BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23878_g1_i2 len=937 path=[2103:0-218 2322:219-219 2323:220-243
382:244-467 2898:468-500 @639@!:501-851 990:852-852 991:853-936]

Length=937
                                                                      Score     E

ref|XP_009798081.1|  PREDICTED: high-affinity nitrate transporter...    237   8e-74   
gb|KHG18250.1|  High-affinity nitrate transporter 3.2 -like protein     236   2e-73   
gb|AAM12786.1|  unknown                                                 235   5e-73   Capsicum annuum
ref|XP_009610897.1|  PREDICTED: high-affinity nitrate transporter...    233   3e-72   
emb|CDP12708.1|  unnamed protein product                                233   3e-72   
ref|XP_007037769.1|  Nitrate transmembrane transporters                 229   2e-70   
ref|XP_003549822.1|  PREDICTED: high-affinity nitrate transporter...    229   2e-70   
ref|XP_003525590.1|  PREDICTED: high-affinity nitrate transporter...    229   2e-70   
dbj|BAI63584.1|  component of high affinity nitrate transporter         228   5e-70   Lotus japonicus
ref|XP_009789615.1|  PREDICTED: high-affinity nitrate transporter...    227   9e-70   
ref|XP_010027193.1|  PREDICTED: high-affinity nitrate transporter...    227   1e-69   
gb|AFK48944.1|  unknown                                                 226   2e-69   
emb|CDP12709.1|  unnamed protein product                                228   3e-69   
ref|XP_009798083.1|  PREDICTED: high-affinity nitrate transporter...    225   4e-69   
ref|XP_004299149.1|  PREDICTED: high-affinity nitrate transporter...    225   8e-69   
gb|AFK44790.1|  unknown                                                 224   1e-68   
ref|XP_010319027.1|  PREDICTED: high-affinity nitrate transporter...    224   1e-68   
ref|XP_006476900.1|  PREDICTED: high-affinity nitrate transporter...    224   2e-68   
gb|KDP31017.1|  hypothetical protein JCGZ_11393                         222   9e-68   
ref|XP_002511305.1|  conserved hypothetical protein                     222   1e-67   Ricinus communis
ref|XP_006344484.1|  PREDICTED: high-affinity nitrate transporter...    221   1e-67   
gb|KDO69464.1|  hypothetical protein CISIN_1g028785mg                   221   1e-67   
ref|XP_011046245.1|  PREDICTED: high-affinity nitrate transporter...    221   2e-67   
ref|XP_007155490.1|  hypothetical protein PHAVU_003G205900g             221   2e-67   
ref|XP_009610896.1|  PREDICTED: high-affinity nitrate transporter...    219   1e-66   
ref|XP_002318088.2|  hypothetical protein POPTR_0012s09110g             219   1e-66   Populus trichocarpa [western balsam poplar]
emb|CAN71077.1|  hypothetical protein VITISV_021663                     219   2e-66   Vitis vinifera
ref|XP_002279861.1|  PREDICTED: high-affinity nitrate transporter...    219   2e-66   Vitis vinifera
ref|XP_011015287.1|  PREDICTED: high-affinity nitrate transporter...    218   2e-66   
ref|XP_011040463.1|  PREDICTED: high-affinity nitrate transporter...    217   6e-66   
ref|XP_008439011.1|  PREDICTED: high-affinity nitrate transporter...    217   1e-65   
ref|XP_010251031.1|  PREDICTED: high-affinity nitrate transporter...    216   2e-65   
ref|XP_011046246.1|  PREDICTED: high-affinity nitrate transporter...    216   3e-65   
ref|XP_010248677.1|  PREDICTED: high-affinity nitrate transporter...    216   3e-65   
ref|NP_001267619.1|  high-affinity nitrate transporter 3.1-like p...    215   6e-65   
ref|XP_002321640.2|  hypothetical protein POPTR_0015s09660g             214   8e-65   Populus trichocarpa [western balsam poplar]
ref|XP_006374542.1|  hypothetical protein POPTR_0015s09670g             214   1e-64   
ref|XP_011086669.1|  PREDICTED: high-affinity nitrate transporter...    211   1e-63   
ref|XP_004515861.1|  PREDICTED: high-affinity nitrate transporter...    211   3e-63   
ref|XP_009404237.1|  PREDICTED: high-affinity nitrate transporter...    209   5e-63   
ref|XP_009362926.1|  PREDICTED: high-affinity nitrate transporter...    208   2e-62   
ref|XP_008392882.1|  PREDICTED: high-affinity nitrate transporter...    208   2e-62   
ref|XP_008239345.1|  PREDICTED: high-affinity nitrate transporter...    208   2e-62   
ref|XP_007209613.1|  hypothetical protein PRUPE_ppa011598mg             208   3e-62   
ref|XP_010102954.1|  hypothetical protein L484_018973                   207   6e-62   
ref|XP_008374376.1|  PREDICTED: high-affinity nitrate transporter...    206   1e-61   
ref|XP_008360776.1|  PREDICTED: high-affinity nitrate transporter...    206   1e-61   
ref|XP_008793734.1|  PREDICTED: high-affinity nitrate transporter...    205   2e-61   
ref|XP_010929915.1|  PREDICTED: high-affinity nitrate transporter...    205   2e-61   
gb|EYU22193.1|  hypothetical protein MIMGU_mgv1a019693mg                204   6e-61   
ref|XP_009333929.1|  PREDICTED: high-affinity nitrate transporter...    204   1e-60   
ref|XP_006344486.1|  PREDICTED: high-affinity nitrate transporter...    203   2e-60   
gb|AFK41592.1|  unknown                                                 201   1e-59   
ref|XP_011071967.1|  PREDICTED: high-affinity nitrate transporter...    201   2e-59   
gb|EYU22284.1|  hypothetical protein MIMGU_mgv1a025936mg                200   2e-59   
ref|XP_011101276.1|  PREDICTED: high-affinity nitrate transporter...    199   4e-59   
dbj|BAP74416.1|  nitrate transporter                                    199   5e-59   
ref|XP_006853022.1|  hypothetical protein AMTR_s00174p00057530          197   5e-58   
ref|XP_009415973.1|  PREDICTED: high-affinity nitrate transporter...    196   1e-57   
gb|EYU22195.1|  hypothetical protein MIMGU_mgv1a013911mg                196   1e-57   
gb|EYU34506.1|  hypothetical protein MIMGU_mgv1a014017mg                195   2e-57   
gb|EYU22194.1|  hypothetical protein MIMGU_mgv1a026235mg                195   2e-57   
ref|XP_011039571.1|  PREDICTED: high-affinity nitrate transporter...    192   1e-56   
ref|XP_006852328.1|  hypothetical protein AMTR_s00049p00207930          193   1e-56   
ref|XP_010555506.1|  PREDICTED: high-affinity nitrate transporter...    189   7e-55   
ref|XP_009379949.1|  PREDICTED: high-affinity nitrate transporter...    182   2e-52   
gb|EYU17760.1|  hypothetical protein MIMGU_mgv1a013981mg                182   3e-52   
ref|XP_010448529.1|  PREDICTED: high-affinity nitrate transporter...    181   7e-52   
ref|XP_006281099.1|  hypothetical protein CARUB_v10027129mg             180   2e-51   
emb|CDY34047.1|  BnaC03g27680D                                          179   3e-51   
ref|XP_008798750.1|  PREDICTED: high-affinity nitrate transporter...    178   2e-50   
ref|XP_010448530.1|  PREDICTED: high-affinity nitrate transporter...    177   2e-50   
emb|CDY64637.1|  BnaA03g57010D                                          177   3e-50   
ref|XP_009134048.1|  PREDICTED: high-affinity nitrate transporter...    177   3e-50   
ref|XP_010448528.1|  PREDICTED: high-affinity nitrate transporter...    177   3e-50   
ref|XP_006284533.1|  hypothetical protein CARUB_v10005735mg             176   7e-50   
ref|XP_004301016.1|  PREDICTED: high-affinity nitrate transporter...    176   7e-50   
ref|XP_009138452.1|  PREDICTED: high-affinity nitrate transporter...    176   9e-50   
gb|EYU28626.1|  hypothetical protein MIMGU_mgv1a0249302mg               172   3e-49   
ref|XP_010433732.1|  PREDICTED: high-affinity nitrate transporter...    174   4e-49   
ref|XP_010438981.1|  PREDICTED: high-affinity nitrate transporter...    174   5e-49   
ref|XP_002867650.1|  predicted protein                                  173   7e-49   
ref|XP_010441706.1|  PREDICTED: high-affinity nitrate transporter...    173   8e-49   
sp|Q9SB67.1|NRT32_ARATH  RecName: Full=High-affinity nitrate tran...    173   1e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34305.1|  BnaA01g14080D                                          174   1e-48   
gb|KFK26653.1|  hypothetical protein AALP_AA8G276000                    172   1e-48   
emb|CDX83019.1|  BnaA01g20190D                                          172   2e-48   
emb|CDY03424.1|  BnaC01g16580D                                          172   2e-48   
gb|ABF59166.1|  hypothetical protein At4g24720                          172   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190826.1|  calcineurin-like metallo-phosphoesterase sup...    172   3e-48   
ref|XP_006402168.1|  hypothetical protein EUTSA_v10014669mg             171   7e-48   
ref|XP_002864044.1|  wound-responsive 3                                 170   1e-47   
ref|XP_010438982.1|  PREDICTED: high-affinity nitrate transporter...    169   4e-47   
ref|NP_199831.1|  high-affinity nitrate transporter 3.1                 168   6e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CAC36942.1|  putative component of high affinity nitrate tran...    168   6e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438980.1|  PREDICTED: high-affinity nitrate transporter...    169   8e-47   
ref|XP_010433734.1|  PREDICTED: high-affinity nitrate transporter...    167   2e-46   
gb|AAM62807.1|  putative component of high affinity nitrate trans...    167   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150665.1|  PREDICTED: high-affinity nitrate transporter...    166   4e-46   
ref|XP_009127362.1|  PREDICTED: high-affinity nitrate transporter...    166   8e-46   
emb|CDX91545.1|  BnaC02g16150D                                          164   2e-45   
emb|CDX71613.1|  BnaC09g26540D                                          163   7e-45   
ref|XP_009118895.1|  PREDICTED: high-affinity nitrate transporter...    162   1e-44   
ref|XP_002978289.1|  hypothetical protein SELMODRAFT_152440             159   2e-43   
ref|XP_010446000.1|  PREDICTED: high-affinity nitrate transporter...    157   4e-43   
ref|XP_002966283.1|  hypothetical protein SELMODRAFT_227648             158   6e-43   
gb|EAY86523.1|  hypothetical protein OsI_07902                          157   2e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_009138456.1|  PREDICTED: manganese-dependent ADP-ribose/CD...    162   2e-42   
ref|NP_001047317.1|  Os02g0595900                                       156   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952977.1|  PREDICTED: high-affinity nitrate transporter...    154   2e-41   
ref|NP_194204.2|  calcineurin-like metallo-phosphoesterase superf...    159   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647452.1|  PREDICTED: high-affinity nitrate transporter...    153   4e-41   
gb|AFW72145.1|  high affinity nitrate transporter                       153   4e-41   
ref|NP_001105929.1|  high affinity nitrate transporter precursor        152   5e-41   Zea mays [maize]
ref|XP_003575282.1|  PREDICTED: high-affinity nitrate transporter...    149   8e-40   
ref|XP_004952978.1|  PREDICTED: high-affinity nitrate transporter...    147   6e-39   
ref|XP_010910986.1|  PREDICTED: high-affinity nitrate transporter...    145   9e-39   
ref|XP_003575281.1|  PREDICTED: high-affinity nitrate transporter...    145   5e-38   
gb|AAV35211.1|  NAR2.2                                                  144   5e-38   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105924.1|  high affinity nitrate transporter precursor        144   6e-38   Zea mays [maize]
tpg|DAA37306.1|  TPA: high affinity nitrate transporter                 144   6e-38   
gb|ACG30087.1|  component of high affinity nitrate transporter          144   7e-38   Zea mays [maize]
gb|EMT31108.1|  hypothetical protein F775_20186                         142   7e-37   
ref|XP_002454118.1|  hypothetical protein SORBIDRAFT_04g024870          142   8e-37   Sorghum bicolor [broomcorn]
ref|XP_002448046.1|  hypothetical protein SORBIDRAFT_06g020180          141   1e-36   Sorghum bicolor [broomcorn]
ref|XP_010667500.1|  PREDICTED: high-affinity nitrate transporter...    140   2e-36   
gb|EMS58629.1|  hypothetical protein TRIUR3_20504                       141   3e-36   
ref|XP_006828375.1|  hypothetical protein AMTR_s00188p00036850          137   4e-36   
gb|AAP31852.1|  NAR2.3                                                  139   4e-36   Hordeum vulgare subsp. vulgare [barley]
gb|AAV35210.1|  NAR2.1                                                  139   4e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AAP31851.1|  NAR2.2                                                  138   2e-35   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006438234.1|  hypothetical protein CICLE_v10033654mg             136   2e-35   
ref|XP_006413394.1|  hypothetical protein EUTSA_v10027123mg             135   6e-35   
gb|AAP31850.1|  NAR2.1                                                  135   2e-34   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006828371.1|  hypothetical protein AMTR_s00188p00033950          131   9e-34   
ref|XP_001771033.1|  predicted protein                                  126   6e-31   
gb|EAY94557.1|  hypothetical protein OsI_16333                          124   4e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001053099.1|  Os04g0480200                                       124   5e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001768154.1|  predicted protein                                  122   2e-29   
ref|XP_001755294.1|  predicted protein                                  113   3e-26   
ref|XP_006849233.1|  hypothetical protein AMTR_s00027p00233840          114   3e-26   
ref|XP_010438977.1|  PREDICTED: high-affinity nitrate transporter...    108   6e-25   
gb|EMT33608.1|  hypothetical protein F775_27090                         102   5e-23   
gb|EMS60424.1|  hypothetical protein TRIUR3_22380                       102   6e-23   
ref|XP_004301017.1|  PREDICTED: high-affinity nitrate transporter...  99.0    3e-21   
ref|XP_010497940.1|  PREDICTED: high-affinity nitrate transporter...  89.4    6e-19   
gb|KDO82198.1|  hypothetical protein CISIN_1g0417871mg                85.1    1e-17   
gb|AGG68805.1|  putative nitrate transporter                          84.0    6e-17   
emb|CDY05799.1|  BnaA10g06210D                                        84.7    6e-17   
gb|AFG50499.1|  hypothetical protein CL2980Contig1_03                 82.8    1e-16   
gb|AFG50498.1|  hypothetical protein CL2980Contig1_03                 82.4    2e-16   
gb|AEW08990.1|  hypothetical protein CL2980Contig1_03                 81.6    4e-16   
gb|EAZ31107.1|  hypothetical protein OsJ_15203                        84.0    9e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EMT09919.1|  hypothetical protein F775_19205                       64.3    5e-09   
gb|KDO82197.1|  hypothetical protein CISIN_1g0417872mg                59.7    6e-08   
ref|XP_007514579.1|  predicted protein                                51.6    2e-04   
ref|XP_003058320.1|  nitrate high-affinity transporter accessory ...  50.4    5e-04   



>ref|XP_009798081.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Nicotiana 
sylvestris]
Length=204

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  816  SLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSS  637
            SL++ C  A+ + E+LFSSLKRSLDVS  H++G VL AG+D++ + WS+N + PA  DSS
Sbjct  11   SLVIACFIASCHAEILFSSLKRSLDVSASHREG-VLMAGEDQLILKWSFNKTFPAGADSS  69

Query  636  YKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTA  457
            YK VKV+LCYAPVSQ DRAWRKTEDHLKKDK+CQ  I T PY    N+  WTIERD+PT 
Sbjct  70   YKKVKVQLCYAPVSQKDRAWRKTEDHLKKDKTCQLNIVTMPYKSSGNSFNWTIERDIPTG  129

Query  456  TFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            T+FVR Y  ++D HE G+GQNTD KK  NLF ++AI+GRHATLDIC
Sbjct  130  TYFVRAYVLDSDGHETGFGQNTDDKKIDNLFDIQAISGRHATLDIC  175



>gb|KHG18250.1| High-affinity nitrate transporter 3.2 -like protein [Gossypium 
arboreum]
Length=203

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = -2

Query  813  LLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSY  634
            L+  C A T YG + FSSL+R+L V+  H+QG +LKAG+D+IT+ W  N S PA T SSY
Sbjct  12   LIFSCFAETCYGVISFSSLQRTLVVTASHRQG-LLKAGEDKITVRWGLNQSFPAGTYSSY  70

Query  633  KSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTAT  454
            K++KV+LCYAP+SQVDRAWRKTEDHL KDK+CQF I  KPY     TL+WTIERDVPTAT
Sbjct  71   KTIKVQLCYAPISQVDRAWRKTEDHLNKDKTCQFKIVKKPYTNVNETLEWTIERDVPTAT  130

Query  453  FFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            FF+R YA ++DDHEV YGQNTDA+K  NLF+++AITGRH +LDI
Sbjct  131  FFIRAYALDSDDHEVAYGQNTDAEKKTNLFEIQAITGRHVSLDI  174



>gb|AAM12786.1| unknown [Capsicum annuum]
Length=202

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 133/171 (78%), Gaps = 3/171 (2%)
 Frame = -2

Query  831  FLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPA  652
            FL T  L++CC  ++++ E+LFSSLK+SL+V+VKH+ G VL AG+D + I W  N + PA
Sbjct  8    FLAT--LVICCSLSSSHAEILFSSLKKSLEVTVKHRAG-VLMAGEDTLEIDWFLNKTFPA  64

Query  651  KTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIER  472
             TDS+YK++K+KLCYAP+SQ DRAWRKTEDH+KKDK+CQF + + PY    N   WTIER
Sbjct  65   GTDSAYKTIKLKLCYAPISQKDRAWRKTEDHIKKDKTCQFQVDSTPYKSSNNKFNWTIER  124

Query  471  DVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            DVPT TFFVR Y  N D HE+GYGQNTD KK  NLF ++AI+GRHATLDIC
Sbjct  125  DVPTGTFFVRAYILNGDGHEIGYGQNTDDKKVNNLFDIQAISGRHATLDIC  175



>ref|XP_009610897.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Nicotiana 
tomentosiformis]
Length=204

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 129/170 (76%), Gaps = 1/170 (1%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            +   S+++ C  A+ + E+LFSSLK+SLD+S  H++G VL AG+D+I + WS+N + PA 
Sbjct  7    IFVVSVVISCFLASCHAEILFSSLKKSLDISASHREG-VLMAGEDQIILEWSFNKTFPAG  65

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERD  469
             DSSYK VKV LCYAP+SQ DR WRKTEDHLKKDK+CQF I T PY    N+  WTIERD
Sbjct  66   ADSSYKKVKVHLCYAPISQKDRLWRKTEDHLKKDKTCQFNIVTMPYKSSGNSFNWTIERD  125

Query  468  VPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            VPT T+F+R Y  ++D HE G+GQNTD KK  NLF ++AI+GRH+TLDIC
Sbjct  126  VPTGTYFIRAYVLDSDGHETGFGQNTDEKKIDNLFDIQAISGRHSTLDIC  175



>emb|CDP12708.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = -2

Query  837  GGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSS  658
            GGFLV   L+L CLAA++ G V FSSL+R+L V     QGQVLKAG+D+IT+TWSYN++ 
Sbjct  4    GGFLVAL-LVLSCLAASSNG-VTFSSLQRTLIVRASPTQGQVLKAGEDKITVTWSYNNTL  61

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTI  478
               TDS+YK++KVKLCYAP+SQVDRAWRKT D L KDK+CQF I  KPY+   +T+ WTI
Sbjct  62   APGTDSTYKTIKVKLCYAPISQVDRAWRKTVDDLAKDKTCQFKIVAKPYSASNSTITWTI  121

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ERD PTAT+F+R YA+N+ + EV +GQ TDA KT NLFQVEAI+GRHA+LDI
Sbjct  122  ERDTPTATYFLRAYAFNSAEEEVAFGQTTDAHKTTNLFQVEAISGRHASLDI  173



>ref|XP_007037769.1| Nitrate transmembrane transporters [Theobroma cacao]
 gb|EOY22270.1| Nitrate transmembrane transporters [Theobroma cacao]
Length=202

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = -2

Query  801  CLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVK  622
            C A T YG + FSSL R+L V+  H+QG +LKA +D+IT+ W  N S PA TDS+Y ++K
Sbjct  16   CFAET-YGMISFSSLPRTLVVTASHRQG-LLKADEDKITVIWGLNQSFPAGTDSAYTTIK  73

Query  621  VKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVR  442
            VKLCYAP+SQVDRAWRKT DHL KDK+CQF I ++PY+    T +WTIERDVPTAT+FVR
Sbjct  74   VKLCYAPISQVDRAWRKTVDHLSKDKTCQFKIVSRPYSNTNQTFQWTIERDVPTATYFVR  133

Query  441  VYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             YA+NA+DHEV YGQNTDAKKT NLF+++AITGRH +LDI
Sbjct  134  AYAFNAEDHEVAYGQNTDAKKTTNLFEIQAITGRHVSLDI  173



>ref|XP_003549822.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Glycine 
max]
Length=208

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 138/175 (79%), Gaps = 3/175 (2%)
 Frame = -2

Query  834  GFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSP  655
            G +V  SLL+ CLA + YG+V FSSLKR+LDV+   KQ QVL+AG D+IT+TW+ N + P
Sbjct  5    GPVVVASLLIFCLAGSCYGKVHFSSLKRTLDVTASPKQEQVLEAGLDKITVTWALNKTLP  64

Query  654  AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLK---W  484
            A TDS+YK++K+KLCYAP+SQ DRAWRKTED LK+DK+CQ  I  KPY+    T++   W
Sbjct  65   AGTDSAYKTIKLKLCYAPISQKDRAWRKTEDELKRDKTCQHKIVAKPYDASNKTVQRFEW  124

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             +ERDVP AT+FVR YA++++D EV YGQ TDAKK+ NLF++ A++GRHA+LDIC
Sbjct  125  LVERDVPKATYFVRAYAFDSNDEEVAYGQTTDAKKSTNLFEINAVSGRHASLDIC  179



