSQ+  D++ +   SS   GN D    +LPEIE R+  N +L++I C++QKG
Sbjct  187   MESIILVKKSQLVLDENHQPSSSSSSDGNRDCSSSNLPEIEVRVSGNDVLIKILCEKQKG  246

Query  611   IIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
              + KI  E+EKL L + NS+V  FG    DI+II +  + FD+ ++ + K L   I
Sbjct  247   NVIKIMGEIEKLGLLITNSNVLPFGP-TFDISIIAQKNRNFDIKIEDLVKNLSCGI  301



>ref|XP_004509201.1| PREDICTED: transcription factor bHLH18-like [Cicer arietinum]
Length=387

 Score =   148 bits (374),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 129/193 (67%), Gaps = 10/193 (5%)
 Frame = -2

Query  1004  KKSGRRGRPPT-HRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQ  828
             KK+    R  T H  DHI+AER RRE +S+QF+ALS ++P L+KMDK SVLGD IKY+KQ
Sbjct  161   KKNYSFTRSTTNHTPDHIIAERIRREKISQQFIALSALIPNLKKMDKASVLGDAIKYVKQ  220

Query  827   IQERVKTLEEESS-KRTMEsvvfvkksqvsFDDDDEMSSGE---KGNSDEQ-----SLPE  675
             ++++VK LEE+S  K+++ES+V VKK    F D+D   +      GNSDE       LPE
Sbjct  221   LKDQVKVLEEQSKRKQSVESIVAVKKLSQLFVDEDVSDTSSYCCNGNSDETLKRNLLLPE  280

Query  674   IETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEK  495
             +E RL    +++RI C++ K ++  ++  +EK +L+V+N+S   FGS  L ITII +ME 
Sbjct  281   VEARLSGKSVMIRILCEKDKVVMVNVYRAIEKFHLSVINASSFSFGSSVLAITIIAQMED  340

Query  494   EFDLPMKHIAKIL  456
             EF++ ++ +AK L
Sbjct  341   EFNISVQKLAKNL  353



>gb|EYU39093.1| hypothetical protein MIMGU_mgv1a013585mg [Erythranthe guttata]
Length=208

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 115/173 (66%), Gaps = 6/173 (3%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            +H+LAERKRRE LS++F+ALS +VP L+KMDK +VLGD  KY+KQ+Q++VK LEE+S K 
Sbjct  41   EHVLAERKRREKLSQRFIALSALVPALKKMDKATVLGDAAKYMKQLQDKVKILEEQSKKT  100

Query  782  TMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIG  603
            ++ SV          + +   SS       ++S PEI+ RLC+  +L+ I+C ++KG++ 
Sbjct  101  SIPSVNESLVFVKKHEQNSSSSSS------DESFPEIKARLCNKEVLITIHCVKRKGVVE  154

Query  602  KIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
            K  S +EKL+L+ +N+SV  FG  AL IT+  + ++EFD  MK +   L + +
Sbjct  155  KAVSMIEKLHLSAINTSVMSFGDSALSITVHAQRDEEFDTNMKELVDDLYAVV  207



>ref|XP_006357857.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH18-like 
[Solanum tuberosum]
Length=310

 Score =   146 bits (368),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 127/196 (65%), Gaps = 6/196 (3%)
 Frame = -2

Query  1028  ADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGD  849
             A TTT   KKS    R      DH+LAERKRRE L+++F+ALST++P L+K+DK +VLGD
Sbjct  110   AVTTTTDQKKS--YNRTSVQAQDHVLAERKRRERLTQRFIALSTLIPNLKKLDKATVLGD  167

Query  848   TIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIE  669
              I+Y+KQ++E+VKTLEE   K   E     +   VS  DD   S      S ++SLP+IE
Sbjct  168   AIQYIKQLEEQVKTLEE---KNKPEIPAAKRPRLVSSCDDSSSSGXISSVSTDRSLPDIE  224

Query  668   TRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEF  489
              R  D +IL+RIYC +Q GI+ +IF+EVEKL+L++++ SV  FG     +TII +M+ + 
Sbjct  225   VRASDGNILIRIYCKKQNGIMKEIFNEVEKLHLSIISCSVMPFGDNTSHMTIIAQMDHKL  284

Query  488   -DLPMKHIAKILRSAI  444
               +   H+A  +R+A+
Sbjct  285   TSVTPNHVANRIRAAM  300



>emb|CDY13737.1| BnaA09g42390D [Brassica napus]
Length=295

 Score =   145 bits (365),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             KK+    R P++  +HILAERKRRE L+++F+ALS ++PGL+KMDK SVLGD IK++K +
Sbjct  106   KKAQPLARSPSNAQEHILAERKRREKLTQRFVALSALIPGLKKMDKASVLGDAIKHIKYL  165

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMS-SGEKGNSDEQS--LPEIETRLCD  654
             QE V   E++   RT+ESVV V KSQ+  D+  ++S S   GN D  S  LPEIE R+  
Sbjct  166   QESVNEYEKQKKGRTLESVVLVNKSQLVLDEHHKLSPSFSDGNRDYSSSNLPEIEVRVSG  225

Query  653   NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
               +L++I C++QKG + KI  E+EKL L++ NSS+  FG  + DI+II +   +FD+ ++
Sbjct  226   KDVLIKIICEKQKGNLIKIMGEIEKLGLSITNSSLLPFGPTS-DISIIAQKTCDFDMKVE  284

Query  473   HIAKILRSAI  444
              + K L   +
Sbjct  285   DVVKSLSCGL  294



>ref|XP_010429208.1| PREDICTED: transcription factor bHLH18-like [Camelina sativa]
Length=334

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 130/193 (67%), Gaps = 6/193 (3%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    R P++  DHILAERKRRE L+++F+ALS +VPGL+KMDK SVLGD IK++K +
Sbjct  142   KRAQTLTRSPSNAQDHILAERKRREKLTQRFVALSALVPGLKKMDKASVLGDAIKHIKYL  201

