BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23877_g2_i1 len=1696 path=[10118:0-534 588:535-601 838:602-1695]

Length=1696
                                                                      Score     E

ref|XP_009782434.1|  PREDICTED: putative U-box domain-containing ...    444   8e-143   
emb|CDP01572.1|  unnamed protein product                                444   9e-143   
ref|XP_009606490.1|  PREDICTED: putative U-box domain-containing ...    430   3e-137   
ref|XP_011099977.1|  PREDICTED: putative U-box domain-containing ...    415   6e-132   
ref|XP_006353276.1|  PREDICTED: putative U-box domain-containing ...    412   1e-130   
emb|CBI14769.3|  unnamed protein product                                389   1e-123   
ref|XP_010647329.1|  PREDICTED: putative U-box domain-containing ...    389   4e-123   
ref|XP_007047770.1|  U-box domain-containing protein kinase famil...    386   1e-120   
ref|XP_008236249.1|  PREDICTED: putative U-box domain-containing ...    385   4e-120   
ref|XP_007208084.1|  hypothetical protein PRUPE_ppa001508mg             383   3e-119   
ref|XP_006572996.1|  PREDICTED: putative U-box domain-containing ...    375   3e-116   
gb|KEH27732.1|  U-box kinase family protein                             367   7e-116   
gb|KDO60542.1|  hypothetical protein CISIN_1g003594mg                   364   1e-115   
ref|XP_010113445.1|  Putative U-box domain-containing protein 50        372   3e-115   
ref|XP_006426255.1|  hypothetical protein CICLE_v10024909mg             368   2e-113   
ref|XP_006466325.1|  PREDICTED: putative U-box domain-containing ...    367   6e-113   
ref|XP_008368019.1|  PREDICTED: putative U-box domain-containing ...    366   9e-113   
ref|XP_003613040.1|  U-box domain-containing protein                    364   5e-112   
gb|KHN04923.1|  Putative U-box domain-containing protein 50             364   5e-112   
gb|KDO60541.1|  hypothetical protein CISIN_1g003594mg                   364   6e-112   
ref|XP_004288524.1|  PREDICTED: putative U-box domain-containing ...    363   1e-111   
ref|XP_009364813.1|  PREDICTED: putative U-box domain-containing ...    360   2e-110   
gb|KHN38882.1|  Putative U-box domain-containing protein 50             359   3e-110   
ref|XP_006587575.1|  PREDICTED: putative U-box domain-containing ...    359   3e-110   
gb|KDP29773.1|  hypothetical protein JCGZ_18708                         348   2e-105   
ref|XP_009364827.1|  PREDICTED: putative U-box domain-containing ...    345   6e-105   
ref|XP_007158363.1|  hypothetical protein PHAVU_002G146600g             345   1e-104   
ref|XP_007207568.1|  hypothetical protein PRUPE_ppa018581mg             339   1e-102   
ref|XP_009782435.1|  PREDICTED: putative U-box domain-containing ...    336   2e-102   
ref|XP_008367777.1|  PREDICTED: putative U-box domain-containing ...    337   1e-101   
ref|XP_004509772.1|  PREDICTED: putative U-box domain-containing ...    332   6e-100   
ref|XP_008237170.1|  PREDICTED: putative U-box domain-containing ...    323   7e-100   
ref|XP_009606491.1|  PREDICTED: putative U-box domain-containing ...    327   8e-99    
ref|XP_010027961.1|  PREDICTED: putative U-box domain-containing ...    329   8e-99    
ref|XP_008440530.1|  PREDICTED: putative U-box domain-containing ...    329   9e-99    
ref|XP_008440531.1|  PREDICTED: putative U-box domain-containing ...    325   2e-97    
ref|XP_004289537.1|  PREDICTED: putative U-box domain-containing ...    322   3e-96    
ref|XP_004143547.1|  PREDICTED: putative U-box domain-containing ...    317   3e-94    
ref|XP_006426256.1|  hypothetical protein CICLE_v10024909mg             315   5e-94    
ref|XP_010519185.1|  PREDICTED: putative U-box domain-containing ...    314   3e-93    
ref|XP_010254557.1|  PREDICTED: putative U-box domain-containing ...    312   2e-92    
ref|XP_010547592.1|  PREDICTED: putative U-box domain-containing ...    302   8e-89    
gb|KEH20117.1|  U-box kinase family protein                             297   3e-87    
ref|XP_010680359.1|  PREDICTED: putative U-box domain-containing ...    293   6e-85    
ref|XP_006587576.1|  PREDICTED: putative U-box domain-containing ...    288   1e-83    
ref|XP_006603389.1|  PREDICTED: putative U-box domain-containing ...    282   3e-81    
ref|XP_008347753.1|  PREDICTED: putative U-box domain-containing ...    270   3e-79    
ref|XP_009150641.1|  PREDICTED: putative U-box domain-containing ...    276   7e-79    
ref|XP_004509787.1|  PREDICTED: putative U-box domain-containing ...    271   2e-78    
ref|XP_010547594.1|  PREDICTED: putative U-box domain-containing ...    273   4e-78    
ref|XP_010463003.1|  PREDICTED: putative U-box domain-containing ...    272   1e-77    
emb|CDY67215.1|  BnaAnng23860D                                          271   2e-77    
ref|NP_201353.4|  U-box domain-containing protein kinase family p...    268   3e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004160941.1|  PREDICTED: putative U-box domain-containing ...    267   6e-76    
ref|XP_006394022.1|  hypothetical protein EUTSA_v10003671mg             267   8e-76    
ref|XP_010484349.1|  PREDICTED: putative U-box domain-containing ...    267   1e-75    
emb|CDX81289.1|  BnaC09g07000D                                          267   1e-75    
ref|XP_011021853.1|  PREDICTED: LOW QUALITY PROTEIN: putative U-b...    267   1e-75    
emb|CDY54713.1|  BnaA09g52450D                                          267   1e-75    
emb|CDY14575.1|  BnaC03g48840D                                          266   2e-75    
ref|XP_009112188.1|  PREDICTED: putative U-box domain-containing ...    263   3e-74    
ref|XP_010444515.1|  PREDICTED: putative U-box domain-containing ...    258   3e-72    
ref|XP_008802350.1|  PREDICTED: putative U-box domain-containing ...    258   4e-72    
ref|XP_006279476.1|  hypothetical protein CARUB_v10025893mg             255   4e-71    
ref|XP_008368020.1|  PREDICTED: putative U-box domain-containing ...    251   1e-70    
gb|KDO60543.1|  hypothetical protein CISIN_1g003594mg                   249   8e-70    
ref|XP_002533954.1|  ATP binding protein, putative                      247   6e-69    Ricinus communis
ref|XP_002866675.1|  kinase family protein                              241   1e-66    
sp|Q9FGD7.1|PUB50_ARATH  RecName: Full=Putative U-box domain-cont...    233   1e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010113446.1|  Putative U-box domain-containing protein 50        233   1e-63    
gb|EPS69941.1|  hypothetical protein M569_04821                         218   1e-59    
gb|KHN37751.1|  Putative U-box domain-containing protein 50             220   6e-59    
gb|KCW54616.1|  hypothetical protein EUGRSUZ_I00562                     216   5e-58    
ref|XP_010312654.1|  PREDICTED: putative U-box domain-containing ...    209   3e-56    
ref|XP_002310308.2|  kinase family protein                              188   4e-48    Populus trichocarpa [western balsam poplar]
ref|XP_008361114.1|  PREDICTED: putative U-box domain-containing ...    166   1e-42    
gb|KHG01315.1|  Putative U-box domain-containing 50 -like protein       143   8e-34    
gb|KFK28250.1|  hypothetical protein AALP_AA8G491900                    135   1e-30    
ref|XP_010914320.1|  PREDICTED: putative U-box domain-containing ...  88.6    3e-15    
ref|XP_008385687.1|  PREDICTED: putative U-box domain-containing ...  85.1    2e-14    
ref|XP_006476873.1|  PREDICTED: U-box domain-containing protein 3...  67.0    4e-09    
ref|XP_003634243.1|  PREDICTED: putative U-box domain-containing ...  66.6    6e-09    
ref|XP_010251075.1|  PREDICTED: U-box domain-containing protein 5...  66.2    7e-09    
gb|KHG08653.1|  Putative U-box domain-containing 50 -like protein     66.2    2e-08    
ref|XP_006467260.1|  PREDICTED: uncharacterized protein LOC102607885  65.9    2e-08    
ref|XP_009618903.1|  PREDICTED: U-box domain-containing protein 3...  66.6    4e-08    
ref|XP_008802697.1|  PREDICTED: U-box domain-containing protein 35    64.3    4e-08    
ref|XP_006449946.1|  hypothetical protein CICLE_v10016013mg           64.7    5e-08    
emb|CAN79356.1|  hypothetical protein VITISV_010065                   63.5    6e-08    Vitis vinifera
ref|XP_008440971.1|  PREDICTED: uncharacterized protein LOC103485222  63.9    6e-08    
ref|XP_008239323.1|  PREDICTED: U-box domain-containing protein 5...  63.5    7e-08    
ref|XP_006476872.1|  PREDICTED: U-box domain-containing protein 3...  63.2    1e-07    
gb|KDO69501.1|  hypothetical protein CISIN_1g025166mg                 62.8    1e-07    
ref|XP_006439910.1|  hypothetical protein CICLE_v10021791mg           62.8    1e-07    
gb|KDO78593.1|  hypothetical protein CISIN_1g021587mg                 63.2    2e-07    
ref|XP_007132069.1|  hypothetical protein PHAVU_011G064400g           64.3    2e-07    
ref|XP_011042691.1|  PREDICTED: U-box domain-containing protein 3...  63.5    3e-07    
ref|XP_007016431.1|  U-box domain-containing protein kinase famil...  63.2    4e-07    
ref|XP_006449945.1|  hypothetical protein CICLE_v10016013mg           62.0    4e-07    
ref|XP_007016430.1|  U-box domain-containing protein kinase famil...  62.8    6e-07    
ref|XP_007016429.1|  U-box domain-containing protein kinase famil...  62.8    6e-07    
ref|XP_009773923.1|  PREDICTED: U-box domain-containing protein 3...  62.8    6e-07    
gb|EYU27649.1|  hypothetical protein MIMGU_mgv1a020618mg              60.5    7e-07    
ref|XP_010942862.1|  PREDICTED: U-box domain-containing protein 33    60.1    7e-07    
ref|XP_008464309.1|  PREDICTED: U-box domain-containing protein 3...  60.5    9e-07    
ref|XP_011002346.1|  PREDICTED: U-box domain-containing protein 3...  60.5    1e-06    
ref|XP_002308753.1|  hypothetical protein POPTR_0006s00580g           60.1    1e-06    Populus trichocarpa [western balsam poplar]
gb|KCW49231.1|  hypothetical protein EUGRSUZ_K02804                   59.3    2e-06    
ref|XP_011005723.1|  PREDICTED: U-box domain-containing protein 3...  60.1    2e-06    
ref|XP_004138091.1|  PREDICTED: U-box domain-containing protein 5...  59.3    2e-06    
ref|XP_007026391.1|  Adenine nucleotide alpha hydrolases-like sup...  59.3    2e-06    
ref|XP_010918573.1|  PREDICTED: U-box domain-containing protein 3...  61.2    2e-06    
ref|XP_003632149.1|  PREDICTED: U-box domain-containing protein 3...  60.8    2e-06    
gb|KDO69500.1|  hypothetical protein CISIN_1g025166mg                 58.9    2e-06    
ref|XP_007210790.1|  hypothetical protein PRUPE_ppa018702mg           59.3    2e-06    
emb|CBI16147.3|  unnamed protein product                              60.8    3e-06    
ref|XP_010037522.1|  PREDICTED: U-box domain-containing protein 5...  58.5    3e-06    
ref|XP_006439911.1|  hypothetical protein CICLE_v10021791mg           58.9    3e-06    
ref|XP_008464515.1|  PREDICTED: U-box domain-containing protein 5...  58.5    3e-06    
ref|XP_004134989.1|  PREDICTED: uncharacterized protein LOC101213489  58.9    3e-06    
ref|XP_010241166.1|  PREDICTED: U-box domain-containing protein 3...  57.8    3e-06    
emb|CDP12743.1|  unnamed protein product                              58.2    4e-06    
ref|XP_002314184.2|  hypothetical protein POPTR_0009s03570g           60.1    4e-06    Populus trichocarpa [western balsam poplar]
gb|KGN49029.1|  hypothetical protein Csa_6G510960                     58.9    6e-06    
ref|XP_010043562.1|  PREDICTED: U-box domain-containing protein 3...  59.7    6e-06    
ref|XP_006424819.1|  hypothetical protein CICLE_v10027788mg           59.3    7e-06    
ref|XP_008380654.1|  PREDICTED: U-box domain-containing protein 5...  57.8    8e-06    
ref|XP_006424818.1|  hypothetical protein CICLE_v10027788mg           58.9    1e-05    
ref|XP_007036324.1|  Adenine nucleotide alpha hydrolases-like sup...  56.6    1e-05    
emb|CBI23514.3|  unnamed protein product                              56.2    1e-05    
ref|XP_006852311.1|  hypothetical protein AMTR_s00049p00196550        56.6    2e-05    
ref|XP_002511332.1|  ATP binding protein, putative                    57.0    2e-05    Ricinus communis
gb|KDO78596.1|  hypothetical protein CISIN_1g021587mg                 56.2    2e-05    
ref|XP_006339578.1|  PREDICTED: U-box domain-containing protein 3...  58.2    2e-05    
ref|XP_004168891.1|  PREDICTED: U-box domain-containing protein 5...  57.0    2e-05    
emb|CDP08808.1|  unnamed protein product                              56.6    2e-05    
ref|XP_010096480.1|  U-box domain-containing protein 33               56.2    3e-05    
emb|CDP09046.1|  unnamed protein product                              57.4    3e-05    
ref|XP_003529681.1|  PREDICTED: U-box domain-containing protein 3...  56.2    3e-05    
ref|XP_011072175.1|  PREDICTED: U-box domain-containing protein 5...  55.5    3e-05    
ref|XP_011095890.1|  PREDICTED: U-box domain-containing protein 5...  55.8    3e-05    
ref|XP_010670316.1|  PREDICTED: U-box domain-containing protein 3...  56.6    4e-05    
ref|XP_010670323.1|  PREDICTED: U-box domain-containing protein 3...  56.2    4e-05    
ref|XP_002299877.2|  hypothetical protein POPTR_0001s24600g           56.6    5e-05    Populus trichocarpa [western balsam poplar]
ref|XP_002269050.1|  PREDICTED: U-box domain-containing protein 36    55.1    5e-05    Vitis vinifera
ref|XP_006449947.1|  hypothetical protein CICLE_v10016013mg           55.1    5e-05    
ref|XP_009773940.1|  PREDICTED: U-box domain-containing protein 3...  56.6    6e-05    
ref|XP_007220262.1|  hypothetical protein PRUPE_ppa001267mg           56.6    6e-05    
ref|XP_008370963.1|  PREDICTED: U-box domain-containing protein 35    55.5    6e-05    
ref|XP_009773947.1|  PREDICTED: U-box domain-containing protein 3...  56.2    6e-05    
ref|XP_010253186.1|  PREDICTED: U-box domain-containing protein 3...  56.2    7e-05    
ref|XP_006601425.1|  PREDICTED: uncharacterized protein LOC100816919  55.1    7e-05    
ref|XP_011095889.1|  PREDICTED: uncharacterized protein LOC105175...  55.1    7e-05    
ref|XP_004299136.1|  PREDICTED: U-box domain-containing protein 3...  54.7    7e-05    
ref|XP_006661585.1|  PREDICTED: U-box domain-containing protein 3...  55.8    8e-05    
ref|XP_010942860.1|  PREDICTED: U-box domain-containing protein 3...  54.7    8e-05    
ref|XP_010942861.1|  PREDICTED: U-box domain-containing protein 3...  54.7    8e-05    
gb|KDO78595.1|  hypothetical protein CISIN_1g021587mg                 53.9    1e-04    
ref|XP_006590986.1|  PREDICTED: U-box domain-containing protein 3...  55.5    1e-04    
ref|XP_009353686.1|  PREDICTED: U-box domain-containing protein 3...  55.5    1e-04    
ref|XP_004250953.1|  PREDICTED: U-box domain-containing protein 3...  55.5    1e-04    
ref|XP_008385126.1|  PREDICTED: U-box domain-containing protein 3...  55.1    1e-04    
ref|XP_006348991.1|  PREDICTED: U-box domain-containing protein 3...  55.1    1e-04    
ref|XP_004140646.1|  PREDICTED: U-box domain-containing protein 5...  53.5    1e-04    
ref|XP_008338844.1|  PREDICTED: U-box domain-containing protein 33    55.1    1e-04    
ref|XP_009629843.1|  PREDICTED: U-box domain-containing protein 3...  55.1    2e-04    
ref|XP_009629842.1|  PREDICTED: U-box domain-containing protein 3...  55.1    2e-04    
ref|XP_008459869.1|  PREDICTED: U-box domain-containing protein 3...  53.9    2e-04    
gb|KHN18419.1|  U-box domain-containing protein 36                    53.9    2e-04    
ref|XP_006488315.1|  PREDICTED: U-box domain-containing protein 3...  54.7    2e-04    
emb|CDY40543.1|  BnaC02g33490D                                        53.1    2e-04    
ref|XP_009361868.1|  PREDICTED: U-box domain-containing protein 3...  53.5    2e-04    
ref|XP_008669387.1|  PREDICTED: U-box domain-containing protein 3...  54.3    3e-04    
gb|KEH31791.1|  universal stress family protein                       53.1    3e-04    
gb|KDP44229.1|  hypothetical protein JCGZ_05696                       54.3    3e-04    
emb|CAN67166.1|  hypothetical protein VITISV_015820                   54.3    3e-04    Vitis vinifera
ref|XP_010241160.1|  PREDICTED: U-box domain-containing protein 3...  52.8    3e-04    
ref|XP_007213955.1|  hypothetical protein PRUPE_ppa011059mg           52.4    3e-04    
ref|XP_009367846.1|  PREDICTED: U-box domain-containing protein 3...  54.3    3e-04    
ref|XP_010102485.1|  U-box domain-containing protein 33               52.8    3e-04    
gb|KDP31037.1|  hypothetical protein JCGZ_11413                       52.4    3e-04    
ref|XP_008669386.1|  PREDICTED: U-box domain-containing protein 3...  53.9    3e-04    
ref|XP_011035331.1|  PREDICTED: U-box domain-containing protein 3...  53.9    3e-04    
ref|XP_008804030.1|  PREDICTED: U-box domain-containing protein 3...  53.9    3e-04    
ref|XP_004515904.1|  PREDICTED: U-box domain-containing protein 3...  52.8    4e-04    
ref|XP_004486362.1|  PREDICTED: U-box domain-containing protein 3...  52.0    4e-04    
ref|XP_002530423.1|  ATP binding protein, putative                    52.4    5e-04    Ricinus communis
gb|KDO72866.1|  hypothetical protein CISIN_1g003481mg                 53.5    5e-04    
ref|XP_011086282.1|  PREDICTED: uncharacterized protein LOC105168059  52.4    5e-04    
ref|XP_010661796.1|  PREDICTED: U-box domain-containing protein 3...  53.1    6e-04    
ref|XP_009340098.1|  PREDICTED: U-box domain-containing protein 3...  53.1    6e-04    
ref|XP_008784570.1|  PREDICTED: U-box domain-containing protein 3...  53.1    6e-04    
ref|XP_007154065.1|  hypothetical protein PHAVU_003G088000g           52.4    6e-04    
ref|XP_010523753.1|  PREDICTED: U-box domain-containing protein 3...  53.1    7e-04    
ref|XP_002274993.2|  PREDICTED: U-box domain-containing protein 3...  53.1    7e-04    Vitis vinifera
ref|XP_010326469.1|  PREDICTED: U-box domain-containing protein 3...  52.8    0.001    
ref|XP_004229888.1|  PREDICTED: U-box domain-containing protein 3...  52.8    0.001    
gb|EMT09986.1|  U-box domain-containing protein 33                    52.4    0.001    
ref|XP_009798369.1|  PREDICTED: U-box domain-containing protein 5...  50.4    0.001    