>ref|XP_003525590.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Glycine 
max]
Length=208

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = -2

Query  834  GFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSP  655
            G +V  SLL+ CLA + YG+V FS+LKR+LDV+   KQGQVL+AG D+IT+TW+ N + P
Sbjct  5    GLVVVASLLIFCLAGSCYGKVHFSTLKRTLDVTASPKQGQVLEAGLDKITVTWALNKTLP  64

Query  654  AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLK---W  484
            A TDS+YK++K+KLCYAP+SQ DRAWRKTED L +DK+CQ  I  KPY+    T++   W
Sbjct  65   AGTDSAYKTIKLKLCYAPISQKDRAWRKTEDELNRDKTCQHKIVAKPYDASNKTVQRYEW  124

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             +ERDVP AT+FVR YA++++D EV YGQ TD KK+ NLF++ A++GRHA+LDIC
Sbjct  125  LVERDVPKATYFVRAYAFDSNDAEVAYGQTTDGKKSTNLFEINAVSGRHASLDIC  179



>dbj|BAI63584.1| component of high affinity nitrate transporter [Lotus japonicus]
Length=202

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 135/173 (78%), Gaps = 3/173 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            ++  + LL CLA T YG+VLFSSLK++LDV+   K GQV++AG D IT+TW+ N + PA 
Sbjct  6    VIIIASLLFCLAGTCYGKVLFSSLKKTLDVTASPKHGQVVEAGLDTITVTWALNKTLPAG  65

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY---NPKPNTLKWTI  478
            TDSSYK++KVKLCYAP+SQ DRAWRKTED L +DK+CQ  I  KPY   N   +T +W I
Sbjct  66   TDSSYKTIKVKLCYAPISQQDRAWRKTEDELSRDKTCQHKIVAKPYDASNKTVHTFEWLI  125

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            ERDVP AT+FVR YA +++D +VGYGQ +DAKKT NLF+++AITGRH +LDIC
Sbjct  126  ERDVPEATYFVRAYALDSNDVQVGYGQTSDAKKTSNLFKIQAITGRHLSLDIC  178



>ref|XP_009789615.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Nicotiana 
sylvestris]
Length=203

 Score =   227 bits (578),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = -2

Query  831  FLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPA  652
            FLV  +LLL CLAAT++GE+LFSSLK SL VS  H+QG VLKAG+ +IT+TWSY SS+ A
Sbjct  6    FLVA-TLLLSCLAATSHGEILFSSLKSSLLVSASHRQG-VLKAGEGDITLTWSYKSSNLA  63

Query  651  KTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIER  472
             TDS+YK+VK+KLCYAP+SQ DRAWR+TEDHLKKDK+CQF I TKPY    N   WTIER
Sbjct  64   GTDSTYKTVKLKLCYAPISQKDRAWRRTEDHLKKDKTCQFDIVTKPYKSANNNFTWTIER  123

Query  471  DVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            DVPT T+FVR YA N+   E GYGQNT+A+KT +LF+V+AI+GRHATLDIC
Sbjct  124  DVPTGTYFVRAYALNSAGEESGYGQNTNAEKTDDLFEVQAISGRHATLDIC  174



>ref|XP_010027193.1| PREDICTED: high-affinity nitrate transporter 3.1 [Eucalyptus 
grandis]
 gb|KCW83278.1| hypothetical protein EUGRSUZ_B00213 [Eucalyptus grandis]
Length=205

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -2

Query  816  SLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSS  637
            SL+L CLA   YG VLFSSL+ +L VS   + GQVLKAG+D+IT+TW YN S PA TDS+
Sbjct  10   SLVLACLAQACYGNVLFSSLQGTLIVSASSQPGQVLKAGEDKITVTWRYNQSFPAGTDSA  69

Query  636  YKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTA  457
            YK+V+VKLCYAPVSQVDRAWRKT D+L KDK+CQ  I ++PY+P   + +W +++DVP A
Sbjct  70   YKTVQVKLCYAPVSQVDRAWRKTVDNLAKDKTCQHAITSRPYSPADQSYEWLVQKDVPEA  129

Query  456  TFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            T+FVR YA NA+  +VG+GQ TD  KT +LFQV+AITGRHA+LDI
Sbjct  130  TYFVRAYALNAEGVQVGFGQTTDKNKTTDLFQVQAITGRHASLDI  174



>gb|AFK48944.1| unknown [Lotus japonicus]
Length=202

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 134/173 (77%), Gaps = 3/173 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            ++  + LL CLA T YG+VLFSSLK++LDV+   K GQV++AG D IT+TW+ N + PA 
Sbjct  6    VIIMASLLFCLAGTCYGKVLFSSLKKTLDVTASPKHGQVVEAGLDAITVTWALNKTLPAG  65

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY---NPKPNTLKWTI  478
            TDSSYK++KVKLCYAP+SQ DRAWRKTED L +DK+CQ  I  KPY   N   +T +W I
Sbjct  66   TDSSYKTIKVKLCYAPISQQDRAWRKTEDELSRDKTCQHKIVAKPYDASNKTVHTFEWLI  125

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            ERDVP AT+FVR YA +++D +VGYGQ +DAKKT NLF+++AITGRH +LD C
Sbjct  126  ERDVPEATYFVRAYALDSNDVQVGYGQTSDAKKTSNLFKIQAITGRHLSLDTC  178



>emb|CDP12709.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            L+  S++L CL AT+YG   FSSL R+L V+     GQV+K+G+D+IT++WSYN++    
Sbjct  66   LLVSSIVLSCLVATSYGAT-FSSLMRTLVVTASPAAGQVVKSGEDKITVSWSYNNTFARG  124

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNP-KPNTLKWTIER  472
            TDS+YK++KVKLCYAP+SQVDRAWRKT D L KDK+CQF I TKPYNP   NT  WT+ER
Sbjct  125  TDSTYKTIKVKLCYAPISQVDRAWRKTVDDLSKDKTCQFNIVTKPYNPSNNNTFTWTVER  184

Query  471  DVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            D PTAT+FVR YAYN+ + EVG+GQ TD+ KT NLF+V AI+GRH +LDI 
Sbjct  185  DTPTATYFVRAYAYNSAEEEVGFGQTTDSHKTTNLFEVHAISGRHTSLDIA  235



>ref|XP_009798083.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Nicotiana sylvestris]
Length=205

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA   GF V  +++L C A TAY   LFSSL ++L ++    QGQVL+AG+ ++TITWS 
Sbjct  1    MATFSGFFVASTVVLFCFALTAY-SALFSSLHQTLILNSSPSQGQVLQAGEGQVTITWSL  59

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            N S+PA TDS+YK+VKVKLCYAP+SQVDR WRK++D+L+KDKSC++ I T PYN   N  
Sbjct  60   NKSNPAGTDSNYKTVKVKLCYAPISQVDRGWRKSDDNLEKDKSCKYNIVTMPYNSLNNNF  119

Query  489  KWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             WT+ +DVPTAT+F+R Y Y++   EV YGQ TD+ K  NLFQ+ AITGRH TLDIC
Sbjct  120  TWTVNKDVPTATYFIRAYVYDSAGEEVAYGQTTDSHKKTNLFQILAITGRHVTLDIC  176



>ref|XP_004299149.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Fragaria 
vesca subsp. vesca]
Length=210

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKH--KQGQVLKAGDDEITITW  676
            MA   G L+   L+L CLA T+YG VLFSSLK++L V+  H    G +LKAG+D+I++TW
Sbjct  1    MASRVGILLASVLVLSCLAGTSYG-VLFSSLKQTLVVTTTHVAANGTLLKAGEDKISVTW  59

Query  675  SYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPN  496
              N S PA TDS+YK+VKVKLCYAPVSQVDR WRKT D+L KDK+CQ  I  +PYN    
Sbjct  60   GLNQSLPAGTDSAYKTVKVKLCYAPVSQVDRGWRKTVDNLVKDKTCQKKIVARPYNASTE  119

Query  495  TLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            T +WTIERDVPT  +FVR YA++A+  EV YGQNT AKK  NLF+V++ITGRH TLDI
Sbjct  120  TFEWTIERDVPTGKYFVRTYAFDAEGVEVAYGQNTGAKKDSNLFEVQSITGRHVTLDI  177



>gb|AFK44790.1| unknown [Medicago truncatula]
 gb|KEH31764.1| component of high affinity nitrate transporter [Medicago truncatula]
Length=206

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 133/173 (77%), Gaps = 3/173 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            LV  SLLLCCLA   YG+ LFSSLKR++DV+   KQGQVL +G D+I+ TW+ N + PA 
Sbjct  6    LVVASLLLCCLAEICYGKDLFSSLKRTIDVTASPKQGQVLLSGVDKISGTWALNKTFPAG  65

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLK---WTI  478
            TDSSYK++K+KLCYAP+SQ DRAWRKTED L +DK+CQ  +   PYN    T++   W I
Sbjct  66   TDSSYKTIKLKLCYAPISQKDRAWRKTEDELSRDKTCQHKMLAMPYNASNKTVQTFEWLI  125

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +RDVP AT+FVR YA++++D EV YGQ T+A K+ NLF++ AI+GRHATLDIC
Sbjct  126  QRDVPQATYFVRAYAFDSNDKEVAYGQTTNAGKSTNLFEINAISGRHATLDIC  178



>ref|XP_010319027.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Solanum 
lycopersicum]
Length=203

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  816  SLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSS  637
            ++++C   A   G++LFS+LK+S++V   HK G VL AG D +T+ WS N++ PA +DS 
Sbjct  12   TIVICSFLAVCEGDILFSTLKKSIEVKADHKAG-VLMAGVDALTLKWSLNTTLPAGSDSG  70

Query  636  YKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTA  457
            YKSVK++LCYAP+SQ DRAWRKTEDHLKKDK+CQF IAT PY    N   WTI+RD+PTA
Sbjct  71   YKSVKLELCYAPISQKDRAWRKTEDHLKKDKTCQFKIATVPYKSSNNNYNWTIKRDIPTA  130

Query  456  TFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            T+FVR Y  N +  E+GYGQNTD KK  NLF ++AI+GRHATLDIC
Sbjct  131  TYFVRAYVLNGNGEEIGYGQNTDDKKVDNLFSIQAISGRHATLDIC  176



>ref|XP_006476900.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Citrus 
sinensis]
Length=204

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 131/176 (74%), Gaps = 2/176 (1%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA  G  L+  S+ L  L    YG  LFSSL+++L V+   K+GQVLKAG+D++TITW  
Sbjct  1    MAARG--LLLASIYLSLLMHECYGVTLFSSLQKTLQVTTTTKRGQVLKAGEDKVTITWGL  58

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            N S  A TDS+YK+VKV+LC+APVSQ DRAWRKTEDHL KDK+C F I  KPYN    TL
Sbjct  59   NQSLAAGTDSAYKTVKVQLCFAPVSQKDRAWRKTEDHLNKDKTCSFKIVEKPYNKSLQTL  118

Query  489  KWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             W IE DVPTAT+FVR YA NA+ HEV YGQ+T+ +KT NLF ++AITGRHA+LDI
Sbjct  119  DWIIESDVPTATYFVRAYALNAERHEVAYGQSTNDQKTTNLFDIQAITGRHASLDI  174



>gb|KDP31017.1| hypothetical protein JCGZ_11393 [Jatropha curcas]
Length=206

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 132/179 (74%), Gaps = 4/179 (2%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA  G FL   S+LL     ++YG + FSSL+++L V+     GQVLKAG D IT+TW  
Sbjct  1    MAPRGLFLA--SILLFAFFGSSYGVIHFSSLQKTLLVTASPSPGQVLKAGVDNITVTWGL  58

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNP--KPN  496
            N S PA TDS+YK++K+KLCYAPVSQ DRAWRKTED+L KDK+CQ  I TKPY+   K N
Sbjct  59   NQSLPAGTDSAYKTIKIKLCYAPVSQKDRAWRKTEDNLSKDKTCQVKIVTKPYSSANKNN  118

Query  495  TLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +  WT+ERDVPTAT+FVR YA+NA++ EV YGQ TD  KT N F ++AITGRHA+LDI 
Sbjct  119  SFTWTVERDVPTATYFVRAYAFNANEQEVAYGQTTDVHKTTNFFDIQAITGRHASLDIA  177



>ref|XP_002511305.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51907.1| conserved hypothetical protein [Ricinus communis]
Length=207

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 134/178 (75%), Gaps = 3/178 (2%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA+  GFL+  S+L+ CL  ++YG + FSSLK +L V+      QVLK G D IT+TW  
Sbjct  1    MARASGFLLA-SVLISCLFGSSYGFIFFSSLKNTLVVTATPSSKQVLKGGVDNITVTWGV  59

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNP--KPN  496
            N S P+ TDS++K++ VKLCYAPVSQ DRAWRKTED L+KDK+CQF I ++PY+   K  
Sbjct  60   NQSLPSGTDSAFKTIDVKLCYAPVSQTDRAWRKTEDELEKDKTCQFKIVSRPYSSANKKE  119

Query  495  TLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +L WTIERDVP+AT+FVR YA+++  HEV YGQ+TD  KT NLF+V+AITGRH +LDI
Sbjct  120  SLTWTIERDVPSATYFVRAYAHDSHGHEVAYGQSTDTHKTTNLFEVQAITGRHVSLDI  177



>ref|XP_006344484.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Solanum 
tuberosum]
Length=203

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 125/166 (75%), Gaps = 1/166 (1%)
 Frame = -2

Query  816  SLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSS  637
            ++++C   A   GE+LFS+LK++L+V   HK G VL AG+D +T  WS N++  A  DS 
Sbjct  12   TIVICSFLAVCDGEILFSTLKKALEVKADHKAG-VLMAGEDILTFKWSLNTTLSAGADSG  70

Query  636  YKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTA  457
            YKSVK++LCYAP+SQ DRAWRKTEDHLKKDK+CQF I T PY    N   WTI+RD+PTA
Sbjct  71   YKSVKLQLCYAPISQKDRAWRKTEDHLKKDKTCQFKIVTVPYKSSNNNYTWTIKRDIPTA  130

Query  456  TFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            T+FVR Y  NA+  E+GYGQNTD KK  NLF ++AI+GRHATLDIC
Sbjct  131  TYFVRAYVLNANGEEIGYGQNTDDKKVDNLFSIQAISGRHATLDIC  176



>gb|KDO69464.1| hypothetical protein CISIN_1g028785mg [Citrus sinensis]
Length=204

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 131/176 (74%), Gaps = 2/176 (1%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA  G  L+  S+ L  L    YG  LFSSL+++L V+   K+GQVLKAG+D++TITW  
Sbjct  1    MAARG--LLLASIYLSLLVHECYGVTLFSSLQKTLQVTTTTKRGQVLKAGEDKVTITWGL  58

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            N S  A TDS+YK++K++LC+APVSQ DRAWRKTEDHL KDK+C F I  KPYN    TL
Sbjct  59   NQSLAAGTDSAYKTMKLQLCFAPVSQKDRAWRKTEDHLNKDKTCSFKIVEKPYNKSLQTL  118

Query  489  KWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             W IE DVPTAT+FVR YA NA+ HEV YGQ+T+ +KT NLF ++AITGRHA+LDI
Sbjct  119  DWIIESDVPTATYFVRAYALNAERHEVAYGQSTNDQKTTNLFDIQAITGRHASLDI  174



>ref|XP_011046245.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Populus 
euphratica]
Length=204

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = -2

Query  834  GFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSP  655
             FL+  SL+L C     YG VL SSL R+L+V+     GQVLK G+D+IT+TW  N +  
Sbjct  5    AFLLA-SLVLSCFLLPCYGTVLLSSLPRTLEVTASPTSGQVLKGGEDKITVTWGLNQTVA  63

Query  654  AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLK---W  484
            A TDS+YK++KVKLCYAP+SQVDR WRKT D LKKD++CQ  I  +PYNP  +T +   W
Sbjct  64   AGTDSTYKTIKVKLCYAPISQVDRGWRKTVDDLKKDRTCQHKIVARPYNPANSTAQSHEW  123

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            T+ERDVPTAT+F+R YAY+AD+ EV YGQ TDA +T NLFQV+AI+GRH T+D C
Sbjct  124  TVERDVPTATYFIRAYAYDADEKEVAYGQTTDAGRTTNLFQVQAISGRHVTVDTC  178



>ref|XP_007155490.1| hypothetical protein PHAVU_003G205900g [Phaseolus vulgaris]
 gb|ESW27484.1| hypothetical protein PHAVU_003G205900g [Phaseolus vulgaris]
Length=207

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 135/180 (75%), Gaps = 5/180 (3%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA  G  LV  SLL+ CLA + YG+V FSSLK +LDV+   KQGQVL+AG D+IT+TW+ 
Sbjct  1    MAAHG--LVVASLLIFCLAGSCYGKVHFSSLKNTLDVTASPKQGQVLEAGTDKITVTWAL  58

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            N +     DS+YK++KVKLCYAP+SQ DRAWRKTE+ L +DK+CQ  I  KPY+    T+
Sbjct  59   NKTVSTGADSAYKTIKVKLCYAPISQKDRAWRKTEEELSRDKTCQHKIVAKPYDASNKTV  118

Query  489  K---WTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +   W IE+D+P AT+FVR YA+N++D EV +GQ TDAKK+ NLF + +I+GRHA+LDIC
Sbjct  119  QRFEWVIEKDIPKATYFVRAYAFNSNDEEVAFGQTTDAKKSSNLFDINSISGRHASLDIC  178



>ref|XP_009610896.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Nicotiana 
tomentosiformis]
Length=205

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            M+ +  F V  +++L C A TAYG  LFSSL ++L ++    QGQVL++G+ ++T+TWS 
Sbjct  1    MSTLSAFFVVSAVVLSCFALTAYGA-LFSSLHQTLVLNSSPTQGQVLQSGEGQVTVTWSL  59

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            N S+P +TDS+YK VKVKLCYAP+SQVDR WRK++D+LKKDKSC++ I T PYN   N  
Sbjct  60   NKSNPGRTDSNYKRVKVKLCYAPISQVDRGWRKSDDNLKKDKSCKYNIVTMPYNSLNNNF  119

Query  489  KWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             W I++DVPTAT+F+R Y Y++   EV YGQ TD+ K  NLF + AITGRH T+DIC
Sbjct  120  TWIIDKDVPTATYFIRAYVYDSVGEEVAYGQTTDSHKKINLFHILAITGRHVTIDIC  176



>ref|XP_002318088.2| hypothetical protein POPTR_0012s09110g [Populus trichocarpa]
 gb|EEE96308.2| hypothetical protein POPTR_0012s09110g [Populus trichocarpa]
Length=205

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            L+  SL+L C     Y  VLFSSL+++L V+     GQVLK G D+IT+TW  N +  A 
Sbjct  6    LLLASLVLSCSLLPCYEAVLFSSLQKTLAVTASPTSGQVLKGGVDKITVTWGLNQTLAAG  65

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNT---LKWTI  478
            TDS+YK++KVKLCYAP+SQVDRAWRKT D +KKD++CQ  I  +PYN    T   L+WT+
Sbjct  66   TDSTYKTIKVKLCYAPLSQVDRAWRKTVDRIKKDRTCQHKIVARPYNSANKTFQSLEWTV  125

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +RDVPTAT+F+R YAYNAD+ EV YGQ TDA KT NLFQVE+ITGRH  +D+C
Sbjct  126  QRDVPTATYFIRAYAYNADESEVAYGQTTDAHKTTNLFQVESITGRHMAMDVC  178



>emb|CAN71077.1| hypothetical protein VITISV_021663 [Vitis vinifera]
Length=201

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
            FSSL+R+L V+   K G+VLK+G+D+IT+TW  N S PA TDS+YK+VKVKLCYAP+SQV
Sbjct  25   FSSLQRTLIVTASPKAGEVLKSGEDKITVTWGLNQSYPAGTDSAYKTVKVKLCYAPISQV  84

Query  588  DRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEV  409
            DRAWRKT DHL KDK+CQ  I ++PY    N+++WTIE+DVPTAT+F+R YAY+A+D EV
Sbjct  85   DRAWRKTVDHLTKDKTCQHKIVSQPYKASNNSVEWTIEKDVPTATYFIRAYAYDAEDQEV  144

Query  408  GYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             YGQ TDA KT NLF +EAITGRHA+LDI
Sbjct  145  AYGQTTDAHKTTNLFGIEAITGRHASLDI  173



>ref|XP_002279861.1| PREDICTED: high-affinity nitrate transporter 3.1 [Vitis vinifera]
 emb|CBI14929.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
            FSSL+R+L V+   K G+VLK+G+D+IT+TW  N S PA TDS+YK+VKVKLCYAP+SQV
Sbjct  25   FSSLQRTLIVTASPKAGEVLKSGEDKITVTWGLNQSYPAGTDSAYKTVKVKLCYAPISQV  84

Query  588  DRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEV  409
            DRAWRKT DHL KDK+CQ  I ++PY    N+++WTIE+DVPTAT+F+R YAY+A+D EV
Sbjct  85   DRAWRKTVDHLTKDKTCQHKIVSQPYKASNNSVEWTIEKDVPTATYFIRAYAYDAEDQEV  144

Query  408  GYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             YGQ TDA KT NLF +EAITGRHA+LDI
Sbjct  145  AYGQTTDAHKTTNLFGIEAITGRHASLDI  173



>ref|XP_011015287.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Populus 
euphratica]
Length=200

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            L+  SL+L C     Y  VLFSSL+++L V+     GQVLK G D+IT+TW  N +  A 
Sbjct  6    LLLASLVLSCSLLPCYVAVLFSSLQKTLAVTASPTSGQVLKGGVDKITVTWGLNQTLAAG  65

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNT---LKWTI  478
            TDS+YK++KVKLCYAP+SQVDRAWRKT D +KKD++CQ  I  +PYN    T   L+WT+
Sbjct  66   TDSTYKTIKVKLCYAPMSQVDRAWRKTVDRIKKDRTCQHKIVARPYNSANKTFQSLEWTV  125