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSS----GEKGNSDEQSLPEIETRLC  657
             QE++K  EE+  +RTMES+V VKKSQ+  D++ + SS    G +G S   +LPEIE R+ 
Sbjct  202   QEKLKEYEEQKQERTMESMVLVKKSQLVLDENHQSSSSSSDGNRGCSS-SNLPEIEVRVS  260

Query  656   DNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPM  477
                +L++I C++QK  + KI  E+EKL L + NS+V  FG    DI+II +    FD+ +
Sbjct  261   GRDVLIKILCEKQKSNLIKIMGEIEKLGLLITNSNVLPFGP-TFDISIIAQKNSNFDMKI  319

Query  476   KHIAKILRSAIQH  438
             + + K L   + +
Sbjct  320   EDVVKNLSCGLSN  332



>ref|XP_010472271.1| PREDICTED: transcription factor bHLH18 [Camelina sativa]
Length=333

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 129/191 (68%), Gaps = 6/191 (3%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    R  ++  DHILAERKRRE L+++F+ALS +VPGL+KMDK SVLGD IK++K +
Sbjct  141   KRAQTLTRSQSNAQDHILAERKRREKLTQRFVALSALVPGLKKMDKASVLGDAIKHIKYL  200

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSS----GEKGNSDEQSLPEIETRLC  657
             QE+VK  EE+  +RTMES+V VKKSQ+  D++ + SS    G +G S   +LPEIE R+ 
Sbjct  201   QEKVKEYEEQKQERTMESMVLVKKSQLVLDENHQSSSSSSDGNRGCSS-SNLPEIEVRVS  259

Query  656   DNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPM  477
                +L++I C++QKG + KI  E+EKL L + NS+V  FG    DI+II +    FD+ +
Sbjct  260   GKDVLIKILCEKQKGNLIKIMGEIEKLGLLITNSNVLPFGP-TFDISIIAQKNSNFDMKI  318

Query  476   KHIAKILRSAI  444
             + + K L   +
Sbjct  319   EDVVKNLSCGL  329



>emb|CAN64530.1| hypothetical protein VITISV_041746 [Vitis vinifera]
Length=215

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 122/206 (59%), Gaps = 4/206 (2%)
 Frame = -2

Query  1052  IAEQETEPADTTTIKPKKSGRRG--RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLR  879
             I++   +  D +    + + R G  R PT   +H++AERKRRE L+  F+ALS IVPGL 
Sbjct  7     ISQDSYQNQDYSQTYGQGTKRLGLTRNPTQNQEHVIAERKRREKLNLLFIALSAIVPGLT  66

Query  878   KMDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGN  699
             K DK SVLGD IKYLK +QERVK LEE+++K+ +E      K     D++   S     +
Sbjct  67    KTDKASVLGDAIKYLKHLQERVKMLEEQTAKKMVE-SAVTVKRYQLSDNETSSSYHNSDS  125

Query  698   SDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSL-ALD  522
             S  Q   EIE R+ +  +L+RI+C ++KG   KI  E+EKL+L V+ SS   FG    +D
Sbjct  126   SSNQLFLEIEARVSNKDVLIRIHCQKEKGFAVKILGEIEKLHLTVIKSSFLPFGEYNIMD  185

Query  521   ITIIVEMEKEFDLPMKHIAKILRSAI  444
             ITI+ +M+  F    K + + LR A+
Sbjct  186   ITIVAQMDHGFCTTAKDLVRNLRLAL  211



>ref|XP_009594425.1| PREDICTED: transcription factor bHLH18-like [Nicotiana tomentosiformis]
Length=316

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 134/197 (68%), Gaps = 6/197 (3%)
 Frame = -2

Query  1028  ADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGD  849
             AD TT   KKS    R      DH++AERKRRE L+++F+ALST++P L+K+DK SVLGD
Sbjct  114   ADITT--QKKS--YNRTSLQAQDHVMAERKRRERLTQRFIALSTLIPNLKKLDKASVLGD  169

Query  848   TIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqv--sFDDDDEMSSGEKGNSDEQSLPE  675
              IKY+KQ++E+VKTLEE++   + ES V VK+++V  S+D+    S      S ++S P+
Sbjct  170   AIKYIKQLEEQVKTLEEKAKNCSDESAVAVKRARVLSSYDEYSSSSDENSSISTDRSFPD  229

Query  674   IETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEK  495
             IE R+ D + ++ IYC +Q GII +I++EVEKL+L++++SSV  FG     +TII +M+ 
Sbjct  230   IEVRVSDGNFMISIYCKKQTGIIKEIYNEVEKLHLSIISSSVMPFGYSTTHMTIIAQMDY  289

Query  494   EFDLPMKHIAKILRSAI  444
             +  +   H+A  +R+ +
Sbjct  290   KLSMTPNHVANRIRAVM  306



>ref|XP_010026570.1| PREDICTED: transcription factor bHLH25-like [Eucalyptus grandis]
Length=268

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R   H  +H++AERKRRE L+++F+ALS+I+P L K+DK SVLGDTIKYLKQ++ERVK L
Sbjct  73   RTTLHGQEHVIAERKRREKLNQRFIALSSIIPDLTKLDKASVLGDTIKYLKQLEERVKIL  132

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDE---QSLPEIETRLCDNHILLRI  633
            EEE + RT+ES  F K   +   D     S ++ + D    Q LP++E R+   ++L+++
Sbjct  133  EEEMTTRTVESATFAKNPSLQRGDGVISFSSDEKSYDPLIGQQLPDVEARVSGKNVLIKV  192

Query  632  YCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
             C +++G I ++  ++E +NL  +N SV  FGS  LD+TI+ ++E E    ++ I K LR
Sbjct  193  QCVKREGCIKEVMKQIEVMNLTTLNISVLAFGSSLLDVTIVAQIENENCPTIQEIVKKLR  252

Query  452  SAI  444
            +A+
Sbjct  253  NAL  255



>ref|XP_009117336.1| PREDICTED: transcription factor bHLH18-like [Brassica rapa]
Length=323