>ref|XP_009782434.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X1 [Nicotiana sylvestris]
Length=800

 Score =   444 bits (1143),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 273/506 (54%), Positives = 362/506 (72%), Gaps = 14/506 (3%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E + E +VYV I  ++HDGF +L+W L+  SSQS TI+ILYA N IC+DYV TP+G+LP+
Sbjct  4     ELEVENKVYVAINSNLHDGFLTLQWALKRWSSQSITIVILYAVNNICKDYVITPMGKLPA  63

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
              SVNEE LKDL+K+EEAK  KIL  Y  FCG VK E +KI+ +D SI++IMVDLI+SL+I
Sbjct  64    GSVNEEILKDLEKFEEAKNQKILWRYKVFCGNVKVEAIKIEGYDESIQEIMVDLITSLRI  123

Query  1151  TKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDE  972
             TKLV+SLTFMK   WKSRSA+ G F +H QKP+FCELF++ GGKLVFL E N E +I+D+
Sbjct  124   TKLVMSLTFMKSSSWKSRSAISGSFFVHRQKPEFCELFIICGGKLVFLREGNNEGLIEDD  183

Query  971   VGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKN  792
              G ++  +R    K+  F+ L+ + M PE + K K  CDS +S       NG  DQWEK 
Sbjct  184   QGEMVANSR---SKRQSFRDLVVK-MFPENSAKMKNQCDSSAS-------NGSFDQWEKY  232

Query  791   QSEIELYLSQLSSSKT---DCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQQV  621
             + EIE Y+SQ+ SS     D   AN+ L+    E  M +NMT +E+ +ALK K  E++Q 
Sbjct  233   KEEIENYMSQILSSNAEEIDDFVANESLQKSNTELVMADNMTVQEKRKALKIKFLEIKQT  292

Query  620   VQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyel  441
             +QL+++EAK  V   AKA+WA  LC  RAE+++ CIN+E+A++A L+ ELD+ KEEL EL
Sbjct  293   IQLSREEAKGHVRGHAKAQWATTLCTRRAEEIDGCINDEIARKADLKRELDATKEELSEL  352

Query  440   qteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqr  261
              TEVE   ++LNSILELQREL++K+QLSS  +S AE+++E+ V+ RT  +Q I+  R+QR
Sbjct  353   HTEVEITTSRLNSILELQRELSNKLQLSSVARSRAEVKVEKVVKQRTDTLQEIDEYRKQR  412

Query  260   dvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVY  81
             DVLRRRIEFC+EKDAIG A  L +PSF  ++F+AAEIRAAT+ FS+R RLK GG+WT+VY
Sbjct  413   DVLRRRIEFCREKDAIGNATMLMKPSFEYKEFTAAEIRAATDGFSDRMRLKSGGDWTDVY  472

Query  80    KGCLNSERVAIKLYHKSTSLSEETFQ  3
             K  LN   VAIKLY      S + F+
Sbjct  473   KARLNHTSVAIKLYSSGDVDSADAFR  498



>emb|CDP01572.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   444 bits (1142),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 274/507 (54%), Positives = 367/507 (72%), Gaps = 11/507 (2%)
 Frame = -3

Query  1517  MEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRL  1338
             ME  Q  ER++V IG D++DGF +LEWVL+  +S    I+IL++ N ICRDYV+TPIG++
Sbjct  1     METDQPAERIFVAIGTDLNDGFATLEWVLKKWNSHPIKIVILFSDNYICRDYVFTPIGKI  60

Query  1337  PSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSL  1158
             P+SSV EEKLK L+K EEAK+DKIL+ YIAFCGKVKAE L+I R++  I K+++ LI+SL
Sbjct  61    PASSVREEKLKVLEKSEEAKSDKILSKYIAFCGKVKAEGLRIDRYEEPIHKVVLGLITSL  120

Query  1157  QITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIK  978
              ITKLV++ + ++PL WKSR+A+   F++ ++KP+FCELFV+F GKLV+L EE  E  I+
Sbjct  121   PITKLVMAFSLLRPLSWKSRTAMNASFYLQSKKPNFCELFVIFNGKLVYLKEETNEGFIE  180

Query  977   DEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWE  798
             D+ G ++ R +E+      FK  + +   PE A+ +       SSS+S+    G  DQWE
Sbjct  181   DDQGVIVARIKERP----SFKGWIGK-FFPENANGKNHCESPSSSSASN---GGTPDQWE  232

Query  797   KNQSEIELYLSQLSSS---KTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQ  627
             K   EIE Y ++LSSS   + + + AND       E  M ENM   E+IE L+ KIR+ +
Sbjct  233   KYGEEIENYFNELSSSIANEGNSEEANDTSISISPELNMAENMAAAEKIEILEIKIRDTR  292

Query  626   QVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeely  447
             + +Q NK+EA+A  E+ AKA+WAI LC +RA DLEA I+EE+AKR  L+++LDS KEEL+
Sbjct  293   ESIQSNKEEARANAEKCAKAKWAIGLCTARANDLEARIHEEIAKRMDLQKDLDSTKEELF  352

Query  446   elqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrr  267
             E+Q+EVEEKR KLN ILELQREL++K+QLS+  KS  E QLE+AVR R +MVQ IE LRR
Sbjct  353   EIQSEVEEKRNKLNPILELQRELSNKLQLSTLAKSRVESQLEKAVRNRAEMVQEIEELRR  412

Query  266   qrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTN  87
             QRDVL+RRIEFCKEKDAIG A RL +  F  R+F+AAEIRAAT++FSE  RLK   +WTN
Sbjct  413   QRDVLQRRIEFCKEKDAIGMANRLNDLCFDYRKFTAAEIRAATDDFSECLRLKSAADWTN  472

Query  86    VYKGCLNSERVAIKLYHKSTSLSEETF  6
             VY+G +N   VAIKL +   +LS++TF
Sbjct  473   VYRGRVNRTTVAIKLSNSDAALSQDTF  499



>ref|XP_009606490.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X1 [Nicotiana tomentosiformis]
Length=803

 Score =   430 bits (1105),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 267/506 (53%), Positives = 361/506 (71%), Gaps = 11/506 (2%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E + E++VYV I  ++HDGF +L+W L+  SSQS TI+ILYA+N IC+++V TP+G+LP+
Sbjct  4     ELEVEKKVYVAINSNLHDGFLTLQWALKRWSSQSITIVILYASNNICKNFVITPMGKLPA  63

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
              SVNEEKLKDL+K+EEAK  KIL  Y  FC  VK E +KI+ +D SI++IMVDLI+ L+I
Sbjct  64    GSVNEEKLKDLEKFEEAKNQKILWRYKVFCANVKVEAIKIEGYDESIQEIMVDLITGLRI  123

Query  1151  TKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDE  972
             TKLV+SLTFMK   WKSRSA+ G F +H QKP+FCELF++ GGKLVFL E N E +I+D+
Sbjct  124   TKLVMSLTFMKSSSWKSRSAISGSFFVHRQKPEFCELFIICGGKLVFLRERNNEGLIEDD  183

Query  971   VGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKN  792
              G ++  +R    K+  FK L+ + M PE       +    S  S SS SN   DQWEK 
Sbjct  184   QGEMVANSR---SKRQSFKDLVVK-MFPE----NNSAKMKNSCDSPSSASNSSVDQWEKY  235

Query  791   QSEIELYLSQLSSSKT---DCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQQV  621
             + EIE Y+SQ+ SS     D   AN+ L++ + E  M +N+T +E+ EA+K K  E++Q 
Sbjct  236   KDEIENYMSQILSSNAEEIDDFIANENLQNSITEFVMADNLTLQEKREAVKIKFLEIKQT  295

Query  620   VQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyel  441
             +QL+++EAK  V   AKA+WA  LC  RAE+++ CIN+E+A++A L+ ELD+ KEE+ EL
Sbjct  296   IQLSREEAKGHVRGHAKAQWATTLCTRRAEEIDGCINDEIARKADLKRELDATKEEISEL  355

Query  440   qteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqr  261
              TEVE   ++LNSILELQ EL++K+QLSS  +S AE+++E+ V+ RT  +Q IE  R+QR
Sbjct  356   HTEVEITTSRLNSILELQGELSNKLQLSSVARSRAEVKVEKVVKQRTDTLQEIEEYRKQR  415

Query  260   dvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVY  81
             DVLRRRIEFC+EKDAIG A  L +PSF  ++F+AAEIRAAT+ FS+R RLK GG+WT+VY
Sbjct  416   DVLRRRIEFCREKDAIGNATMLIKPSFEYKEFTAAEIRAATDGFSDRMRLKSGGDWTDVY  475

Query  80    KGCLNSERVAIKLYHKSTSLSEETFQ  3
             K  LN   VAIKLY      S + F+
Sbjct  476   KARLNHTSVAIKLYSSGDVDSADAFR  501



>ref|XP_011099977.1| PREDICTED: putative U-box domain-containing protein 50 [Sesamum 
indicum]
Length=776

 Score =   415 bits (1067),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 262/503 (52%), Positives = 342/503 (68%), Gaps = 21/503 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV IG D  DGF +L+W LR  S+   +I+IL+AANTIC+DYVYTP+GRLPSSSV+E
Sbjct  7     EKVYVAIGTDWGDGFSTLQWTLRKWSNHGISIVILHAANTICKDYVYTPLGRLPSSSVSE  66

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL  L+K EEAK+DKIL+ YIAFCG+VKAE++K++ +D  + K +V++ISSL+ITKLV+
Sbjct  67    EKLMVLEKSEEAKSDKILSQYIAFCGRVKAEVIKLENNDQPLHKQIVEVISSLRITKLVM  126

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
             SL FMK   WKSR+ + G F++  QKPDFC LFV+ GG+LVFL EEN +  I+D+ G ++
Sbjct  127   SLAFMKLSSWKSRTVISGTFYVLRQKPDFCNLFVICGGRLVFLREENEQGFIEDDRGMMV  186

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              + R+     H  K    +  L   A+             SSS  N  A QWEK   EIE
Sbjct  187   AKLRK----NHSIKTWFGKTCLENAANNSSP---------SSSGINDSAHQWEKWSQEIE  233

Query  776   LYLSQLSS------SKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQQVVQ  615
              Y ++L S       K D D      ++   E  MPENM   ERI+ LK +I+  Q  +Q
Sbjct  234   QYANELLSIHEAEEGKIDLDTG--IFKERPTELYMPENMDAAERIQFLKRRIQTAQHTIQ  291

Query  614   LNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqt  435
             L K++A A  +++ KAEWAI +C S+AE+LEA INEE+ K   L +ELDS K EL EL +
Sbjct  292   LKKQQAHAAKKQREKAEWAISICNSKAEELEASINEEVVKNIDLNKELDSRKRELNELGS  351

Query  434   eveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdv  255
             EVEEKR+KLNSILELQ+EL+ K+QLS+  K+ AE+QLE+AVRTR +MVQ IE LR+ RDV
Sbjct  352   EVEEKRSKLNSILELQKELSQKLQLSTSAKARAEVQLEKAVRTRAEMVQEIEELRKNRDV  411

Query  254   lrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKG  75
             L+RRIEFCKEKDAI +  +        R+FSAAEI+AAT +FS+R RLK  G  TNVY+G
Sbjct  412   LQRRIEFCKEKDAIAKVSKSYGFGSDYREFSAAEIKAATEDFSQRLRLKSVGRLTNVYRG  471

Query  74    CLNSERVAIKLYHKSTSLSEETF  6
              +N   VAIK Y    + S+E F
Sbjct  472   RINHITVAIKTYSSEHTWSKEGF  494



>ref|XP_006353276.1| PREDICTED: putative U-box domain-containing protein 50-like [Solanum 
tuberosum]
Length=776

 Score =   412 bits (1059),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 254/506 (50%), Positives = 346/506 (68%), Gaps = 35/506 (7%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E +++ +VY+ I  D+HDGF +L+W L+  +S S TI+ILYA+N IC+DYV TP+G+LP 
Sbjct  4     EMERDNKVYIAINSDIHDGFLTLQWALKRWNSHSITIVILYASNNICKDYVVTPMGKLPR  63

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
              SVNEEKLKDL+K EEAK  KIL  Y  FCG VK E +KI+R+D SI+K MVDLI  L+I
Sbjct  64    GSVNEEKLKDLEKLEEAKNQKILWRYKVFCGNVKVEAIKIERYDESIQKFMVDLIYGLKI  123

Query  1151  TKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDE  972
              KLV+SLTFMKP  WKSRSA+ G F +H QKP+FCELF++ GGKLVFL E N E +I+D+
Sbjct  124   NKLVISLTFMKPSSWKSRSAISGSFFVHRQKPEFCELFIICGGKLVFLREGNNEGLIEDD  183

Query  971   VGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKN  792
              G ++ ++R     +  F+ L+ + M PE + K  +                        
Sbjct  184   QGIMVAKSRS---MRQSFRDLVIK-MFPENSSKLLK------------------------  215

Query  791   QSEIELYLSQLSSS---KTDCDAANDPL-EDCVKEPTMPENMTTKERIEALKAKIREVQQ  624
                I+ Y+ QL SS   + D   A++ L ++ + E  M ENMT +E+ EAL+ KI E+++
Sbjct  216   ---IDNYMCQLLSSNFEEIDDFVADEILHKNIITELVMAENMTMQEKKEALRIKILEIKE  272

Query  623   VVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelye  444
              +QL+++EAK+ VE QAKA+WAI LC  RAE+++ CIN+E+A++  L+ ELD+ K+EL E
Sbjct  273   AIQLSREEAKSHVEGQAKAQWAITLCTRRAEEIDGCINDELARKPDLKRELDATKDELNE  332

Query  443   lqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrq  264
             L TEVE  ++KL+SILELQ E+++K+QLSS  +S AE+QLE+ ++ R   V+ IE  R Q
Sbjct  333   LHTEVEVTKSKLSSILELQHEVSTKMQLSSVARSRAEVQLEKVLKQRMDTVKEIEEFRGQ  392

Query  263   rdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNV  84
             RDVLRRRI FC+EKDAIG A  L EP    ++FSAAEIR AT+ FS   RLK GG+WT+V
Sbjct  393   RDVLRRRITFCREKDAIGNASMLIEPRLKYKEFSAAEIRTATDGFSNLMRLKSGGDWTDV  452

Query  83    YKGCLNSERVAIKLYHKSTSLSEETF  6
             YK  L+   VAIKLY  +   SE+TF
Sbjct  453   YKAKLHHTSVAIKLYSSADVDSEDTF  478



>emb|CBI14769.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   389 bits (999),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 247/509 (49%), Positives = 344/509 (68%), Gaps = 24/509 (5%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G D+ DGF +LEW LR  +S ST+I+I++A N I  D+VYTP G+LP+SSV++
Sbjct  6     EKVYVAVGSDLQDGFATLEWALRKWNSHSTSIVIIHATNIISNDFVYTPFGKLPASSVSD  65

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL  L KYEE KT+K+L+ Y+AFCGKVKAEILKI++HD  I K+++DLIS + ITKLVL
Sbjct  66    EKLGVLRKYEEDKTNKLLSKYMAFCGKVKAEILKIEKHDEPIHKVIIDLISGVHITKLVL  125

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
              +TF+K    +S+SA+ G F++H  KP+FCELF+V GGKLVFL EEN + +++D+ G ++
Sbjct  126   GMTFLKSSAGRSKSAISGSFYVHRNKPEFCELFIVCGGKLVFLREEN-DGLMEDDQGVMV  184

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              R R K      FK    + M  E +     +  S +SS+ +   N L +QWE +  EIE
Sbjct  185   ARTRGKP----SFKGWFGK-MFAE-SPTSHHTHGSSTSSTIADSLNSL-NQWENSVDEIE  237

Query  776   LYLSQLSS---SKTDCDAANDPLEDCVKEPTMPENMTT--------KERIEALKAKIREV  630
              Y  QL S    + DC+  N+P      E  MPEN+T          E+  ALK K+ E 
Sbjct  238   NYFQQLLSLNLDEQDCEDENNP-----TEQEMPENITAFLLQFQSGAEKFGALKIKLEEA  292

Query  629   QQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeel  450
              + +QL +KEAK  VER  +AEWAI L   RAE+LE  INEE++ R  + +ELD++KE++
Sbjct  293   HETIQLKRKEAKDHVERHGRAEWAICLSTRRAEELEVHINEEISNRIDIRKELDASKEQI  352

Query  449   yelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLr  270
             YE++++VEE +++L S+LELQ EL+ K+QLSS  +S  E QLE     R +MV+ IE LR
Sbjct  353   YEVRSDVEESKSRLRSLLELQTELSKKLQLSSLSRSRVEAQLENVAIARAEMVREIEELR  412

Query  269   rqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWT  90
             RQRDVL+RRIEFC+EK+AIG A RL E     R+++   I+ AT++FSE  R+K GG+ T
Sbjct  413   RQRDVLQRRIEFCREKEAIGTASRLSELICSYREYTPEVIKLATDDFSEHLRMKTGGDLT  472

Query  89    NVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             NV+KG +N   VAIK+ + +  LS+E FQ
Sbjct  473   NVFKGRINHATVAIKMVNSAKGLSQEAFQ  501



>ref|XP_010647329.1| PREDICTED: putative U-box domain-containing protein 50, partial 
[Vitis vinifera]
Length=650

 Score =   389 bits (998),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 244/505 (48%), Positives = 342/505 (68%), Gaps = 20/505 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G D+ DGF +LEW LR  +S ST+I+I++A N I  D+VYTP G+LP+SSV++
Sbjct  6     EKVYVAVGSDLQDGFATLEWALRKWNSHSTSIVIIHATNIISNDFVYTPFGKLPASSVSD  65

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL  L KYEE KT+K+L+ Y+AFCGKVKAEILKI++HD  I K+++DLIS + ITKLVL
Sbjct  66    EKLGVLRKYEEDKTNKLLSKYMAFCGKVKAEILKIEKHDEPIHKVIIDLISGVHITKLVL  125