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +RDVPTAT+F+R YAYNAD+ EV YGQ TDA KT NLFQVE+ITGRH  +D+C
Sbjct  126  QRDVPTATYFIRAYAYNADESEVAYGQTTDAHKTTNLFQVESITGRHMAMDVC  178



>ref|XP_011040463.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Populus 
euphratica]
Length=200

 Score =   217 bits (553),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            L+  SL+L C     Y  +LFSSL+++L V+     GQVLK G D+IT+TW  N +  A 
Sbjct  6    LLLASLVLSCSLLPCYVALLFSSLQKTLAVTASPTSGQVLKGGLDKITVTWGLNQTLAAG  65

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNT---LKWTI  478
            TDS+YK++KVKLCYAP+SQVDRAWRKT D +KKD++CQ  I  +PYN    T   L+WT+
Sbjct  66   TDSTYKTIKVKLCYAPMSQVDRAWRKTVDRIKKDRTCQHKIVARPYNSANKTFQSLEWTV  125

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +RDVPTAT+F+R YAYNAD+ EV YGQ TDA KT NLFQVE+ITGRH  +D+C
Sbjct  126  QRDVPTATYFIRAYAYNADESEVAYGQTTDAHKTTNLFQVESITGRHMAMDVC  178



>ref|XP_008439011.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Cucumis 
melo]
Length=213

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = -2

Query  834  GFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSP  655
            GFL+  +L L C    + G +  SSL R+L+V+   K GQVLKAG D+I +TW  N +  
Sbjct  5    GFLLA-ALFLSCFLGFSLGNIHLSSLPRTLEVTASPKPGQVLKAGVDKIRVTWVLNGTVK  63

Query  654  AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNT---LKW  484
            A +DSSYK++K KLCYAPVSQVDRAWRKTED LKKDK+CQF I  KPYNP   T    +W
Sbjct  64   AGSDSSYKNIKAKLCYAPVSQVDRAWRKTEDDLKKDKTCQFDIVEKPYNPANKTAQSFEW  123

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            T+ERDVPT TFFVR Y +N+   EV YGQ TD KK  NLFQ+E+ITGRH +LDI
Sbjct  124  TVERDVPTGTFFVRAYVFNSAGQEVAYGQTTDDKKGTNLFQIESITGRHVSLDI  177



>ref|XP_010251031.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Nelumbo nucifera]
Length=205

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 126/171 (74%), Gaps = 2/171 (1%)
 Frame = -2

Query  828  LVTYSLL-LCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPA  652
            L+  SLL  C LA + YG VLFS+L+ +L VS   K+G+VL+AGDD+IT+TW  N S P 
Sbjct  5    LLAGSLLTFCLLAESCYGTVLFSTLQPTLVVSASPKEGEVLRAGDDKITVTWGMNQSFPV  64

Query  651  KTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKP-NTLKWTIE  475
             TD +YK VKVKLCYAP+SQ DRAWRKT D L KDK+CQF I  +PYN     +  W IE
Sbjct  65   GTDEAYKQVKVKLCYAPISQQDRAWRKTNDDLSKDKTCQFQIIVRPYNSSSQQSFDWMIE  124

Query  474  RDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            RDVPTAT+FVR YAYN+D  EV +GQ+TD +K  NLF ++ I+GRHA+LD+
Sbjct  125  RDVPTATYFVRAYAYNSDGREVAFGQSTDGQKKTNLFDIQGISGRHASLDV  175



>ref|XP_011046246.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Populus 
euphratica]
Length=204

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 123/164 (75%), Gaps = 3/164 (2%)
 Frame = -2

Query  801  CLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVK  622
            C     YG VL SSL R+L+V+     GQVLK G+D+IT+TW  N +  A TDS+YK++K
Sbjct  15   CFLLPCYGTVLLSSLPRTLEVTASPTSGQVLKGGEDKITVTWGLNQTVAAGTDSTYKTIK  74

Query  621  VKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLK---WTIERDVPTATF  451
            VKLCYAP+SQVDR WRKT D LKKD++CQ  I  +PYNP  +T +   WT+ERDVPTAT+
Sbjct  75   VKLCYAPISQVDRGWRKTVDDLKKDRTCQHKIVARPYNPANSTAQSHEWTVERDVPTATY  134

Query  450  FVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            F+R YAY+AD+ EV YGQ TDA +T NLFQV+AI+GRH T+D C
Sbjct  135  FIRAYAYDADEKEVAYGQTTDAGRTTNLFQVQAISGRHVTVDTC  178



>ref|XP_010248677.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Nelumbo 
nucifera]
Length=206

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = -2

Query  828  LVTYSLL---LCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSS  658
            L+  SLL    C LA + YG VLFSSL+R+L V+   K GQVL+AG+D+IT+TW  N S 
Sbjct  5    LLIASLLAFAFCLLAESCYGTVLFSSLQRTLVVTASPKDGQVLRAGEDKITVTWGMNQSF  64

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTI  478
            P  TD +YK VKV+LCYAP+SQ DR WRKT+D L KDK+CQF I  + Y+    +  WTI
Sbjct  65   PVGTDEAYKKVKVQLCYAPISQKDRGWRKTKDDLSKDKTCQFDIVARAYDSNQPSFDWTI  124

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ERDVPTAT+FVR YAYN+D  +V +GQ+TD +K  NLF ++ I+GRHA+LDI
Sbjct  125  ERDVPTATYFVRAYAYNSDGQQVAFGQSTDGQKKTNLFDIQGISGRHASLDI  176



>ref|NP_001267619.1| high-affinity nitrate transporter 3.1-like precursor [Cucumis 
sativus]
 ref|XP_004157776.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Cucumis 
sativus]
 gb|ACV33078.2| high-affinity nitrate transport system component [Cucumis sativus]
 gb|KGN64351.1| High-affinity nitrate transport system component [Cucumis sativus]
Length=211

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 125/168 (74%), Gaps = 3/168 (2%)
 Frame = -2

Query  816  SLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSS  637
            +L L C    ++G + FSSL R+L+V+   K GQVLKAG D+I++TW  N +  A +DSS
Sbjct  10   ALFLSCFLGFSHGNIHFSSLPRTLEVTASPKPGQVLKAGVDKISVTWVLNETVKAGSDSS  69

Query  636  YKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLK---WTIERDV  466
            YK++K KLCYAPVSQVDRAWRKTED LKKDK+CQF+I  K YNP   T++   WT++RD+
Sbjct  70   YKNIKAKLCYAPVSQVDRAWRKTEDDLKKDKTCQFSIVEKQYNPANKTVQSFEWTVKRDI  129

Query  465  PTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            PT TFFVR Y  N+   EV YGQ TDAKK  NLFQ+E+ITGRH +LDI
Sbjct  130  PTGTFFVRAYVLNSAGEEVAYGQTTDAKKGTNLFQIESITGRHISLDI  177



>ref|XP_002321640.2| hypothetical protein POPTR_0015s09660g [Populus trichocarpa]
 gb|EEF05767.2| hypothetical protein POPTR_0015s09660g [Populus trichocarpa]
Length=206

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = -2

Query  804  CCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSV  625
            C L    YG VLFSSL+R+L+V+     GQVLK G D+IT+TW  N +  A TDS+YK++
Sbjct  15   CFLLPACYGTVLFSSLQRTLEVTASPTSGQVLKGGVDKITVTWGLNQTVAAGTDSTYKTI  74

Query  624  KVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLK---WTIERDVPTAT  454
            KVKLCYAP+SQVDR WRKT D+LKKD++CQ  I  +PYN   +T +   WT+ERDVPTAT
Sbjct  75   KVKLCYAPISQVDRGWRKTVDNLKKDRTCQHKIVARPYNAANSTAQSHEWTVERDVPTAT  134

Query  453  FFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +FVR YAY+AD+  V YGQ TDA+KT NLF+V+AI+GRH T+D C
Sbjct  135  YFVRAYAYDADEKVVAYGQTTDARKTTNLFRVQAISGRHVTMDTC  179



>ref|XP_006374542.1| hypothetical protein POPTR_0015s09670g [Populus trichocarpa]
 gb|ERP52339.1| hypothetical protein POPTR_0015s09670g [Populus trichocarpa]
Length=205

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 122/164 (74%), Gaps = 3/164 (2%)
 Frame = -2

Query  801  CLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVK  622
            C     YG VLFSSL R+L V+     GQVLK G D+IT+TW  N +  A TDS+YK++K
Sbjct  15   CFLLPCYGIVLFSSLHRTLVVTASPTSGQVLKGGVDKITVTWGLNQTVAAGTDSTYKTIK  74

Query  621  VKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLK---WTIERDVPTATF  451
            VKLCYAP+SQVDR WRKT D+LKKD++CQ  I  +PYNP  +T +   WT+ERDVPTAT+
Sbjct  75   VKLCYAPISQVDRGWRKTVDNLKKDRTCQHKIVARPYNPANSTAQSHEWTVERDVPTATY  134

Query  450  FVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            FVR YAY+AD+  V YGQ TDA KT NLFQV+AI+GRH T+D C
Sbjct  135  FVRAYAYDADEKVVAYGQTTDAHKTTNLFQVQAISGRHVTMDTC  178



>ref|XP_011086669.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Sesamum 
indicum]
Length=203

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 120/170 (71%), Gaps = 0/170 (0%)
 Frame = -2

Query  831  FLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPA  652
             L   SL     A T YG VLFS+L ++L VS     GQVLKAG+D IT+TW  N S P 
Sbjct  5    LLAVLSLATLSFADTCYGGVLFSTLPQTLAVSASPTDGQVLKAGEDNITVTWGLNQSFPD  64

Query  651  KTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIER  472
             TDSSY  VK+ LCY P+SQ DR WRKT D+L KDK+CQFTIA + Y  +     W IER
Sbjct  65   GTDSSYNEVKLMLCYGPISQADRGWRKTVDNLSKDKTCQFTIAHRTYMRETQNFTWMIER  124

Query  471  DVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            DVPTA +FVR YAYN+  +EV YGQ TDAKK++NLF+V+AI+GRH++LDI
Sbjct  125  DVPTAVYFVRAYAYNSSRNEVAYGQTTDAKKSRNLFKVQAISGRHSSLDI  174



>ref|XP_004515861.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Cicer 
arietinum]
Length=205

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 129/173 (75%), Gaps = 3/173 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            L+  SLLLCCLA T YG+VLF+SLKR+LDV+   K GQVL AG+D+I+ TW  N + PA 
Sbjct  6    LIVASLLLCCLAETCYGKVLFTSLKRTLDVTASPKLGQVLLAGEDKISGTWVLNKTFPAG  65

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY---NPKPNTLKWTI  478
            TDSSYK++K+KLCYAP+SQ DRAWRKTE+ L +DK+C   +    Y   N   +T +W I
Sbjct  66   TDSSYKTIKLKLCYAPISQRDRAWRKTENELSRDKTCPHKMLAMHYDASNKTVHTFEWLI  125

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            ++DVP AT+F+R YA +++D +V YGQ T+  K+ NLFQ+ AI+GRH TLDIC
Sbjct  126  KKDVPQATYFIRAYAVDSNDVQVAYGQTTNTNKSTNLFQINAISGRHITLDIC  178



>ref|XP_009404237.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Musa acuminata subsp. malaccensis]
Length=200

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 122/164 (74%), Gaps = 3/164 (2%)
 Frame = -2

Query  813  LLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSY  634
            +LLC +  +A   VLFSSL ++L V+     GQVL AG DEIT+TW+ N S PA TDS Y
Sbjct  14   VLLCYIGPSA--AVLFSSLPQTLRVTASPSPGQVLHAGVDEITVTWALNQSLPAGTDSGY  71

Query  633  KSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTAT  454
            K VKV LCYAPVSQ DR WRKT+DHLKKDK+CQF +AT+PY     T+ +T+ER++PTAT
Sbjct  72   KKVKVTLCYAPVSQTDRGWRKTDDHLKKDKTCQFKMATRPYAAT-GTVTYTVERNIPTAT  130

Query  453  FFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            FFVR Y  +A D EV YGQ+TD KKT NLF +  ITGRHA+LDI
Sbjct  131  FFVRAYVLDASDTEVAYGQSTDPKKTTNLFDIAGITGRHASLDI  174



>ref|XP_009362926.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Pyrus 
x bretschneideri]
Length=203

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = -2

Query  789  TAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLC  610
            T+YG VLFSSLK SL V+  H + QV+KAG D++T++W  N S  A TDS++K++KVKLC
Sbjct  20   TSYGIVLFSSLKDSLFVTASHTENQVMKAGIDKLTVSWGLNQSYEAGTDSTFKTIKVKLC  79

Query  609  YAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPN-TLKWTIERDVPTATFFVRVYA  433
            YAPVSQVDR WRKT D+L KDK+C F I  + Y  K N T++WTIERDVP AT+FVR YA
Sbjct  80   YAPVSQVDRGWRKTVDNLAKDKTCLFKIVERSYTSKSNDTVEWTIERDVPGATYFVRAYA  139

Query  432  YNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +NA   EV YGQ T+AKKT NLF VE I+GRH +LDI 
Sbjct  140  FNAAGQEVAYGQTTNAKKTANLFVVEGISGRHVSLDIA  177



>ref|XP_008392882.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Malus 
domestica]
Length=203

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = -2

Query  789  TAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLC  610
            T+YG VLFSSLK SL V+  H + QVLKAG D++T++W  N SS A TDS++K++KVKLC
Sbjct  20   TSYGIVLFSSLKDSLFVTASHAENQVLKAGIDKLTVSWGLNQSSEAGTDSTFKTIKVKLC  79

Query  609  YAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPN-TLKWTIERDVPTATFFVRVYA  433
            YAPVSQVDR WRKT D+L KDK+C   I  + Y  K N +++WTIERDVP AT+FVR YA
Sbjct  80   YAPVSQVDRGWRKTVDNLAKDKTCLLKIVERSYTSKSNDSVEWTIERDVPGATYFVRAYA  139

Query  432  YNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +NA   EV YGQ T+AKKT NLF VE I+GRH +LDI 
Sbjct  140  FNAAGQEVAYGQTTNAKKTANLFVVEGISGRHMSLDIA  177



>ref|XP_008239345.1| PREDICTED: high-affinity nitrate transporter 3.1 [Prunus mume]
Length=204

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = -2

Query  789  TAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLC  610
            T++G VLFSSLK++L V+  HK+GQV K G D++T++W  N S PA +DS+YK++KVK C
Sbjct  20   TSHG-VLFSSLKQTLIVTASHKEGQVYKTGIDKLTVSWGLNQSFPAGSDSTYKTIKVKFC  78

Query  609  YAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAY  430
            YAPVSQVDR WRKT D L KDK+CQF +  +PY+    + +WTIERDVP+AT+F+R YAY
Sbjct  79   YAPVSQVDRGWRKTVDSLSKDKTCQFKVVARPYSSSNQSFEWTIERDVPSATYFLRAYAY  138

Query  429  NADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +A D EV YGQ TDA+K  NLF V+ I+GRHA+LDI 
Sbjct  139  DAADVEVAYGQTTDAQKATNLFVVQGISGRHASLDIA  175



>ref|XP_007209613.1| hypothetical protein PRUPE_ppa011598mg [Prunus persica]
 gb|EMJ10812.1| hypothetical protein PRUPE_ppa011598mg [Prunus persica]
Length=204

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = -2

Query  789  TAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLC  610
            T++G VL SSLK++L V+  HK+GQV K G D++T++W  N S PA +DS+YK++KVK C
Sbjct  20   TSHG-VLLSSLKQTLIVTASHKEGQVYKTGIDKLTVSWGLNQSFPAGSDSTYKTIKVKFC  78

Query  609  YAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAY  430
            YAPVSQVDR WRKT D L KDK+CQF +  +PY+    + +WTIERDVP+AT+F+R YAY
Sbjct  79   YAPVSQVDRGWRKTVDSLNKDKTCQFKVVARPYSSSNQSFEWTIERDVPSATYFLRAYAY  138

Query  429  NADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +A D EV YGQ TDA+K  NLF V+AITGRHA+LDI 
Sbjct  139  DAADVEVAYGQTTDAQKETNLFVVQAITGRHASLDIA  175



>ref|XP_010102954.1| hypothetical protein L484_018973 [Morus notabilis]
 gb|EXB94472.1| hypothetical protein L484_018973 [Morus notabilis]
Length=224

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 126/175 (72%), Gaps = 14/175 (8%)
 Frame = -2

Query  801  CLAATAYGEVLFSSLKRSLDVSVKHKQGQ--------------VLKAGDDEITITWSYNS  664
            C A  ++G+VLFSSLKR+L V+   K+GQ              VLKAG+D+IT+ W  N 
Sbjct  21   CFAEISFGKVLFSSLKRTLVVTASPKEGQASIIRATSNVIEFAVLKAGEDKITVNWGLNK  80

Query  663  SSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKW  484
            + PA TDS+YK++KVKLCYAP+SQ DRAWRKT++ L KDK+CQF I ++ Y     + +W
Sbjct  81   TFPAGTDSAYKTIKVKLCYAPISQEDRAWRKTKEDLSKDKTCQFKIVSRAYTASDQSFEW  140

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            T+ER VP AT+FVR YAY+A+D  V YGQ+TD KKT NLF ++AITGRHA+LDI 
Sbjct  141  TVERYVPLATYFVRAYAYDANDDPVAYGQSTDGKKTTNLFDIKAITGRHASLDIA  195



>ref|XP_008374376.1| PREDICTED: high-affinity nitrate transporter 3.2 [Malus domestica]
 ref|XP_008364596.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Malus 
domestica]
Length=204

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  834  GFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSP  655
            G L+   L+L C + T+YG VLFSSLK SL V+  H + QVLKAG D++T++W  N S  
Sbjct  5    GILLASLLVLSCFSQTSYGIVLFSSLKDSLLVTASHTENQVLKAGIDKLTVSWGLNQSYE  64

Query  654  AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY-NPKPN-TLKWT  481
            A TDS++K++KV LC+A VSQVDR WRKT D+L KDK+C   I  +PY + K N +  W 
Sbjct  65   AGTDSTFKTIKVNLCFAQVSQVDRGWRKTVDNLAKDKTCLVKIVERPYTSSKSNDSFDWI  124

Query  480  IERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            IERDVP AT+FVR YA++A D +V YGQ TDAKKT NLF VE ITGRH +LDI
Sbjct  125  IERDVPGATYFVRAYAFDAADQQVAYGQTTDAKKTANLFVVEGITGRHLSLDI  177



>ref|XP_008360776.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Malus 
domestica]
Length=203

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 119/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  789  TAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLC  610
            T+YG VLFSSLK SL V+  H + QVLKAG D++T++W  N SS A TDS++K++KVKLC
Sbjct  20   TSYGIVLFSSLKDSLFVTASHAENQVLKAGIDKLTVSWGLNQSSEAGTDSTFKTIKVKLC  79

Query  609  YAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPN-TLKWTIERDVPTATFFVRVYA  433
            YAPVSQVDR WRKT D+L KDK+C   I    Y  K N +++WTIERDVP AT+FVR YA
Sbjct  80   YAPVSQVDRGWRKTVDNLAKDKTCLXKIVEXSYTSKSNDSVEWTIERDVPGATYFVRAYA  139

Query  432  YNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +NA   EV YGQ T+AKKT NLF VE I+GRH +LDI 
Sbjct  140  FNAAGQEVAYGQTTNAKKTANLFVVEGISGRHMSLDIA  177



>ref|XP_008793734.1| PREDICTED: high-affinity nitrate transporter 3.2 [Phoenix dactylifera]
Length=201

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 125/176 (71%), Gaps = 1/176 (1%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA++     T  LLL C   ++ G V FS LK +L V+   K GQVL AG+D+IT+TW  
Sbjct  1    MARLLSNQATAFLLLICYVGSSMGSVHFSDLKETLIVTASPKSGQVLYAGEDKITVTWKL  60

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            NSS PA TD++Y+ VKVKLCYAPVSQ DR WRKTED+LKKDK+CQF I  +PY     + 
Sbjct  61   NSSLPASTDAAYEKVKVKLCYAPVSQKDRGWRKTEDNLKKDKTCQFKITNQPY-AGGGSF  119

Query  489  KWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ++T++R VPTAT+FVR Y  +A D E+ YGQ TDAKKT NLF V  ITG HA+LDI
Sbjct  120  EYTVDRSVPTATYFVRAYVVDASDTELAYGQTTDAKKTTNLFDVVGITGHHASLDI  175



>ref|XP_010929915.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1 [Elaeis guineensis]
Length=203

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 121/164 (74%), Gaps = 1/164 (1%)
 Frame = -2

Query  813  LLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSY  634
            LLL C   ++ G   FS LKR+L V+   K GQVL AG+D+IT+TW  NSS PA TD++Y
Sbjct  15   LLLICYVGSSMGSAHFSDLKRTLIVTASPKPGQVLYAGEDKITVTWKLNSSLPAGTDAAY  74

Query  633  KSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTAT  454
            K VKVKLCYAPVSQ DR WRKT+D+LKKDK+CQF + T+PY     +  +TI+R VPTAT
Sbjct  75   KKVKVKLCYAPVSQKDRGWRKTDDNLKKDKTCQFKVTTQPY-AGSGSFVYTIDRTVPTAT  133

Query  453  FFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +FVR Y  +A D E+ YGQ TDAKK+ NLF +  ITGRHA+LDI
Sbjct  134  YFVRAYVVDASDTELAYGQTTDAKKSTNLFDIVGITGRHASLDI  177



>gb|EYU22193.1| hypothetical protein MIMGU_mgv1a019693mg [Erythranthe guttata]
Length=206

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 126/178 (71%), Gaps = 4/178 (2%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA +  FL+  S+ + CL AT YG V F SL  +L V+  HK+G VLKAG D IT+TW+ 
Sbjct  1    MAILQRFLLA-SVFVSCLVATCYGGVSFKSLHPTLTVTATHKEG-VLKAGLDNITVTWAL  58