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             KK+    R P++  +HILAERKRRE L+++F+ALS ++PGL+KMDK SVLGD IK++K +
Sbjct  134   KKAQPLARSPSNAQEHILAERKRREKLTQRFVALSALIPGLKKMDKASVLGDAIKHIKYL  193

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMS-SGEKGNSDEQS--LPEIETRLCD  654
             QE V   E++   RT+ESVV V KSQ+  D+  ++S S   GN D  S  LPEIE R+  
Sbjct  194   QESVSEYEKQKKGRTLESVVLVNKSQLVLDEHHKLSPSFSDGNRDYSSSNLPEIEVRVSG  253

Query  653   NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
               +L++I C++QKG + KI  E+EKL L++ NSS+  FG  + DI+II +   +FD+ ++
Sbjct  254   KDVLIKIICEKQKGNLIKIMGEIEKLGLSITNSSLLPFGPTS-DISIIAQKTCDFDMKVE  312

Query  473   HIAKILRSAI  444
              + K L   +
Sbjct  313   DVVKSLSCGL  322



>ref|XP_011021822.1| PREDICTED: transcription factor bHLH18 [Populus euphratica]
 ref|XP_011021823.1| PREDICTED: transcription factor bHLH18 [Populus euphratica]
 ref|XP_011021824.1| PREDICTED: transcription factor bHLH18 [Populus euphratica]
Length=393

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 127/179 (71%), Gaps = 0/179 (0%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R   H  DHI+AERKRR+ LS+QF+ALS +VPGL+KMDK SVL   +KY+KQ+QE++K L
Sbjct  199  RSAMHVQDHIMAERKRRKKLSQQFIALSAVVPGLKKMDKASVLEGAMKYMKQLQEQLKQL  258

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            ++++  +TMESVV +KKS++S DD+   S        +  LPEIE R  D  +L+RI+C 
Sbjct  259  QDQTKTKTMESVVLLKKSKLSVDDECSSSDENFDGLPDSPLPEIEARTTDKDVLIRIHCK  318

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
             Q+G+  KI SE+E L+L+VVNSSV  FG+  LD+T+I +M+ +F L MK + K LR A
Sbjct  319  NQQGVGIKILSEIENLHLSVVNSSVLVFGNSTLDVTVIAQMDNDFSLTMKDLVKKLRLA  377



>emb|CDX76899.1| BnaC08g34850D [Brassica napus]
Length=323

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -2

Query  1028  ADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGD  849
             AD    + KK+    R P++  +HILAERKRRE L+++F+ALS ++PGL+KMDK SVLGD
Sbjct  126   ADLIRRETKKAQPLTRSPSNAQEHILAERKRREKLTQRFVALSALIPGLKKMDKASVLGD  185

Query  848   TIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMS-SGEKGNSDEQS--LP  678
              IK++K +QE V   E++   RT+ESVV V KSQ+  D+  ++S S   GN D  S  LP
Sbjct  186   AIKHIKYLQESVNEYEKQKKGRTLESVVLVNKSQLVLDELHKLSPSFSDGNRDYSSSNLP  245

Query  677   EIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEME  498
             EIE R+    +L++I C++QKG + KI  E+EKL L++ NSS+  FG  + DI+II +  
Sbjct  246   EIEVRVSGKDVLIKIICEKQKGNLIKIMGEIEKLGLSITNSSLLPFGPTS-DISIIAQKT  304

Query  497   KEFDLPMKHIAKILRSAI  444
              +FD+ ++ + K L   +
Sbjct  305   SDFDMKVEDVVKSLSYGL  322



>ref|XP_006357745.1| PREDICTED: transcription factor bHLH25-like [Solanum tuberosum]
Length=350

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -2

Query  1013  IKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYL  834
             I   K     R P    DH+LAERKRRE L++ F+ LST++P L+K+DK S+LGD I Y+
Sbjct  158   ISQTKKMNYSRTPLQAQDHVLAERKRRERLTQYFVTLSTLIPNLKKLDKASILGDAITYI  217

Query  833   KQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCD  654
             KQ++E+VK L+EE++K   E VV VK+S++  + D+  +  E  NS++  +P+IE R  D
Sbjct  218   KQLEEQVKRLDEEANK---EPVVAVKRSRLLSNYDNSSTCNE--NSNKSVVPDIEVRASD  272

Query  653   NHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK  474
              ++L+R+ C +Q+GII +IFS+VE  +L + +SSV  FG     ITI+ +M+ + ++   
Sbjct  273   GNVLIRVSCKKQEGIIKEIFSQVEMFHLTITSSSVIPFGYDTTHITIVAQMDHQLNMTTD  332

Query  473   HIAKILRSAI  444
             ++A  +R +I
Sbjct  333   NVANKIRLSI  342



>gb|KCW59644.1| hypothetical protein EUGRSUZ_H02396, partial [Eucalyptus grandis]
Length=307

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R   H  +H++AERKRRE L+++F+ALS+I+P L K+DK SVLGDTIKYLKQ++ERVK L
Sbjct  112  RTTLHGQEHVIAERKRREKLNQRFIALSSIIPDLTKLDKASVLGDTIKYLKQLEERVKIL  171

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDE---QSLPEIETRLCDNHILLRI  633
            EEE + RT+ES  F K   +   D     S ++ + D    Q LP++E R+   ++L+++
Sbjct  172  EEEMTTRTVESATFAKNPSLQRGDGVISFSSDEKSYDPLIGQQLPDVEARVSGKNVLIKV  231

Query  632  YCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
             C +++G I ++  ++E +NL  +N SV  FGS  LD+TI+ ++E E    ++ I K LR
Sbjct  232  QCVKREGCIKEVMKQIEVMNLTTLNISVLAFGSSLLDVTIVAQIENENCPTIQEIVKKLR  291