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
              +TF+K    +S+SA+ G F++H  KP+FCELF+V GGKLVFL EEN + +++D+ G ++
Sbjct  126   GMTFLKSSAGRSKSAISGSFYVHRNKPEFCELFIVCGGKLVFLREEN-DGLMEDDQGVMV  184

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              R R K   K  F  +         +     +  S +SS+ +   N L +QWE +  EIE
Sbjct  185   ARTRGKPSFKGWFGKMFAE------SPTSHHTHGSSTSSTIADSLNSL-NQWENSVDEIE  237

Query  776   LYLSQLSS---SKTDCDAANDPLEDCVKEPTMPEN----MTTKERIEALKAKIREVQQVV  618
              Y  QL S    + DC+  N+P      E  MPEN    ++  E+  ALK K+ E  + +
Sbjct  238   NYFQQLLSLNLDEQDCEDENNP-----TEQEMPENSDSDVSGAEKFGALKIKLEEAHETI  292

Query  617   QLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelq  438
             QL +KEAK  VER  +AEWAI L   RAE+LE  INEE++ R  + +ELD++KE++YE++
Sbjct  293   QLKRKEAKDHVERHGRAEWAICLSTRRAEELEVHINEEISNRIDIRKELDASKEQIYEVR  352

Query  437   teveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrd  258
             ++VEE +++L S+LELQ EL+ K+QLSS  +S  E QLE     R +MV+ IE LRRQRD
Sbjct  353   SDVEESKSRLRSLLELQTELSKKLQLSSLSRSRVEAQLENVAIARAEMVREIEELRRQRD  412

Query  257   vlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYK  78
             VL+RRIEFC+EK+AIG A RL E     R+++   I+ AT++FSE  R+K GG+ TNV+K
Sbjct  413   VLQRRIEFCREKEAIGTASRLSELICSYREYTPEVIKLATDDFSEHLRMKTGGDLTNVFK  472

Query  77    GCLNSERVAIKLYHKSTSLSEETFQ  3
             G +N   VAIK+ + +  LS+E FQ
Sbjct  473   GRINHATVAIKMVNSAKGLSQEAFQ  497



>ref|XP_007047770.1| U-box domain-containing protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOX91927.1| U-box domain-containing protein kinase family protein, putative 
[Theobroma cacao]
Length=803

 Score =   386 bits (992),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 240/504 (48%), Positives = 336/504 (67%), Gaps = 18/504 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G D+ DGF++L W LR  +SQ+ +I++L+ A  I +D+VYTP G+LP S+V+E
Sbjct  6     EKVYVAVGNDIQDGFKTLAWTLRRWNSQAISIVLLHVAYNISKDFVYTPFGKLPVSAVSE  65

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L KYE+ KTDK+L+ YIAFCGKVK EILK++++D  I K++VDL+S L+I KLV+
Sbjct  66    EKLEVLRKYEQEKTDKLLSKYIAFCGKVKTEILKVEKYDEPIHKLIVDLMSGLRIGKLVM  125

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
              +TFMK   W+S+SA+ G F++H  KP FCEL+++ GGKLV L     E  ++D+ G ++
Sbjct  126   GMTFMKSSSWRSKSAISGSFYVHQYKPHFCELYIICGGKLVVLKGNIDEGFMEDDQGIMV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              +  EK            R +L +I  +   S     S    S  +   +QWE N  E++
Sbjct  186   AKIGEKPSL---------RNLLGKIFSENSSSRRQKCSCPPPSNQDSPKNQWEDNVQELD  236

Query  776   LYLSQLSSSKTDCDAAND------PLEDCVKEPTMPENMTTKERIEALKAKIREVQQVVQ  615
              Y   L S   + D  ND      P+E   +E T   NM  +E++E L++KI E  + +Q
Sbjct  237   NYFQHLLS--LNLDEENDHLLQTNPVEPDSQENT-NSNMNAEEKMETLQSKIDEAHETIQ  293

Query  614   LNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqt  435
             L +KEAKA  ER AKAEWAI LC +RAE+LE  I EE+ KR  +   LD  KE+L+E+  
Sbjct  294   LKRKEAKANAERHAKAEWAIILCNTRAEELETQIKEEVTKRLEIRRILDIEKEQLHEVIR  353

Query  434   eveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdv  255
             +VEE + +LNS++ELQ EL+SK+Q+SS  ++HAE QLE+AV TR +MV+ IE LRRQRDV
Sbjct  354   DVEESKNRLNSLMELQAELSSKLQISSMARAHAEAQLEKAVVTRAEMVREIEELRRQRDV  413

Query  254   lrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKG  75
             L+RRIEFC+EKDA+G   RL E S   R+++A +IR AT+ FSER RLK GG+W NVY+G
Sbjct  414   LQRRIEFCREKDALGMVARLTELSCSYREYTAEDIRLATDGFSERLRLKSGGDWLNVYRG  473

Query  74    CLNSERVAIKLYHKSTSLSEETFQ  3
              +N   VAIK    +  LS++ FQ
Sbjct  474   RINHSTVAIKTLVSANRLSQQDFQ  497



>ref|XP_008236249.1| PREDICTED: putative U-box domain-containing protein 50 [Prunus 
mume]
Length=812

 Score =   385 bits (990),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 230/506 (45%), Positives = 334/506 (66%), Gaps = 12/506 (2%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G D+ DGF++L+W L+  +S+  +I+IL+    I +D+VYTP G+LP+SS+N+
Sbjct  6     EKVYVALGNDIQDGFKTLQWTLKKWNSKPISIVILHVTYNISKDFVYTPFGKLPASSMND  65

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L KYE+ K DK+L+ YI+FCG+VKAE+LK+++ +  I K++ DLI + +ITKLV+
Sbjct  66    EKLEVLMKYEQEKIDKLLSKYISFCGQVKAELLKVEKCEQPIHKVITDLIFTHKITKLVM  125

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               TF+K   W+ +SA+ G F++H+ KPDFCE FV+ GG+LVFL  EN + +++D+ G ++
Sbjct  126   GFTFLKTSSWRIKSAVSGSFYVHHHKPDFCEFFVICGGRLVFLRGENNKGIMEDDQGVMV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              + REK      FK  L +I     AD            S++  S+   +QWE    EIE
Sbjct  186   AKVREKG----SFKGWLAKIFNENSADSLDTVSHPSLIFSTNPNSSNSQNQWESCVQEIE  241

Query  776   LYLSQLSSSKTD----CDAANDPLEDCVKEPTMPE----NMTTKERIEALKAKIREVQQV  621
              Y   L S K D        ND ++    E   PE    NM   E +E+ K  ++E Q+ 
Sbjct  242   NYFQHLLSLKLDEEEDLGQGNDRVQISPMELARPEHADSNMIAAEDLESRKKMLKEAQET  301

Query  620   VQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyel  441
              +L +KE KA  ER  KAEW I LC  RAE+LEA I EE+ KR  L++ LDS KE+L+E+
Sbjct  302   TKLKRKEVKANAERSTKAEWTISLCNRRAEELEAKIKEEVTKREELKKALDSEKEQLHEV  361

Query  440   qteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqr  261
               + EE +++LNS++ELQ EL++K+  SS  KS+ E QLE+AV TR +MV+ IE LR+QR
Sbjct  362   IMDTEESKSRLNSLMELQYELSTKLHNSSLAKSNRETQLEKAVSTRAEMVREIEELRQQR  421

Query  260   dvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVY  81
             +VL RRIEFCKEKDAIG   RL + S   + ++A EIR ATN+FSER R+K GG+WT++Y
Sbjct  422   EVLHRRIEFCKEKDAIGMVARLSDTSCGFKDYTAEEIRLATNDFSERLRIKPGGDWTSMY  481

Query  80    KGCLNSERVAIKLYHKSTSLSEETFQ  3
             +G +N   VAIK+ + +  +S++ FQ
Sbjct  482   RGRINHATVAIKMLNSANDISKQDFQ  507



>ref|XP_007208084.1| hypothetical protein PRUPE_ppa001508mg [Prunus persica]
 gb|EMJ09283.1| hypothetical protein PRUPE_ppa001508mg [Prunus persica]
Length=812

 Score =   383 bits (984),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 229/506 (45%), Positives = 334/506 (66%), Gaps = 12/506 (2%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G D+ DGF++L+W L+  +S+  +I+IL+    I +D+VYTP G+LP+SS+++
Sbjct  6     EKVYVALGNDIQDGFKTLQWTLKKWNSKPISIVILHVTYNISKDFVYTPFGKLPASSLSD  65

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L KYE+ K DK+L+ YI+ CG+VKAE+LK++R +  I K++ DLI + +ITKLV+
Sbjct  66    EKLEVLMKYEQEKIDKLLSKYISSCGQVKAELLKVERCEQPIHKVITDLIFTHKITKLVM  125

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               TF+K   W+ +SA+ G F++H+ KPDFCE FV+ GG+LVFL  EN + +++D+ G ++
Sbjct  126   GFTFLKTSSWRIKSAVSGSFYVHHHKPDFCEFFVICGGRLVFLRGENNKGIMEDDQGVMV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              + REK       K  L ++     AD   +        S++  S    +QWE    EIE
Sbjct  186   AKLREKG----SLKSWLAKMFNENSADSLDKVSHPSLRFSTNPNSPNSQNQWESCVQEIE  241

Query  776   LYLSQLSSSKTD----CDAANDPLEDCVKEPTMPE----NMTTKERIEALKAKIREVQQV  621
              Y   L S K D    C   ND ++    E   PE    NM   E +E+ K  +RE Q+ 
Sbjct  242   NYFQHLLSLKLDEEEDCGQGNDRVQISPMEMARPEHADLNMIAAEDLESRKKMLREAQET  301

Query  620   VQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyel  441
             ++  +KEAKA  ER  KAEW I LC  RAE+LEA I EE+ KR  L++ LDS KE+L+E+
Sbjct  302   IKFKRKEAKANAERSTKAEWTISLCNRRAEELEAKIKEEVTKREDLKKALDSEKEQLHEV  361

Query  440   qteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqr  261
               + EE +++LNS++ELQ EL++K+  SS  KS+ E QLE+AV TR +MV+ IE LR+QR
Sbjct  362   IMDTEESKSRLNSLMELQYELSTKLHNSSLAKSNRETQLEKAVSTRAEMVREIEELRQQR  421

Query  260   dvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVY  81
             +VL RRIEFCKEKDAIG   RL + S   + ++A EIR ATN+FSER R+K GG+WT++Y
Sbjct  422   EVLHRRIEFCKEKDAIGMVARLSDMSCGFKDYTAEEIRLATNDFSERLRIKPGGDWTSMY  481

Query  80    KGCLNSERVAIKLYHKSTSLSEETFQ  3
             +G +N   VAIK+ + +  +S++ FQ
Sbjct  482   RGRINHATVAIKMLNSANGISKQDFQ  507



>ref|XP_006572996.1| PREDICTED: putative U-box domain-containing protein 50-like [Glycine 
max]
Length=801

 Score =   375 bits (963),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 241/506 (48%), Positives = 340/506 (67%), Gaps = 19/506 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E++YV +G DV DG+++L W L+  +S   +I+IL+  +   +DYV+TP G+LP+ SV+E
Sbjct  7     EKIYVAVGNDVQDGYKTLNWALKKWNSHPISIVILHLTHNSTKDYVHTPFGKLPARSVSE  66

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L K E+ K +K+L+ YIAFCGKV AEIL++++ D  ++K ++DLI  L ITKLV+
Sbjct  67    EKLQILRKDEQDKINKLLSKYIAFCGKVPAEILEVEKFDEPMQKRVIDLIFGLGITKLVM  126

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               +FMKP + KS+ A+ GLFH+H QKP FCELFV+ GGK VFL  +N E +++D+ G ++
Sbjct  127   GFSFMKPSM-KSKGAINGLFHVHEQKPSFCELFVICGGKQVFLRGKNDEKIMEDDQGVMV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              R R+K      FK  L++    +  D + R     SS+  S V+    +QWE    EIE
Sbjct  186   ARMRDKIT----FKDWLDKWFKDKTNDSQDRIASLSSSNLESPVNR---NQWEFYLQEIE  238

Query  776   LYLSQLSSSKTD---CDAANDPLEDCVKEPTMPE----NMTTKERIEALKAKIREVQQVV  618
              Y  +L SSK +   C   ND  +    EP + E    NM+T E+IE LK K+ E Q+ +
Sbjct  239   NYYQELLSSKPEEGSCVQENDDSQIGPIEPHVTEQNNYNMSTAEKIEILKNKLNEGQKTI  298

Query  617   QLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelq  438
             QL +KEAK  +ER  KAEWAI LC SRAE+LE+ I EE++ R  L++E D+ KE+  E++
Sbjct  299   QLKRKEAKDNIERHTKAEWAICLCNSRAEELESRIREEVSAREELKKESDAEKEQTEEMR  358

Query  437   teveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrd  258
             TEVEE++ +L+S+ E+Q EL++++Q+ +  K  AE QLE+AV  R +M + IE LRRQRD
Sbjct  359   TEVEERKRRLSSLTEVQSELSNRLQIWTLAKIRAETQLEKAVGERREMGREIEELRRQRD  418

Query  257   vlrrRIEFCKEKDAIGEAKRLGEPSFCC-RQFSAAEIRAATNEFSERQRLKCGGNWTNVY  81
             VL RRIEFCK+KDAIG A RL E +FC  R+++  E+R AT+ FSER RLK GG+WTNVY
Sbjct  419   VLNRRIEFCKQKDAIGMAARLAETTFCAFREYTEEELRLATDNFSERLRLKSGGDWTNVY  478

Query  80    KGCLNSERVAIKLYHKSTSLSEETFQ  3
             +G  N   VAIK+     SLS + FQ
Sbjct  479   RGRFNHSTVAIKML---PSLSPQHFQ  501



>gb|KEH27732.1| U-box kinase family protein [Medicago truncatula]
Length=572

 Score =   367 bits (943),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 233/508 (46%), Positives = 340/508 (67%), Gaps = 20/508 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E++YV +G+D  DGF +L W L+   S   +I+IL+  + I ++YVYTP G+LP+ S+N+
Sbjct  7     EKIYVAVGDDAQDGFNTLNWALKKWKSHPISIVILHVTHNISKEYVYTPFGKLPARSLND  66

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L K E+ +  K+ + YIAFCGKV AEIL++++ D  ++K ++DLI+ L+ITKLV+
Sbjct  67    EKLEALRKDEKERIKKLFSKYIAFCGKVSAEILEVKKFDEPMQKRVIDLITELEITKLVM  126

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               +FMKP L KS+ A+ GLF++H  KP  CELF++ GGK VFL   N E +++D+ G ++
Sbjct  127   GFSFMKPSL-KSKGAISGLFYVHQHKPSLCELFIICGGKQVFLRGNNDEKIMEDDSGVMV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              + R+K      FK  L+++     +DK          S+S S +N + +QWE    +IE
Sbjct  186   AKMRDKVT----FKDWLDKM----FSDK-TNYYSQNRLSASPSSTNLVQNQWEFYLQDIE  236

Query  776   LYLSQLSSSKTDCDAA---NDPLEDCVK-EPTMPE----NMTTKERIEALKAKIREVQQV  621
              Y  +L SS  +  +    ND L  C K EP + +    N +T E+IE LK K+ E ++ 
Sbjct  237   NYYQELLSSNLEEGSYVQENDGLHVCPKFEPHVTDLNNSNKSTAEKIEMLKNKLNEARKT  296

Query  620   VQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyel  441
             ++L +KEAK  +ER+ KAEWAI LC SRAE++E  I EE++ + +L +EL   KE+  E+
Sbjct  297   IELKRKEAKENIERRTKAEWAISLCNSRAEEIEGRIREEVSTKENLNKELQLEKEQREEM  356

Query  440   qteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqr  261
             +TE++EK+ ++NS++ELQ EL++K+QLS+  +S AE Q+ERAVR RT+MV+ IE LR+QR
Sbjct  357   RTEIKEKKQRMNSLVELQSELSNKLQLSTMARSRAETQVERAVRERTEMVREIEELRKQR  416

Query  260   dvlrrRIEFCKEKDAIGEAKRLGE--PSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTN  87
             DVL RRIEFCK+KDAIG A RL +   S   R++S  E+R AT+ FSER RLK G +WTN
Sbjct  417   DVLNRRIEFCKQKDAIGMAARLSDNITSIGMREYSEEELRLATDNFSERLRLKSGRDWTN  476

Query  86    VYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             VY+G  N   VAIK+     SLS+E FQ
Sbjct  477   VYRGRFNHSTVAIKMMSSFHSLSQEEFQ  504



>gb|KDO60542.1| hypothetical protein CISIN_1g003594mg [Citrus sinensis]
Length=505

 Score =   364 bits (935),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 233/509 (46%), Positives = 332/509 (65%), Gaps = 20/509 (4%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTIC-RDYVYTPIGRLPSSSV  1323
             E +VYV +G D+ DG+++L+W +R   +QS +I+IL+    I  +D+VYTP G+LP++S+
Sbjct  5     EPKVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIKDFVYTPFGKLPATSL  64

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             ++EKL+ L KYE+ KTD +L+ Y+ FCGKVKAEILK+++ D  + K+++DL+S L ITKL
Sbjct  65    SDEKLEILKKYEQGKTDNLLSKYLGFCGKVKAEILKVEKSDEPVHKLILDLVSRLTITKL  124

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGG  963
             V+ L+FM P   KSR+A+ G + +H+  PD+CELF++ GGKLV L  EN E +++D+ G 
Sbjct  125   VMGLSFMIPSAGKSRTAVSGSYFVHHHMPDYCELFIICGGKLVSLKGENDEGIMEDDQGV  184

Query  962   VIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
                + RE+      F  L  ++      +  + S  S    + S  S      WE    E
Sbjct  185   KFAKMRERV----NFGNLWTKMFSGNGRNPNRLSICSRGPDADSPYSRS---TWENCVQE  237

Query  782   IELYLSQLSSSKTDCDAAN-----DPLEDCVKEPTMPE----NMTTKERIEALKAKIREV  630
             IE+Y   L+S   D DA+N     + L+    EP   E    NM+  ER E +K+KI E 
Sbjct  238   IEIYFQHLASFNLD-DASNSEDGDEILQTRAIEPNAAEQIDSNMSVAERTEFMKSKINEA  296

Query  629   QQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeel  450
             +++++L KKE K   ER AKA+WAI LC SRA+ LE+   E++A R  ++ +LDS KE+ 
Sbjct  297   REMIRLKKKETKDDAERCAKAKWAICLCNSRADQLESLTKEDVASRMEIQRDLDSLKEQS  356

Query  449   yelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLr  270
              E+  +VEE + +L+S++ELQ EL++K+QLS+  K HAE QLE+AV  R ++V+ IE LR
Sbjct  357   CEVIRDVEESKNRLSSLIELQSELSNKLQLSTMAKGHAEAQLEKAVIARAEIVKDIEELR  416