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY--NPKPN  496
            + S+PA TD+SYK++KVKLCYAPVSQVDR WRKT+D L KDK+C   I  KPY       
Sbjct  59   DPSAPAGTDASYKTIKVKLCYAPVSQVDRGWRKTKDDLTKDKTCSHKIVAKPYIAGGAVA  118

Query  495  TLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            T  WT++RDVPTA +FVR YA+NA D EV YGQ T  +K  NLF +EA+TGRH +LDI
Sbjct  119  TATWTVQRDVPTAKYFVRAYAHNASDMEVAYGQTTSTEKKTNLFDIEAVTGRHVSLDI  176



>ref|XP_009333929.1| PREDICTED: high-affinity nitrate transporter 3.2 [Pyrus x bretschneideri]
Length=204

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = -2

Query  789  TAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLC  610
            T+YG VLFSSLK SL V+  H + QVLKAG D++T++W  N S  A TDS++K++KVKLC
Sbjct  20   TSYGIVLFSSLKDSLLVTASHTENQVLKAGIDKLTVSWGLNQSYEAGTDSTFKTIKVKLC  79

Query  609  YAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY--NPKPNTLKWTIERDVPTATFFVRVY  436
            +APVSQVDR WRKT D L  DK+C F I  +PY  N   ++  W IERDVP AT+FVR Y
Sbjct  80   FAPVSQVDRGWRKTVDKLAMDKTCLFKIVERPYTSNKSNDSFDWIIERDVPGATYFVRAY  139

Query  435  AYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            A+NA   EV YGQ TDAKKT NLF VE ITGRH +LDI 
Sbjct  140  AFNAAGQEVAYGQTTDAKKTANLFVVEGITGRHLSLDIA  178



>ref|XP_006344486.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Solanum 
tuberosum]
Length=207

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 121/177 (68%), Gaps = 0/177 (0%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA   G  V  +++            LFSSL+++L ++    QGQVL+AG+ ++TITWS 
Sbjct  1    MATFSGVFVASAIVFSFFGIIITYAALFSSLQQTLLINSSPSQGQVLQAGEAQVTITWSL  60

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            N+S P  TD++YK+V VKLCYAPVSQ+DR WRK+ ++LKKDK+CQ  + T PY P  N  
Sbjct  61   NNSYPTGTDTNYKTVNVKLCYAPVSQLDRGWRKSNNNLKKDKTCQINLVTMPYKPSNNNF  120

Query  489  KWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             WTI +DVPTAT+F+R Y Y++    V YGQ TDA K  NLF++ AITGRH T+D+C
Sbjct  121  TWTIHKDVPTATYFIRAYVYDSTGEVVAYGQTTDAHKKTNLFKITAITGRHITIDVC  177



>gb|AFK41592.1| unknown [Medicago truncatula]
 gb|KEH31763.1| component of high affinity nitrate transporter [Medicago truncatula]
Length=206

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = -2

Query  783  YGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYA  604
            YG+ LFSSLKR+LDV+   K GQVL +G D+I+ TW+ N + PA TDSSYK++K+KLCYA
Sbjct  21   YGKDLFSSLKRTLDVTASPKHGQVLLSGVDKISGTWALNKTFPAGTDSSYKTIKLKLCYA  80

Query  603  PVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLK---WTIERDVPTATFFVRVYA  433
             +SQ DRAWRKTED L +DK+CQ  +   PYN    T++   W I+RDVP AT+FVR YA
Sbjct  81   AISQKDRAWRKTEDELSRDKTCQHKMLAMPYNASNKTVQTFEWLIQRDVPQATYFVRAYA  140

Query  432  YNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            ++++D EV YGQ T+A K+ NLF++ AI+GRHATLDIC
Sbjct  141  FDSNDKEVAYGQTTNAGKSTNLFEINAISGRHATLDIC  178



>ref|XP_011071967.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Sesamum 
indicum]
Length=204

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 122/170 (72%), Gaps = 1/170 (1%)
 Frame = -2

Query  831  FLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPA  652
            FL   +LLL CLA T+Y  V FSSL R+L +SV   QG VL+AG+D IT+ WS N+S P 
Sbjct  6    FLAASALLLSCLAVTSYA-VTFSSLPRTLVLSVSTTQGHVLRAGEDNITLAWSLNTSLPV  64

Query  651  KTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIER  472
             TDS YK+VK+KLCYAP+SQ DRAWRKT D L KDK+CQ  IA++ Y+   +T  WT+++
Sbjct  65   GTDSGYKTVKLKLCYAPISQKDRAWRKTVDDLAKDKTCQHKIASQAYSSSSSTFTWTLQK  124

Query  471  DVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            DVPT T+FVR Y +N+ D  V YGQ TDA K  NLF ++AI+G H +L +
Sbjct  125  DVPTGTYFVRAYVHNSADEVVAYGQTTDAHKATNLFDIQAISGSHVSLHV  174



>gb|EYU22284.1| hypothetical protein MIMGU_mgv1a025936mg [Erythranthe guttata]
Length=205

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  816  SLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSS  637
            S+ +CCL AT  G V F+SLK +L V+  HK G VLKAG D +T+TW  + S PA TDSS
Sbjct  10   SVFVCCLVATCDGIVSFNSLKPTLTVTATHKGG-VLKAGVDNVTVTWMLDPSVPAGTDSS  68

Query  636  YKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY--NPKPNTLKWTIERDVP  463
            YK++KVKLCYAPVSQVDR WRKT+D L KDK+C   I  KPY       T  WT++RDVP
Sbjct  69   YKTIKVKLCYAPVSQVDRGWRKTKDDLSKDKTCSHKIVAKPYVAGGAVATATWTVQRDVP  128

Query  462  TATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            TA +FVR YA++A D EV YGQ T A K  NLF +EA+TGRH +LDI
Sbjct  129  TAKYFVRAYAHDAADMEVAYGQTTSADKKTNLFDIEAVTGRHVSLDI  175



>ref|XP_011101276.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Sesamum 
indicum]
Length=203

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -2

Query  774  VLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVS  595
            V FSSL+ +L V+   + GQVLKAG+D+IT+TW+ N+S PA  DS+Y ++KVKLC+AP+S
Sbjct  23   VTFSSLQDTLIVTASPQPGQVLKAGEDKITVTWALNTSFPAGIDSAYGTIKVKLCFAPIS  82

Query  594  QVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDH  415
            Q DRAWRKT D+LKKDK+C   I  KPY+   NT  WT++RDVPTAT+F+R YA N+ D 
Sbjct  83   QQDRAWRKTVDNLKKDKTCLHKIVAKPYSTSNNTFTWTVQRDVPTATYFIRAYACNSADE  142

Query  414  EVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            EV YGQ TD+ KT NLF+V+AI+GRH +LDI
Sbjct  143  EVAYGQTTDSHKTTNLFEVQAISGRHVSLDI  173



>dbj|BAP74416.1| nitrate transporter [Chrysanthemum sp. CSG-2014]
Length=199

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 119/161 (74%), Gaps = 0/161 (0%)
 Frame = -2

Query  804  CCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSV  625
            C L++   G+VLFSSL RSL VS    +GQVLKAG+++I + +  N +   +T+  YK +
Sbjct  13   CFLSSVTNGDVLFSSLPRSLSVSASPTEGQVLKAGENDIVLAFGLNQTVANQTNGLYKKM  72

Query  624  KVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFV  445
            +VKLCYAP+SQVDR WRKT D+LKKDK+CQFTI  KPY       +W IE+D+PTAT+FV
Sbjct  73   EVKLCYAPISQVDRKWRKTVDNLKKDKTCQFTIYDKPYETNVEGFRWKIEKDIPTATYFV  132

Query  444  RVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            R YAY ++  E+ YGQ T+ KKT NLF+++ I+GRHA+LDI
Sbjct  133  RAYAYGSNGEEIAYGQTTNDKKTDNLFRIQGISGRHASLDI  173



>ref|XP_006853022.1| hypothetical protein AMTR_s00174p00057530 [Amborella trichopoda]
 gb|ERN14489.1| hypothetical protein AMTR_s00174p00057530 [Amborella trichopoda]
Length=205

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -2

Query  810  LLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYK  631
             L      A GEVLFS+L  +L V    K G VL  G+D IT+TWS N S P  TD  YK
Sbjct  11   FLLFFTGYAAGEVLFSTLNPTLVVQASPKAGNVLNVGEDHITVTWSLNQSLPHGTDQQYK  70

Query  630  SVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPN--TLKWTIERDVPTA  457
             + +KLCYAP+SQ DRAWRKT D +KKDK+CQF IA +PYNP  +  T+ W IERD+PTA
Sbjct  71   RITIKLCYAPLSQKDRAWRKTVDDMKKDKTCQFKIAAQPYNPNNSTVTVSWLIERDIPTA  130

Query  456  TFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            T+F+R YA ++ D+++ YGQ T+  KT NLF+++ ITGRHA+LDI
Sbjct  131  TYFIRAYASDSQDNKLAYGQTTNKNKTTNLFEIQGITGRHASLDI  175



>ref|XP_009415973.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1 [Musa acuminata subsp. malaccensis]
Length=198

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            L+   LL+ C+ ++    VLFSSL  +L V+     GQVL AG D+I ++W  N S+PA 
Sbjct  6    LLRLVLLVSCIGSSM--AVLFSSLPNTLTVTSSPAAGQVLHAGVDQIKVSWKLNQSTPAS  63

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERD  469
             DS YK VKV LCY PVSQ DR WRKT+DHLKKDK+CQF + T+PY+    +  +T+ER 
Sbjct  64   ADSGYKKVKVLLCYDPVSQADRGWRKTDDHLKKDKTCQFKVTTQPYSSGGGSFVYTVERS  123

Query  468  VPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +PT T+FVR YA ++ D EV YGQ T+A KT NLF V  ITGRHA+LDI
Sbjct  124  IPTGTYFVRAYALDSGDTEVAYGQTTNAAKTTNLFDVVGITGRHASLDI  172



>gb|EYU22195.1| hypothetical protein MIMGU_mgv1a013911mg [Erythranthe guttata]
Length=206

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  816  SLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSS  637
            S+ + CL AT YG V F +L+ +L V+  HK+G VLKAG D IT+TW+ + S+PA  D+S
Sbjct  11   SVFVSCLVATCYGGVSFKTLQTTLAVTATHKEG-VLKAGLDNITVTWALDPSAPAGADAS  69

Query  636  YKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY--NPKPNTLKWTIERDVP  463
            YK++KVKLCYAPVSQVDR WRKT+D L KDK+C   I  KPY       T  WT++RDVP
Sbjct  70   YKTIKVKLCYAPVSQVDRGWRKTKDDLTKDKTCSHKIVAKPYIAGGAVATATWTVQRDVP  129

Query  462  TATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            TA +FVR YA++A D E+ YGQ T   K  NLF +EA+TGRH +LDI
Sbjct  130  TAKYFVRAYAHDAADVELAYGQTTSVDKKTNLFDIEAVTGRHVSLDI  176



>gb|EYU34506.1| hypothetical protein MIMGU_mgv1a014017mg [Erythranthe guttata]
Length=203

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = -2

Query  819  YSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDS  640
            +  +L CLAA       FSSL+++L V+   +  QVLKAG+DEIT+TWS NS+ PA  DS
Sbjct  6    FLFVLSCLAAATCRGATFSSLQQTLIVTASPQPAQVLKAGEDEITVTWSLNSTFPAGVDS  65

Query  639  SYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTI-ATKPY-NPKPNTLKWTIERDV  466
            SYK+V +KLCYAP+SQ DR WRKT D+L KDK+CQ  I A KPY  P  NT   T+ RDV
Sbjct  66   SYKTVTIKLCYAPISQKDRGWRKTVDNLVKDKTCQHKIVANKPYIFPSNNTFTSTVLRDV  125

Query  465  PTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            PTAT+F+R YA N++  EV YGQ TD+ K  NLF+++AITGRH +LDI
Sbjct  126  PTATYFIRAYAQNSEGDEVAYGQTTDSHKAVNLFEIQAITGRHVSLDI  173



>gb|EYU22194.1| hypothetical protein MIMGU_mgv1a026235mg [Erythranthe guttata]
Length=206

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 120/167 (72%), Gaps = 3/167 (2%)
 Frame = -2

Query  816  SLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSS  637
            S+ + CL AT YG V F SL+ +L V+  HK+G VLKAG D +T+TW+ + S+PA +D+S
Sbjct  11   SVFVSCLVATCYGGVSFKSLQPTLTVTATHKEG-VLKAGLDNVTVTWALDPSAPAGSDAS  69

Query  636  YKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY--NPKPNTLKWTIERDVP  463
            YK++KVKLCYAPVSQVDR WRKT+D L KDK+C   I  KPY       T  WT+ RDVP
Sbjct  70   YKTIKVKLCYAPVSQVDRGWRKTKDDLTKDKTCSHKIVAKPYIAGGAVATATWTVLRDVP  129

Query  462  TATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            TA +FVR YA++A D E+ YGQ T A K  NLF +EA+TGRH +LDI
Sbjct  130  TAKYFVRAYAHDAADVELTYGQTTSADKKTNLFDIEAVTGRHVSLDI  176



>ref|XP_011039571.1| PREDICTED: high-affinity nitrate transporter 3.1-like, partial 
[Populus euphratica]
Length=168

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 107/135 (79%), Gaps = 3/135 (2%)
 Frame = -2

Query  714  VLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQ  535
            VLK G+D+IT+TW  N +  A TDS+YK++KVKLCYAP+SQVDR WRKT D LKKD++CQ
Sbjct  7    VLKGGEDKITVTWGLNQTVAAGTDSTYKTIKVKLCYAPISQVDRGWRKTVDDLKKDRTCQ  66

Query  534  FTIATKPYNPKPNTLK---WTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLF  364
              I  +PYNP  NT +   WT+ERDVPTAT+F+R YAY+AD+ EV YGQ TDA +T NLF
Sbjct  67   HKIVARPYNPANNTAQSHEWTVERDVPTATYFIRAYAYDADEKEVAYGQTTDAGRTTNLF  126

Query  363  QVEAITGRHATLDIC  319
            QV+AI+GRH T+D C
Sbjct  127  QVQAISGRHVTVDTC  141



>ref|XP_006852328.1| hypothetical protein AMTR_s00049p00207930 [Amborella trichopoda]
 gb|ERN13795.1| hypothetical protein AMTR_s00049p00207930 [Amborella trichopoda]
Length=202

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 114/165 (69%), Gaps = 1/165 (1%)
 Frame = -2

Query  813  LLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSY  634
             LL   A+ A G VLFS+LK +L V    + G VL  G+D IT+TWS N S P   D  Y
Sbjct  10   FLLLFFASYAAGGVLFSTLKPTLVVQASPRAGSVLNVGEDRITVTWSLNQSFPKGMDQQY  69

Query  633  KSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTAT  454
            K +KVKLCYAP+SQ DRAWRKT D +KKDK+CQF IA +PYN    T+ W IERD PTAT
Sbjct  70   KKIKVKLCYAPISQKDRAWRKTVDDIKKDKTCQFKIAAQPYNSTA-TVAWLIERDTPTAT  128

Query  453  FFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +F+R YA ++ D+EV YGQ T+  KT NLF ++ I+GR A+LD+ 
Sbjct  129  YFIRTYALDSQDNEVTYGQTTNKNKTTNLFVIQGISGRQASLDVA  173



>ref|XP_010555506.1| PREDICTED: high-affinity nitrate transporter 3.1 [Tarenaya hassleriana]
Length=207

 Score =   189 bits (479),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSS  658
            L+  SLL+C L  T+ G   E LF+ L+ +L V+ K  +  VL  G D++++TW  NS++
Sbjct  6    LLVISLLVCSLIGTSRGAGKEKLFTDLQHTLAVTAKPSRQGVLDPGKDKVSVTWRLNSTA  65

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTI  478
               +DS YK+V VKLCYAPVSQVDR WRKT + L KDK+C   I ++PY+  P +  WTI
Sbjct  66   APGSDSDYKTVAVKLCYAPVSQVDRPWRKTSNELFKDKTCPHNIVSRPYDGTPQSFDWTI  125

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ERD+PTA++FVR YA ++   +  YGQ+TDA K+ NLF V+AI+GRHA+LDI
Sbjct  126  ERDIPTASYFVRAYALDSKGEKAAYGQSTDASKSANLFSVQAISGRHASLDI  177



>ref|XP_009379949.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Musa acuminata subsp. malaccensis]
Length=204

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 110/151 (73%), Gaps = 1/151 (1%)
 Frame = -2

Query  774  VLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVS  595
            VLFSSL +++ V+     GQVL AG D++ +TW+ N S P  T S+YK VKV  CYAP S
Sbjct  29   VLFSSLPKTIIVTASPSPGQVLYAGVDQMNVTWAINQSLPGATVSAYKKVKVSFCYAPAS  88

Query  594  QVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDH  415
            Q DR WRKT+D+LKKDK+CQF I T+PY     ++ +T+ER +PTATFFVR Y  +++D 
Sbjct  89   QADRGWRKTDDNLKKDKTCQFKITTQPY-ATAGSVAYTVERSIPTATFFVRAYVLDSEDA  147

Query  414  EVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            EV YGQ+T+A+KT NLF V  ITGRH++L I
Sbjct  148  EVAYGQSTNAQKTTNLFDVVGITGRHSSLGI  178



>gb|EYU17760.1| hypothetical protein MIMGU_mgv1a013981mg [Erythranthe guttata]
Length=204

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  819  YSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDS  640
            + ++L CLAA       FSSL+++L V+   +  QVLKAG+DEIT+TWS NS+ PA  DS
Sbjct  6    FLIVLSCLAAATCRGATFSSLQQTLIVTASPQPAQVLKAGEDEITVTWSLNSTFPAGVDS  65

Query  639  SYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTI-ATKPY--NPKPNTLKWTIERD  469
            SYK+V +KLCYAP+SQ  R WRKT D+L KDK+CQ  I A KPY  +   NT   T+ RD
Sbjct  66   SYKTVTIKLCYAPISQKYRGWRKTVDNLVKDKTCQHKIVANKPYISSSSNNTFTSTVLRD  125

Query  468  VPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            VPTAT+F+R YA N++  EV YGQ TD+ K  NLF+++AITGRH +LDI
Sbjct  126  VPTATYFIRAYAQNSEGDEVAYGQTTDSHKAVNLFEIQAITGRHVSLDI  174



>ref|XP_010448529.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X2 [Camelina sativa]
Length=208

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = -2

Query  816  SLLLCCLAATAYGE---VLFSSLKRSLDVSVKHKQ-GQVLKAGDDEITITWSYNSSSPAK  649
            SLL+     ++ GE    LF+ L+ S++V+ K  Q G VL+AG D +T+ W   SS+   
Sbjct  10   SLLIFSFIQSSRGENKDRLFAELQNSIEVAAKPIQDGVVLEAGKDMVTVKWKLKSSAKVD  69

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERD  469
             D+++K+++VKLCYAP+SQVDR WRKT + L KDK+C + I +KPY+  P +L WT+E D
Sbjct  70   ADATFKTIQVKLCYAPISQVDRPWRKTHNELLKDKTCPYEIVSKPYDKTPQSLDWTVELD  129

Query  468  VPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +PT T+FVRVY  + D HEV YGQ++D  +T NLF ++AI+G H +LDI 
Sbjct  130  IPTGTYFVRVYGIDGDGHEVAYGQSSDEGRTTNLFSIQAISGGHVSLDIA  179



>ref|XP_006281099.1| hypothetical protein CARUB_v10027129mg [Capsella rubella]
 gb|EOA13997.1| hypothetical protein CARUB_v10027129mg [Capsella rubella]
Length=211

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 122/173 (71%), Gaps = 9/173 (5%)
 Frame = -2

Query  816  SLLLCCLAATAYG----EVLFSSLKR-SLDVSVK---HKQGQVLKAGDDEITITWSYNSS  661
            SLL+C L  ++ G    E LFS L++ SL+V+ K     +G VL AG D+I+ITW   SS
Sbjct  10   SLLICTLIQSSLGAEKKERLFSDLEKGSLEVTTKPSREGEGVVLDAGIDKISITWKL-SS  68

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWT  481
            + +K ++ +K++KVKLCYAP SQVDR WRKT D L KDK+C   I  +PY+    ++ WT
Sbjct  69   TGSKKEAEFKTIKVKLCYAPTSQVDRPWRKTHDELFKDKTCPHKIVARPYDKTTQSIDWT  128

Query  480  IERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +ERD+PT T+FVR YA +A+DHEV +GQ+TDA K   LF V+AI+GRH +LDI
Sbjct  129  LERDIPTGTYFVRAYAVDANDHEVAFGQSTDAAKKTGLFSVQAISGRHKSLDI  181



>emb|CDY34047.1| BnaC03g27680D [Brassica napus]
Length=206

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = -2

Query  816  SLLLCCLAATAYG---EVLFSSLKR-SLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            SLL+C L   ++G   E LFS L++ +L+V+ K  +  VL AG D+++ITW    SS A 
Sbjct  10   SLLICLLFQISHGATKERLFSDLEKGALEVTAKPSRESVLDAGIDKLSITWKL--SSTAT  67

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERD  469
             ++ + ++KVKLCYAPVSQVDR WRKTE+ L KDKSC   I T+ Y+  P + ++T+ERD
Sbjct  68   KEAEFTTIKVKLCYAPVSQVDRPWRKTENELFKDKSCPHKIITRAYDKSPQSFEYTLERD  127

Query  468  VPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +PT T+FVR YA +A DHEV +GQ+TD  K+ NLF V+AI+GRH +LDI
Sbjct  128  IPTGTYFVRAYAVDAKDHEVAFGQSTDEAKSTNLFSVQAISGRHKSLDI  176



>ref|XP_008798750.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Phoenix 
dactylifera]
Length=230

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 117/175 (67%), Gaps = 6/175 (3%)
 Frame = -2

Query  828  LVTYS-----LLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNS  664
            LV++S     LLL   A  A G VLFS+L ++L VS   KQG VL AG+D+IT++W  N 
Sbjct  29   LVSFSATCLLLLLISSAGPAVGGVLFSTLPKTLMVSASPKQGYVLGAGEDKITVSWGLNR  88