Query  452  SAI  444
            +A+
Sbjct  292  NAL  294



>ref|XP_003608593.1| Transcription factor bHLH25 [Medicago truncatula]
 gb|AES90790.1| basic helix loop helix (bHLH) DNA-binding family protein [Medicago 
truncatula]
Length=252

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 130/194 (67%), Gaps = 12/194 (6%)
 Frame = -2

Query  1004  KKSGRRGRPPT--HRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             KK+G   +  T  H  DHI+AER RRE +S+ F+ALS ++P L+KMDK SVLGD IKY+K
Sbjct  54    KKNGSFSKSTTTHHTPDHIIAERIRREKISQLFIALSALIPNLKKMDKASVLGDAIKYVK  113

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDD---DEMSSGEKGNSDEQ-----SLPE  675
             +++E+VK LEE+S  +++E VV VKK      D+   D  S+   GNSDE      SLPE
Sbjct  114   ELKEQVKMLEEQS--KSVEPVVVVKKLSELSSDEDVSDTSSNSCNGNSDETSKTNLSLPE  171

Query  674   IETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEK  495
             +E  L   ++L+RI C++ K ++  ++ E+EKL+L V+N+S   FGS AL ITII +ME 
Sbjct  172   VEASLSGKNVLIRILCEKDKAVMVNVYREIEKLHLLVINASSFSFGSSALAITIIAQMEN  231

Query  494   EFDLPMKHIAKILR  453
             E ++ ++ +AK LR
Sbjct  232   ELNMSIQQLAKKLR  245



>ref|XP_008785755.1| PREDICTED: transcription factor bHLH18-like [Phoenix dactylifera]
Length=300

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 123/189 (65%), Gaps = 9/189 (5%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             +P+++G   RP +   DH++AERKRRE LS+QF+ALS I+PGL+K DK S+LGD + YLK
Sbjct  117   RPERNGMVSRPTSQ--DHVIAERKRREKLSQQFIALSAIIPGLKKTDKASLLGDAVDYLK  174

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDN  651
             Q++E+ KTLEE++ K++    +   K  +   + +  S GE       ++ +IE  L   
Sbjct  175   QLEEKAKTLEEQAVKKSAAEPIIFVKKSLHISNTNGSSPGE-------AVQKIEASLEGK  227

Query  650   HILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKH  471
              +L+ I+C+++KG++ K+ SE+EKL+L V+N  V  F   +L+IT+  ++E+ F +  K 
Sbjct  228   AVLMSIHCEKKKGVLVKVLSEIEKLHLGVINMGVVPFIDSSLNITVTAQIEEGFSMTEKD  287

Query  470   IAKILRSAI  444
             + K L SA+
Sbjct  288   LVKELNSAL  296



>ref|XP_007156672.1| hypothetical protein PHAVU_002G007400g [Phaseolus vulgaris]
 gb|ESW28666.1| hypothetical protein PHAVU_002G007400g [Phaseolus vulgaris]
Length=336

 Score =   144 bits (364),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 127/200 (64%), Gaps = 11/200 (6%)
 Frame = -2

Query  1046  EQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDK  867
             ++ +E  +  T  PK  G   +   H  DHI+AERKRRE LS+  +AL+ ++PGL+KMDK
Sbjct  142   KRSSENPNYETKSPKSQGS-FKTSGHGGDHIIAERKRREKLSQSLIALAALIPGLKKMDK  200

Query  866   TSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQ  687
              SVLGD I+Y+K++QER KTLEE  ++  + SVV V K+++S+ D               
Sbjct  201   ASVLGDAIRYVKELQERQKTLEENKNRDDVGSVVMVNKARLSYRD----------GCGRA  250

Query  686   SLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIV  507
             SLP +E R+ +  +LLRI+C +QKG++ KI  E++ L+L VVNSSV  FG   +DITI+ 
Sbjct  251   SLPRVEARVSEKDVLLRIHCQKQKGLLLKILVEIQNLHLFVVNSSVLSFGDSIIDITIVA  310

Query  506   EMEKEFDLPMKHIAKILRSA  447
             +M  ++ L +  + K LR A
Sbjct  311   QMGTDYKLTINELVKNLRRA  330



>ref|XP_004233614.1| PREDICTED: transcription factor bHLH18-like [Solanum lycopersicum]
Length=326

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 118/186 (63%), Gaps = 8/186 (4%)
 Frame = -2

Query  1001  KSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQ  822
             K     R P    DH+LAERKRRE L++ F+ LST++P L+K+DK S+LGD I Y+KQ++
Sbjct  141   KKMNYSRTPLQAQDHVLAERKRRERLTQYFVTLSTLIPNLKKLDKASILGDAITYIKQLE  200

Query  821   ERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHIL  642
             E+VK L+EE++K+ ++             + D  S+  + NS++  +PEI+ R+ D ++L
Sbjct  201   EQVKRLDEEANKQPVK-------RSRLHSNYDNFSTCNE-NSNKSVVPEIDVRVSDGNVL  252

Query  641   LRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAK  462
             +R+ C +Q GII +IFS+VE   L + +SSV  FG     ITI+ +M+ + ++  + +A 
Sbjct  253   IRVCCKKQAGIIKEIFSQVEMFQLTITSSSVIPFGYDTTHITIVAQMDHQLNMATEQVAN  312

Query  461   ILRSAI  444
              +R +I
Sbjct  313   NIRLSI  318



>ref|XP_010531586.1| PREDICTED: transcription factor bHLH19 [Tarenaya hassleriana]
Length=306

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = -2

Query  986  GRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKT  807
             R P    +H+LAERKRRE LS +F+ALS ++PGL+K DK +VLG+ I +LK++QER++ 
Sbjct  123  ARSPVLAKEHVLAERKRREKLSERFIALSALIPGLKKADKATVLGNAITHLKELQERIRD  182