Query  269   rqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWT  90
             RQRDVL RRIEFCKEKDAIG   R  E S   R+++A +IR AT +FSER RLKC G+WT
Sbjct  417   RQRDVLHRRIEFCKEKDAIGMVIRSSELSCAFREYAAEDIRLATEDFSERFRLKCAGDWT  476

Query  89    NVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             NVY+G LN   VAIK  +    LSEE FQ
Sbjct  477   NVYRGRLNHASVAIKTLN--NGLSEEDFQ  503



>ref|XP_010113445.1| Putative U-box domain-containing protein 50 [Morus notabilis]
 gb|EXC35472.1| Putative U-box domain-containing protein 50 [Morus notabilis]
Length=786

 Score =   372 bits (955),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 227/516 (44%), Positives = 337/516 (65%), Gaps = 15/516 (3%)
 Frame = -3

Query  1517  MEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRL  1338
             M+    E +VYV +G D+ DG ++L+W L+  +SQ  +I+IL+A + I +D+VYTP G+L
Sbjct  1     MDSQLAENKVYVALGNDLQDGLKTLDWTLKKWNSQPISIIILHATHNISKDFVYTPFGKL  60

Query  1337  PSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSL  1158
             P+S+V++EKL  L +YE+ + DK+L+ YI+FCG+VKAE+LK+++ D  I K+++DLI   
Sbjct  61    PASAVSDEKLDVLKRYEKERIDKLLSKYISFCGEVKAELLKVEKCDDPIHKVIIDLICGH  120

Query  1157  QITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIK  978
             ++TKLV+  +F+K   WK ++A+ G F++H  KPDFC LF++ GGK + +  EN + +++
Sbjct  121   RVTKLVMGFSFLKSSSWKIKTAISGSFYVHKNKPDFCALFIICGGKQLSIRGENNKGIME  180

Query  977   DEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADK--EKRscdspsssssssvSNGLADQ  804
             D+ G  + + REK      FK  L +I +P       E+      SSSS +  S     Q
Sbjct  181   DDQGVTVAKLREKG----SFKDWLGKIFIPNPPQNSLERNPRRVLSSSSINLDSPSTQSQ  236

Query  803   WEKNQSEIELYLSQLSSSKTD---CDAANDPLEDCVK--EPTMPE----NMTTKERIEAL  651
             WE    EIE Y   L S   D   CD  ++  +      E   PE    ++T  E+I++L
Sbjct  237   WESYAQEIEDYFQHLLSLNLDEEACDKEDESFQQISPRVESGTPEHADCDLTAAEKIDSL  296

Query  650   KAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEEL  471
             K K++E Q+ +Q  + EAKA  ERQAKAE AI LC  RAE+L+A I EE++ R  + E+L
Sbjct  297   KRKLKEAQKTIQSKRIEAKANAERQAKAERAILLCNHRAEELQARIKEEVSTRTEVNEDL  356

Query  470   DSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMV  291
             D+ KE L E+  E+EE +++LNS+ EL+ EL++K+Q+S+  KSHAE QLE++V  R++MV
Sbjct  357   DTEKEHLNEILAEIEESKSRLNSLTELKNELSNKLQISTLAKSHAEAQLEKSVSMRSEMV  416

Query  290   QGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRL  111
             + IE LR+QRDVL+RRIEFC+EKDAIG   +  E S   ++++A +IR ATN FSER RL
Sbjct  417   REIEELRQQRDVLQRRIEFCREKDAIGMVAKFTETSCGFKEYTAEQIRLATNGFSERLRL  476

Query  110   KCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             K GG+WT VY+G +N   VAIK+      +S E FQ
Sbjct  477   KPGGDWTTVYRGRINHSTVAIKILDSVNGMSPEDFQ  512



>ref|XP_006426255.1| hypothetical protein CICLE_v10024909mg [Citrus clementina]
 gb|ESR39495.1| hypothetical protein CICLE_v10024909mg [Citrus clementina]
Length=808

 Score =   368 bits (944),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 235/510 (46%), Positives = 334/510 (65%), Gaps = 20/510 (4%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTIC-RDYVYTPIGRLPSSS  1326
             +E +VYV +G D+ DG+++L+W LR   +QS +I+IL+    I  +D+VYTP G+LP++S
Sbjct  4     EEPKVYVAVGNDLQDGYRTLDWTLRKWKAQSISIVILHVTYNISIKDFVYTPFGKLPATS  63

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             +++EKL+ L KYE+ KTD +L+ Y+ FCGKVKAEILK+++ D  + K+++DL+S L ITK
Sbjct  64    LSDEKLEILKKYEQGKTDNLLSKYMGFCGKVKAEILKVEKSDEPVHKLILDLVSRLTITK  123

Query  1145  LVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             LV+ L+FMKP   KSR+A+ G + +H+  PD+CELF++ GGKLV L  EN E +++D+ G
Sbjct  124   LVMGLSFMKPSAGKSRTAVSGSYFVHHHMPDYCELFIICGGKLVSLKGENDEGIMEDDQG  183

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
                 + RE+      F  L  ++      +  + S  S    + S  S      WE    
Sbjct  184   VKFAKMRERV----NFGNLWTKMFSGNGRNPNRLSICSRGPDADSPYSRS---TWENCVQ  236

Query  785   EIELYLSQLSSSKTDCDAAN-----DPLEDCVKEPTMPE----NMTTKERIEALKAKIRE  633
             EIE+Y   L+S   D DA+N     + L+    EP   E    NM+  ER E +K+KI E
Sbjct  237   EIEIYFQHLASFNLD-DASNSEDGDEILQTRAIEPNAAEQIDSNMSVAERTEFMKSKINE  295

Query  632   VQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKee  453
              +++++L KKE K   ER AKA+WAI LC SRA+ LE+   E++A R  ++ +LDS KE+
Sbjct  296   AREMIRLKKKETKDDAERCAKAKWAICLCNSRADQLESLTKEDVASRMEIQRDLDSLKEQ  355

Query  452   lyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENL  273
               E+  +VEE + +L+S++ELQ EL++K+QLS+  K HAE QLE+AV  R ++V+ IE L
Sbjct  356   SCEVIRDVEESKNRLSSLIELQSELSNKLQLSTMAKGHAEAQLEKAVIARAEIVKDIEEL  415

Query  272   rrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW  93
             RRQRDVL RRIEFCKEKDAIG   R  E S   R+++A +IR AT +FSER RLKC G+W
Sbjct  416   RRQRDVLHRRIEFCKEKDAIGMVIRSSELSCAFREYAAEDIRLATEDFSERFRLKCAGDW  475

Query  92    TNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             TNVY+G LN   VAIK  +    LSEE FQ
Sbjct  476   TNVYRGRLNHASVAIKTLN--NGLSEEDFQ  503



>ref|XP_006466325.1| PREDICTED: putative U-box domain-containing protein 50-like [Citrus 
sinensis]
Length=808

 Score =   367 bits (941),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 231/509 (45%), Positives = 332/509 (65%), Gaps = 18/509 (4%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTIC-RDYVYTPIGRLPSSS  1326
             +E +VYV +G D+ DG+++L+W +R   +QS +I+IL+    I  +D+VYTP G+LP++S
Sbjct  4     EEPKVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIKDFVYTPFGKLPATS  63

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             +++EKL+ L KYE+ KTD +L+ Y+ FCGKVKAEILK+++ D  + K+++DL+S L ITK
Sbjct  64    LSDEKLEILKKYEQGKTDNLLSKYLGFCGKVKAEILKVEKSDEPVHKLILDLVSRLTITK  123

Query  1145  LVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             LV+ L+FM P   KSR+A+ G + +H+  PD+CELF++ GGKLV L  EN E +++D+ G
Sbjct  124   LVMGLSFMIPSAGKSRTAVSGSYFVHHHMPDYCELFIICGGKLVSLKGENDEGIMEDDQG  183

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
                 + RE+      F  L  ++      +  + S  S    + S  S      WE    
Sbjct  184   VKFAKMRERV----NFGNLWTKMFSGNGRNPNRLSICSRGPDADSPYSQS---TWENCVQ  236

Query  785   EIELYLSQLSSSKTD----CDAANDPLEDCVKEPTMPE----NMTTKERIEALKAKIREV  630
             EIE+Y   LSS   D     +  ++ L+    EP   E    NM+  ER E +K+KI E 
Sbjct  237   EIEIYFQHLSSLNLDEASNSEDGDEILQTLAIEPNAAEQIDSNMSVAERTEFMKSKINEA  296

Query  629   QQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeel  450
             +++++L KKE +   ER AKA+WAI LC SRA+ LE+   E++A R  ++ +LDS KE+ 
Sbjct  297   REMIRLKKKETRDDAERCAKAKWAICLCNSRADQLESLTKEDVASRMEIQRDLDSLKEQS  356

Query  449   yelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLr  270
              E+  +VEE + +L+S++ELQ EL++K+QLS+  K HAE QLE+AV  R +MV+ IE LR
Sbjct  357   CEVIRDVEESKNRLSSLIELQSELSNKLQLSTMAKGHAEAQLEKAVIARAEMVKDIEELR  416

Query  269   rqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWT  90
             RQRDVL RRIEFCKEKDAIG   R  E S   R+++A +IR AT +FSER RLKC G+WT
Sbjct  417   RQRDVLHRRIEFCKEKDAIGMVIRSSELSCAFREYTAEDIRLATEDFSERFRLKCAGDWT  476

Query  89    NVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             NVY+G LN   VAIK+ +    LSEE FQ
Sbjct  477   NVYRGRLNHASVAIKMLN--NGLSEEDFQ  503



>ref|XP_008368019.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X1 [Malus domestica]
Length=803

 Score =   366 bits (939),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 225/498 (45%), Positives = 329/498 (66%), Gaps = 5/498 (1%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G D+ DGF++LEW L+  +S+  +I+IL+  + I +++VYTP G+LP+SSV++
Sbjct  6     EKVYVAVGNDIEDGFKTLEWTLKKWNSKPISIVILHVTHNISQEFVYTPFGKLPASSVSD  65

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKLK   KYE+ K D++L+ YI+FCG+VKAE+L++++ +  I  ++ +LI   +ITKLV+
Sbjct  66    EKLKVFIKYEQEKIDELLSKYISFCGQVKAELLRVEKCEQXIHTVVTELILRHKITKLVI  125

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
                F+K   W+ +SA+ G F++HN KPDFCELFV+ GG+ VFL  EN + VI+D+ G  +
Sbjct  126   GFPFLKSSSWRMKSAVSGSFYVHNHKPDFCELFVICGGRRVFLRGENSKGVIEDDQGVTV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              + REK      FK  L ++     A             S++  S    +Q      E+E
Sbjct  186   AKIREKS----SFKAWLAKMFNENPAYSLDTISHPSLGFSTNPYSXSSQNQRGNCVHELE  241

Query  776   LYLSQLSSSKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQQVVQLNKKEA  597
              Y   L S K D    N+P E    E     +M   E IE+ K  ++E Q++++L +KEA
Sbjct  242   NYFQHLLSLKMDEGXHNNPXELATPEHA-DSDMIAAEDIESRKKTLKEAQEMIKLKRKEA  300

Query  596   KAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqteveEKR  417
             KA +ER  KA+ AI LC  RAE LEA INEE  KR  L++ LDS KE+L+E+  + EE +
Sbjct  301   KANLERSTKAQRAISLCNRRAEQLEAKINEEATKREELKKALDSEKEQLHEVILDTEESK  360

Query  416   AKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIE  237
              +L+S+LELQ EL++K+Q+S+  KS++E QLE+AV TR +MV+ IE LR+QRDVL RRIE
Sbjct  361   NRLSSLLELQFELSNKLQISTFAKSNSEAQLEKAVSTRAEMVREIEELRQQRDVLHRRIE  420

Query  236   FCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSER  57
             FCKEKDAIG   RL + S   ++++A EIR ATN+FSER R+K GG+WT++Y+G +N   
Sbjct  421   FCKEKDAIGMVARLSDTSCGFKEYTAEEIRLATNDFSERLRIKPGGDWTSIYRGRINHAT  480

Query  56    VAIKLYHKSTSLSEETFQ  3
             VAIK+ +    LS++ FQ
Sbjct  481   VAIKMLNSGNELSKQDFQ  498



>ref|XP_003613040.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES95998.1| U-box kinase family protein [Medicago truncatula]
Length=808

 Score =   364 bits (935),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 233/508 (46%), Positives = 340/508 (67%), Gaps = 20/508 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E++YV +G+D  DGF +L W L+   S   +I+IL+  + I ++YVYTP G+LP+ S+N+
Sbjct  7     EKIYVAVGDDAQDGFNTLNWALKKWKSHPISIVILHVTHNISKEYVYTPFGKLPARSLND  66

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L K E+ +  K+ + YIAFCGKV AEIL++++ D  ++K ++DLI+ L+ITKLV+
Sbjct  67    EKLEALRKDEKERIKKLFSKYIAFCGKVSAEILEVKKFDEPMQKRVIDLITELEITKLVM  126

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               +FMKP L KS+ A+ GLF++H  KP  CELF++ GGK VFL   N E +++D+ G ++
Sbjct  127   GFSFMKPSL-KSKGAISGLFYVHQHKPSLCELFIICGGKQVFLRGNNDEKIMEDDSGVMV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              + R+K      FK  L+++     +DK          S+S S +N + +QWE    +IE
Sbjct  186   AKMRDKVT----FKDWLDKM----FSDKTN-YYSQNRLSASPSSTNLVQNQWEFYLQDIE  236

Query  776   LYLSQLSSSKTDCDAA---NDPLEDCVK-EPTMPE----NMTTKERIEALKAKIREVQQV  621
              Y  +L SS  +  +    ND L  C K EP + +    N +T E+IE LK K+ E ++ 
Sbjct  237   NYYQELLSSNLEEGSYVQENDGLHVCPKFEPHVTDLNNSNKSTAEKIEMLKNKLNEARKT  296

Query  620   VQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyel  441
             ++L +KEAK  +ER+ KAEWAI LC SRAE++E  I EE++ + +L +EL   KE+  E+
Sbjct  297   IELKRKEAKENIERRTKAEWAISLCNSRAEEIEGRIREEVSTKENLNKELQLEKEQREEM  356

Query  440   qteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqr  261
             +TE++EK+ ++NS++ELQ EL++K+QLS+  +S AE Q+ERAVR RT+MV+ IE LR+QR
Sbjct  357   RTEIKEKKQRMNSLVELQSELSNKLQLSTMARSRAETQVERAVRERTEMVREIEELRKQR  416

Query  260   dvlrrRIEFCKEKDAIGEAKRLGE--PSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTN  87
             DVL RRIEFCK+KDAIG A RL +   S   R++S  E+R AT+ FSER RLK G +WTN
Sbjct  417   DVLNRRIEFCKQKDAIGMAARLSDNITSIGMREYSEEELRLATDNFSERLRLKSGRDWTN  476

Query  86    VYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             VY+G  N   VAIK+     SLS+E FQ
Sbjct  477   VYRGRFNHSTVAIKMMSSFHSLSQEEFQ  504



>gb|KHN04923.1| Putative U-box domain-containing protein 50 [Glycine soja]
Length=799

 Score =   364 bits (934),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 239/506 (47%), Positives = 339/506 (67%), Gaps = 21/506 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E++YV +G DV DG+++L W L+  +S   +I+IL+  +   +DYV+TP G+LP+ SV+E
Sbjct  7     EKIYVAVGNDVQDGYKTLNWALKKWNSHPISIVILHLTHNSTKDYVHTPFGKLPARSVSE  66

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L K E+ K +K+L+ YIAFCGKV AEIL++++ D  ++K ++DLI  L ITKLV+
Sbjct  67    EKLQILRKDEQDKINKLLSKYIAFCGKVPAEILEVEKFDEPMQKRVIDLIFGLGITKLVM  126

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               +FMKP + KS+ A+ GLFH+H QKP FCELFV+ GGK VFL  +N E +++D+ G ++
Sbjct  127   GFSFMKPSM-KSKGAINGLFHVHEQKPSFCELFVICGGKQVFLRGKNDEKIMEDDQGVMV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              R R+K      FK  L++    +  D + R     SS+  S V+    +QWE    EIE
Sbjct  186   ARMRDKIT----FKDWLDKWFKDKTNDSQDRIASLSSSNLESPVNR---NQWEFYLQEIE  238

Query  776   LYLSQLSSSKTD---CDAANDPLEDCVKEPTMPE----NMTTKERIEALKAKIREVQQVV  618
              Y  +L SSK +   C   ND  +    EP + E    NM+T+E+IE LK K+ E Q+ +
Sbjct  239   NYYQELLSSKPEEGSCVQENDDSQIGPIEPHVTEQNNYNMSTEEKIEILKNKLNEGQKNI  298

Query  617   QLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelq  438
             QL +KEAK  +ER  KAEWAI LC SRAE+LE+ I EE++ R  L++E D+ KE+  E++
Sbjct  299   QLKRKEAKDNIERHTKAEWAICLCNSRAEELESRIREEVSAREELKKESDAEKEQTEEMR  358

Query  437   teveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrd  258
             TEVEE++ +L+S+ E+Q EL++++Q+ +  K  AE QLE+AV  R +M + IE LRRQRD
Sbjct  359   TEVEERKRRLSSLTEVQSELSNRLQIWTLAKIRAETQLEKAVGERREMGREIEELRRQRD  418

Query  257   vlrrRIEFCKEKDAIGEAKRLGEPS-FCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVY  81
             VL RRIEFCK+KDAIG A  L E + F  R+++  E+R AT+ FSER RLK GG+WTNVY
Sbjct  419   VLNRRIEFCKQKDAIGMA--LAETTFFAFREYTEEELRLATDNFSERLRLKSGGDWTNVY  476

Query  80    KGCLNSERVAIKLYHKSTSLSEETFQ  3
             +G  N   VAIK+     SLS + FQ
Sbjct  477   RGRFNHSTVAIKML---PSLSPQHFQ  499



>gb|KDO60541.1| hypothetical protein CISIN_1g003594mg [Citrus sinensis]
Length=808

 Score =   364 bits (934),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 233/510 (46%), Positives = 333/510 (65%), Gaps = 20/510 (4%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTIC-RDYVYTPIGRLPSSS  1326
             +E +VYV +G D+ DG+++L+W +R   +QS +I+IL+    I  +D+VYTP G+LP++S
Sbjct  4     EEPKVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIKDFVYTPFGKLPATS  63

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             +++EKL+ L KYE+ KTD +L+ Y+ FCGKVKAEILK+++ D  + K+++DL+S L ITK
Sbjct  64    LSDEKLEILKKYEQGKTDNLLSKYLGFCGKVKAEILKVEKSDEPVHKLILDLVSRLTITK  123

Query  1145  LVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             LV+ L+FM P   KSR+A+ G + +H+  PD+CELF++ GGKLV L  EN E +++D+ G
Sbjct  124   LVMGLSFMIPSAGKSRTAVSGSYFVHHHMPDYCELFIICGGKLVSLKGENDEGIMEDDQG  183