Query  663  SSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNT-LK  487
            S PA  D +YK V+V+LCYAP SQ DR WRKT+D L KDK+CQF +A +PY    +T  +
Sbjct  89   SLPAGADEAYKEVEVRLCYAPASQADRGWRKTDDDLSKDKTCQFGVAVRPYTTTNSTSFE  148

Query  486  WTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            + + R++PTAT+F+R Y  + D   V YGQ TD +K  +LF+V  I+GR  +LDI
Sbjct  149  YELSRELPTATYFIRAYVLDFDGKVVAYGQTTDDRKAADLFEVVGISGRSLSLDI  203



>ref|XP_010448530.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X3 [Camelina sativa]
Length=203

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = -2

Query  771  LFSSLKRSLDVSVKHKQ-GQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVS  595
            LF+ L+ S++V+ K  Q G VL+AG D +T+ W   SS+    D+++K+++VKLCYAP+S
Sbjct  23   LFAELQNSIEVAAKPIQDGVVLEAGKDMVTVKWKLKSSAKVDADATFKTIQVKLCYAPIS  82

Query  594  QVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDH  415
            QVDR WRKT + L KDK+C + I +KPY+  P +L WT+E D+PT T+FVRVY  + D H
Sbjct  83   QVDRPWRKTHNELLKDKTCPYEIVSKPYDKTPQSLDWTVELDIPTGTYFVRVYGIDGDGH  142

Query  414  EVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            EV YGQ++D  +T NLF ++AI+G H +LDI 
Sbjct  143  EVAYGQSSDEGRTTNLFSIQAISGGHVSLDIA  174



>emb|CDY64637.1| BnaA03g57010D [Brassica napus]
Length=206

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = -2

Query  816  SLLLCCLAATAYG---EVLFSSLKR-SLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            SLL+C L   ++G   E LFS L++ +L+V+ K  +  VL AG D+++ITW    SS A 
Sbjct  10   SLLICLLFQISHGATKERLFSDLEKGALEVTAKPSREGVLDAGIDKLSITWKL--SSTAT  67

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERD  469
             ++ + ++KVKLCYAPVSQVDR WRKTE+ L KDKSC   I T+ Y+  P + ++T+ERD
Sbjct  68   KEAEFTTIKVKLCYAPVSQVDRPWRKTENELFKDKSCPHKIITRAYDKSPQSFEYTLERD  127

Query  468  VPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +PT T+FVR YA +A DHEV +GQ+T+  K+ NLF V+AI+GRH +LDI
Sbjct  128  IPTGTYFVRAYAVDAKDHEVAFGQSTNEAKSTNLFSVQAISGRHKSLDI  176



>ref|XP_009134048.1| PREDICTED: high-affinity nitrate transporter 3.1 [Brassica rapa]
Length=206

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = -2

Query  816  SLLLCCLAATAYG---EVLFSSLKR-SLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            SLL+C L   ++G   E LFS L++ +L+V+ K  +  VL AG D+++ITW    SS A 
Sbjct  10   SLLICLLFQISHGATKERLFSDLEKGALEVTAKPSREGVLDAGIDKLSITWKL--SSTAT  67

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERD  469
             ++ + ++KVKLCYAPVSQVDR WRKTE+ L KDKSC   I T+ Y+  P + ++T+ERD
Sbjct  68   KEAEFTTIKVKLCYAPVSQVDRPWRKTENELFKDKSCPHKIITRAYDKSPQSFEYTLERD  127

Query  468  VPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +PT T+FVR YA +A DHEV +GQ+T+  K+ NLF V+AI+GRH +LDI
Sbjct  128  IPTGTYFVRAYAVDAKDHEVAFGQSTNEAKSTNLFSVQAISGRHKSLDI  176



>ref|XP_010448528.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X1 [Camelina sativa]
Length=228

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 116/171 (68%), Gaps = 3/171 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQ-GQVLKAGDDEITITWSYNSSSPA  652
            L+ +S +  C       + LF+ L+  ++V+ K  Q G VL+AG D +T+ W   SS+  
Sbjct  31   LLIFSFIHSCRGGNK--DRLFTELQNLIEVTTKPMQDGVVLEAGKDMVTVKWKLKSSAKV  88

Query  651  KTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIER  472
              D+++K+++VKLCYAP+SQVDR WRKT + L KDK+C + I +KPY+  P +L WT+E 
Sbjct  89   DADATFKTIQVKLCYAPISQVDRPWRKTHNELLKDKTCPYEIVSKPYDKTPQSLDWTVEL  148

Query  471  DVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            D+PT T+FVRVY  + D HEV YGQ++D  +T NLF ++AI+G H +LDI 
Sbjct  149  DIPTGTYFVRVYGIDGDGHEVAYGQSSDEGRTTNLFSIQAISGGHVSLDIA  199



>ref|XP_006284533.1| hypothetical protein CARUB_v10005735mg [Capsella rubella]
 gb|EOA17431.1| hypothetical protein CARUB_v10005735mg [Capsella rubella]
Length=208

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKHKQ-GQVLKAGDDEITITWSYNSS  661
            L+  SLL+     +  G   + L S L+ SLDV+ K  Q G VL+AG D +TITW   SS
Sbjct  6    LLFASLLIVSFIDSNLGGTKDRLLSELQNSLDVTAKPAQDGVVLEAGKDMVTITWKLKSS  65

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWT  481
            +    D+++K+++VKLCYAP+SQVDR WRKT + L++DK+C   I +K Y+  P +L WT
Sbjct  66   AKVDADAAFKTIQVKLCYAPISQVDRPWRKTYNELRRDKTCPHEIVSKLYDRTPQSLDWT  125

Query  480  IERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            ++ D+PT T+FVR Y  + D HEV YGQ++D  +T NLF V+AI+G H +LDI 
Sbjct  126  VQLDIPTGTYFVRAYGIDGDGHEVAYGQSSDEGRTTNLFSVQAISGGHVSLDIA  179



>ref|XP_004301016.1| PREDICTED: high-affinity nitrate transporter 3.2-like [Fragaria 
vesca subsp. vesca]
Length=224

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 129/202 (64%), Gaps = 25/202 (12%)
 Frame = -2

Query  867  LKGRSEMAKIGGFLVTYSLLLCCLAATAY--GEVLFSSLKRSLDVSVK-HKQGQV-----  712
            +  RSE+        +  L L C++  +Y  G VLFSSL  ++++ V  HK  QV     
Sbjct  1    MASRSEIV-----FASLLLFLSCISEPSYANGVVLFSSLPNTIEMIVSPHKPEQVVKPAE  55

Query  711  --------LKAGDDEITITWSYNSS-SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDH  559
                    LKAG+D+++I+W  N S S   TDS+YK+VKVKLCYAPVSQVDR WRKT D+
Sbjct  56   GSWTFGGMLKAGEDKLSISWRLNQSFSAGTTDSAYKTVKVKLCYAPVSQVDRGWRKTVDN  115

Query  558  LKKDKSCQFTIATKPY---NPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTD  388
            L KDK+CQF I T+ Y   + K   + WTI+RDVPTA++FVR YAY+     V YGQ+T 
Sbjct  116  LAKDKTCQFKIETRAYKHGSSKWKYVDWTIKRDVPTASYFVRAYAYDGAGVAVAYGQSTG  175

Query  387  AKKTQNLFQVEAITGRHATLDI  322
             KK  N+F+V+ ITGRH TLD+
Sbjct  176  PKKNYNIFEVQGITGRHKTLDV  197



>ref|XP_009138452.1| PREDICTED: high-affinity nitrate transporter 3.2 isoform X1 [Brassica 
rapa]
Length=209

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 118/175 (67%), Gaps = 4/175 (2%)
 Frame = -2

Query  831  FLVTYSLLLCCLAATAYG--EV-LFSSLKRSLDVSVKH-KQGQVLKAGDDEITITWSYNS  664
            FL    L+      + +G  EV LF++L+ SL+V+ K  + G VL+AG D + ITW   S
Sbjct  6    FLFVSFLIFSSSIESNHGATEVSLFTNLENSLEVTAKPLRDGVVLEAGKDMVRITWMLKS  65

Query  663  SSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKW  484
            S     D+++K+V+VKLCYAP+SQVDR WRKT + L +D+SC   I +KPY+  P +L W
Sbjct  66   SGKVDGDTAFKTVEVKLCYAPISQVDRPWRKTHNELSRDRSCPHKIVSKPYDKIPQSLNW  125

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            TI+R+ PT T+FVR Y  + +  EV YGQ++DA+KT NLF VE I+GRH +LDI 
Sbjct  126  TIDRETPTGTYFVRAYGTDVNGQEVAYGQSSDAEKTTNLFSVEGISGRHTSLDIA  180



>gb|EYU28626.1| hypothetical protein MIMGU_mgv1a0249302mg, partial [Erythranthe 
guttata]
Length=162

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = -2

Query  711  LKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQF  532
            LKAG+DEIT+TWS NS+ PA  DSSYK+V +KLCYAP+SQ DR WRKT D+L KDK+CQ 
Sbjct  1    LKAGEDEITVTWSLNSTFPAGVDSSYKTVTIKLCYAPISQKDRGWRKTVDNLVKDKTCQH  60

Query  531  TI-ATKPY-NPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQV  358
             I A KPY  P  NT   T+ RDVPTAT+F+R YA N++  EV YGQ TD+ K  NLF++
Sbjct  61   KIVANKPYIFPSNNTFTSTVLRDVPTATYFIRAYAQNSEGDEVAYGQTTDSHKAVNLFEI  120

Query  357  EAITGRHATLDI  322
            +AITGRH +LDI
Sbjct  121  QAITGRHVSLDI  132



>ref|XP_010433732.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X1 [Camelina sativa]
 ref|XP_010433733.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X2 [Camelina sativa]
Length=208

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKHKQ-GQVLKAGDDEITITWSYNSS  661
            L+  SLL+  L  ++ G   + LF+ L++SL+V+ KH Q G VL+AG D +TI W   SS
Sbjct  6    LLFVSLLIFSLIPSSRGGNKDRLFTELQKSLEVTPKHVQDGVVLEAGKDMVTIKWKLKSS  65

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWT  481
            +    D ++K ++VKLCYAP+SQVDR WRKT + L KDK+C   I +K Y+  P +L WT
Sbjct  66   AKVDADDTFKKIQVKLCYAPISQVDRPWRKTHNELFKDKTCPHEIVSKSYDKTPQSLDWT  125

Query  480  IERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            ++ D+PT T+FVR Y  + D  EV YGQ++D  + +NLF V+AI+G H +LDI 
Sbjct  126  VDLDIPTGTYFVRAYGIDGDGQEVAYGQSSDEGRKKNLFSVQAISGGHVSLDIA  179



>ref|XP_010438981.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X2 [Camelina sativa]
Length=208

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 107/152 (70%), Gaps = 1/152 (1%)
 Frame = -2

Query  771  LFSSLKRSLDVSVKHKQ-GQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVS  595
            LFS L+ SLDV+ K  Q G VL+AG D +TI W   SS     D+++K+++VKLCYAP+S
Sbjct  28   LFSVLQNSLDVTGKPVQDGVVLEAGKDMVTIKWKLKSSGKVDADATFKTIQVKLCYAPIS  87

Query  594  QVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDH  415
            QVDR WRKT + L KDK+C   I +KPY+  P +L WT++ D+PT T+FVR Y  + D  
Sbjct  88   QVDRPWRKTHNELFKDKTCPHEIVSKPYDKTPQSLDWTVDLDIPTGTYFVRAYGIDGDGQ  147

Query  414  EVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            EV YGQ++D  +T+NLF V+AI+G H +LDI 
Sbjct  148  EVAYGQSSDEGRTKNLFSVQAISGGHVSLDIA  179



>ref|XP_002867650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=207

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 117/174 (67%), Gaps = 5/174 (3%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKH-KQGQVLKAGDDEITITWSYNSS  661
            L+  S+L+  L  ++ G   + LF+ L+ S++V+ K  K   VL+ G D +TITW   SS
Sbjct  6    LLFVSVLIFSLTESSRGRNKDRLFTELQNSIEVTAKPVKDSGVLEGGKDMVTITWKLKSS  65

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWT  481
            +    D+++K++++KLCYAP+SQVDR WRK+++ L KD SC   I +KPY+  P +L WT
Sbjct  66   TKVDMDAAFKTIQIKLCYAPISQVDRPWRKSDNKLSKDNSCPHEIVSKPYDMTPQSLDWT  125

Query  480  IERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +ERD+PT T+FVR Y  + D HEV YGQ+TD  +T NLF V+A +G H  LDI 
Sbjct  126  VERDIPTGTYFVRAYGIDGDGHEVAYGQSTDEGRTTNLFSVQA-SGHHVALDIA  178



>ref|XP_010441706.1| PREDICTED: high-affinity nitrate transporter 3.1 [Camelina sativa]
 ref|XP_010482331.1| PREDICTED: high-affinity nitrate transporter 3.1 [Camelina sativa]
Length=210

 Score =   173 bits (439),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 121/172 (70%), Gaps = 8/172 (5%)
 Frame = -2

Query  816  SLLLCCLAATAYG---EVLFSSLKR-SLDVSVKHKQ---GQVLKAGDDEITITWSYNSSS  658
            SLL+C L  +++G   E LFS L++ SL+V+ K  +   G VL AG D+I+ITW   SS+
Sbjct  10   SLLICSLIQSSHGAEKERLFSELEKGSLEVTTKPSREGAGVVLDAGIDKISITWKL-SST  68

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTI  478
             +K ++ +K++KVKLCYAP SQVDR WRKT D L KDK+C   I  +PY+    ++ W +
Sbjct  69   GSKKEAEFKTIKVKLCYAPPSQVDRPWRKTHDELFKDKTCPHKIVARPYDKTTQSIDWIL  128

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ERD+PT T+FVR YA +  DHEV +GQ+T+  KT +LF V+AI+GRH +LDI
Sbjct  129  ERDIPTGTYFVRAYAVDEHDHEVAFGQSTNEAKTTSLFSVQAISGRHKSLDI  180



>sp|Q9SB67.1|NRT32_ARATH RecName: Full=High-affinity nitrate transporter 3.2; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA22991.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79382.1| hypothetical protein [Arabidopsis thaliana]
Length=209

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 5/175 (3%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKH-KQGQVLKAGDDEITITWSYNSS  661
            L+  SLL+  L  ++ G   + LF+ L+ S++V+ K  K   VL+AG D +TITW   SS
Sbjct  6    LLFVSLLIFSLIESSSGGKKDRLFTDLQNSIEVTAKPVKDSGVLEAGKDMVTITWKLKSS  65

Query  660  SP-AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKW  484
            S    TD+++K+++VKLCYAP+SQVDR WRKT++ L KD+SC   I +K Y+  P +L W
Sbjct  66   SAKVDTDTAFKTIQVKLCYAPISQVDRPWRKTDNKLFKDRSCPHEIVSKAYDKTPQSLDW  125

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            TI  D+PT T+FVR Y  + D HEV YGQ+TD  +T NLF V AI+G H  LDI 
Sbjct  126  TIGLDIPTGTYFVRAYGIDGDGHEVAYGQSTDEGRTTNLFSVHAISGHHVGLDIA  180



>emb|CDY34305.1| BnaA01g14080D [Brassica napus]
Length=262

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -2

Query  771  LFSSLKRSLDVSVKHKQGQV--LKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPV  598
            LF++L+ SL+V+ K  +  V  L+AG D + ITW   SS+    D+S+K+V+VKLCYAP+
Sbjct  81   LFTNLENSLEVTAKPTRVGVVVLEAGKDMVRITWMLKSSAKVNDDASFKTVEVKLCYAPI  140

Query  597  SQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADD  418
            SQVDR WRKT + L +D+SC   I +KPY+  P +L WTI+R+ PT T+FVRVY    + 
Sbjct  141  SQVDRPWRKTHNELSRDRSCPHKIVSKPYDKIPQSLNWTIDRETPTGTYFVRVYGIGVNG  200

Query  417  HEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             EV YGQ++DA+KT NLF VE I+GRH +LDI
Sbjct  201  QEVAYGQSSDAEKTTNLFSVEGISGRHTSLDI  232



>gb|KFK26653.1| hypothetical protein AALP_AA8G276000 [Arabis alpina]
Length=205

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 119/169 (70%), Gaps = 7/169 (4%)
 Frame = -2

Query  816  SLLLCCLAATAYG---EVLFSSLKR-SLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            SL+LC L  ++ G   E LFS L++ +L+V+ K  +  VL AG D+++I+W  +S +   
Sbjct  10   SLVLCLLIESSLGATKERLFSELRKDALEVTAKPSRDGVLDAGKDKVSISWKLSSGA---  66

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERD  469
            +D+ +K++KVKLCYAP SQ+DR WRKT D L KDK+C   I  KPY+    ++ +T+ERD
Sbjct  67   SDADFKTIKVKLCYAPSSQLDRPWRKTHDELFKDKTCPHKIVAKPYDKTAQSMDYTLERD  126

Query  468  VPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +PT  +FVR YA + + HEV +GQ+TD  K  N+F+V+AI+GRHA+LDI
Sbjct  127  IPTGAYFVRAYAVDENGHEVAFGQSTDVAKNNNIFKVQAISGRHASLDI  175



>emb|CDX83019.1| BnaA01g20190D [Brassica napus]
Length=206

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 120/175 (69%), Gaps = 6/175 (3%)
 Frame = -2

Query  840  IGGFLVTYSLLLCCLAATAYGEVLFSSLKR-SLDVSVKHKQGQVLKAGDDEITITWSYNS  664
            +  F+V    L+   +  A  E LFS L++ +LDV+ K  +  VL AG D+++ITW    
Sbjct  8    LASFIV---YLMIQFSHGATKERLFSDLEKDALDVTAKPSRQGVLDAGIDKLSITWKL--  62

Query  663  SSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKW  484
            SS AK  +++ ++KVKLCYAPVSQVDR WRKTE+ L KDK+C   I T+ YN    + K+
Sbjct  63   SSTAKKQANFTTIKVKLCYAPVSQVDRPWRKTENELFKDKTCPHKIITRAYNKSSQSFKY  122

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            T++RD+PT T+FVR YA +A DHEV +GQ+T+  KT NLF V+AI+GRH +LDI 
Sbjct  123  TLDRDIPTGTYFVRTYAVDAKDHEVAFGQSTNEAKTTNLFSVQAISGRHKSLDIA  177



>emb|CDY03424.1| BnaC01g16580D [Brassica napus]
Length=208

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = -2

Query  771  LFSSLKRSLDVSVK-HKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVS  595
            LF++L+ SL+V+ K  + G V +AG D + ITW   SS+    D+++K+V+VKLCYAP+S
Sbjct  28   LFTNLENSLEVTAKPTRVGVVWEAGKDIVRITWMLKSSAKVNDDAAFKTVEVKLCYAPIS  87

Query  594  QVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDH  415
            QVDR WRKT + L +D+SC   I +KPY+  P +L WTI+R+ PT T+F+R Y  + + +
Sbjct  88   QVDRPWRKTHNELSRDRSCPHKIVSKPYDKIPQSLNWTIDRETPTGTYFIRAYGTDVNGY  147

Query  414  EVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            EV YGQ++DA+KT NLF VE I+GRH +LDI 
Sbjct  148  EVAYGQSSDAEKTTNLFSVEGISGRHTSLDIA  179



>gb|ABF59166.1| hypothetical protein At4g24720 [Arabidopsis thaliana]
Length=231

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 5/175 (3%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKH-KQGQVLKAGDDEITITWSYNSS  661
            L+  SLL+  L  ++ G   + LF+ L+ S++V+ K  K   VL+AG D +TITW   SS
Sbjct  28   LLFVSLLIFSLIESSSGGKKDRLFTDLQNSIEVTAKPVKDSGVLEAGKDMVTITWKLKSS  87

Query  660  SP-AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKW  484
            S    TD+++K+++VKLCYAP+SQVDR WRKT++ L KD+SC   I +K Y+  P +L W
Sbjct  88   SAKVDTDTAFKTIQVKLCYAPISQVDRPWRKTDNKLFKDRSCPHEIVSKAYDKTPQSLDW  147

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            TI  D+PT T+FVR Y  + D HEV YGQ+TD  +T NLF V AI+G H  LDI 
Sbjct  148  TIGLDIPTGTYFVRAYGIDGDGHEVAYGQSTDEGRTTNLFSVHAISGHHVGLDIA  202



>ref|NP_001190826.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
 gb|AEE84949.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
Length=231

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 5/175 (3%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKH-KQGQVLKAGDDEITITWSYNSS  661
            L+  SLL+  L  ++ G   + LF+ L+ S++V+ K  K   VL+AG D +TITW   SS
Sbjct  28   LLFVSLLIFSLIESSSGGKKDRLFTDLQNSIEVTAKPVKDSGVLEAGKDMVTITWKLKSS  87

Query  660  SP-AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKW  484
            S    TD+++K+++VKLCYAP+SQVDR WRKT++ L KD+SC   I +K Y+  P +L W
Sbjct  88   SAKVDTDTAFKTIQVKLCYAPISQVDRPWRKTDNKLFKDRSCPHEIVSKAYDKTPQSLDW  147

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            TI  D+PT T+FVR Y  + D HEV YGQ+TD  +T NLF V AI+G H  LDI 
Sbjct  148  TIGLDIPTGTYFVRAYGIDGDGHEVAYGQSTDEGRTTNLFSVHAISGHHVGLDIA  202



>ref|XP_006402168.1| hypothetical protein EUTSA_v10014669mg [Eutrema salsugineum]
 gb|ESQ43621.1| hypothetical protein EUTSA_v10014669mg [Eutrema salsugineum]
Length=211

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 121/175 (69%), Gaps = 13/175 (7%)
 Frame = -2

Query  816  SLLLCCLAATAYG---EVLFSSLKR-SLDVSVK---HKQGQVLKAGDDEITITWSYNSSS  658
            SL +C L  +++G   E LFS L++ + +V+ K     +G VL AG D+++ITW  NS++
Sbjct  10   SLFICSLIQSSHGATKERLFSDLEKGAFEVTTKPSREGEGVVLDAGIDKLSITWKLNSTA  69