Query  806  LEEES-SKRTMEsvvfvkksqvsFDDDDEMSSGEK-GNSDEQSLPEIETRLCDNHILLRI  633
            LE+E  + R  E+++ VKKS++  +D+   SS    G + +Q LPEIE  +  + +L+R+
Sbjct  183  LEQEKEASRETETMIVVKKSRILVEDETRGSSFSSLGENLDQELPEIEANMSRDDVLIRL  242

Query  632  YCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILR  453
            +C++ KG I +I +E+E+L+L V+NS+V  FG   LDIT++ + EK+F + +K + K L+
Sbjct  243  HCEKNKGCIVRILNEIERLHLRVMNSTVLPFGDFTLDITVLAKKEKDFCMTVKDLVKSLK  302

Query  452  SAI  444
             A+
Sbjct  303  LAM  305



>ref|XP_007156673.1| hypothetical protein PHAVU_002G007500g [Phaseolus vulgaris]
 gb|ESW28667.1| hypothetical protein PHAVU_002G007500g [Phaseolus vulgaris]
Length=348

 Score =   144 bits (364),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 124/188 (66%), Gaps = 13/188 (7%)
 Frame = -2

Query  995  GRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQER  816
            G   R P    +H++AERKRRE LS++F+ALS ++PGL+KMDK SVLGD IKY+KQ+QER
Sbjct  166  GITTRNPIQAQEHVIAERKRREKLSQKFIALSAVLPGLKKMDKASVLGDAIKYVKQLQER  225

Query  815  VKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD---EQSLPEIETRLCDNHI  645
            V+TLEE+++K T  S V +K+S +  DD+         NSD   + SLPEIE R+    +
Sbjct  226  VQTLEEKTAKSTTGSSVLLKRSILFADDE---------NSDSHCDHSLPEIEVRVTGKDV  276

Query  644  LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
            L+R   D+  G   KI SE+EKL+  V +SS+  FG+  +D+TII +M++ + +  K + 
Sbjct  277  LIRTQSDKHSGRAAKILSELEKLHFIVQSSSLLPFGNNNIDVTIIAQMKENY-MAAKDLL  335

Query  464  KILRSAIQ  441
              LR A++
Sbjct  336  GRLRQALK  343



>ref|XP_010531323.1| PREDICTED: transcription factor NAI1 [Tarenaya hassleriana]
Length=304

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 154/249 (62%), Gaps = 21/249 (8%)
 Frame = -2

Query  1148  DRPLKQLKIHHHPNIDDVNLPELRQELLTSNAIA------------EQETEPADTTTIKP  1005
             +RP KQ+K +H+ N              +S  I+            EQ+   A ++    
Sbjct  61    ERPTKQVKPNHNTNYSSSPSSSSSSISPSSQLISFGDCNVSNIMGMEQQFRQATSS----  116

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             KKS  R +P T + +H++AERKRR+ L+ + +ALS ++PGL+K+DK +VL D I ++K++
Sbjct  117   KKSTTRKQPHTMK-EHVIAERKRRQKLNERLIALSALLPGLKKVDKATVLEDAISHVKRL  175

Query  824   QERVKTLEEE--SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDN  651
             QERVK LEEE  S+ ++MESV+FVK+S +S D+D   SS E+ +   ++LP IE ++ + 
Sbjct  176   QERVKQLEEEQGSTTKSMESVIFVKRSVLSEDEDSLASSDEQIS--RRTLPLIEAKVSNQ  233

Query  650   HILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKH  471
              +LLRI C++ KG +GKI S +E L L V +S    FG+  LDITI+ +M+  F  P+K 
Sbjct  234   DLLLRILCEKSKGCLGKILSTMEMLQLDVASSFTLPFGNSTLDITILAKMDSNFSRPVKD  293

Query  470   IAKILRSAI  444
             + + +RSAI
Sbjct  294   VVENIRSAI  302



>ref|XP_003560380.1| PREDICTED: transcription factor bHLH18-like [Brachypodium distachyon]
Length=349

 Score =   144 bits (363),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 124/182 (68%), Gaps = 5/182 (3%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-K  786
            DHILAERKRRE LS +F+ALS IVPGL+KMDK SVLGD IKY+K +Q++VK +EE +  +
Sbjct  167  DHILAERKRREKLSERFIALSKIVPGLKKMDKASVLGDAIKYVKTLQDQVKGMEESARLR  226

Query  785  RTMEsvvfvkksqvsFDDDDEMSSG----EKGNSDEQSLPEIETRLCDNHILLRIYCDRQ  618
            R +E+ V VKKSQ+  ++DD  SS      +G ++   LPEIE R+ D  +L++I+C+ +
Sbjct  227  RPVEAAVLVKKSQLVPEEDDGSSSSCDENFEGAAEAGGLPEIEARMSDRTVLVKIHCENR  286

Query  617  KGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
            KG +    S+VE   L ++N++V  F + +LDITI+    ++F L +K I + L  A + 
Sbjct  287  KGALIAALSQVEGFGLTIMNTNVLPFTASSLDITIMATAGEDFSLSVKDIVRKLNQAFKS  346

Query  437  AA  432
            ++
Sbjct  347  SS  348



>ref|XP_009606580.1| PREDICTED: transcription factor bHLH25-like [Nicotiana tomentosiformis]
Length=301

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 119/178 (67%), Gaps = 14/178 (8%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEE----  795
            DH + ERKRR+ L++ F++LS I+PGL+KMDK S+LGDTI+Y+K++Q+RVK LE+E    
Sbjct  125  DHAILERKRRQKLTQLFISLSNILPGLKKMDKASLLGDTIQYMKELQQRVKVLEKEIKNN  184

Query  794  SSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSL-PEIETRLCDNHILLRIYCDRQ  618
             SKR++               D  +S G   +S+E+ + PEI  R+ D   L+ IYC++Q
Sbjct  185  PSKRSL---------AAKVPSDVSLSEGSDYSSNEEDIVPEINVRISDKSALIDIYCNKQ  235

Query  617  KGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAI  444
             G++G+I SE+E+L+L+V + ++  F   +LDI+++ EME  FD+ ++ I K L+S +
Sbjct  236  GGVVGRILSEMERLHLSVRDMNIMSFSRTSLDISVVAEMENGFDVNVEDIVKALQSKL  293