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
                 + RE+      F  L  ++      +  + S  S    + S  S      WE    
Sbjct  184   VKFAKMRERV----NFGNLWTKMFSGNGRNPNRLSICSRGPDADSPYSRS---TWENCVQ  236

Query  785   EIELYLSQLSSSKTDCDAAN-----DPLEDCVKEPTMPE----NMTTKERIEALKAKIRE  633
             EIE+Y   L+S   D DA+N     + L+    EP   E    NM+  ER E +K+KI E
Sbjct  237   EIEIYFQHLASFNLD-DASNSEDGDEILQTRAIEPNAAEQIDSNMSVAERTEFMKSKINE  295

Query  632   VQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKee  453
              +++++L KKE K   ER AKA+WAI LC SRA+ LE+   E++A R  ++ +LDS KE+
Sbjct  296   AREMIRLKKKETKDDAERCAKAKWAICLCNSRADQLESLTKEDVASRMEIQRDLDSLKEQ  355

Query  452   lyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENL  273
               E+  +VEE + +L+S++ELQ EL++K+QLS+  K HAE QLE+AV  R ++V+ IE L
Sbjct  356   SCEVIRDVEESKNRLSSLIELQSELSNKLQLSTMAKGHAEAQLEKAVIARAEIVKDIEEL  415

Query  272   rrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW  93
             RRQRDVL RRIEFCKEKDAIG   R  E S   R+++A +IR AT +FSER RLKC G+W
Sbjct  416   RRQRDVLHRRIEFCKEKDAIGMVIRSSELSCAFREYAAEDIRLATEDFSERFRLKCAGDW  475

Query  92    TNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             TNVY+G LN   VAIK  +    LSEE FQ
Sbjct  476   TNVYRGRLNHASVAIKTLN--NGLSEEDFQ  503



>ref|XP_004288524.1| PREDICTED: putative U-box domain-containing protein 50-like [Fragaria 
vesca subsp. vesca]
Length=798

 Score =   363 bits (931),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 222/505 (44%), Positives = 335/505 (66%), Gaps = 23/505 (5%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             + E+VYV +G D+ DGF++LEW L+  +SQ  +I+IL+ A+ I +D++YTP G+LP+SS+
Sbjct  4     RAEKVYVAVGNDIQDGFKTLEWTLKKWNSQLISIVILHVAHDISKDFIYTPFGKLPASSM  63

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             N+EKL+ L KYE+ KTDK+L  Y+AFCG+VKAEIL +++ +  I K+++DLI   QIT+L
Sbjct  64    NDEKLEVLMKYEQKKTDKLLRKYLAFCGQVKAEILTVEKCEQPIHKVIMDLILRHQITRL  123

Query  1142  VLSLTFMK-PLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             ++  TF+K    W+ +SA+   F+IH+ KPDFCELFV+ GG+LVFL  EN +  ++D+ G
Sbjct  124   IMGFTFLKTSSTWRIKSAVSAAFYIHHHKPDFCELFVICGGRLVFLRGENDKGTMEDDQG  183

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
              ++ + REK      FK  L ++        E  +     ++++++      + WE +  
Sbjct  184   VIVAKLREKA----SFKGWLAKMF------NETSATSPDGTTANANSPTNSQNSWECHVQ  233

Query  785   EIELYLSQLSSSKTDCDAANDPLEDCVKE-PTMPENMTTKERIEA--LKAKIREVQQVVQ  615
             EIE Y   L S K +        EDC +E   +P N    + I A  +K K++E Q +++
Sbjct  234   EIEDYFQHLLSLKLE--------EDCEQEKDDVPNNPMESDMIAAEDMKTKLKEAQDIIE  285

Query  614   LNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqt  435
             L +KEA+A  +RQ KA+WAI LC  RAE+LEA I EE+  RA L++ LD  KE+L+E+ T
Sbjct  286   LKRKEARANADRQTKAQWAISLCNFRAEELEAQIKEELKNRAELKKTLDCEKEQLHEVVT  345

Query  434   eveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdv  255
             +  E  ++LNS++ELQ EL++K+Q+++  KS+ E QLE A+ TR +MV+ IE LR+ RDV
Sbjct  346   DTGESNSRLNSLMELQFELSNKLQITTSAKSNTESQLEMAISTREEMVREIEELRQHRDV  405

Query  254   lrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW-TNVYK  78
             L RRIEFCKEKD IG   RL + S   ++++A EIR ATN FSER R+K GG+W T +Y+
Sbjct  406   LLRRIEFCKEKDVIGMVGRLTDTSCGFKKYTAEEIRLATNNFSERLRIKPGGDWNTTMYR  465

Query  77    GCLNSERVAIKLYHKSTSLSEETFQ  3
             G +N   VAIK+ + +   S++ F+
Sbjct  466   GRINHATVAIKILNYAKGESKQDFK  490



>ref|XP_009364813.1| PREDICTED: putative U-box domain-containing protein 50 [Pyrus 
x bretschneideri]
Length=803

 Score =   360 bits (923),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 220/498 (44%), Positives = 326/498 (65%), Gaps = 5/498 (1%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G D+ DGF++LEW L+  +S+  +I++L+    I +++VYTP G+LP+SSV++
Sbjct  6     EKVYVAVGNDIEDGFKTLEWTLKKWNSKPISIVLLHVTYNISQEFVYTPFGKLPASSVSD  65

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKLK   KYE+ + D++L+ YI+FCG+VKAE+L++++ +  I  ++ DLI    ITKLV+
Sbjct  66    EKLKVFIKYEQERIDELLSKYISFCGQVKAELLRVEKCEQPIHTVVTDLIRRHNITKLVI  125

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
                F+K   W+ +SA+ G F++H+ KPDFCELF++ GG+ VFL  EN + VI+D+ G  +
Sbjct  126   GFPFLKSSSWRMKSAVSGSFYVHHHKPDFCELFIICGGRRVFLRGENSKGVIEDDQGVTV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              + REK      FK  L ++     A             S++  S+   +Q      E+E
Sbjct  186   AKIREKS----SFKAWLAKMFNENPAYSLDTISHPSLGFSTNPYSSSSQNQRGNCVQELE  241

Query  776   LYLSQLSSSKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQQVVQLNKKEA  597
              Y   L S K D    N  +E    E     +M   E IE+ K  ++E Q +++L +KEA
Sbjct  242   NYFQHLLSLKMDEGVHNSRMELTTPEHA-DSDMIAAEDIESRKKTLKEAQDMIKLKRKEA  300

Query  596   KAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqteveEKR  417
             KA +ER  KA+ AI LC  RAE LEA INEE  KR  L++ LDS KE+L+E+  + EE +
Sbjct  301   KANLERSTKAQRAISLCNRRAEQLEAKINEEATKREELKKALDSEKEQLHEVIMDTEESK  360

Query  416   AKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIE  237
              +L+S++ELQ EL++K+Q+S+  KS++E QLE+AV TR +MV+ IE LR+QRDVL RRIE
Sbjct  361   NRLSSLMELQFELSNKLQISTFAKSNSEAQLEKAVSTRAEMVREIEELRQQRDVLHRRIE  420

Query  236   FCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSER  57
             FCKEKDAIG   RL + S   ++++A EIR ATN+FSER R+K GG+WT++Y+G +N   
Sbjct  421   FCKEKDAIGMVARLSDTSCGFKEYTAEEIRLATNDFSERLRIKPGGDWTSIYRGRINHAT  480

Query  56    VAIKLYHKSTSLSEETFQ  3
             VAIK+ +    LS++ FQ
Sbjct  481   VAIKMLNSGNELSKQDFQ  498



>gb|KHN38882.1| Putative U-box domain-containing protein 50 [Glycine soja]
Length=800

 Score =   359 bits (922),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 229/506 (45%), Positives = 333/506 (66%), Gaps = 19/506 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E++YV +G DV DG ++L W L+  +S   +I +L+  +   +DYVYTP G+LP+ SV+E
Sbjct  7     EKIYVAVGNDVQDGLKTLNWALKKWNSHPISIAVLHVTHNSTKDYVYTPFGKLPARSVSE  66

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L K E+ K +K+L+ YIAFCGKV AEIL++++ D  ++K ++DLI  L ITKLV+
Sbjct  67    EKLQILRKDEQDKINKLLSKYIAFCGKVPAEILEVEKFDEPMQKRVIDLIFGLGITKLVM  126

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               +FMKP + KS+ A+ GLF++H  KP FCELF++ GGK VFL  +N E +++D+ G + 
Sbjct  127   GFSFMKPSM-KSKGAISGLFYVHQHKPSFCELFIICGGKQVFLRGKNDEKIMEDDRGVMS  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              R R+K      FK  L++    +  D + RS    S++  S ++    +QWE    EIE
Sbjct  186   ARMRDKVT----FKDWLDKWFNDKTNDSQDRSTSLSSTNLESPLNQ---NQWEFYLQEIE  238

Query  776   LYLSQLSSS---KTDCDAANDPLEDCVKEPTMPE----NMTTKERIEALKAKIREVQQVV  618
              Y  +L SS   + +C   ND  +    EP + E    +M+  ++IE LK K+ E Q+++
Sbjct  239   KYYQELLSSNLEEGNCVLENDDSQIGPIEPHVTEHNNYDMSAADKIEILKNKLNEAQKII  298

Query  617   QLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelq  438
             QL +KEAK  +ER  KAEWAI LC SRAE+LE+ I EE + R  L++E D+ KE+  E++
Sbjct  299   QLKRKEAKDNIERHTKAEWAICLCNSRAEELESRIREEASAREELKKESDAEKEQTVEMK  358

Query  437   teveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrd  258
             TE+EE++  L S+ E+Q EL++++Q+ +  K+ AE QLE+AV  R++MV+ IE LRRQRD
Sbjct  359   TELEERKRSLRSLTEVQSELSNRLQIWTLAKTRAETQLEKAVGERSEMVREIEELRRQRD  418

Query  257   vlrrRIEFCKEKDAIGEAKRLGEPSFCC-RQFSAAEIRAATNEFSERQRLKCGGNWTNVY  81
             V  RRIEFCKEKDAIG A  L E + C  R+++  E+R AT+ FS+R R K GG+WTNVY
Sbjct  419   VFNRRIEFCKEKDAIGMAASLAEMTCCAFREYTEEELRLATDNFSDRLRFKSGGDWTNVY  478

Query  80    KGCLNSERVAIKLYHKSTSLSEETFQ  3
             +G  N   VAIK+     SLS + FQ
Sbjct  479   RGRFNHSSVAIKML---PSLSHQHFQ  501



>ref|XP_006587575.1| PREDICTED: putative U-box domain-containing protein 50-like isoform 
X1 [Glycine max]
Length=800

 Score =   359 bits (922),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 229/506 (45%), Positives = 333/506 (66%), Gaps = 19/506 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E++YV +G DV DG ++L W L+  +S   +I +L+  +   +DYVYTP G+LP+ SV+E
Sbjct  7     EKIYVAVGNDVQDGLKTLNWALKKWNSHPISIAVLHVTHNSTKDYVYTPFGKLPARSVSE  66

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L K E+ K +K+L+ YIAFCGKV AEIL++++ D  ++K ++DLI  L ITKLV+
Sbjct  67    EKLQILRKDEQDKINKLLSKYIAFCGKVPAEILEVEKFDEPMQKRVIDLIFGLGITKLVM  126

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               +FMKP + KS+ A+ GLF++H  KP FCELF++ GGK VFL  +N E +++D+ G + 
Sbjct  127   GFSFMKPSM-KSKGAISGLFYVHQHKPSFCELFIICGGKQVFLRGKNDEKIMEDDRGVMS  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              R R+K      FK  L++    +  D + RS    S++  S ++    +QWE    EIE
Sbjct  186   ARMRDKVT----FKDWLDKWFNDKTNDSQDRSTSLSSTNLESPLNQ---NQWEFYLQEIE  238

Query  776   LYLSQLSSS---KTDCDAANDPLEDCVKEPTMPE----NMTTKERIEALKAKIREVQQVV  618
              Y  +L SS   + +C   ND  +    EP + E    +M+  ++IE LK K+ E Q+++
Sbjct  239   KYYQELLSSNLEEGNCVLENDDSQIGPIEPHVTEHNNYDMSAADKIEILKNKLNEAQKII  298

Query  617   QLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelq  438
             QL +KEAK  +ER  KAEWAI LC SRAE+LE+ I EE + R  L++E D+ KE+  E++
Sbjct  299   QLKRKEAKDNIERHTKAEWAICLCNSRAEELESRIREEASAREELKKESDAEKEQTVEMK  358

Query  437   teveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrd  258
             TE+EE++  L S+ E+Q EL++++Q+ +  K+ AE QLE+AV  R++MV+ IE LRRQRD
Sbjct  359   TELEERKRSLRSLTEVQSELSNRLQIWTLAKTRAETQLEKAVGERSEMVREIEELRRQRD  418

Query  257   vlrrRIEFCKEKDAIGEAKRLGEPSFCC-RQFSAAEIRAATNEFSERQRLKCGGNWTNVY  81
             V  RRIEFCKEKDAIG A  L E + C  R+++  E+R AT+ FS+R R K GG+WTNVY
Sbjct  419   VFNRRIEFCKEKDAIGMAASLAEMTCCAFREYTEEELRLATDNFSDRLRFKSGGDWTNVY  478

Query  80    KGCLNSERVAIKLYHKSTSLSEETFQ  3
             +G  N   VAIK+     SLS + FQ
Sbjct  479   RGRFNHSSVAIKML---PSLSHQHFQ  501



>gb|KDP29773.1| hypothetical protein JCGZ_18708 [Jatropha curcas]
Length=834

 Score =   348 bits (892),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 231/534 (43%), Positives = 335/534 (63%), Gaps = 47/534 (9%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILY-AANTICRDYVYTP----------  1350
             E+VYV +G D+ DGF++L+W +R       +I+IL+ ++N I +D+VYTP          
Sbjct  6     EKVYVILGNDLQDGFKTLDWTIRKWKPNPISIVILHLSSNNISKDFVYTPCEFHYQNLSS  65

Query  1349  --------------------------IGRLPSSSVNeeklkdldkyeeaKTDKILANYIA  1248
                                       +G+LP+SSV+EEKL+ L KYE+ K +K+L+ +I 
Sbjct  66    LSCSSLELRSYYCRYYYVLILLEQISVGKLPASSVSEEKLQVLRKYEQEKIEKLLSKFIT  125

Query  1247  FCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIH  1068
             FCGKVKAEILK+++ D  I ++++DLIS  +ITKLVL LTF++   W+S++A+ G F++H
Sbjct  126   FCGKVKAEILKVEKSDEPIHRVIIDLISRHKITKLVLGLTFLRSSSWRSKNAISGSFYVH  185

Query  1067  NQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLP  888
               KP+FCELF++ GGKLVFL  EN E+V++D+ G  + +       K   K  L +I LP
Sbjct  186   QHKPNFCELFIICGGKLVFLRRENEEAVMEDDQGSNVTK-------KGNIKSWLGKI-LP  237

Query  887   EIADKEKRscdspsssssssvSNGLADQWEKNQSEIELYLSQLSSSKTDCDAANDPLEDC  708
             +  +   R     +SS      N L  QWE    EI+ Y   L S  +D +      +D 
Sbjct  238   D-HNSLGRHSRMSASSKGFDSPN-LRTQWENCVLEIQNYYEHLLSLNSDEEGREKESDDI  295

Query  707   VKEPTMPENMTTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAED  528
             + +    E   T+     +++KI E +++++L K+EAKA  ER AKAEWAI LC SR E+
Sbjct  296   LLQVGPLERGVTEPTNSIMRSKINEAKKIIRLKKEEAKANAERSAKAEWAISLCNSRVEE  355

Query  527   LEACINEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQE  348
             LE  I EE+  +  +++ LD+ KE++ E+ +++ E + +L SILELQ EL+SK+QLSS  
Sbjct  356   LEDRIKEEVTSQIEIKKRLDNEKEDIQEIISDIAENKNRLKSILELQSELSSKLQLSSIA  415

Query  347   KSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQ  168
             +S+AE QLE+AV  R +MV+ IE LRRQRDVL+RRIEFCKEKDAIG  K+L   S   R+
Sbjct  416   RSNAETQLEKAVTIRAEMVREIEELRRQRDVLQRRIEFCKEKDAIGMVKKLNALSCGYRE  475

Query  167   FSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             +SA +IR AT+ FS+  RLK GG+WTNVY+G L++  VAIKL +    LS+E F
Sbjct  476   YSAEDIRLATDSFSDNLRLKSGGDWTNVYRGRLHNSTVAIKLLNSDRGLSQEDF  529



>ref|XP_009364827.1| PREDICTED: putative U-box domain-containing protein 50 [Pyrus 
x bretschneideri]
Length=800

 Score =   345 bits (886),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 224/509 (44%), Positives = 326/509 (64%), Gaps = 23/509 (5%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTIC-RDYVYTPIGRLPSSSVN  1320
             E+VYV +G ++ DGF +L W LR   SQ  +I+IL+   +I  +DYVYTP G+LP+SSV+
Sbjct  6     EKVYVALGNELQDGFNTLAWTLRRWKSQPISIVILHVTYSISGKDYVYTPFGKLPASSVS  65

Query  1319  eeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
             +EKLK L +YE+ K D IL+ YIAFCGKVKAEILK++++D SI K+++DLIS L ITKLV
Sbjct  66    DEKLKVLKRYEQKKMDNILSKYIAFCGKVKAEILKVEQNDESIHKLILDLISGLHITKLV  125

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGV  960
             +  TF+K   W++++A+  LF+IH  K + CELF+++GGK +FL  EN + + +D  G +
Sbjct  126   IGFTFIKSSSWRTKTAISMLFYIHEHKTESCELFIIYGGKELFLRGENDQRIQEDGKGVM  185

Query  959   IGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEI  780
             + + ++K      FK +LE++ L      E R     S +   S    L + WE    E+
Sbjct  186   VAKKKDKV----SFKFMLEKMFL------ENRHSLFGSPTKKDSA--NLQNLWENCVQEM  233

Query  779   ELYLSQLSSSKT--DCDAAN--------DPLEDCVKEPTMPENMTTKERIEALKAKIREV  630
             E+Y  QL S+    +CD  N         P E  + +     NM++ E+IE L+  I   
Sbjct  234   EIYYQQLCSNLDVENCDQGNGTGTSQQPSPTEAIMLQINGNPNMSSAEKIEFLRKTISVT  293

Query  629   QQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeel  450
             + ++++ KKEAK   ++ AKAE AI LC  RA++L+  I EE   R  L +ELD+ KE+L
Sbjct  294   RGMIRMKKKEAKENADKHAKAERAICLCERRAQELDVQIKEEGDNRRELNKELDTEKEQL  353

Query  449   yelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLr  270
             + +  E+EE R K+ S++ELQ EL+ K+ +S   KS AE+QLE  V   T M + IE +R
Sbjct  354   HVVVNEIEESRNKMKSLIELQYELSHKLHMSKMAKSQAEVQLENEVMQCTDMEREIEVIR  413