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPK---PNTLK  487
                ++ +K++KVKLCYAP+SQVDR WRKTE+ L KDKSC   I  +PY+       T+ 
Sbjct  70   K---EAEFKTIKVKLCYAPISQVDRPWRKTENELFKDKSCPHKIVARPYDSSVKTAQTID  126

Query  486  WTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +T+ERD+PT T+FVR YA +A DHEV +GQ+TD  K  NLF V+AI+GRH +LDI
Sbjct  127  YTLERDIPTGTYFVRAYAVDAHDHEVAFGQSTDEDKKTNLFSVQAISGRHKSLDI  181



>ref|XP_002864044.1| wound-responsive 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40303.1| wound-responsive 3 [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 114/172 (66%), Gaps = 8/172 (5%)
 Frame = -2

Query  816  SLLLCCLAATAYGE---VLFSSL-KRSLDVSV---KHKQGQVLKAGDDEITITWSYNSSS  658
            SLL+C L  +++G     LF  L K +LDV+    +   G VL AG D + ITW   S+ 
Sbjct  10   SLLICSLIQSSHGAEKVRLFKELDKGALDVTTQPSRQGDGVVLDAGKDTLNITWKL-SAI  68

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTI  478
             +K ++ +K +KVKLCYAP SQ+DR WRKT D L KDK+C   I  KPY+  P +  WT+
Sbjct  69   GSKREAEFKIIKVKLCYAPPSQLDRPWRKTHDELFKDKTCPHKIIAKPYDKTPQSTVWTV  128

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ERD+PT T+FVR YA +A  HEV YGQ+TD  KT NLF V+AI+GRH +LDI
Sbjct  129  ERDIPTGTYFVRAYAVDAIGHEVAYGQSTDDAKTTNLFSVQAISGRHTSLDI  180



>ref|XP_010438982.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X3 [Camelina sativa]
Length=200

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 104/151 (69%), Gaps = 7/151 (5%)
 Frame = -2

Query  771  LFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQ  592
            LFS L+ SLDV+V       L+AG D +TI W   SS     D+++K+++VKLCYAP+SQ
Sbjct  28   LFSVLQNSLDVTV-------LEAGKDMVTIKWKLKSSGKVDADATFKTIQVKLCYAPISQ  80

Query  591  VDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHE  412
            VDR WRKT + L KDK+C   I +KPY+  P +L WT++ D+PT T+FVR Y  + D  E
Sbjct  81   VDRPWRKTHNELFKDKTCPHEIVSKPYDKTPQSLDWTVDLDIPTGTYFVRAYGIDGDGQE  140

Query  411  VGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            V YGQ++D  +T+NLF V+AI+G H +LDI 
Sbjct  141  VAYGQSSDEGRTKNLFSVQAISGGHVSLDIA  171



>ref|NP_199831.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 ref|NP_851159.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 ref|NP_851160.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 sp|Q9FGS5.1|NRT31_ARATH RecName: Full=High-affinity nitrate transporter 3.1; AltName: 
Full=Protein WOUND-RESPONSIVE 3; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09391.1| unnamed protein product [Arabidopsis thaliana]
 emb|CAC36292.1| putative component of high affinity nitrate transporter [Arabidopsis 
thaliana]
 gb|AED95909.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 gb|AED95910.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
 gb|AED95911.1| high-affinity nitrate transporter 3.1 [Arabidopsis thaliana]
Length=210

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 8/172 (5%)
 Frame = -2

Query  816  SLLLCCLAATAYGE---VLFSSL-KRSLDVSVKHKQ---GQVLKAGDDEITITWSYNSSS  658
            SLL+C L  + +G     LF  L K +LDV+ K  +   G VL AG D + ITW+  SS 
Sbjct  10   SLLICSLIQSIHGAEKVRLFKELDKGALDVTTKPSREGPGVVLDAGKDTLNITWTL-SSI  68

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTI  478
             +K ++ +K +KVKLCYAP SQVDR WRKT D L KDK+C   I  KPY+    +  WT+
Sbjct  69   GSKREAEFKIIKVKLCYAPPSQVDRPWRKTHDELFKDKTCPHKIIAKPYDKTLQSTTWTL  128

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ERD+PT T+FVR YA +A  HEV YGQ+TD  K  NLF V+AI+GRHA+LDI
Sbjct  129  ERDIPTGTYFVRAYAVDAIGHEVAYGQSTDDAKKTNLFSVQAISGRHASLDI  180



>emb|CAC36942.1| putative component of high affinity nitrate transporter [Arabidopsis 
thaliana]
Length=210

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 8/172 (5%)
 Frame = -2

Query  816  SLLLCCLAATAYGE---VLFSSL-KRSLDVSVKHKQ---GQVLKAGDDEITITWSYNSSS  658
            SLL+C L  + +G     LF  L K +LDV+ K  +   G VL AG D + ITW+  SS 
Sbjct  10   SLLICSLIQSIHGAEKLRLFKELDKGALDVTTKPSREGPGVVLDAGKDTLNITWTL-SSI  68

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTI  478
             +K ++ +K +KVKLCYAP SQVDR WRKT D L KDK+C   I  KPY+    +  WT+
Sbjct  69   GSKREAEFKIIKVKLCYAPPSQVDRPWRKTHDELFKDKTCPHKIIAKPYDKTLQSTTWTL  128

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ERD+PT T+FVR YA +A  HEV YGQ+TD  K  NLF V+AI+GRHA+LDI
Sbjct  129  ERDIPTGTYFVRAYAVDAIGHEVAYGQSTDDAKKTNLFSVQAISGRHASLDI  180



>ref|XP_010438980.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X1 [Camelina sativa]
Length=241

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKHKQGQ-VLKAGDDEITITWSYNSS  661
            L+  SLL+     ++ G   + LF+ L+  L+V+ K  Q   VL+AG D +TI W   SS
Sbjct  39   LLFVSLLIFSFIESSRGGNKDRLFTELQNLLEVTAKPVQDVIVLEAGKDMVTIKWKLKSS  98

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWT  481
                 D+++K+++VKLCYAP+SQVDR WRKT + L KDK+C   I +KPY+  P +L WT
Sbjct  99   GKVDADATFKTIQVKLCYAPISQVDRPWRKTHNELFKDKTCPHEIVSKPYDKTPQSLDWT  158

Query  480  IERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            ++ D+PT T+FVR Y  + D  EV YGQ++D  +T+NLF V+AI+G H +LDI 
Sbjct  159  VDLDIPTGTYFVRAYGIDGDGQEVAYGQSSDEGRTKNLFSVQAISGGHVSLDIA  212



>ref|XP_010433734.1| PREDICTED: high-affinity nitrate transporter 3.2-like isoform 
X3 [Camelina sativa]
Length=208

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (65%), Gaps = 4/174 (2%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKHKQ-GQVLKAGDDEITITWSYNSS  661
            L+  SLL+     ++ G   +  F+ L+ SL+V+ K  Q G VL+AG D +TI W   SS
Sbjct  6    LLFVSLLIFSFIESSRGGNKDKFFTELQNSLEVTAKPVQDGLVLEAGKDMVTIKWKLKSS  65

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWT  481
            +    D ++K ++VKLCYAP+SQVDR WRKT + L KDK+C   I +K Y+  P +L WT
Sbjct  66   AKVDADDTFKKIQVKLCYAPISQVDRPWRKTHNELFKDKTCPHEIVSKSYDKTPQSLDWT  125

Query  480  IERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            ++ D+PT T+FVR Y  + D  EV YGQ++D  + +NLF V+AI+G H +LDI 
Sbjct  126  VDLDIPTGTYFVRAYGIDGDGQEVAYGQSSDEGRKKNLFSVQAISGGHVSLDIA  179



>gb|AAM62807.1| putative component of high affinity nitrate transporter [Arabidopsis 
thaliana]
Length=210

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 113/172 (66%), Gaps = 8/172 (5%)
 Frame = -2

Query  816  SLLLCCLAATAYGE---VLFSSL-KRSLDVSVKHKQ---GQVLKAGDDEITITWSYNSSS  658
            SLL+C L  + +G     LF  L K +LDV+ K  +   G VL AG D + ITW+  SS 
Sbjct  10   SLLICSLIQSIHGAEKLRLFKELDKGALDVTTKPSREGPGVVLDAGKDTLNITWTL-SSI  68

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTI  478
             +K ++ +K +KVKLCYAP SQVDR WRKT D   KDK+C   I  KPY+    +  WT+
Sbjct  69   GSKREAEFKIIKVKLCYAPPSQVDRPWRKTHDEFFKDKTCPHKIIAKPYDKTLQSTTWTL  128

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ERD+PT T+FVR YA +A  HEV YGQ+TD  K  NLF V+AI+GRHA+LDI
Sbjct  129  ERDIPTGTYFVRAYAVDAIGHEVAYGQSTDDAKKTNLFSVQAISGRHASLDI  180



>ref|XP_009150665.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Brassica 
rapa]
Length=206

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 117/175 (67%), Gaps = 6/175 (3%)
 Frame = -2

Query  840  IGGFLVTYSLLLCCLAATAYGEVLFSSLKR-SLDVSVKHKQGQVLKAGDDEITITWSYNS  664
            +  F+V    L+   +  A  E LFS L++ +LDV+ K  +  VL AG D+++ITW   S
Sbjct  8    LASFIV---YLMIQFSHGATKERLFSDLEKDALDVTAKPSRQGVLDAGIDKLSITWKLRS  64

Query  663  SSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKW  484
            +  AK  +++ ++KVKLCYAPVSQVDR WRKTE+ L KDK+C   I T+ YN    + K+
Sbjct  65   T--AKKQANFTTIKVKLCYAPVSQVDRPWRKTENELFKDKTCPHKIITRAYNKSSQSFKY  122

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            T++RD+PT T+FVR YA +A DHEV +GQ+T   K   LF V+AI+GRH +LDI 
Sbjct  123  TLDRDIPTGTYFVRTYAVDAKDHEVAFGQSTSEAKPTKLFSVQAISGRHKSLDIA  177



>ref|XP_009127362.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Brassica 
rapa]
 emb|CDY16372.1| BnaA02g11760D [Brassica napus]
Length=212

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 124/179 (69%), Gaps = 12/179 (7%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKR-SLDVSV---KHKQGQVLKAGDDEITITWSY  670
            L+  SLL+C +  +++G   E LF+ L++ +L+++    +  +G VL AG D+++ITW  
Sbjct  6    LLFASLLICSMIQSSHGATKERLFTDLEKGALEITATPSRTGEGVVLAAGIDKLSITWKV  65

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNT-  493
              SS A  +  +K++KVKLCYAP+SQVDR WRKTE+ L KDKSC   I++  Y+P   T 
Sbjct  66   --SSTATKEPEFKTIKVKLCYAPISQVDRPWRKTENELFKDKSCPHKISSFSYDPTVKTA  123

Query  492  --LKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
                +T+ERD+PT T++VR YA +A DHEV +GQ+T+  KT NLF V+AI+GRH +LDI
Sbjct  124  QSFDYTLERDIPTGTYYVRAYAVDAKDHEVAFGQSTNQDKTTNLFSVQAISGRHKSLDI  182



>emb|CDX91545.1| BnaC02g16150D [Brassica napus]
Length=212

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 123/179 (69%), Gaps = 12/179 (7%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKR-SLDVSV---KHKQGQVLKAGDDEITITWSY  670
            L+  SLL+C +  +++G   E LF+ L++ SL+++    +  +G VL AG D+++ITW  
Sbjct  6    LLFASLLICSMIQSSHGATKERLFTDLEKGSLEITATPSRTGEGVVLAAGIDKLSITWKV  65

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNT-  493
              SS A  +  +K++KVKLCYAPVSQVDR WRKT + L KDKSC   I++  Y+P   T 
Sbjct  66   --SSTATKEPEFKTIKVKLCYAPVSQVDRPWRKTHNELFKDKSCPHKISSFSYDPTVKTA  123

Query  492  --LKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
                +T+ERD+PT T++VR YA +A DHEV +GQ+T+  KT NLF V+AI+GRH +LDI
Sbjct  124  QSFDYTLERDIPTGTYYVRAYAVDAIDHEVAFGQSTNEAKTTNLFSVQAISGRHKSLDI  182



>emb|CDX71613.1| BnaC09g26540D [Brassica napus]
Length=212

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 118/175 (67%), Gaps = 12/175 (7%)
 Frame = -2

Query  816  SLLLCCLAATAYG---EVLFSSLKRS-LDVSV---KHKQGQVLKAGDDEITITWSYNSSS  658
            SLL+C L  + +    E LFS L++S L+V+    +  +G VL AG D+++ITW    SS
Sbjct  10   SLLICLLIQSIHAATKERLFSDLEKSALEVTATPSRVGEGVVLAAGVDKLSITWKV--SS  67

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNT---LK  487
             A  +  + ++KVKLCYAP SQVDR WRKTE+ L KDKSC   I++  Y+P   T     
Sbjct  68   TATKEPEFNAIKVKLCYAPASQVDRPWRKTENELFKDKSCPHKISSWSYDPAMKTAQSFD  127

Query  486  WTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +T+ERD+PT T+FVR YA +A DHEV +GQ+T+  KT NLF V+AI+GRH +LDI
Sbjct  128  YTLERDIPTGTYFVRAYAVDAKDHEVAFGQSTNEDKTSNLFSVQAISGRHKSLDI  182



>ref|XP_009118895.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Brassica 
rapa]
Length=212

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 119/175 (68%), Gaps = 12/175 (7%)
 Frame = -2

Query  816  SLLLCCLAATAYG---EVLFSSLKRS-LDVSV---KHKQGQVLKAGDDEITITWSYNSSS  658
            SLL+C L  +++    E LFS L++S L+V+    +  +G VL AG D+++ITW    SS
Sbjct  10   SLLICLLIQSSHAATKERLFSDLEKSALEVTATPSRVGEGVVLAAGVDKLSITWKV--SS  67

Query  657  PAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPK---PNTLK  487
             A  +  +K++KVKLCYAP SQVDR WRKTE+ L KDKSC   I++  Y+P      +  
Sbjct  68   TATKEPEFKAIKVKLCYAPASQVDRPWRKTENELFKDKSCPHKISSWSYDPAMKAGQSFD  127

Query  486  WTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            +T+ERD+PT T+FVR YA +  DHEV +GQ+T+  KT NLF V+AI+GRH +LDI
Sbjct  128  YTLERDIPTGTYFVRAYAVDTKDHEVAFGQSTNEDKTTNLFSVQAISGRHKSLDI  182



>ref|XP_002978289.1| hypothetical protein SELMODRAFT_152440 [Selaginella moellendorffii]
 gb|EFJ20946.1| hypothetical protein SELMODRAFT_152440 [Selaginella moellendorffii]
Length=208

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVK-HKQGQVL---KAGDDEITITWSYNSS  661
            ++  S+    LA + +G V F+SL RSL V+V  ++QG+ L   ++G D + I WS NSS
Sbjct  7    VLLVSIAFLALARSVHGGVSFASLPRSLVVTVAMNEQGRFLNSVESGKDRLLINWSVNSS  66

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY-NPKPNTLKW  484
             PA T+  +K++K+KLCYAP SQ +R WRK+ D LKKDK+CQF IAT+ Y     N+ +W
Sbjct  67   VPAPTN--FKNIKLKLCYAPPSQENRGWRKSTDDLKKDKTCQFDIATQSYAGAAGNSTEW  124

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             I +D+P A +FVR YA N+   +V YGQ+T+A KT+N+F V  ITGR  +L I
Sbjct  125  LISKDIPGALYFVRAYAINSTGSQVAYGQSTNAAKTENIFTVIPITGRPKSLYI  178



>ref|XP_010446000.1| PREDICTED: high-affinity nitrate transporter 3.1-like, partial 
[Camelina sativa]
Length=169

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -2

Query  720  GQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKS  541
            G VL AG D+I+ITW   SS+ +K ++ +K++KVKLCYAP SQVDR WRKT D L KDK+
Sbjct  8    GVVLDAGIDKISITWKL-SSTGSKKEAEFKTIKVKLCYAPPSQVDRPWRKTHDELFKDKT  66

Query  540  CQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQ  361
            C   I  +PY+    ++ W +ERD+PT T+FVR YA +  DHEV +GQ+T+  KT +LF 
Sbjct  67   CPHKIVARPYDKTTQSIDWILERDIPTGTYFVRAYAVDEHDHEVAFGQSTNEAKTTSLFS  126

Query  360  VEAITGRHATLDIC  319
            V+AI+GRH +LDI 
Sbjct  127  VQAISGRHKSLDIA  140



>ref|XP_002966283.1| hypothetical protein SELMODRAFT_227648 [Selaginella moellendorffii]
 gb|EFJ32310.1| hypothetical protein SELMODRAFT_227648 [Selaginella moellendorffii]
Length=208

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 116/174 (67%), Gaps = 7/174 (4%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVK-HKQGQVL---KAGDDEITITWSYNSS  661
            ++  S+    LA + +G V F+SL RSL V+V  ++QG+ L   ++G D + I WS NSS
Sbjct  7    VLLVSIAFLALARSVHGGVSFASLPRSLVVTVAMNEQGRFLNSVESGKDRLLINWSVNSS  66

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY-NPKPNTLKW  484
             PA T+  +K++K+KLCYAP SQ +R WRK+ D LKKDK+CQF IAT+ Y     N+ +W
Sbjct  67   VPAPTN--FKNIKLKLCYAPPSQQNRGWRKSTDDLKKDKTCQFDIATQSYAGAAGNSTEW  124

Query  483  TIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             I +D P A +FVR YA N+   +V YGQ+T+A KT+N+F V  ITGR  +L I
Sbjct  125  LISKDTPGALYFVRAYAINSTGSQVAYGQSTNAAKTENIFTVIPITGRPKSLYI  178



>gb|EAY86523.1| hypothetical protein OsI_07902 [Oryza sativa Indica Group]
Length=206

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 98/153 (64%), Gaps = 4/153 (3%)
 Frame = -2

Query  777  EVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPV  598
            +V  S L ++L V V  K G+V+ AG++ +T+TWS N+S PA  D+++KSVKVKLCYAP 
Sbjct  33   QVFLSKLPKALVVGVSPKHGEVVHAGENTVTVTWSLNTSEPAGADAAFKSVKVKLCYAPA  92

Query  597  SQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADD  418
            S+ DR WRK  D L KDK+CQF +  +PY        + + RD+PTA++FVR YA +A  
Sbjct  93   SRTDRGWRKASDDLHKDKACQFKVTVQPYAAGAGRFDYVVARDIPTASYFVRAYAVDASG  152

Query  417  HEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             EV YGQ++        F V  ITG HA+L + 
Sbjct  153  TEVAYGQSS----PDAAFDVAGITGIHASLKVA  181



>ref|XP_009138456.1| PREDICTED: manganese-dependent ADP-ribose/CDP-alcohol diphosphatase 
isoform X2 [Brassica rapa]
Length=444

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 111/170 (65%), Gaps = 6/170 (4%)
 Frame = -2

Query  819  YSLLLCCLAATAYGEVLFSSLK----RSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPA  652
            Y ++  CL+   +    F   +    RSL+ +++     VL+AG D + ITW   SS   
Sbjct  247  YDVVKVCLSGHDHKGGYFVDSRGVHHRSLEAALECPP--VLEAGKDMVRITWMLKSSGKV  304

Query  651  KTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIER  472
              D+++K+V+VKLCYAP+SQVDR WRKT + L +D+SC   I +KPY+  P +L WTI+R
Sbjct  305  DGDTAFKTVEVKLCYAPISQVDRPWRKTHNELSRDRSCPHKIVSKPYDKIPQSLNWTIDR  364

Query  471  DVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            + PT T+FVR Y  + +  EV YGQ++DA+KT NLF VE I+GRH +LDI
Sbjct  365  ETPTGTYFVRAYGTDVNGQEVAYGQSSDAEKTTNLFSVEGISGRHTSLDI  414



>ref|NP_001047317.1| Os02g0595900 [Oryza sativa Japonica Group]
 sp|Q6ZI50.1|NAR21_ORYSJ RecName: Full=High-affinity nitrate transporter-activating protein 
2.1; Short=OsNAR2.1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD16835.1| component of high affinity nitrate transporter-like protein [Oryza 
sativa Japonica Group]
 dbj|BAF09231.1| Os02g0595900 [Oryza sativa Japonica Group]
 gb|EAZ23664.1| hypothetical protein OsJ_07366 [Oryza sativa Japonica Group]
Length=206

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 98/153 (64%), Gaps = 4/153 (3%)
 Frame = -2

Query  777  EVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPV  598
            +V  S L ++L V V  K G+V+ AG++ +T+TWS N+S PA  D+++KSVKVKLCYAP 
Sbjct  33   QVFLSKLPKALVVGVSPKHGEVVHAGENTVTVTWSLNTSEPAGADAAFKSVKVKLCYAPA  92

Query  597  SQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADD  418
            S+ DR WRK  D L KDK+CQF +  +PY        + + RD+PTA++FVR YA +A  
Sbjct  93   SRTDRGWRKASDDLHKDKACQFKVTVQPYAAGAGRFDYVVARDIPTASYFVRAYAVDASG  152

Query  417  HEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             EV YGQ++        F V  ITG HA+L + 
Sbjct  153  TEVAYGQSS----PDAAFDVAGITGIHASLKVA  181



>ref|XP_004952977.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Setaria 
italica]
Length=203

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 108/172 (63%), Gaps = 6/172 (3%)
 Frame = -2

Query  831  FLVTYSLLLC-CLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSP  655
            F +  ++LLC CL A A   V  S+L ++L V+   K GQVL AG D +T+TWS N++ P
Sbjct  10   FSLLAAVLLCGCLPAPAAAGVHLSTLPKALAVTASPKPGQVLHAGVDTVTVTWSLNTTEP  69