>ref|XP_002988006.1| hypothetical protein SELMODRAFT_48361, partial [Selaginella moellendorffii]
 gb|EFJ10798.1| hypothetical protein SELMODRAFT_48361, partial [Selaginella moellendorffii]
Length=162

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 107/162 (66%), Gaps = 0/162 (0%)
 Frame = -2

Query  998  SGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQE  819
            S  +G+   H  DHI+AERKRRE LS++F+ALS IVPGL+KMDK SVLGD IKY+KQ+QE
Sbjct  1    SSPQGKTSGHTLDHIMAERKRREKLSQRFIALSAIVPGLKKMDKASVLGDAIKYVKQLQE  60

Query  818  RVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILL  639
            R+K+LEE  S++ ++SV + KKS        +       + D+   PEIE R    ++L+
Sbjct  61   RLKSLEEHVSRKGVQSVAYCKKSVPMHGGSKQEDKYGSVSDDDFCPPEIEARYMGKNVLV  120

Query  638  RIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITI  513
            R++C+++KG++ K   E+EKLNL V+N+S   F     D T 
Sbjct  121  RVHCEKRKGLLVKCLGELEKLNLLVINASALSFSDTVHDFTF  162



>ref|XP_009389454.1| PREDICTED: transcription factor bHLH25-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=276

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 111/316 (35%), Positives = 163/316 (52%), Gaps = 61/316 (19%)
 Frame = -2

Query  1331  MMNLSQACFSGMGTDDLSF-------LDQFQILQSIEQEFAGVLGEDVLCssspeegspP  1173
             M  L+  C+S MG D  SF       LDQF       Q+    LG       S E  +  
Sbjct  1     MEALASPCYSDMGMDQSSFKRWELSALDQFS-----AQQLEVALGSP-----SSESYTSL  50

Query  1172  TTCHLGEDDRPLKQLKIHHHPNIDDVNLPELRQELLTSNAIAEQETEPADTTTIKPKKSG  993
              +CH      P + +    H ++ D            + A A+ + E  D   +   K  
Sbjct  51    PSCH-----PPNEIVTAAWHSDLHD-----------GAAATAKMKAEMKDVLVLDGSKRK  94

Query  992   -----RRG--RP------PTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLG  852
                  R G  RP       +H  +H++AERKRRE L+++F+ALS +VPGL+K    SVLG
Sbjct  95    WDIMIRHGTKRPSMGNSSASHNQEHVMAERKRREKLTQRFIALSAVVPGLKK---ASVLG  151

Query  851   DTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEI  672
             D IKYLKQ+QE+VK+LE++ +KR  ES V  K+S      D+    G         L EI
Sbjct  152   DAIKYLKQLQEKVKSLEDQVAKRNTESTVLAKRSY-----DERQRCGSL-------LVEI  199

Query  671   ETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKE  492
             E R+    IL++I+C+ QKG++ K  SE+EKL+L+V+ +S   F   +LDIT++ ++E+E
Sbjct  200   EARVFQKSILIKIHCENQKGVLVKALSEIEKLHLSVICTSAMSFAISSLDITVMTQIEEE  259

Query  491   FDLPMKHIAKILRSAI  444
             F +  K + K L SA+
Sbjct  260   FCMTAKDLVKKLNSAL  275



>ref|XP_004509038.1| PREDICTED: transcription factor bHLH18-like [Cicer arietinum]
Length=353

 Score =   144 bits (362),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 121/179 (68%), Gaps = 9/179 (5%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESS-K  786
            DH++AERKRRE LS++F+ LS+++PGL+KMDK ++L D I YLKQ++ERV TLEE+++  
Sbjct  178  DHVMAERKRREKLSQKFIVLSSMIPGLKKMDKATILEDAISYLKQLKERVNTLEEQAAVD  237

Query  785  RTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKG-I  609
            RT+ES VF K+S +  DDD   S  E     +QS+P+IE R+    +LLRIYCD+  G  
Sbjct  238  RTVESAVFAKRSILFADDDHNSSCDENA---DQSVPKIEARVSGKDMLLRIYCDKHNGRA  294

Query  608  IGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMK----HIAKILRSAI  444
               I  E+EK +L + +S    FG+  LDITI+ +M KE+ L +K     I+++LR  I
Sbjct  295  ATAILCELEKHHLTIQSSCAFPFGNNYLDITIVAKMNKEYCLTIKDLIRSISQVLRQLI  353



>gb|KEH16277.1| basic helix loop helix (bHLH) DNA-binding family protein [Medicago 
truncatula]
Length=265

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 128/200 (64%), Gaps = 3/200 (2%)
 Frame = -2

Query  1040  ETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTS  861
             E E  + +T    +S R+     H +DHI+AERKRRE L++ F+AL+ +VP L+K+DK S
Sbjct  62    EMENMNHSTQTSDESSRKRSRGNHGHDHIMAERKRREKLTQNFIALAALVPNLKKVDKYS  121

Query  860   VLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSL  681
             VL D IKYLK++++R++ LEE++ K  +ES V V K  +  DD+   S+ ++       L
Sbjct  122   VLVDAIKYLKELKKRLEELEEQNEKTKIESQVIVTKPGIYSDDNS--STCDESIHSVVGL  179

Query  680   P-EIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             P ++E R+   +IL+RI C   KG+I KI  E+++  L VVN SV  FG   +D+TII +
Sbjct  180   PFQVEARVLGKYILIRIQCQEHKGLIVKIMVEIQRFQLFVVNGSVLPFGDSLIDVTIIAQ  239

Query  503   MEKEFDLPMKHIAKILRSAI  444
             M++ +++ +K + K LR A+
Sbjct  240   MDEGYNMSIKELVKNLRMAV  259



>ref|XP_009392954.1| PREDICTED: transcription factor bHLH18-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=313