Query  269   rqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWT  90
             R+RDV RRRIEFC+++DA G A+ LGE S C R+++  EI+ ATNEFSER RLK G + +
Sbjct  414   RERDVFRRRIEFCRQQDATGTAEGLGELSCCLREYTDEEIKQATNEFSERFRLKSGSDLS  473

Query  89    NVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             +VYKG +N   V IK+ + +  LS+E FQ
Sbjct  474   SVYKGRINHVTVGIKVLNPANGLSQEDFQ  502



>ref|XP_007158363.1| hypothetical protein PHAVU_002G146600g [Phaseolus vulgaris]
 gb|ESW30357.1| hypothetical protein PHAVU_002G146600g [Phaseolus vulgaris]
Length=803

 Score =   345 bits (884),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 226/505 (45%), Positives = 331/505 (66%), Gaps = 18/505 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G D  DGF++L W L+  +S   +++IL+  ++   D VYTP G+LP+ SV+E
Sbjct  7     EKVYVAVGNDAQDGFKTLNWALKKWNSHPISVVILHVTHSTPMDCVYTPFGKLPARSVSE  66

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L K E+ K +K+L+ Y+AFCGKV A+IL++++ D  ++K ++DLI  L ITKLV+
Sbjct  67    EKLQILRKDEQEKINKLLSKYVAFCGKVPADILEVEKSDEPLQKRVIDLIFGLGITKLVM  126

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               +FMKP + KS+ A+ GLF++H  KP FCELF++ GGK +FL  +N E +++D+ G ++
Sbjct  127   GFSFMKPSM-KSKGAISGLFYVHQHKPSFCELFIICGGKQIFLSGKNDEKIMEDDQGVMV  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              R R+K      FK  L++    +  D   +S    SS+  S V+    ++WE    EIE
Sbjct  186   ARIRDKIT----FKDWLDKWFHDKTNDSLDKSESLSSSNLESPVNR---NRWEFYLQEIE  238

Query  776   LYLSQLSSSK---TDCDAANDPLEDCVKEPTMPE----NMTTKERIEALKAKIREVQQVV  618
              Y  +L SSK    +C   ND  +    EP + E    N +  E+IE LK+K+ E Q+ +
Sbjct  239   NYYQELLSSKLEEGNCGLDNDESQIGPNEPHVTEHNNYNKSGAEKIEILKSKLNEAQKTI  298

Query  617   QLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelq  438
              L +KEAK   ER AKAEWAI LC SRAE++E  I EE++ +  L +E ++ +E+  E++
Sbjct  299   LLKRKEAKDSKERHAKAEWAICLCNSRAEEVEGRIREEVSAKEELRKEWEAEREQTEEMR  358

Query  437   teveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrd  258
              EVEE+R +L+S+ E+Q EL++++Q+ +  K+ AE QLERAV  R +MV+ IE LRRQRD
Sbjct  359   MEVEERRRRLSSLTEVQSELSNRLQIWTLSKTRAETQLERAVGERREMVREIEELRRQRD  418

Query  257   vlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYK  78
             VL RRIEFCK+KDAIG A RL +     R+++A E+R AT+ FSER RLK GG+W+NVY+
Sbjct  419   VLNRRIEFCKQKDAIGMAARLADTCCTFREYTAEEVRLATDNFSERLRLKSGGDWSNVYR  478

Query  77    GCLNSERVAIKLYHKSTSLSEETFQ  3
             G  N   VAIK+     S S + FQ
Sbjct  479   GRFNHSTVAIKML---PSFSLQHFQ  500



>ref|XP_007207568.1| hypothetical protein PRUPE_ppa018581mg [Prunus persica]
 gb|EMJ08767.1| hypothetical protein PRUPE_ppa018581mg [Prunus persica]
Length=798

 Score =   339 bits (870),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 221/510 (43%), Positives = 324/510 (64%), Gaps = 23/510 (5%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTIC-RDYVYTPIGRLPSSSV  1323
             EE++YV +G+++ DG+++LEW LR   SQ  +I+IL+    +  +DYVYTP G+LP+SSV
Sbjct  5     EEKIYVALGDELQDGYKTLEWTLRRWKSQPISIVILHVTYKLSGKDYVYTPFGKLPASSV  64

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             ++EKLK L KYE+ K DKIL+ Y +FCGKVKAEI  ++++D  I K+++DLIS L ITKL
Sbjct  65    SDEKLKILRKYEQEKIDKILSKYKSFCGKVKAEIFNVEKYDEPIHKLILDLISGLHITKL  124

Query  1142  VLSLTFMKPLL-WKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             V+   F+K    WK+++A+   F+IH  K + C+LF++ GGK VFL  EN + +++DE G
Sbjct  125   VIGFAFIKSSSSWKAKTAIGVSFYIHEHKAESCDLFIICGGKEVFLRGENDQRIMEDEKG  184

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
              ++ + ++K      FK  +E++ L      E R     SS+   S  + + + WE    
Sbjct  185   VMVAKLKDKI----SFKFFIEKMFL------ENRRSPFASSTRKDS--SSMQNHWENCVQ  232

Query  785   EIELYLSQLSSS---------KTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIRE  633
             EIE+Y  +L S+         +T       P E  + E     NM+  ERIE+L+ KI E
Sbjct  233   EIEIYYQKLCSNLDGEEDYEQETGTSQQPSPTEAIMLEINSNPNMSLAERIESLRKKISE  292

Query  632   VQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKee  453
               + ++L KKE KA VER AKAE AI LC  RA++LE  INEE   R  L ++L + KE+
Sbjct  293   THERIRLKKKETKANVERHAKAERAICLCERRAQELEVQINEEAGNRTELNKKLSTQKEQ  352

Query  452   lyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENL  273
             L E+  ++EE + ++ S++ELQ EL+ K+ LS   KS AE QL+     R +MV+ IE L
Sbjct  353   LNEVINDIEESKNRIKSVVELQSELSHKLHLSKMAKSQAEAQLQNEAVKRAEMVREIEGL  412

Query  272   rrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW  93
             RR RDV  RRIEFC++KD IG A RL E S C R+++  EI+ AT++FSE  RLK G + 
Sbjct  413   RRGRDVFGRRIEFCRKKDGIGTAARLSELSCCLREYTDEEIKLATDDFSELFRLKSGSDL  472

Query  92    TNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             ++VYKG +N   VA+K+ +++  LS+E FQ
Sbjct  473   SSVYKGRINHVTVAVKVLNQANGLSQEDFQ  502



>ref|XP_009782435.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X2 [Nicotiana sylvestris]
Length=687

 Score =   336 bits (862),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 209/396 (53%), Positives = 279/396 (70%), Gaps = 14/396 (4%)
 Frame = -3

Query  1181  MVDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
             MVDLI+SL+ITKLV+SLTFMK   WKSRSA+ G F +H QKP+FCELF++ GGKLVFL E
Sbjct  1     MVDLITSLRITKLVMSLTFMKSSSWKSRSAISGSFFVHRQKPEFCELFIICGGKLVFLRE  60

Query  1001  ENGESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvS  822
              N E +I+D+ G ++  +R    K+  F+ L+ + M PE + K K  CDS +S       
Sbjct  61    GNNEGLIEDDQGEMVANSR---SKRQSFRDLVVK-MFPENSAKMKNQCDSSAS-------  109

Query  821   NGLADQWEKNQSEIELYLSQLSSSKT---DCDAANDPLEDCVKEPTMPENMTTKERIEAL  651
             NG  DQWEK + EIE Y+SQ+ SS     D   AN+ L+    E  M +NMT +E+ +AL
Sbjct  110   NGSFDQWEKYKEEIENYMSQILSSNAEEIDDFVANESLQKSNTELVMADNMTVQEKRKAL  169

Query  650   KAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEEL  471
             K K  E++Q +QL+++EAK  V   AKA+WA  LC  RAE+++ CIN+E+A++A L+ EL
Sbjct  170   KIKFLEIKQTIQLSREEAKGHVRGHAKAQWATTLCTRRAEEIDGCINDEIARKADLKREL  229

Query  470   DSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMV  291
             D+ KEEL EL TEVE   ++LNSILELQREL++K+QLSS  +S AE+++E+ V+ RT  +
Sbjct  230   DATKEELSELHTEVEITTSRLNSILELQRELSNKLQLSSVARSRAEVKVEKVVKQRTDTL  289

Query  290   QGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRL  111
             Q I+  R+QRDVLRRRIEFC+EKDAIG A  L +PSF  ++F+AAEIRAAT+ FS+R RL
Sbjct  290   QEIDEYRKQRDVLRRRIEFCREKDAIGNATMLMKPSFEYKEFTAAEIRAATDGFSDRMRL  349

Query  110   KCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             K GG+WT+VYK  LN   VAIKLY      S + F+
Sbjct  350   KSGGDWTDVYKARLNHTSVAIKLYSSGDVDSADAFR  385



>ref|XP_008367777.1| PREDICTED: putative U-box domain-containing protein 50 [Malus 
domestica]
Length=802

 Score =   337 bits (863),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 222/509 (44%), Positives = 321/509 (63%), Gaps = 23/509 (5%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTIC-RDYVYTPIGRLPSSSVN  1320
             E+VYV +G ++ DGF++L W+LR   SQ  +I+IL+   +I  +DYVYTP G+LP+SSV+
Sbjct  6     EKVYVALGNELQDGFKTLAWILRRWKSQPISIVILHVTYSISGKDYVYTPFGKLPASSVS  65

Query  1319  eeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
             +EKLK L +YE+ K D IL+ Y+AFCGKVKAEILK+++ D SI K+++DLIS L ITKLV
Sbjct  66    DEKLKVLRRYEQKKMDNILSKYVAFCGKVKAEILKVEQTDESIHKLILDLISGLHITKLV  125

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGV  960
             +  TF+K   W+ ++A+  LF+IH  K + CELF++ GG  +FL  EN + + +D  G +
Sbjct  126   IGFTFIKSSSWRMKTAISVLFYIHEHKTESCELFIICGGNELFLRGENDQRIQEDGKGVM  185

Query  959   IGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEI  780
             + + ++K      FK +LE++ L      E R     S +   S    L + WE    E+
Sbjct  186   VAKKKDKV----SFKFMLEKMFL------ENRHSLFGSPTKKDSA--NLQNLWENCVQEM  233

Query  779   ELYLSQLSSSKT--DCDAAN--------DPLEDCVKEPTMPENMTTKERIEALKAKIREV  630
             E+Y  QL S+    +CD  N         P E  + +     NM+  E+IE L+  I E 
Sbjct  234   EIYYQQLCSNLDVENCDQXNGTGTSQQPSPTEAIMLQINGNPNMSPAEKIEFLRKTISET  293

Query  629   QQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeel  450
             + ++++ KKEAK   +R AKAE AI LC  RA++L+  I EE   R  L +ELD+ KE+L
Sbjct  294   RGMIRMKKKEAKENADRHAKAERAICLCERRAQELDVQIKEEGDNRRELNKELDTEKEQL  353

Query  449   yelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLr  270
             +E+   +EE   K+ S++ELQ EL+ K+ +S   KS AE+QLE  V  RT M + IE LR
Sbjct  354   HEVVNNIEESXNKMKSLIELQYELSHKLHMSKMAKSQAEVQLENEVMKRTDMERKIEVLR  413

Query  269   rqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWT  90
             R+RDV  RRIEFC+++DA G A+ L E S   R+++  EI+ ATNEFSER RLK G + +
Sbjct  414   RERDVFXRRIEFCRQQDATGTAEGLSELSCRLREYTDEEIKQATNEFSERFRLKSGSDLS  473

Query  89    NVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             +VYKG +N   V IK+ + +  LS+E FQ
Sbjct  474   SVYKGRINHVTVGIKVLNSANGLSQEDFQ  502



>ref|XP_004509772.1| PREDICTED: putative U-box domain-containing protein 50-like [Cicer 
arietinum]
Length=799

 Score =   332 bits (851),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 223/511 (44%), Positives = 333/511 (65%), Gaps = 18/511 (4%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             ++ + E++YV +G+D  DGF +L W L+  +S S +I+IL+  + I +DYVYTP G+LP+
Sbjct  2     DANQREKIYVAVGDDAQDGFNTLNWALKKWNSHSISIVILHVTHNISKDYVYTPFGKLPA  61

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
              S+N+EKL+ L K E+ +  K+ + YI FCGKV  EI ++++ D   +K ++DLI  L I
Sbjct  62    RSLNDEKLEALRKDEKERIKKLFSKYITFCGKVPVEIHEVEKFDEPKQKHIIDLIIDLGI  121

Query  1151  TKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDE  972
             TKLV+  +FMKP L KS+ A+ GLF++H  KP FCELF++  GK VFL   N E +++D+
Sbjct  122   TKLVMGFSFMKPSL-KSKGAISGLFYVHQHKPTFCELFIICVGKQVFLRGNNDEKIMEDD  180

Query  971   VGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKN  792
              G ++ + R+K      FK  L++I   +  D  + S  +  S++     N   +QWE  
Sbjct  181   SGVMVAKMRDKVT----FKDWLDKIFSDKTNDYSQNSLSASPSTT-----NLGQNQWEFY  231

Query  791   QSEIELYLSQLSSSKTDCDAANDPLEDCVKEPTMPE----NMTTKERIEALKAKIREVQQ  624
               +IE Y  +L SS  +  + ++       EP + +    NM T E+IE LK K+ E ++
Sbjct  232   LQDIENYYQELLSSNLEEGSYDNLHISPTIEPRVTQQNNSNMNTAEKIEILKNKVNEARK  291

Query  623   VVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelye  444
              +QL +KE K  +ER  KAEWAI LC  RAE++E  I EE++ +  L +EL+  KE+  E
Sbjct  292   TIQLKRKEVKDNIERSTKAEWAISLCNIRAEEIEGRIREELSTKEELNKELNLEKEQKEE  351

Query  443   lqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrq  264
              + E+EEK+ +L+S+LE+Q EL++K+Q+S+  KS +E QL+RAV+ RT+MV+ IE LR+Q
Sbjct  352   TRREIEEKKQRLHSLLEVQSELSNKLQISTVTKSRSETQLKRAVKERTEMVREIEELRKQ  411

Query  263   rdvlrrRIEFCKEKDAIGEAKRLGEPSFCC--RQFSAAEIRAATNEFSERQR-LKC-GGN  96
             R+VL RRIEFCK+KDAIG A RLGE    C  R++S  E+R AT+ FSER R LKC GG+
Sbjct  412   RNVLNRRIEFCKQKDAIGMAARLGENIINCGMREYSEEELRLATDNFSERLRLLKCGGGD  471

Query  95    WTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             ++NVY+G  N   VAI++     SLS++ FQ
Sbjct  472   YSNVYRGRFNHSTVAIQMLSCFASLSQQDFQ  502



>ref|XP_008237170.1| PREDICTED: putative U-box domain-containing protein 50 [Prunus 
mume]
Length=483

 Score =   323 bits (828),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 211/486 (43%), Positives = 310/486 (64%), Gaps = 22/486 (5%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTIC-RDYVYTPIGRLPSSS  1326
             +EE+VYV +G+++ DG+++LEW LR   SQ  +I+IL+    +  +DYVYTP G+LP+SS
Sbjct  4     QEEKVYVALGDELQDGYKTLEWTLRRWKSQPISIVILHVTYKLSGKDYVYTPFGKLPASS  63

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             V++EKLK L KYEE K DKIL+ YIAFCGKVKAEIL ++++D  I K+++DLIS L ITK
Sbjct  64    VSDEKLKILRKYEEEKIDKILSKYIAFCGKVKAEILNVEKYDEPIHKLILDLISGLHITK  123

Query  1145  LVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             LV+   F+K   WK+++A+   F+IH  K + C+LF++ GGK VFL  EN + +++D+ G
Sbjct  124   LVIGFAFIKSSSWKAKTAIGVSFYIHEHKAESCDLFIICGGKEVFLRGENDQIIMEDDKG  183

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
              ++ + +++      FK  +E++ L      E R     SS+   S  + + + WE    
Sbjct  184   VMVAKLKDEV----SFKFFIEKMFL------ENRRSPFASSTRKDS--SNMQNHWENCVQ  231

Query  785   EIELYLSQLSSS---------KTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIRE  633
              IE+Y  +L S+         +T       P +  + E     NM+  ERIE+L+ KI E
Sbjct  232   VIEMYYQKLCSNLDGEEDYEQETGNSQQPSPTKAIMLEINANPNMSLAERIESLRKKISE  291

Query  632   VQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKee  453
               + ++L KKE KA VER AKAE  I LC  RA++LE  I EE   R  L ++L++ KE+
Sbjct  292   THERIRLKKKETKANVERHAKAERVICLCERRAQELEVQIKEEAGNRTELNKKLNTEKEQ  351

Query  452   lyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENL  273
             L E+  ++EE + ++ S++ELQ EL+ ++ LS   KS AE QL+  V  R +MV+ IE L
Sbjct  352   LNEVINDIEESKNRIKSVIELQSELSHELHLSKMAKSQAEAQLQNEVVKRAEMVREIEVL  411

Query  272   rrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW  93
             RR RDV RRRIEFC++KD  G A RL E S C R+++  EI+ AT++FSE  RLK G + 
Sbjct  412   RRGRDVFRRRIEFCRKKDGTGLAARLSELSCCLREYTDEEIKLATDDFSELFRLKSGSDL  471

Query  92    TNVYKG  75
             ++VYKG
Sbjct  472   SSVYKG  477



>ref|XP_009606491.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009606492.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009606493.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X2 [Nicotiana tomentosiformis]
Length=690

 Score =   327 bits (837),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 205/396 (52%), Positives = 276/396 (70%), Gaps = 11/396 (3%)
 Frame = -3

Query  1181  MVDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
             MVDLI+ L+ITKLV+SLTFMK   WKSRSA+ G F +H QKP+FCELF++ GGKLVFL E
Sbjct  1     MVDLITGLRITKLVMSLTFMKSSSWKSRSAISGSFFVHRQKPEFCELFIICGGKLVFLRE  60

Query  1001  ENGESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvS  822
              N E +I+D+ G ++  +R    K+  FK L+ + M PE       +    S  S SS S
Sbjct  61    RNNEGLIEDDQGEMVANSR---SKRQSFKDLVVK-MFPE----NNSAKMKNSCDSPSSAS  112

Query  821   NGLADQWEKNQSEIELYLSQLSSSKT---DCDAANDPLEDCVKEPTMPENMTTKERIEAL  651
             N   DQWEK + EIE Y+SQ+ SS     D   AN+ L++ + E  M +N+T +E+ EA+
Sbjct  113   NSSVDQWEKYKDEIENYMSQILSSNAEEIDDFIANENLQNSITEFVMADNLTLQEKREAV  172

Query  650   KAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEEL  471
             K K  E++Q +QL+++EAK  V   AKA+WA  LC  RAE+++ CIN+E+A++A L+ EL
Sbjct  173   KIKFLEIKQTIQLSREEAKGHVRGHAKAQWATTLCTRRAEEIDGCINDEIARKADLKREL  232