Query  654  AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKP-NTLKWTI  478
            A  D++YK+VKV LCYAPVSQ DR WRK+ED L KDK+CQF +  + Y      +  + +
Sbjct  70   AGADAAYKNVKVNLCYAPVSQKDRGWRKSEDDLSKDKACQFKLTQQAYAAGARRSFDYAV  129

Query  477  ERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             +D+P+ T++VR YA +A   +V YGQ       +  F V  ITG HA++ +
Sbjct  130  AKDIPSGTYYVRAYALDASGTQVAYGQT----GPEAAFVVAGITGIHASIKV  177



>ref|NP_194204.2| calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
 gb|AEE84947.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
Length=443

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -2

Query  714  VLKAGDDEITITWSYNSSSP-AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSC  538
            VL+AG D +TITW   SSS    TD+++K+++VKLCYAP+SQVDR WRKT++ L KD+SC
Sbjct  282  VLEAGKDMVTITWKLKSSSAKVDTDTAFKTIQVKLCYAPISQVDRPWRKTDNKLFKDRSC  341

Query  537  QFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQV  358
               I +K Y+  P +L WTI  D+PT T+FVR Y  + D HEV YGQ+TD  +T NLF V
Sbjct  342  PHEIVSKAYDKTPQSLDWTIGLDIPTGTYFVRAYGIDGDGHEVAYGQSTDEGRTTNLFSV  401

Query  357  EAITGRHATLDIC  319
             AI+G H  LDI 
Sbjct  402  HAISGHHVGLDIA  414



>ref|XP_006647452.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Oryza 
brachyantha]
Length=208

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 99/161 (61%), Gaps = 6/161 (4%)
 Frame = -2

Query  795  AATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVK  616
            AA A  +V  S L ++L V+   K G+VL AG++ +T+TWS NS+ PA  D+++KSVKVK
Sbjct  27   AAAAATQVFLSKLPKALVVAASAKHGEVLHAGENTVTVTWSLNSTEPAGADAAFKSVKVK  86

Query  615  LCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY--NPKPNTLKWTIERDVPTATFFVR  442
            LCYAP S+ DR WRK  D L KDK+CQF +   PY          + + RDVPTA++FVR
Sbjct  87   LCYAPASRKDRGWRKASDDLHKDKACQFKVTALPYAAGGGGGRFDYVVARDVPTASYFVR  146

Query  441  VYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             YA +A   EV YGQ +        F V  ITG HA+L + 
Sbjct  147  AYAVDASGTEVAYGQTS----PDAAFDVAGITGIHASLKVA  183



>gb|AFW72145.1| high affinity nitrate transporter [Zea mays]
Length=203

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 97/153 (63%), Gaps = 5/153 (3%)
 Frame = -2

Query  774  VLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVS  595
            V  SSL ++LDV+   K GQVL AG D +T+TWS N++ PA  D+ YK VKVKLCYAP S
Sbjct  30   VHLSSLPKALDVTTSAKPGQVLHAGVDSLTVTWSLNATEPAGADAGYKGVKVKLCYAPAS  89

Query  594  QVDRAWRKTEDHLKKDKSCQFTIATKPY-NPKPNTLKWTIERDVPTATFFVRVYAYNADD  418
            Q DR WRK+ED + KDK+CQF +  + Y    P + ++ + RDVP+ ++++R +A +A  
Sbjct  90   QKDRGWRKSEDDISKDKACQFKVTEQAYAAAAPGSFQYAVARDVPSGSYYLRAFATDASG  149

Query  417  HEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             EV YGQ          F V  ITG HA+L I 
Sbjct  150  AEVAYGQTAPTAA----FDVAGITGIHASLKIA  178



>ref|NP_001105929.1| high affinity nitrate transporter precursor [Zea mays]
 gb|AAY40796.1| high affinity nitrate transporter [Zea mays]
Length=203

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 97/153 (63%), Gaps = 5/153 (3%)
 Frame = -2

Query  774  VLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVS  595
            V  SSL ++LDV+   K GQVL AG D +T+TWS N++ PA  D+ YK VKVKLCYAP S
Sbjct  30   VHLSSLPKALDVTTSAKPGQVLHAGVDSLTVTWSLNATEPAGADAGYKGVKVKLCYAPAS  89

Query  594  QVDRAWRKTEDHLKKDKSCQFTIATKPY-NPKPNTLKWTIERDVPTATFFVRVYAYNADD  418
            Q DR WRK+ED + KDK+CQF +  + Y    P + ++ + RDVP+ ++++R +A +A  
Sbjct  90   QKDRGWRKSEDDISKDKACQFKVTEQAYAAAAPGSFQYAVARDVPSGSYYLRAFATDASG  149

Query  417  HEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             EV YGQ          F V  ITG HA+L I 
Sbjct  150  AEVAYGQTAPTAA----FDVAGITGIHASLKIA  178



>ref|XP_003575282.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Brachypodium distachyon]
Length=201

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 103/162 (64%), Gaps = 7/162 (4%)
 Frame = -2

Query  804  CCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSV  625
            CC  A+A      S L  +LDV+   K GQVL  G+D  T+TWS N++ PA  D++YKSV
Sbjct  20   CCAPASA--AAYLSKLPVALDVTASPKPGQVLHGGEDVFTVTWSLNATQPAGADAAYKSV  77

Query  624  KVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKP-NTLKWTIERDVPTATFF  448
            KV LCYAPVSQ +R WRKT D LKKDK+CQF +A +PY       +++ +  D+PTAT++
Sbjct  78   KVSLCYAPVSQKEREWRKTNDDLKKDKTCQFKVAQQPYAAGSQGKVEYRVALDIPTATYY  137

Query  447  VRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            VR YA +A   +V YGQ     K  + F+V +ITG   ++ +
Sbjct  138  VRAYALDASGTQVAYGQT----KLADAFEVVSITGVTTSIKV  175



>ref|XP_004952978.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Setaria 
italica]
Length=203

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 101/161 (63%), Gaps = 5/161 (3%)
 Frame = -2

Query  798  LAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKV  619
            L A A   V  S+L ++LDV+   K GQVL AG D +T+TWS N++ PA  D+++K+VKV
Sbjct  22   LPAPAAAGVHLSTLPKALDVTASPKPGQVLHAGVDTVTVTWSLNTTEPAGADAAFKNVKV  81

Query  618  KLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKP-NTLKWTIERDVPTATFFVR  442
             LCYAPVSQ DR WRK+ED L KDK+CQF +  + Y      +  + + +D+P+ T++VR
Sbjct  82   NLCYAPVSQKDRGWRKSEDDLSKDKACQFKLTQQAYAAGARRSFDYAVAKDIPSGTYYVR  141

Query  441  VYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             YA +A   +V YGQ       +  F V  ITG HA++ + 
Sbjct  142  AYALDASGTQVAYGQT----GPEAAFVVAGITGIHASIKVA  178



>ref|XP_010910986.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like, partial [Elaeis guineensis]
Length=159

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  711  LKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQF  532
            L+AG+D+I ++W  N S PA TD +Y+ VKV+LCYAPVSQ DR WRKTED L KDK+CQF
Sbjct  1    LRAGEDQIMVSWGLNQSFPAGTDEAYRKVKVRLCYAPVSQADRGWRKTEDDLSKDKTCQF  60

Query  531  TIATKPYNPKPNT-LKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVE  355
             +A + Y     T  +  + R++PTAT+FVR YA + +     YGQ TD  K  NLF+V 
Sbjct  61   DVAVRSYTTTTLTSFECKLSRELPTATYFVRAYALDYNGRVAAYGQTTDDHKATNLFEVV  120

Query  354  AITGRHATLDI  322
             I+GR   LDI
Sbjct  121  GISGRSLWLDI  131



>ref|XP_003575281.1| PREDICTED: high-affinity nitrate transporter-activating protein 
2.1-like [Brachypodium distachyon]
Length=200

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 98/151 (65%), Gaps = 5/151 (3%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
             S L  +LDV+   K GQVL  G+D  T+TWS N++ PA  D++YKSVKV LCYAPVSQ 
Sbjct  29   LSKLPVALDVTASPKPGQVLHGGEDVFTVTWSLNATQPAGADAAYKSVKVSLCYAPVSQK  88

Query  588  DRAWRKTEDHLKKDKSCQFTIATKPYNP-KPNTLKWTIERDVPTATFFVRVYAYNADDHE  412
            +R WRKT D LKKDK+CQF +A +PY       +++ +  D+PTAT++VR YA +A   +
Sbjct  89   EREWRKTNDDLKKDKTCQFKVAQQPYAAGSQGKVEYRVALDIPTATYYVRAYALDASGTQ  148

Query  411  VGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            V YGQ     K  + F+V +ITG   ++ + 
Sbjct  149  VAYGQT----KLADAFEVVSITGVTTSIKVA  175



>gb|AAV35211.1| NAR2.2 [Triticum aestivum]
Length=199

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
             S L  +LDV      GQVL AG+D IT+TW+ N+S PA  D++YK+VKV LCYAP SQ 
Sbjct  29   LSKLPVTLDVIASPSPGQVLHAGEDVITVTWALNASRPAGDDAAYKNVKVSLCYAPASQK  88

Query  588  DRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEV  409
            +R WRKT D LKKDK+CQF +A +PY      +++ +  D+PTAT++VR YA +A   +V
Sbjct  89   EREWRKTHDDLKKDKTCQFKVAQQPYAGAGGRVEYRVALDIPTATYYVRAYALDASGTQV  148

Query  408  GYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             YGQ   A      F V +ITG   ++ + 
Sbjct  149  AYGQTAPAAA----FNVVSITGVTTSIKVA  174



>ref|NP_001105924.1| high affinity nitrate transporter precursor [Zea mays]
 gb|AAY40797.1| high affinity nitrate transporter [Zea mays]
Length=195

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 101/176 (57%), Gaps = 7/176 (4%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA+ G  L    +++    A     V  S+L R+L V    K GQVL AG+D IT+TW  
Sbjct  1    MARPGAALPLLLVVVGACCARLAAAVHLSALGRTLIVEASPKAGQVLHAGEDTITVTWHL  60

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            N+S+   +   YK+++V LCYAP SQ DR WRK  D L KDK+CQF IA   Y     TL
Sbjct  61   NASA---SSVGYKALEVTLCYAPASQEDRGWRKANDDLSKDKACQFRIARHAYAGGQGTL  117

Query  489  KWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ++ + RDVPTA++ VR YA +A    VGYGQ   A      F V  ++G HA+L +
Sbjct  118  RYRVARDVPTASYHVRAYALDASGAPVGYGQTAPA----YYFHVAGVSGVHASLRV  169



>tpg|DAA37306.1| TPA: high affinity nitrate transporter [Zea mays]
Length=197

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 101/176 (57%), Gaps = 7/176 (4%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA+ G  L    +++    A     V  S+L R+L V    K GQVL AG+D IT+TW  
Sbjct  3    MARPGAALPLLLVVVGACCARLAAAVHLSALGRTLIVEASPKAGQVLHAGEDTITVTWHL  62

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            N+S+   +   YK+++V LCYAP SQ DR WRK  D L KDK+CQF IA   Y     TL
Sbjct  63   NASA---SSVGYKALEVTLCYAPASQEDRGWRKANDDLSKDKACQFRIARHAYAGGQGTL  119

Query  489  KWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ++ + RDVPTA++ VR YA +A    VGYGQ   A      F V  ++G HA+L +
Sbjct  120  RYRVARDVPTASYHVRAYALDASGAPVGYGQTAPA----YYFHVAGVSGVHASLRV  171



>gb|ACG30087.1| component of high affinity nitrate transporter [Zea mays]
Length=197

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 101/176 (57%), Gaps = 7/176 (4%)
 Frame = -2

Query  849  MAKIGGFLVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSY  670
            MA+ G  L    +++    A     V  S+L R+L V    K GQVL AG+D IT+TW  
Sbjct  3    MARSGAALPLLLVVVGACCARLAAAVHLSALGRTLIVEASPKAGQVLHAGEDTITVTWHL  62

Query  669  NSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTL  490
            N+S+   +   YK+++V LCYAP SQ DR WRK  D L KDK+CQF IA   Y     TL
Sbjct  63   NASA---SSVGYKALEVTLCYAPASQEDRGWRKANDDLSKDKACQFRIARHAYAGGQGTL  119

Query  489  KWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ++ + RDVPTA++ VR YA +A    VGYGQ   A      F V  ++G HA+L +
Sbjct  120  RYRVARDVPTASYHVRAYALDASGAPVGYGQTAPA----YYFHVAGVSGVHASLRV  171



>gb|EMT31108.1| hypothetical protein F775_20186 [Aegilops tauschii]
Length=201

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
             S L  +LDV+     GQVL AG+D IT+TW+ N+S PA  D+ YK+VKV LCYAPVSQ 
Sbjct  32   LSKLPVTLDVTASPSPGQVLHAGEDVITVTWALNASQPAGKDAEYKNVKVSLCYAPVSQK  91

Query  588  DRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEV  409
            +R WRKT D LKKDK+CQF +  + Y P    +++ +  D+PTAT++VR YA +A   +V
Sbjct  92   EREWRKTHDDLKKDKTCQFKVTQQAY-PGTGKVEYRVALDIPTATYYVRAYALDASGTQV  150

Query  408  GYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             YGQ   A    + F V +ITG   ++ + 
Sbjct  151  AYGQTAPA----SAFNVVSITGVTTSIKVA  176



>ref|XP_002454118.1| hypothetical protein SORBIDRAFT_04g024870 [Sorghum bicolor]
 gb|EES07094.1| hypothetical protein SORBIDRAFT_04g024870 [Sorghum bicolor]
Length=211

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 94/155 (61%), Gaps = 7/155 (5%)
 Frame = -2

Query  774  VLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVS  595
            V  S+L  +L V+   K GQVL AG D +T+TWS  S+ PA  D++YK VKVKLCYAP S
Sbjct  36   VHLSTLPEALAVTASAKPGQVLHAGVDSVTVTWSLKSTEPAGADAAYKDVKVKLCYAPAS  95

Query  594  QVDRAWRKTEDHLKKDKSCQFTIATKPY---NPKPNTLKWTIERDVPTATFFVRVYAYNA  424
            Q DR WRK+ED L KDK+CQF +  + Y        +  + + RDVP+ ++ +R YA +A
Sbjct  96   QKDRGWRKSEDDLSKDKACQFKVTQQAYAAAAGGGGSFTYVVARDVPSGSYHLRAYATDA  155

Query  423  DDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
               EV YGQ + A      F V  ITG HA+L + 
Sbjct  156  SGTEVAYGQTSPAAA----FDVAGITGIHASLKVA  186



>ref|XP_002448046.1| hypothetical protein SORBIDRAFT_06g020180 [Sorghum bicolor]
 gb|EES12374.1| hypothetical protein SORBIDRAFT_06g020180 [Sorghum bicolor]
Length=216

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 95/159 (60%), Gaps = 14/159 (9%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
             S+L R+L V    + GQVL AG+D IT+TW  N+S+PA  D+ YK+VKV LCYAP SQ 
Sbjct  36   LSALGRTLVVEASPEAGQVLHAGEDTITVTWRLNASAPAGADAGYKAVKVTLCYAPASQE  95

Query  588  DRAWRKTEDHLKKDKSCQFTI----------ATKPYNPKPNTLKWTIERDVPTATFFVRV  439
            DR WRK  D L KDK+CQF I          A  P      TL++ + RDVPTA++ VR 
Sbjct  96   DRGWRKANDDLSKDKACQFEIAQPQPYAYAAAAGPGTGAGTTLRYRVARDVPTASYHVRA  155

Query  438  YAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            YA +A    VGYGQ   A      F+V  +TG HA+L +
Sbjct  156  YALDASGAPVGYGQTAPA----YYFRVAGVTGIHASLRV  190



>ref|XP_010667500.1| PREDICTED: high-affinity nitrate transporter 3.2 [Beta vulgaris 
subsp. vulgaris]
Length=198

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 106/170 (62%), Gaps = 7/170 (4%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAK  649
            L+ ++ +LC L AT Y + +F+ L+ +L VS        L+AG D+IT++W  N +    
Sbjct  6    LIIFAAVLCSLVATCYSKGVFADLRNTLTVSASPSGRVDLRAGIDQITVSWRLNRNISNT  65

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERD  469
              ++Y  V VKLCY   SQ DR WR+TE+ L +DK+CQF++  K YN   +++ +T++++
Sbjct  66   DSATYSKVDVKLCYHLESQKDRPWRRTEEDLSRDKTCQFSMVKKDYNSSTDSVTYTVKKN  125

Query  468  VPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNL-FQVEAITGRHATLDI  322
            +PTA +FVRVY  NAD+ E+ YGQ      T  L   ++ I+GR  ++D+
Sbjct  126  IPTAHYFVRVYVRNADNREIAYGQ------TNGLDLNIKGISGRSTSIDV  169



>gb|EMS58629.1| hypothetical protein TRIUR3_20504 [Triticum urartu]
Length=251

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
             S L  SLDV+     GQVL AG+D IT+TW+ N+S PA  D+ YK+VKV LCYAPVSQ 
Sbjct  82   LSKLPVSLDVTASPSPGQVLHAGEDVITVTWALNASQPAGKDADYKNVKVSLCYAPVSQK  141

Query  588  DRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEV  409
            +R WRKT D LKKDK+CQF +  + Y P    +++ +  D+PTAT++VR YA +A   +V
Sbjct  142  EREWRKTHDDLKKDKTCQFKVTQQAY-PGTGKVEYRVALDIPTATYYVRAYALDASGTQV  200

Query  408  GYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             YGQ   A    + F V +ITG   ++ + 
Sbjct  201  AYGQTAPA----SAFNVVSITGVTTSIKVA  226



>ref|XP_006828375.1| hypothetical protein AMTR_s00188p00036850 [Amborella trichopoda]
 gb|ERM95791.1| hypothetical protein AMTR_s00188p00036850 [Amborella trichopoda]
Length=128

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 85/115 (74%), Gaps = 2/115 (2%)
 Frame = -2

Query  690  ITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY  511
            ++ +WS N S P  TD  YK +K+KLC AP+SQ DRA RKT D LKKDK+CQF IA +PY
Sbjct  5    VSPSWSSNPSFPHGTDLQYKKIKIKLCSAPLSQKDRAGRKTVDDLKKDKTCQFKIAAQPY  64

Query  510  NPKPN--TLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEA  352
            NP  +  T+ W IERD+P+AT+F+R YA ++ D+E+ YGQ T+  KT NLF+V+A
Sbjct  65   NPNNSRTTVSWLIERDIPSATYFIRAYALDSQDNELAYGQATNKNKTTNLFEVQA  119



>gb|AAP31852.1| NAR2.3 [Hordeum vulgare subsp. vulgare]
Length=198

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 94/150 (63%), Gaps = 5/150 (3%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
             S L  +LDV+     GQVL AG+D IT+TW+ N+S PA  D+ YK+VKV LCYAPVSQ 
Sbjct  29   LSKLPVTLDVTASPTPGQVLHAGEDVITVTWALNASQPAGKDADYKNVKVSLCYAPVSQK  88

Query  588  DRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEV  409
            +R WRKT D LKKDK+CQF I  + Y P    +++ +  D+PTAT++VR YA +A   +V
Sbjct  89   EREWRKTHDDLKKDKTCQFKITQQAY-PGAGKVEYRVALDIPTATYYVRAYALDASGTQV  147

Query  408  GYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             YGQ          F V +ITG   ++ + 
Sbjct  148  AYGQTAPTAA----FNVVSITGVTTSIKVA  173



>gb|AAV35210.1| NAR2.1 [Triticum aestivum]
Length=198

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 5/150 (3%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
             S L  +LDV+     GQVL AG+D IT+TW+ N+S PA  D  YK+VKV LCYAPVSQ 
Sbjct  29   LSKLPVTLDVTASPSPGQVLHAGEDVITVTWALNASQPAGKDVDYKNVKVSLCYAPVSQK  88

Query  588  DRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEV  409
            +R WRKT D LKKDK+CQF +  + Y P    +++ +  D+PTAT++VR YA +A   +V
Sbjct  89   EREWRKTHDDLKKDKTCQFKVTQQAY-PGTGKVEYRVALDIPTATYYVRAYALDASGTQV  147

Query  408  GYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             YGQ   +    + F V +ITG   ++ + 
Sbjct  148  AYGQTAPS----SAFNVVSITGVTTSIKVA  173



>gb|AAP31851.1| NAR2.2 [Hordeum vulgare subsp. vulgare]
Length=201

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 94/152 (62%), Gaps = 6/152 (4%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
             S L  +LDV+     GQVL AG+D IT+TW+ N++ PA  D++YKSVKV LCYAP SQ 
Sbjct  29   LSKLTVTLDVTASPTPGQVLHAGEDVITVTWALNATRPAGDDAAYKSVKVSLCYAPASQK  88

Query  588  DRAWRKTEDHLKKDKSCQFTIATKPY--NPKPNTLKWTIERDVPTATFFVRVYAYNADDH  415
            +R WRKT D LKKDK+CQF +  +PY        +++ +  D+PTA ++VR YA +A   
Sbjct  89   EREWRKTHDDLKKDKTCQFKVTQQPYAAGAAGGRVEYRVALDIPTAAYYVRAYALDASGT  148

Query  414  EVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            +V YGQ   A      F V +ITG   ++ + 
Sbjct  149  QVAYGQTAPA----TAFDVVSITGVTTSIKVA  176



>ref|XP_006438234.1| hypothetical protein CICLE_v10033654mg, partial [Citrus clementina]
 gb|ESR51474.1| hypothetical protein CICLE_v10033654mg, partial [Citrus clementina]
Length=154

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 89/130 (68%), Gaps = 9/130 (7%)
 Frame = -2

Query  711  LKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQF  532
            LKAGDD+IT++WS N S  A TD  YK VKV LCYAP SQVD AW KTED + KD++CQF
Sbjct  1    LKAGDDKITVSWSLNRSFRA-TDDLYKKVKVTLCYAPASQVDGAWSKTEDDMTKDRTCQF  59