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 120/167 (72%), Gaps = 3/167 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K++    R  +H  +H++AERKRRE LS++F+ALS +VPGL+KMDK SVLGD I+YLK++
Sbjct  116   KRANMAARTASHNPEHVVAERKRREKLSQRFIALSAVVPGLKKMDKASVLGDAIEYLKRL  175

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             +E+VK+LE++ +KR  E  V VKKS++  DDDD  S            P+IE R+CD  +
Sbjct  176   EEQVKSLEDQVAKRQAEKAVLVKKSRLCADDDDSSSDEHPCGGPA---PQIEARVCDKAV  232

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             L++I+C+ +KG++ K  SE+EKL+L+V N+SV  F + +LDIT++ +
Sbjct  233   LIKIHCENRKGVLVKALSEIEKLHLSVGNTSVIPFAAASLDITVMTQ  279



>ref|XP_004233615.1| PREDICTED: transcription factor bHLH18-like [Solanum lycopersicum]
 ref|XP_010316043.1| PREDICTED: transcription factor bHLH18-like [Solanum lycopersicum]
Length=318

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 134/202 (66%), Gaps = 10/202 (5%)
 Frame = -2

Query  1028  ADTTTIKPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGD  849
             A TTT   KKS    R      DH+LAERKRRE L+++F+ALST++P L+K+DK +VLGD
Sbjct  110   AITTTTDQKKS--YNRTSVQAQDHVLAERKRRERLTQRFIALSTLIPNLKKLDKATVLGD  167

Query  848   TIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSD-----EQS  684
              I+Y+K+++E+VKTLEE++ K + E V+   K         + SS ++ +S      ++S
Sbjct  168   AIQYIKELEEQVKTLEEKNKKCSEEPVIPPAKRPRLVSSCADSSSSDEISSVSTVCTDRS  227

Query  683   LPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVE  504
             LP+IE R  D +IL+RIYC +Q G++ +IF+EVEKL+L++++ SV  FG     ITII +
Sbjct  228   LPDIEVRASDGNILIRIYCKKQNGMMKEIFNEVEKLHLSIISCSVMPFGYNTSHITIIAQ  287

Query  503   MEKEF--DLPMKHIAKILRSAI  444
             M+ +   + P  H+A  +R+A+
Sbjct  288   MDHKLTSNTP-NHVANRIRAAM  308



>ref|XP_006600899.1| PREDICTED: transcription factor bHLH25-like [Glycine max]
Length=373

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 120/183 (66%), Gaps = 4/183 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K +    R PT   DH++AERKRRE LS++F+ALS IVPGL+KMDK +VL D IKY+KQ+
Sbjct  188   KAAASTTRNPTQAQDHVIAERKRREKLSQRFIALSAIVPGLKKMDKATVLEDAIKYVKQL  247

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QERVKTLEE++  +T+ES VFVK+S V       + S     + +QSLPE+E R+    +
Sbjct  248   QERVKTLEEQAVDKTVESAVFVKRSVVFAG----VDSSSSDENSDQSLPEMEARISGKEV  303

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+RI+CD+  G    I  E+EK  L V +SS   FG+  LDITI+ +M  ++ L  K + 
Sbjct  304   LIRIHCDKNSGGAAAILRELEKHYLTVQSSSFLPFGNNTLDITIVAKMNNDYCLTAKDLI  363

Query  464   KIL  456
             + L
Sbjct  364   RSL  366



>gb|KHN01702.1| Transcription factor bHLH25 [Glycine soja]
Length=373

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 120/183 (66%), Gaps = 4/183 (2%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQI  825
             K +    R PT   DH++AERKRRE LS++F+ALS IVPGL+KMDK +VL D IKY+KQ+
Sbjct  188   KAAASTTRNPTQAQDHVIAERKRREKLSQRFIALSAIVPGLKKMDKATVLEDAIKYVKQL  247

Query  824   QERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHI  645
             QERVKTLEE++  +T+ES VFVK+S V       + S     + +QSLPE+E R+    +
Sbjct  248   QERVKTLEEQAVDKTVESAVFVKRSVVFAG----VDSSSSDENSDQSLPEMEARISGKEV  303

Query  644   LLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIA  465
             L+RI+CD+  G    I  E+EK  L V +SS   FG+  LDITI+ +M  ++ L  K + 
Sbjct  304   LIRIHCDKNSGGAAAILRELEKHYLTVQSSSFLPFGNNTLDITIVAKMNNDYCLTAKDLI  363

Query  464   KIL  456
             + L
Sbjct  364   RSL  366



>gb|ACN21641.1| putative basic helix-loop-helix protein BHLH17 [Lotus japonicus]
Length=382

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 140/240 (58%), Gaps = 30/240 (13%)
 Frame = -2

Query  1112  PNIDDVNLPELRQELLTSNAIAEQETEPADTTTIKPKKSGRRGRPPTHRYDHILAERKRR  933
             P + +VN P   ++  T N   E  T P             +G   +H  DHI+AER+RR
Sbjct  148   PQLRNVNFPAQNRKGSTQNQNFETITNPQG-----------KGSKKSHGQDHIIAERRRR  196

Query  932   ELLSRQFLALSTIVPGLRK----------------MDKTSVLGDTIKYLKQIQERVKTLE  801
             E LS+  +AL+ ++PGL+K                MDK SVLGD IKY+K ++ER++ LE
Sbjct  197   EKLSQSLIALAALIPGLKKVHHSHPFSLLSVFGFKMDKASVLGDAIKYVKVLKERLRLLE  256

Query  800   EESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGN--SDEQSLPEIETRLCDNHILLRIYC  627
             E++  R MESVV V K Q+S DD+   S  + G     E++LP +E R+ +  +LLR++C
Sbjct  257   EQNKNRAMESVVVVNKPQISNDDNSSSSC-DDGTIIGSEEALPHVEARVSEKDVLLRLHC  315