Query  470   DSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMV  291
             D+ KEE+ EL TEVE   ++LNSILELQ EL++K+QLSS  +S AE+++E+ V+ RT  +
Sbjct  233   DATKEEISELHTEVEITTSRLNSILELQGELSNKLQLSSVARSRAEVKVEKVVKQRTDTL  292

Query  290   QGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRL  111
             Q IE  R+QRDVLRRRIEFC+EKDAIG A  L +PSF  ++F+AAEIRAAT+ FS+R RL
Sbjct  293   QEIEEYRKQRDVLRRRIEFCREKDAIGNATMLIKPSFEYKEFTAAEIRAATDGFSDRMRL  352

Query  110   KCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             K GG+WT+VYK  LN   VAIKLY      S + F+
Sbjct  353   KSGGDWTDVYKARLNHTSVAIKLYSSGDVDSADAFR  388



>ref|XP_010027961.1| PREDICTED: putative U-box domain-containing protein 50 [Eucalyptus 
grandis]
Length=811

 Score =   329 bits (844),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 226/505 (45%), Positives = 325/505 (64%), Gaps = 13/505 (3%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G D+ D F++LEW LR  SSQ   ++IL+ +  I +++VY P G+LP+SSV+E
Sbjct  6     EKVYVAVGNDLQDNFKTLEWALRKWSSQPIHVVILHVSRNISKEFVYGPFGKLPASSVSE  65

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             E L+ L K E+ K + +L+  IAFCGKVKAE +K++++D  I K++VDLIS L ITKLV+
Sbjct  66    EVLEVLRKNEQEKIENLLSKCIAFCGKVKAEGVKVEKYDEPIHKLIVDLISRLHITKLVM  125

Query  1136  SLTFMKPLL--WKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGG  963
              LTFMK     WK + A+ G F++H  KPDFC+L+++  GKLV    E  + +++D+ G 
Sbjct  126   GLTFMKSFSSSWKPKGAISGSFYVHRHKPDFCQLYLISAGKLVHQRWEGEDGIMEDDQGV  185

Query  962   VIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
              + + +EK      FK  L ++    I+   +R+  S   S ++S S  L  QWE    E
Sbjct  186   TVAKLKEKSI----FKGWLGKMFNDNIS--LERNSSSTPPSPANSDSPNLHCQWEHYAEE  239

Query  782   IELYLSQLSSSKTDCDAANDPLEDCVKEPTMPEN----MTTKERIEALKAKIREVQQVVQ  615
             IE Y  +L  S  + D   D       +P +PE+    M   E+IEALK KI E  Q +Q
Sbjct  240   IEAYFQELLISCKEDDNFEDHGMGSPVKPEVPEDAITTMNPAEKIEALKRKIEEAHQTIQ  299

Query  614   LNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqt  435
             L KKE+K  +ER +KAEWAI LC  R ED+EA   EE+  R  L+++L++ K++LYE+  
Sbjct  300   LKKKESKENMERHSKAEWAITLCNERLEDIEARAKEEVTNRVALQKDLEAEKDKLYEMSR  359

Query  434   eveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdv  255
             + EE R+KL  +L+LQ EL++K+Q+S+  K HAE +LE+AV TR +MV+ IE LRRQRDV
Sbjct  360   DNEESRSKLKLLLQLQSELSNKLQISNLAKVHAEARLEKAVITRGEMVREIEELRRQRDV  419

Query  254   lrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKG  75
             L+RRIEFC+EKD I    RL E S   ++++  EIR AT+ F+E  RLK GG WTNVY+G
Sbjct  420   LQRRIEFCREKDTIEMVNRLTEVSCGFQEYTEDEIRLATDNFAECLRLKSGGEWTNVYRG  479

Query  74    CLN-SERVAIKLYHKSTSLSEETFQ  3
              +N +  VA K+      LS++ F+
Sbjct  480   RINHATTVAFKMLKSPNGLSQDDFR  504



>ref|XP_008440530.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X1 [Cucumis melo]
Length=806

 Score =   329 bits (844),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 219/510 (43%), Positives = 321/510 (63%), Gaps = 22/510 (4%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             KEE+V+V IG D+ DGF++L W LR   S   +I+IL+ +     +YV+TP G+LP SSV
Sbjct  4     KEEKVFVAIGNDLRDGFKTLGWTLRKWKSHPISIVILHVSYNNSMEYVHTPFGKLPVSSV  63

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             +EEK++ L +YE+ K +KIL+ Y+ FCGKV+AEILK+++ D  + K++VDL+S L IT L
Sbjct  64    SEEKVEVLRRYEQEKINKILSKYVDFCGKVRAEILKVEKSDKPVHKLIVDLVSELGITNL  123

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGG  963
             V+  TFMK   WK ++A+ G F+I+  K  FCEL+V++GGK VFL +E    +++DE G 
Sbjct  124   VIGFTFMKSSSWKPKNAISGSFYIYRNKAHFCELYVIWGGKQVFLRDER---IMEDESGV  180

Query  962   VIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
              I +       KH  K  L ++ + +      R+    SSS  SS S    + W+ N  E
Sbjct  181   RISKI----STKHSLKGWLGKMFVEDPTYFSDRNLSLSSSSPHSSNSMSSQNYWDHNVQE  236

Query  782   IELYLSQLSS----SKTDCDAANDPLEDCVKEPTM-----PE-NMTTKERIEALKAKIRE  633
             +E Y  +L S     + DC+   D + +            P+ NM  +ERIE L+ KI E
Sbjct  237   LENYYEELLSLNVQEEEDCEQDQDGVLENSSSTRFNILDYPDSNMNPEERIEHLRTKIEE  296

Query  632   VQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKee  453
              ++ +QL + EAK   ERQAKAEWAI LC+ R ++LEA I EE+  R  L++ELDSAKE 
Sbjct  297   ARKSIQLMRDEAKGSSERQAKAEWAINLCSQRTDELEAKIKEEVTIREDLQKELDSAKEY  356

Query  452   lyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENL  273
             + E+  ++EE + +L+S+L+LQ EL+SK+Q+S+ EKS  E QLE+  +T+  +V+ IE L
Sbjct  357   ILEIVADIEESKTRLSSLLKLQAELSSKLQISTAEKSRLEAQLEKTAKTKKGLVRAIEEL  416

Query  272   rrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW  93
             RRQR++L RRIEFCK++DA+G  +R  E S   R ++  EI  AT+ FSE+ RL      
Sbjct  417   RRQREILHRRIEFCKDRDAMGMGERSIEVSCSTRVYTVEEITLATDNFSEQMRLS-----  471

Query  92    TNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             + VY+G +N   VAI++      LSE+ FQ
Sbjct  472   SRVYRGRINHLSVAIQMITSGNRLSEDDFQ  501



>ref|XP_008440531.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X2 [Cucumis melo]
Length=803

 Score =   325 bits (834),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 216/507 (43%), Positives = 318/507 (63%), Gaps = 19/507 (4%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             KEE+V+V IG D+ DGF++L W LR   S   +I+IL+ +     +YV+TP G+LP SSV
Sbjct  4     KEEKVFVAIGNDLRDGFKTLGWTLRKWKSHPISIVILHVSYNNSMEYVHTPFGKLPVSSV  63

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             +EEK++ L +YE+ K +KIL+ Y+ FCGKV+AEILK+++ D  + K++VDL+S L IT L
Sbjct  64    SEEKVEVLRRYEQEKINKILSKYVDFCGKVRAEILKVEKSDKPVHKLIVDLVSELGITNL  123

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGG  963
             V+  TFMK   WK ++A+ G F+I+  K  FCEL+V++GGK VFL +E    +++DE G 
Sbjct  124   VIGFTFMKSSSWKPKNAISGSFYIYRNKAHFCELYVIWGGKQVFLRDER---IMEDESGV  180

Query  962   VIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
              I +       KH  K  L ++ + +      R+    SSS  SS S    + W+ N  E
Sbjct  181   RISKI----STKHSLKGWLGKMFVEDPTYFSDRNLSLSSSSPHSSNSMSSQNYWDHNVQE  236

Query  782   IELYLSQLSS----SKTDCDAANDPL---EDCVKEPTMPENMTTKERIEALKAKIREVQQ  624
             +E Y  +L S     + DC+   D +       +   +    +  ERIE L+ KI E ++
Sbjct  237   LENYYEELLSLNVQEEEDCEQDQDGVLENSSSTRFNILDYPDSNMERIEHLRTKIEEARK  296

Query  623   VVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelye  444
              +QL + EAK   ERQAKAEWAI LC+ R ++LEA I EE+  R  L++ELDSAKE + E
Sbjct  297   SIQLMRDEAKGSSERQAKAEWAINLCSQRTDELEAKIKEEVTIREDLQKELDSAKEYILE  356

Query  443   lqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrq  264
             +  ++EE + +L+S+L+LQ EL+SK+Q+S+ EKS  E QLE+  +T+  +V+ IE LRRQ
Sbjct  357   IVADIEESKTRLSSLLKLQAELSSKLQISTAEKSRLEAQLEKTAKTKKGLVRAIEELRRQ  416

Query  263   rdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNV  84
             R++L RRIEFCK++DA+G  +R  E S   R ++  EI  AT+ FSE+ RL      + V
Sbjct  417   REILHRRIEFCKDRDAMGMGERSIEVSCSTRVYTVEEITLATDNFSEQMRLS-----SRV  471

Query  83    YKGCLNSERVAIKLYHKSTSLSEETFQ  3
             Y+G +N   VAI++      LSE+ FQ
Sbjct  472   YRGRINHLSVAIQMITSGNRLSEDDFQ  498



>ref|XP_004289537.1| PREDICTED: putative U-box domain-containing protein 50-like [Fragaria 
vesca subsp. vesca]
Length=800

 Score =   322 bits (826),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 223/517 (43%), Positives = 321/517 (62%), Gaps = 32/517 (6%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTI-CRDYVYTPIGRLPSSS  1326
             +EE+VYV +G  + DG ++LEW LR    Q  +I+IL+  + +  RDYV TP G+LP+SS
Sbjct  4     QEEKVYVALGNQLQDGIKTLEWTLRKWRFQPISIVILHVTSRVSVRDYVSTPFGKLPASS  63

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             V++EKLK L K E+ K  KIL+ YIAFCGKVKAEIL ++R+D  I   ++DLIS L+ITK
Sbjct  64    VSDEKLKILRKLEQEKIYKILSTYIAFCGKVKAEILNVERYDDPIHMQILDLISGLRITK  123

Query  1145  LVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESV-IKDEV  969
             LV+   FMK   WK ++ + G FHIH  KP+ CELF++ GGK VFL  EN + + ++D+ 
Sbjct  124   LVMGFLFMKSSSWKPKTVISGSFHIHQHKPESCELFIICGGKEVFLRGENDKRLSMEDDQ  183

Query  968   GGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLAD-QWEKN  792
             GG++ + ++             RI +  I      S  S   SS+ + S+ L + QWE  
Sbjct  184   GGMVAKMKD-------------RISISLILGSMFGSRQSSPPSSTKNHSSSLENMQWESY  230

Query  791   QSEIELYLSQLSSS---------KTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKI  639
               EIE+YL QL S+         ++D      P +  V E     N++  E+ E+LK K+
Sbjct  231   VQEIEIYLQQLCSTLDEEDLREQESDISQQASPTDAIVLELNGNPNLSIAEKFESLKFKV  290

Query  638   REVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAK  459
             RE  Q +QL KKE +A V+R+ KAEWAI LC  RAE+LE  I EE  KR  +++E D  K
Sbjct  291   REAHQRLQLKKKEVQASVDRRLKAEWAISLCKHRAEELEVLIKEEAKKRIEMKKEQDRDK  350

Query  458   eelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIE  279
             + L+E++T++EE + KL+S+++L+ EL+ ++ +S   K+  E QLE  + TR +MV+ I+
Sbjct  351   DFLHEVKTDIEESKNKLSSLIQLRPELSHRLHISKMAKARMEAQLENDITTRAEMVREID  410

Query  278   NLrrqrdvlrrRIEFCKEKDAIGEAKRLG--EPSFCCRQFSAAEIRAATNEFSERQRLKC  105
              LRR+RDV +RRIEFCKEK  +G A R G  + S C R+++  EI+ AT+++S     K 
Sbjct  411   ELRRERDVFQRRIEFCKEK--VGVAGRSGSDQVSCCLREYTTEEIKLATDDYSGSLLFKT  468

Query  104   G-GNWTNVYKGCLNSERVAI--KLYHKSTSLSEETFQ  3
             G G  T VYKG +N +RVAI  KL +    L  E FQ
Sbjct  469   GSGRSTTVYKGRINHDRVAIKLKLINSDDGLPREDFQ  505



>ref|XP_004143547.1| PREDICTED: putative U-box domain-containing protein 50-like [Cucumis 
sativus]
 gb|KGN48698.1| hypothetical protein Csa_6G498940 [Cucumis sativus]
Length=806

 Score =   317 bits (813),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 213/510 (42%), Positives = 316/510 (62%), Gaps = 22/510 (4%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             K ++V+V IG D+ DGF++L W LR   S   +I+IL+ ++    +YV+TP G+LP SSV
Sbjct  4     KPDKVFVAIGNDLQDGFKTLGWTLRKWKSHPISIVILHVSHNNSMEYVHTPFGKLPVSSV  63

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             +EEK++ L +YE+ K +K+L+ Y+ FCGKV+AEILK++R D  + K++VDL+S L IT L
Sbjct  64    SEEKVEVLRRYEQEKINKLLSKYVDFCGKVRAEILKVERSDKPVHKLIVDLVSELGITNL  123

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGG  963
             V+  TFMK   WK ++A+ G F+I+  K  FCEL+V++GGK VFL +E    +++D+ G 
Sbjct  124   VIGFTFMKSSSWKPKNAISGSFYIYRNKAHFCELYVIWGGKQVFLRDER---IMEDDRGV  180

Query  962   VIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
              I +       KH  +  L ++ + +      R+    SSS  +S S    + W+ N  E
Sbjct  181   RISKI----STKHSLRGWLGKMFMEDPTYSSDRNLSLSSSSPRNSNSMSSRNYWDHNVQE  236

Query  782   IELYLSQLSS----SKTDCDAANDPL--EDCVKE----PTMPENMTTKERIEALKAKIRE  633
             +E Y  +L S     + DC+   D +    C  +      +  N   +ERIE L+ KI E
Sbjct  237   LENYYEELLSLNVQEEEDCEQDQDGVLENSCSTQFNILDYLDSNTNPEERIEHLRTKIEE  296

Query  632   VQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKee  453
              ++ +QL + E K   ERQAKAEWAI LC+ R ++LEA I EE+  R  L++EL SAKE 
Sbjct  297   ARKSIQLMRDETKGSSERQAKAEWAINLCSQRTDELEAKIKEEVTIREELQKELGSAKEY  356

Query  452   lyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENL  273
             + E+  E++E + +L+S+LELQ EL+SK+Q+S+ EK   E QLE+  +T+  M + IE L
Sbjct  357   ILEIVAEIKESKIRLSSLLELQAELSSKLQISTAEKLRLEAQLEKTAKTKKGMEREIEEL  416

Query  272   rrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW  93
             RRQR++L RRIEFCK+KDAIG  +R  E S   R ++  EI  AT+ FSE+ RL      
Sbjct  417   RRQREILHRRIEFCKDKDAIGMGERSTEVSCSTRVYTVEEISLATDNFSEQMRLS-----  471

Query  92    TNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             + VY+G +N   VAI++      LSE+ FQ
Sbjct  472   SRVYRGRINHMSVAIQMIASGNRLSEDDFQ  501



>ref|XP_006426256.1| hypothetical protein CICLE_v10024909mg [Citrus clementina]
 gb|ESR39496.1| hypothetical protein CICLE_v10024909mg [Citrus clementina]
Length=760

 Score =   315 bits (808),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 212/458 (46%), Positives = 298/458 (65%), Gaps = 19/458 (4%)
 Frame = -3

Query  1349  IGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDL  1170
             +G+LP++S+++EKL+ L KYE+ KTD +L+ Y+ FCGKVKAEILK+++ D  + K+++DL
Sbjct  8     VGKLPATSLSDEKLEILKKYEQGKTDNLLSKYMGFCGKVKAEILKVEKSDEPVHKLILDL  67

Query  1169  ISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGE  990
             +S L ITKLV+ L+FMKP   KSR+A+ G + +H+  PD+CELF++ GGKLV L  EN E
Sbjct  68    VSRLTITKLVMGLSFMKPSAGKSRTAVSGSYFVHHHMPDYCELFIICGGKLVSLKGENDE  127

Query  989   SVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLA  810
              +++D+ G    + RE+      F  L  ++      +  + S  S    + S  S    
Sbjct  128   GIMEDDQGVKFAKMRERV----NFGNLWTKMFSGNGRNPNRLSICSRGPDADSPYSRS--  181

Query  809   DQWEKNQSEIELYLSQLSSSKTDCDAAN-----DPLEDCVKEPTMPE----NMTTKERIE  657
               WE    EIE+Y   L+S   D DA+N     + L+    EP   E    NM+  ER E
Sbjct  182   -TWENCVQEIEIYFQHLASFNLD-DASNSEDGDEILQTRAIEPNAAEQIDSNMSVAERTE  239

Query  656   ALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEE  477
              +K+KI E +++++L KKE K   ER AKA+WAI LC SRA+ LE+   E++A R  ++ 
Sbjct  240   FMKSKINEAREMIRLKKKETKDDAERCAKAKWAICLCNSRADQLESLTKEDVASRMEIQR  299

Query  476   ELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQ  297
             +LDS KE+  E+  +VEE + +L+S++ELQ EL++K+QLS+  K HAE QLE+AV  R +
Sbjct  300   DLDSLKEQSCEVIRDVEESKNRLSSLIELQSELSNKLQLSTMAKGHAEAQLEKAVIARAE  359

Query  296   MVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQ  117
             +V+ IE LRRQRDVL RRIEFCKEKDAIG   R  E S   R+++A +IR AT +FSER 
Sbjct  360   IVKDIEELRRQRDVLHRRIEFCKEKDAIGMVIRSSELSCAFREYAAEDIRLATEDFSERF  419

Query  116   RLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             RLKC G+WTNVY+G LN   VAIK  +    LSEE FQ
Sbjct  420   RLKCAGDWTNVYRGRLNHASVAIKTLN--NGLSEEDFQ  455



>ref|XP_010519185.1| PREDICTED: putative U-box domain-containing protein 50 [Tarenaya 
hassleriana]
Length=787

 Score =   314 bits (805),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 209/507 (41%), Positives = 316/507 (62%), Gaps = 45/507 (9%)
 Frame = -3

Query  1493  RVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             +VYV +G +V DG+++++W L+  +S   +++IL+  N I  D+VYTP G+LP+ SV+EE
Sbjct  12    KVYVAVGNNVEDGYKTIDWALKKWNSIPISMVILHICN-ISNDFVYTPFGKLPAISVSEE  70