Query  531  TIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEA  352
            TI         ++L   IE D P A++FV VYA ++   EVG+GQ   A+K+ NLF++ A
Sbjct  60   TI--------NHSLGSMIENDAPEASYFVTVYASDSAGKEVGFGQTFGARKSSNLFEIHA  111

Query  351  ITGRHATLDI  322
            I+ RH +L+I
Sbjct  112  ISERHLSLEI  121



>ref|XP_006413394.1| hypothetical protein EUTSA_v10027123mg, partial [Eutrema salsugineum]
 gb|ESQ54847.1| hypothetical protein EUTSA_v10027123mg, partial [Eutrema salsugineum]
Length=145

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 11/129 (9%)
 Frame = -2

Query  711  LKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQF  532
            L++G D I +TW   SS     D++ K+V V+LCYAP+SQVDR WR++ + L KDK+C +
Sbjct  1    LESGKDIIRVTWKLKSSVKIDVDAAIKTVDVRLCYAPISQVDRPWRQSHNELFKDKTCPY  60

Query  531  TIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEA  352
             I +KPY+    +L W IERD+PT T+FVRVY  +A+ HE           T NLF VEA
Sbjct  61   KIVSKPYDKISQSLNWIIERDIPTGTYFVRVYGIDANGHE-----------TTNLFSVEA  109

Query  351  ITGRHATLD  325
            I GRH +LD
Sbjct  110  IDGRHISLD  118



>gb|AAP31850.1| NAR2.1 [Hordeum vulgare subsp. vulgare]
Length=197

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 98/161 (61%), Gaps = 8/161 (5%)
 Frame = -2

Query  804  CCLAATAYGEVLFSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSV  625
            CC +A A      S L  +LDV+     GQVL AG+D IT+TW+ N++   K D+ YK+V
Sbjct  19   CCTSAGAVA--YLSKLPVTLDVTASPSPGQVLHAGEDVITVTWALNTTQAGK-DADYKNV  75

Query  624  KVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFV  445
            KV LCYAPVSQ +R WRKT D LKKDK+CQF +  + Y P    +++ +  D+PTAT++V
Sbjct  76   KVSLCYAPVSQKEREWRKTHDDLKKDKTCQFKVTQQAY-PGAGKVEYRVALDIPTATYYV  134

Query  444  RVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            R YA +A   +V YGQ          F V +ITG   ++ +
Sbjct  135  RAYALDASGTQVAYGQTAPTAA----FNVVSITGVTTSIKV  171



>ref|XP_006828371.1| hypothetical protein AMTR_s00188p00033950 [Amborella trichopoda]
 gb|ERM95787.1| hypothetical protein AMTR_s00188p00033950 [Amborella trichopoda]
Length=128

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 82/115 (71%), Gaps = 2/115 (2%)
 Frame = -2

Query  690  ITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPY  511
            ++ +WS N S P  TD  YK  K+KLC AP+SQ DRA RK  D LKKDK+CQF IA +PY
Sbjct  5    VSPSWSSNQSYPHGTDLQYKKTKIKLCSAPLSQKDRAGRKIVDALKKDKTCQFKIAAQPY  64

Query  510  NPKPN--TLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEA  352
            NP  +  T+ W IERD+P+AT+FVR YA ++ D+E+ YGQ T+  KT  LF+++A
Sbjct  65   NPNNSTTTVSWLIERDIPSATYFVRAYALDSQDNELAYGQTTNENKTTYLFEIQA  119



>ref|XP_001771033.1| predicted protein [Physcomitrella patens]
 dbj|BAE06052.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 dbj|BAE45930.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 gb|EDQ64188.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 100/168 (60%), Gaps = 12/168 (7%)
 Frame = -2

Query  807  LCCLAATAYGEVLFSSLKRSLDVSVKHKQGQ---VLKAGDDEITITWSYNSSS--PAKTD  643
            +  LA+ A G+VLFS L +SL V+     G+   V+K G+D I + W+ N+S+  PA   
Sbjct  17   ILGLASHAEGQVLFSKLPKSLVVTATLPDGKPIGVVKTGEDSILVKWAVNTSAQIPAS--  74

Query  642  SSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVP  463
                 VK KLC+A  SQ+ R WR T+D LKKDK+C + IAT+ Y      + + + + +P
Sbjct  75   ----KVKTKLCFAVESQLLRGWRATKDDLKKDKTCLYNIATQDYTTAGGEVTYMLAKSIP  130

Query  462  TATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             A +FVR YA NAD  +V  GQ++   K  N F V  I+GRHA++DI 
Sbjct  131  GAKYFVRAYAVNADGVQVATGQSSP-NKVANTFTVIPISGRHASIDIA  177



>gb|EAY94557.1| hypothetical protein OsI_16333 [Oryza sativa Indica Group]
Length=210

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 89/147 (61%), Gaps = 8/147 (5%)
 Frame = -2

Query  753  RSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKS---VKVKLCYAPVSQVDR  583
            ++L V    + GQVL AG+D IT+TWS N+++ A    +      VKV LCYAP SQV R
Sbjct  43   KALVVEASPRAGQVLHAGEDAITVTWSLNATAAAAAAGADAGYKAVKVTLCYAPASQVGR  102

Query  582  AWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGY  403
             WRK  D L KDK+CQF IA +PY+      ++T+ RDVPTA+++VR YA +A    V Y
Sbjct  103  GWRKAHDDLSKDKACQFKIAQQPYD-GAGKFEYTVARDVPTASYYVRAYALDASGARVAY  161

Query  402  GQNTDAKKTQNLFQVEAITGRHATLDI  322
            G+   +      F V  ITG  A++++
Sbjct  162  GETAPSAS----FAVAGITGVTASIEV  184



>ref|NP_001053099.1| Os04g0480200 [Oryza sativa Japonica Group]
 sp|Q7XK12.1|NAR22_ORYSJ RecName: Full=Probable high-affinity nitrate transporter-activating 
protein 2.2; Short=OsNAR2.2; Flags: Precursor [Oryza 
sativa Japonica Group]
 emb|CAE05891.1| OSJNBa0044K18.32 [Oryza sativa Japonica Group]
 dbj|BAF15013.1| Os04g0480200 [Oryza sativa Japonica Group]
 emb|CAH66874.1| OSIGBa0158F13.5 [Oryza sativa Indica Group]
 dbj|BAG98803.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 89/147 (61%), Gaps = 8/147 (5%)
 Frame = -2

Query  753  RSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKS---VKVKLCYAPVSQVDR  583
            ++L V    + GQVL AG+D IT+TWS N+++ A    +      VKV LCYAP SQV R
Sbjct  43   KALVVEASPRAGQVLHAGEDAITVTWSLNATAAAAAAGADAGYKAVKVTLCYAPASQVGR  102

Query  582  AWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGY  403
             WRK  D L KDK+CQF IA +PY+      ++T+ RDVPTA+++VR YA +A    V Y
Sbjct  103  GWRKAHDDLSKDKACQFKIAQQPYD-GAGKFEYTVARDVPTASYYVRAYALDASGARVAY  161

Query  402  GQNTDAKKTQNLFQVEAITGRHATLDI  322
            G+   +      F V  ITG  A++++
Sbjct  162  GETAPSAS----FAVAGITGVTASIEV  184



>ref|XP_001768154.1| predicted protein [Physcomitrella patens]
 dbj|BAE06054.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 dbj|BAE45932.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 gb|EDQ67027.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 98/159 (62%), Gaps = 9/159 (6%)
 Frame = -2

Query  786  AYGEVLFSSL--KRSLDVSVKHKQGQVLK---AGDDEITITWSYNSSSPAKTDSSYKSVK  622
            A G V F+SL  KR+L V+V       +K    G D I + WS N+S+PA  D+  K+V+
Sbjct  24   AEGFVSFNSLSSKRTLVVTVSMANNSDIKEVHTGQDSILVNWSVNASAPAIVDA--KTVE  81

Query  621  VKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVR  442
             +LC+A  SQ  R WRKT+D+LKKDK+C + I  +PY P   ++ + + + +P A +FVR
Sbjct  82   TRLCFAKESQTLRGWRKTDDNLKKDKTCLYKIQRQPYAP-AGSVTYALPKSIPGAKYFVR  140

Query  441  VYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLD  325
             Y +N+ D ++ YGQ++   K  N F V  I+GRH ++D
Sbjct  141  AYVFNSSDLQIAYGQSS-PNKINNTFTVIPISGRHGSID  178



>ref|XP_001755294.1| predicted protein [Physcomitrella patens]
 dbj|BAE06053.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 dbj|BAE45931.1| putative component of high affinity nitrate transporter [Physcomitrella 
patens]
 gb|EDQ79774.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 94/163 (58%), Gaps = 8/163 (5%)
 Frame = -2

Query  798  LAATAYGEVLFSSLKRSLDVSVKHKQGQVL---KAGDDEITITWSYNSSSPAKTDSSYKS  628
            +A+   G+VLFS+L +SL V+     G+ +   K G+D I + W+ NS+  A  D+    
Sbjct  20   VASCVEGQVLFSTLPKSLVVTAALPDGKPIGEVKTGEDSILVKWTVNST--ASVDAV--K  75

Query  627  VKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFF  448
            +K KLC+A  SQV R WR T D LKKDK+C + IAT+ ++       + + + +P A +F
Sbjct  76   LKTKLCFASESQVLRGWRATNDDLKKDKTCLYDIATQDFSRTGGETTYKLSKSIPGAKYF  135

Query  447  VRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            VR YA NA+  +V  GQ T   K  N F V  I+GR  ++DI 
Sbjct  136  VRAYAINAEGKQVATGQ-TSPNKVANTFTVIPISGRSTSIDIA  177



>ref|XP_006849233.1| hypothetical protein AMTR_s00027p00233840 [Amborella trichopoda]
 gb|ERN10814.1| hypothetical protein AMTR_s00027p00233840 [Amborella trichopoda]
Length=255

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = -2

Query  582  AWRKTEDHLKKDKSCQFTIATKPYNPKPNT--LKWTIERDVPTATFFVRVYAYNADDHEV  409
            AWRKT D LKKDK+CQF IA +PYNP  +T  + W IERD+ TAT+F+R YA ++ ++++
Sbjct  45   AWRKTVDDLKKDKTCQFKIAAQPYNPNDSTTTVSWLIERDIRTATYFIRAYALDSQENDM  104

Query  408  GYGQNTDAKKTQNLFQVEAITGRHATLDI  322
             YGQ T   KT NLF+++ ITG HA+LDI
Sbjct  105  AYGQTTGKNKTTNLFEIQGITGTHASLDI  133



>ref|XP_010438977.1| PREDICTED: high-affinity nitrate transporter 3.2-like, partial 
[Camelina sativa]
Length=147

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 82/132 (62%), Gaps = 16/132 (12%)
 Frame = -2

Query  828  LVTYSLLLCCLAATAYG---EVLFSSLKRSLDVSVKHKQ-GQVLKAGDDEITITWSYNSS  661
            L+  SLL+  L  ++ G   + LF+ +++SL+V+ K  Q G VL+AG D +TI W   SS
Sbjct  27   LLFVSLLIFSLIPSSRGGNKDRLFTEVQKSLEVTAKPVQDGVVLEAGKDMVTIKWKLKSS  86

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWT  481
            +    D ++K ++VKLCYAP+SQVDR WRKT   L KDK+C            P +L WT
Sbjct  87   AKVDADDTFKKIQVKLCYAPISQVDRPWRKTHSELFKDKTC------------PQSLDWT  134

Query  480  IERDVPTATFFV  445
            ++ D+PT T+FV
Sbjct  135  VDLDIPTGTYFV  146



>gb|EMT33608.1| hypothetical protein F775_27090 [Aegilops tauschii]
Length=141

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 70/109 (64%), Gaps = 5/109 (5%)
 Frame = -2

Query  645  DSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDV  466
            D+ YK+VKV LCYAPVSQ +R WRKT D LKKDK+CQF +  + Y P    +++ +  D+
Sbjct  13   DAKYKNVKVSLCYAPVSQKEREWRKTHDDLKKDKTCQFKVTQQAY-PGTGKVEYRVALDI  71

Query  465  PTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            PTAT++VR YA +A   +V YGQ   A    + F V +ITG   ++ + 
Sbjct  72   PTATYYVRAYALDASGTQVAYGQTAPA----SAFNVVSITGVTTSIKVA  116



>gb|EMS60424.1| hypothetical protein TRIUR3_22380 [Triticum urartu]
Length=151

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -2

Query  768  FSSLKRSLDVSVKHKQGQVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQV  589
             S L  +LDV+     GQVL AG+D IT+TW+ N++ PA  D++YKSVKV LCYAP SQ 
Sbjct  29   LSKLPVTLDVTASPSAGQVLHAGEDVITVTWALNATGPAGDDAAYKSVKVSLCYAPASQK  88

Query  588  DRAWRKTEDHLKKDKSCQF  532
            +R WRKT D LKKDK+CQF
Sbjct  89   EREWRKTHDDLKKDKTCQF  107



>ref|XP_004301017.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Fragaria 
vesca subsp. vesca]
Length=189

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = -2

Query  648  TDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPN--TLKWTIE  475
            TD++YK+V +KLCYAPVSQV +  RKTED L KDK+CQ    T PYN   N    + T++
Sbjct  3    TDTAYKTVNLKLCYAPVSQVGKPERKTEDDLDKDKTCQIEFYTGPYNSSSNWQFYESTLD  62

Query  474  RDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            R VP  ++FVR Y  ++    V YGQ+T  +K  N+F+V   +G H  L++ 
Sbjct  63   RHVPIGSYFVRAYVTDSAGVLVAYGQSTGQEKDYNIFEV---SGSHKRLEMV  111



>ref|XP_010497940.1| PREDICTED: high-affinity nitrate transporter 3.1-like, partial 
[Camelina sativa]
Length=72

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -2

Query  654  AKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIE  475
            +K ++ +K++KVKLCYAP SQVDR WRKT D L KDK+C   I  +PY+    ++ W +E
Sbjct  1    SKKEAEFKTIKVKLCYAPPSQVDRPWRKTHDELFKDKTCPHKIVARPYDKTTQSIDWILE  60

Query  474  RDVPTATFFVR  442
            RD+PT T+FVR
Sbjct  61   RDIPTGTYFVR  71



>gb|KDO82198.1| hypothetical protein CISIN_1g0417871mg, partial [Citrus sinensis]
Length=61

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -2

Query  711  LKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQF  532
            LKAGDD+IT++WS N S  A TD  YK VKV LCYAP SQVD AW KTED + KD++CQF
Sbjct  1    LKAGDDKITVSWSLNRSFRA-TDDLYKKVKVTLCYAPASQVDGAWSKTEDDMTKDRTCQF  59

Query  531  TI  526
            TI
Sbjct  60   TI  61



>gb|AGG68805.1| putative nitrate transporter, partial [Populus simonii x (Populus 
nigra x Salix matsudana)]
 gb|AGG68806.1| putative nitrate transporter, partial [Populus alba x Populus 
glandulosa]
Length=76

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  465  PTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
            PTAT+F+R YAYNAD+ EV YGQ TDA KT +LFQVE+ITGRH  +DIC
Sbjct  1    PTATYFIRAYAYNADESEVAYGQTTDAHKTTSLFQVESITGRHMAMDIC  49



>emb|CDY05799.1| BnaA10g06210D [Brassica napus]
Length=113

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = -2

Query  543  SCQFTIATKPYNPK---PNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQ  373
            SC   I++  Y+P      +  +T+ERD+PT T+FVR YA +  DHEV +GQ+T+  KT 
Sbjct  7    SCPHKISSWSYDPAMKAGQSFDYTLERDIPTGTYFVRAYAVDTKDHEVAFGQSTNEDKTT  66

Query  372  NLFQVEAITGRHATLDI  322
            NLF V+AI+GRH +LDI
Sbjct  67   NLFSVQAISGRHKSLDI  83



>gb|AFG50499.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50500.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50501.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50504.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50505.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50507.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50509.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50512.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
Length=71

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  510  NPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHAT  331
            N + NT+ WT+ERDVPTA +FVR Y  +A   +V YGQ+T+  KT NLF++++I+GRH +
Sbjct  1    NIQNNTVAWTVERDVPTAIYFVRAYILDASGIQVAYGQSTNKAKTANLFKIQSISGRHVS  60

Query  330  LDIC  319
            LDI 
Sbjct  61   LDIA  64



>gb|AFG50498.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50502.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50503.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50506.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50508.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50510.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
 gb|AFG50511.1| hypothetical protein CL2980Contig1_03, partial [Pinus taeda]
Length=71

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  510  NPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHAT  331
            N + NT+ WT+ERDVPTA +FVR Y  +A   +V YGQ+T+  KT NLF++++I+GRH +
Sbjct  1    NIQNNTVAWTVERDVPTAIYFVRTYILDASGIQVAYGQSTNKAKTANLFKIQSISGRHVS  60

Query  330  LDIC  319
            LDI 
Sbjct  61   LDIA  64



>gb|AEW08990.1| hypothetical protein CL2980Contig1_03, partial [Pinus radiata]
Length=71

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  510  NPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHAT  331
            N + NT+ WT+ERDVPTA +FVR Y  +A   +V YGQ+T+  KT NLF++++I+GRH +
Sbjct  1    NIQNNTVAWTVERDVPTAIYFVRAYILDASGIQVVYGQSTNKAKTANLFKIQSISGRHVS  60

Query  330  LDIC  319
            LDI 
Sbjct  61   LDIA  64



>gb|EAZ31107.1| hypothetical protein OsJ_15203 [Oryza sativa Japonica Group]
Length=212

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 76/152 (50%), Gaps = 14/152 (9%)
 Frame = -2

Query  753  RSLDVSVKHKQGQVLKAGDD----EITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVD  586
            ++L V    + GQVL AG+     ++                 YK+VKV LCYAP SQV 
Sbjct  43   KALVVEASPRAGQVLHAGEGRHHRDMVAESEGGGGRRPGRIPGYKAVKVTLCYAPASQVG  102

Query  585  RAWRKTEDHLKKDKSCQFTIATK-PYNP--KPNTLKWTIERDVPTATFFVRVYAYNADDH  415
            R WRK     ++ +  Q  ++++ P  P       ++T+ RDVPTA+++VR YA +A   
Sbjct  103  RGWRKAP---RRPEQGQGRVSSRSPQQPYDGAGKFEYTVARDVPTASYYVRAYALDASGA  159

Query  414  EVGYGQNTDAKKTQNLFQVEAITGRHATLDIC  319
             V YG+   +      F V  ITG  A++++ 
Sbjct  160  RVAYGETAPSAS----FAVAGITGVTASIEVA  187



>gb|EMT09919.1| hypothetical protein F775_19205 [Aegilops tauschii]
Length=168

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = -2

Query  576  RKTEDHLKKDKSCQFTIATKPYNPKPNTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQ  397
            RKT ++L KDK+CQ+ +  +PY      +++ +  D+PTAT++VR YA +A   +V YGQ
Sbjct  68   RKTHENLDKDKTCQYKVTEQPYTGAGGKVEYRVALDIPTATYYVRAYALDASGTQVAYGQ  127

Query  396  NTDAKKTQNLFQVEAI  349
             T    T N+  +  I
Sbjct  128  -TLRTATFNIVSIRGI  142



>gb|KDO82197.1| hypothetical protein CISIN_1g0417872mg, partial [Citrus sinensis]
Length=93

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  498  NTLKWTIERDVPTATFFVRVYAYNADDHEVGYGQNTDAKKTQNLFQVEAITGRHATLDI  322
            ++L   IE D P A++FV VYA ++   EVG GQ   A+K+ NLF++ AI+ RH +L+I
Sbjct  2    HSLGSMIENDAPEASYFVTVYASDSAGKEVGVGQTFGARKSSNLFEIHAISERHLSLEI  60



>ref|XP_007514579.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14819.1| predicted protein [Bathycoccus prasinos]
Length=213

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 18/157 (11%)
 Frame = -2

Query  834  GFLVTYSLLLCCLAATAYGEVLFSSLKRSL-DVSVKHKQG-QVLKAGDDEITITWSYNSS  661
             FL   +L+     A  Y E+  + +  S+ DV++           G   +T+ WS  + 
Sbjct  11   AFLALIALMQFVSGAALYSEMTGAKIAVSVSDVALTDGCAPTTYTGGASSLTVKWSGLTV  70

Query  660  SPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSCQFTIATKPYNPKP-NTLKW  484
            +PAK       + +KLCY     VDRAWRK +D++K +K C+ T  T  +  +P  +   
Sbjct  71   APAK-------IAIKLCYTKDQTVDRAWRKFKDNIKDNKQCKQTADTAAFLVEPFESTDL  123

Query  483  TIERDV-------PTATFFVRVYAYNADDHEVGYGQN  394
            + E++V       PT T+ V+V A +     + YG +
Sbjct  124  SGEKEVVIPMNTAPT-TYTVQVLAMDDTGAFIQYGDS  159



>ref|XP_003058320.1| nitrate high-affinity transporter accessory protein [Micromonas 
pusilla CCMP1545]
 gb|EEH58271.1| nitrate high-affinity transporter accessory protein [Micromonas 
pusilla CCMP1545]
Length=213

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 15/141 (11%)
 Frame = -2

Query  717  QVLKAGDDEITITWSYNSSSPAKTDSSYKSVKVKLCYAPVSQVDRAWRKTEDHLKKDKSC  538
            Q+  A  D IT+ W+        T +S  S+ +K+CY     V+R WRK  D + K+K C
Sbjct  52   QLAGAHSDTITVAWT------GFTSNSEASLTIKMCYTDDMIVNRPWRKYVDAVDKNKQC  105

Query  537  -QFTIATKPYNPKPNTLKW----TIERDVPTATFFVRVYAYNADDHEVGYGQ---NTDAK  382
             Q    TK  +    T       TI  + P +T++ +V   +A    V YG+   N+   
Sbjct  106  WQIPEMTKTLHSGIATADGSKTITIPTNTPASTYYFQVIGVDASGGYVSYGESSTNSCKL  165

Query  381  KTQNLFQVEA-ITGRHATLDI  322
             T++     A + G HATL +
Sbjct  166  TTKSYDNTPATLVGTHATLTV  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776