Query  626   DRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSA  447
              +QKG++ KI  E++ L+L VVNSSV  FG   LDITI+ +M  E++L +  + K LR A
Sbjct  316   KKQKGLLLKILFEIQNLHLFVVNSSVLPFGDSILDITIVAQMGAEYNLTINELVKNLRVA  375



>ref|XP_002262864.2| PREDICTED: transcription factor bHLH18 [Vitis vinifera]
Length=344

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 112/181 (62%), Gaps = 2/181 (1%)
 Frame = -2

Query  983  RPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTL  804
            R PT   +H++AERKRRE L+  F+ALS IVPGL K DK SVLGD IKYLK +QERVK L
Sbjct  161  RNPTQNQEHVIAERKRREKLNLLFIALSAIVPGLTKTDKASVLGDAIKYLKHLQERVKML  220

Query  803  EEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCD  624
            EE+++K+ +E      K     D++   S     +S  Q   EIE R+ +  +L+RI+C 
Sbjct  221  EEQTAKKMVE-SAVTVKRYQLSDNETSSSYHNSDSSSNQLFLEIEARVSNKDVLIRIHCQ  279

Query  623  RQKGIIGKIFSEVEKLNLAVVNSSVARFGSL-ALDITIIVEMEKEFDLPMKHIAKILRSA  447
            ++KG   KI  E+EKL+L V+ SS   FG    +DITI+ +M+  F    K + + LR A
Sbjct  280  KEKGFAVKILGEIEKLHLTVIKSSFLPFGEYNIMDITIVAQMDHGFCTTAKDLVRNLRLA  339

Query  446  I  444
            +
Sbjct  340  L  340



>ref|XP_009392953.1| PREDICTED: transcription factor bHLH18-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=333

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 133/217 (61%), Gaps = 31/217 (14%)
 Frame = -2

Query  1004  KKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRK-----------------  876
             K++    R  +H  +H++AERKRRE LS++F+ALS +VPGL+K                 
Sbjct  116   KRANMAARTASHNPEHVVAERKRREKLSQRFIALSAVVPGLKKVRSWIGSSFLLRQRSTR  175

Query  875   -----------MDKTSVLGDTIKYLKQIQERVKTLEEESSKRTMEsvvfvkksqvsFDDD  729
                        MDK SVLGD I+YLK+++E+VK+LE++ +KR  E  V VKKS++  DDD
Sbjct  176   LIDLQISTPWKMDKASVLGDAIEYLKRLEEQVKSLEDQVAKRQAEKAVLVKKSRLCADDD  235

Query  728   DEMSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSV  549
             D  S            P+IE R+CD  +L++I+C+ +KG++ K  SE+EKL+L+V N+SV
Sbjct  236   DSSSDEHPCGGPA---PQIEARVCDKAVLIKIHCENRKGVLVKALSEIEKLHLSVGNTSV  292

Query  548   ARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQH  438
               F + +LDIT++ +ME+EF +  K + K L SA + 
Sbjct  293   IPFAAASLDITVMTQMEEEFCVTAKEVVKKLNSAFRQ  329



>gb|AAD11428.1| transporter homolog [Mesembryanthemum crystallinum]
Length=300

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = -2

Query  962  DHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLKQIQERVKTLEEESSKR  783
            +H+LAERKRRE ++++F ALS +VPGL+KMDK S+LGD  KYLKQ++E+VK LEE+++ R
Sbjct  118  EHVLAERKRREKMTQRFHALSALVPGLKKMDKASILGDAAKYLKQLEEQVKLLEEQTASR  177

Query  782  TMEsvvfvkksqvsFDDDDE----MSSGEKGNSDEQSLPEIETRLCDNHILLRIYCDRQK  615
            T+ESVV VK S V   + D      S+    +S    L EIE   C+N++L+RI+  + +
Sbjct  178  TVESVVLVKNSNVQDPNLDHGGNSSSNENSNSSLNNPLLEIEAGACNNNVLIRIHAQKDQ  237

Query  614  GIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDLPMKHIAKILRSAIQHA  435
             ++ K+ +E+E L+L  +N +   FG  A+DITI+ +M+ +F+L +K +   LR A+Q  
Sbjct  238  DLVRKVLNEIENLHLTTLNFNTIPFGGYAMDITIVAQMDDDFELTIKDVVMHLRLALQQC  297

Query  434  AQT  426
            + T
Sbjct  298  SNT  300



>gb|KCW59636.1| hypothetical protein EUGRSUZ_H02386 [Eucalyptus grandis]
Length=351

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 123/193 (64%), Gaps = 4/193 (2%)
 Frame = -2

Query  1010  KPKKSGRRGRPPTHRYDHILAERKRRELLSRQFLALSTIVPGLRKMDKTSVLGDTIKYLK  831
             K K +    R P H  +H+LAERKRRE +S++ +ALS I+P L+KMDK S+L D I++LK
Sbjct  155   KTKNTSAATRTPVHAQEHVLAERKRREKISKRLIALSAIIPNLKKMDKASILEDAIEHLK  214

Query  830   QIQERVKTLEEESSKRTMEsvvfvkksqvsFDDDDEMSSGEKGNSDE----QSLPEIETR  663
             ++Q+RVK LEEE++       V V K      D+D  SS ++ +  +     SLPEIE R
Sbjct  215   ELQQRVKALEEEAAAAKTVESVVVVKKSQLTTDEDTYSSSDEHSCSQIDRPLSLPEIEAR  274

Query  662   LCDNHILLRIYCDRQKGIIGKIFSEVEKLNLAVVNSSVARFGSLALDITIIVEMEKEFDL  483
             +  N +L++I+C+R+ G + K+  E+E+LNL VVNS +  FGS  LD+TI+ +M+    L
Sbjct  275   VSGNCVLIKIHCERRNGSVSKMIGEIEELNLTVVNSCIMPFGSSILDVTILAQMDVGSSL  334

Query  482   PMKHIAKILRSAI  444
              M  + + LR A+
Sbjct  335   KMGDLVRNLRQAL  347



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4152661970184