Query  1313  klkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLS  1134
             KL+ L KYEE K DK+L+ YIAFCGKVKAEI K+++ D  I+ ++VDLIS L ITKLV+ 
Sbjct  71    KLQVLRKYEEEKIDKLLSKYIAFCGKVKAEIFKVEKQDDPIQVLIVDLISKLNITKLVMG  130

Query  1133  LTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVIG  954
             +TFM+   WKS+SA+ G F+++  KP+FCE +++ GGK                   ++ 
Sbjct  131   ITFMRSSSWKSKSAISGSFYVYQNKPEFCEFYIICGGK-------------------MVA  171

Query  953   RAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIEL  774
               RE     +  +  + ++      + ++ S  S              D W+KN  E E 
Sbjct  172   LKRENDGNNNNIRNWIGKMFHDPTRNLDRSSSISE-------------DPWDKNARETEN  218

Query  773   YLSQLSSSKTDCDAANDPLED-------CVKEPTMPENMTTKERIEALKAKIREVQQVVQ  615
             YL  L S   D +  N+ +++          E  + ++M   E++E +K K  E +++++
Sbjct  219   YLQLLLSLNLDEETDNNGVDEGEYDDDDDDVELGVLQHMDLAEKMEYMKRKTEEAREMME  278

Query  614   LNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqt  435
              NK+EAK+  ER AKAEWA+ LC++R E LEA INEE  +R  ++E LD   E+L E+  
Sbjct  279   KNKREAKSNAERYAKAEWAVSLCSNRIEKLEARINEEGRRRVKIQETLDMESEQLDEVAR  338

Query  434   eveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdv  255
             +VEE +AKL+S+ ELQREL+SK++  +  KS AE QLE+ V  R +M++ IE LR QRD+
Sbjct  339   DVEEGKAKLSSLSELQRELSSKLRSLTMAKSQAEAQLEKVVSERGKMIEDIEKLRHQRDI  398

Query  254   lrrRIEFCKEKDAIGEAKRL--GEPSFC-CRQFSAAEIRAATNEFSERQRLKCGGNWTNV  84
               RRIEFCKEKDAIG   RL  GE + C   ++++ +IR AT++FS+R+RLK GGNWT V
Sbjct  399   FNRRIEFCKEKDAIGLVSRLNAGEDARCRYTEYASEDIRLATDDFSDRRRLKSGGNWTKV  458

Query  83    YKGCLNSERVAIKLYHKSTSLSEETFQ  3
             Y+G + S  +A+K+      LS++ F+
Sbjct  459   YRGRIKSTTLAVKVI--GDCLSDQDFR  483



>ref|XP_010254557.1| PREDICTED: putative U-box domain-containing protein 50 [Nelumbo 
nucifera]
Length=814

 Score =   312 bits (800),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 214/516 (41%), Positives = 320/516 (62%), Gaps = 21/516 (4%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             K E+VYV +G D+ +G  +LEW LR  S Q+ +I+I++  N   +D+VYTP G+LP+SSV
Sbjct  4     KSEKVYVAVGNDLQEGIGTLEWALRKWSGQTISIVIIHFNNN-NKDFVYTPFGKLPASSV  62

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             N+EKL+    YE+ KTDK+L+ YI FC KV+  +LK+++ +  I K++V LIS L++TK 
Sbjct  63    NDEKLRIFRMYEQEKTDKLLSKYIDFCAKVRTGVLKVEKTEEPIYKVIVGLISRLRVTKF  122

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGG  963
             V+ +T MK   WK++SA+   F++H  KP+FCE F++ GG+L+FL E N E  ++D+ G 
Sbjct  123   VMGITLMKSQCWKTKSAISAAFYVHKNKPNFCESFIICGGELIFLGEGNEEGFVEDDQGL  182

Query  962   VIGRAREkkkkKHGFKVLLERIMLPEIA-----DKEKRscdspsssssssvSNGLADQWE  798
             ++ + R K      FK  L R+     A      ++   C S ++S    +S    D+WE
Sbjct  183   MVAKLRNKG----SFKGWLGRVFTDSTAIHQSCVRDDSHCTSAAASMGIELSLNSHDRWE  238

Query  797   KNQSEIELYLSQLSSS---KTDCDAANDPL-------EDCVKEPTMPENMTTKERIEALK  648
                 E+E YL  LS S   +   +  N P        ++  K       M   +RI A++
Sbjct  239   NYAEEVENYLQWLSISEVGEEFHEEENGPAASQLSLEKELEKFQQASTKMNASDRIGAMR  298

Query  647   AKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELD  468
             AK  E +++ +  +KE K  VERQ +AE  I LC  R E+L+A INEE   +  L+++L+
Sbjct  299   AKTEEARKMTEEKRKEVKIHVERQRRAERIISLCNRRVEELDARINEESTTQNDLKKDLE  358

Query  467   SAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQ  288
             +A+E +YE+ +++EE ++KL+SI+ELQ EL  K+  SS  K HAE QL+ A+  RT+M+ 
Sbjct  359   AAREYIYEVSSDIEETKSKLSSIMELQAELTRKLHSSSLAKFHAESQLQNAMAARTEMLL  418

Query  287   GIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEP-SFCCRQFSAAEIRAATNEFSERQRL  111
              I+ LRR+RD+LRRR+EFC+EK+AI  A       ++  R+F+A EIR AT++FSER RL
Sbjct  419   EIDELRRERDLLRRRVEFCREKEAIAAATASSNSLNYAYREFTADEIRVATDDFSERMRL  478

Query  110   KCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             K GG  TNVY+G LN   VAIKL       S+E F+
Sbjct  479   KSGGVGTNVYRGRLNHTTVAIKLQDSLCRQSQEEFR  514



>ref|XP_010547592.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X1 [Tarenaya hassleriana]
Length=781

 Score =   302 bits (774),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 200/502 (40%), Positives = 307/502 (61%), Gaps = 43/502 (9%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G  V DGF++++W L+     + +I+IL+ +N +  D VYTP G+LP+SSV+E
Sbjct  11    EKVYVAVGNGVEDGFKTIDWALKKWDPINISIVILHISN-LSNDLVYTPFGKLPASSVSE  69

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L KYEE K DK+L+ Y+AFCGKVKAE LK++  D  I+ +++DLIS L+ITKLV+
Sbjct  70    EKLQVLRKYEEEKVDKLLSKYVAFCGKVKAETLKVEMQDDPIQVLILDLISKLKITKLVM  129

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
              +TFM+   WK++SA+ G F+++  KP+FCE  ++ GGK+V L  ++  +  ++  G + 
Sbjct  130   GITFMRSSSWKAKSAISGSFYVYRHKPEFCEFHIICGGKMVALRRDDDGNNTRNWFGKMF  189

Query  956   GRAREkkkkKHGFKVLLERI--MLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
                       H     L+R   +  +  D E                    + W+KN  E
Sbjct  190   ----------HDPTRNLDRSSSVGEDPMDSE--------------------NPWDKNSRE  219

Query  782   IELYLSQLSSSKTDCDAANDPL---EDCVKEPTMPENMTTKERIEALKAKIREVQQVVQL  612
              + Y  QL S   D D   +     ED   E    + M   E+++ +K K +E Q++++ 
Sbjct  220   TDDYYHQLLSLNVDDDTDGNNFVEEEDGDVELDALQRMNAGEKMKYVKRKAKEAQEMIEQ  279

Query  611   NKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqte  432
             NK+EAKA  ER AKAE AI LC+ R ++LE  + EE  +R  ++E L++ KE L E+  +
Sbjct  280   NKREAKANAERYAKAERAISLCSCRIQELETQVQEESERRVKIDEILETEKELLDEVIRD  339

Query  431   veEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvl  252
             V+E++AKL+S+ +LQREL+SK+   +  KS AE +LE+ V  R + V+ +E  R QRD+ 
Sbjct  340   VQEEKAKLSSLGKLQRELSSKLSTVTTAKSEAETRLEKVVSQRNETVREMEKSRHQRDIF  399

Query  251   rrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGC  72
              RRIEFCKE++AIG   RL       R+++A ++R AT++FS+R RLK GGNW  VY+G 
Sbjct  400   NRRIEFCKEREAIGLVSRL-----SYREYAAEDVRLATDDFSDRWRLKSGGNWRRVYRGR  454

Query  71    LNSERVAIKLYHKSTSLSEETF  6
             +N   +A+K+   S  LS++ F
Sbjct  455   INHTTMAVKM--TSDCLSDQDF  474



>gb|KEH20117.1| U-box kinase family protein [Medicago truncatula]
Length=769

 Score =   297 bits (761),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 195/500 (39%), Positives = 307/500 (61%), Gaps = 9/500 (2%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQ-STTILILYAANTICRDYVYTPIGRLPSSSVN  1320
             E++YV +G DV DGFQ+L+W L+  +S  + +I+IL+      +D+VYT +G+LP+    
Sbjct  7     EKIYVAVGYDVLDGFQTLDWALKKWNSHPNISIIILHVKYNSSKDHVYTLLGKLPAKGAC  66

Query  1319  eeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
             EE L+ + KYEE   +K+L+ YIA C K+ AE  ++++ D  ++ I +DLI  L ITKLV
Sbjct  67    EETLERIRKYEETIINKLLSKYIALCDKIPAETFEVEKFDEPMQNITIDLIFGLGITKLV  126

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGV  960
             +  +FM+  L KS+ A+ GLF++H  KPDFCELF++ GGK V    +N E  ++D+ G  
Sbjct  127   IGFSFMRHSL-KSKDAMNGLFYVHQHKPDFCELFIICGGKQVSPRVKNDEITMEDDSGVK  185

Query  959   IGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEI  780
             + + R+K      FK  +ER+   +  D  + S     ++S+S  S+   +QWE    EI
Sbjct  186   VAKMRDKT----SFKYWIERMFCDKTIDSNQTSSSRSPTTSTSLESHLDQNQWELYMQEI  241

Query  779   ELYLSQLSSSKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQQVVQLNKKE  600
             E YL +L S   D  +     +D    P  P   + +E++E +  K+ E    +Q+ +KE
Sbjct  242   ENYLQELMSLHLDEGSFGQDNDDSFLSPIEP--YSAEEKLEIVIDKLNEAYNTIQVERKE  299

Query  599   AKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqteveEK  420
              K  +ER AKAEWAI +C+ R E+LE   +EE+ KR  L++EL+  K+++Y ++T VEE 
Sbjct  300   EKENLERHAKAEWAIYICSRREEELEYLKSEEVTKREELKKELNVEKDQIYYIRTYVEES  359

Query  419   RAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRI  240
             + +L+S+ +LQ +L +K+ +S+ E S  E +LE+ +  RT M+  IE L RQRDV  +RI
Sbjct  360   KQRLSSLQDLQLDLKNKLNVSTLEVSECETKLEKVMNERTNMLMEIEELSRQRDVFNKRI  419

Query  239   EFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNS-  63
             +F K KDA     ++ +     R+++  EI  A++ FSE  RLKCGG+W+NVYKG ++  
Sbjct  420   KFFKGKDATKMCNKIIDNGCSLREYTKEEIIMASHNFSEHFRLKCGGDWSNVYKGHIDHY  479

Query  62    ERVAIKLYHKSTSLSEETFQ  3
               VAIK+ H + +LS+  FQ
Sbjct  480   SNVAIKMLHSNLALSQHDFQ  499



>ref|XP_010680359.1| PREDICTED: putative U-box domain-containing protein 50 [Beta 
vulgaris subsp. vulgaris]
Length=820

 Score =   293 bits (749),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 207/513 (40%), Positives = 315/513 (61%), Gaps = 20/513 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHD--GFQSLEWVLRNCSSQS--TTILILYAANTICRDYVYTPIGRLPSS  1329
             E+++V +  ++ +  G  +L WV++   S +   +I+IL+  ++   + V TP G+LP+S
Sbjct  10    EKIHVALTNEMQEQEGCLTLNWVIKKWVSHNHPISIVILFINSSSSFELVDTPFGKLPAS  69

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
             S++++KL  L K EE K DK+L  YIAFCGKVK E+ KI +HD  I+K M+DLI   +IT
Sbjct  70    SLSDDKLNILKKCEEEKIDKLLYRYIAFCGKVKTEVHKITKHDEPIQKTMIDLIIERRIT  129

Query  1148  KLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEV  969
             KLV+ + +M+    +S++ + G F+I   KPDFCELF++  GKLV L EEN E  ++DE 
Sbjct  130   KLVMGMPYMRSSSGRSKNTISGSFYIDRTKPDFCELFILCRGKLVRLKEENDEGYMEDED  189

Query  968   GGVIGRAREkkkkKHGFKVLLERIML--PEIADKEKRscdspsssssssvSNGLADQWEK  795
             G ++ + ++K      FK  L +++    E +        S S S S    NG  + WE 
Sbjct  190   GVIVAKLKQKT----SFKGWLGKMLSHGQERSTTYSSPRCSSSDSESPLSRNG-NNHWEL  244

Query  794   NQSEIELYLSQLSSSKTDCDAANDPLED--CVKEPTMPENMTTK------ERIEALKAKI  639
              + +IE Y  +L       +   +  E+  C    T  +N+         +RIEALK +I
Sbjct  245   YEQDIEEYFQELLLVSNSLENRENGEENGSCNMNSTSEQNILADGIQGAGDRIEALKNEI  304

Query  638   REVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAK  459
             +  +  ++ N  EA+A V+RQAKA WAI L   RAE L+A I EE++ R  L +++D+ K
Sbjct  305   QAARVTIESNDNEARAEVDRQAKASWAICLSNHRAEQLQAAIAEEISTRDDLAKDIDNTK  364

Query  458   eelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIE  279
             E+++E+  +V+E + ++NS+LELQ EL+SK+Q+SS     AE QL+ A  +R+++V+ IE
Sbjct  365   EQIHEILADVQESKDRINSLLELQSELSSKLQVSSFANLGAESQLQSAAYSRSELVREIE  424

Query  278   NLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCC-RQFSAAEIRAATNEFSERQRLKCG  102
              LR+QRDV +RRIEFCKEKDAIG A R  +   C  R+FSA EIR AT+ F+  ++L CG
Sbjct  425   ELRKQRDVFQRRIEFCKEKDAIGLATRTSDQVSCSYREFSANEIRLATDNFATYRKLTCG  484

Query  101   GNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
               WTNVYKG +N   +A+K+      +S+E FQ
Sbjct  485   REWTNVYKGRINRMSIAVKMLDSVADMSQELFQ  517



>ref|XP_006587576.1| PREDICTED: putative U-box domain-containing protein 50-like isoform 
X2 [Glycine max]
Length=753

 Score =   288 bits (736),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 202/502 (40%), Positives = 299/502 (60%), Gaps = 58/502 (12%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E++YV +G DV DG ++L W L+  +S   +I +L+  +   +DYVYTP G+LP+ SV+E
Sbjct  7     EKIYVAVGNDVQDGLKTLNWALKKWNSHPISIAVLHVTHNSTKDYVYTPFGKLPARSVSE  66

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L K E+ K +K+L+ YIAFCGKV AEIL++++ D  ++K ++DLI  L ITKLV+
Sbjct  67    EKLQILRKDEQDKINKLLSKYIAFCGKVPAEILEVEKFDEPMQKRVIDLIFGLGITKLVM  126

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
               +FMKP + KS+ A+ GLF++H  KP FCELF++ GGK VFL  +N E +++D+ G + 
Sbjct  127   GFSFMKPSM-KSKGAISGLFYVHQHKPSFCELFIICGGKQVFLRGKNDEKIMEDDRGVMS  185

Query  956   GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIE  777
              R R+K      FK  L++    +  D + RS    S++  S ++    +QWE    EIE
Sbjct  186   ARMRDKVT----FKDWLDKWFNDKTNDSQDRSTSLSSTNLESPLNQ---NQWEFYLQEIE  238

Query  776   LYLSQLSSS---KTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQQVVQLNK  606
              Y  +L SS   + +C   ND  +    EP + E+    +  E L+++IR          
Sbjct  239   KYYQELLSSNLEEGNCVLENDDSQIGPIEPHVTEH-NNYDMAEELESRIR----------  287

Query  605   KEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqteve  426
                                             EE + R  L++E D+ KE+  E++TE+E
Sbjct  288   --------------------------------EEASAREELKKESDAEKEQTVEMKTELE  315

Query  425   EKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrr  246
             E++  L S+ E+Q EL++++Q+ +  K+ AE QLE+AV  R++MV+ IE LRRQRDV  R
Sbjct  316   ERKRSLRSLTEVQSELSNRLQIWTLAKTRAETQLEKAVGERSEMVREIEELRRQRDVFNR  375

Query  245   RIEFCKEKDAIGEAKRLGEPSFCC-RQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGCL  69
             RIEFCKEKDAIG A  L E + C  R+++  E+R AT+ FS+R R K GG+WTNVY+G  
Sbjct  376   RIEFCKEKDAIGMAASLAEMTCCAFREYTEEELRLATDNFSDRLRFKSGGDWTNVYRGRF  435

Query  68    NSERVAIKLYHKSTSLSEETFQ  3
             N   VAIK+     SLS + FQ
Sbjct  436   NHSSVAIKML---PSLSHQHFQ  454



>ref|XP_006603389.1| PREDICTED: putative U-box domain-containing protein 50-like [Glycine 
max]
Length=798

 Score =   282 bits (722),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 188/511 (37%), Positives = 301/511 (59%), Gaps = 13/511 (3%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             ++ + E++YV +G D+ DGFQ+L W ++  +S   +I+IL+      + YV T +G+LP+
Sbjct  2     DATETEKIYVAVGYDIVDGFQTLSWAMKKWNSHPCSIVILHVNYNTSKKYVPTLLGKLPA  61

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
                +E+ L+ + K+E+    K+L+ YIA C  V AE L++++ D  +EK  +DLI  L I
Sbjct  62    KGASEKILERIRKHEQRIIQKLLSKYIALCDNVPAETLEVEKFDEPMEKRTIDLIHGLGI  121

Query  1151  TKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDE  972
             TKL++  +FMKP L KS   + GLF+++  KP FCELFV+FGGK V    +N E +++D+
Sbjct  122   TKLIMGFSFMKPSL-KSEVDVNGLFYVNQHKPPFCELFVIFGGKQVTPRVKNDEIIMEDD  180

Query  971   VGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKN  792
              G  I   R+K          LER+   +  D + RS  +PSSSS++       ++W+ +
Sbjct  181   NGFKIASMRDKINCID----WLERMFFDKTIDTQHRSSCAPSSSSTNFEPYLNQNEWKFS  236

Query  791   QSEIELYLSQL--------SSSKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIR  636
               EIE Y  +L        SS + +  +  +P+E  VKE     NM+  E I+ LK K+ 
Sbjct  237   FQEIENYAQELMSLNLEEGSSGQDNHVSHFNPVEPYVKERNSSNNMSAAENIDILKDKVN  296

Query  635   EVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKe  456
             E  + +QL +KE +A  ER  KAEWAI LC  R E+LE  I EE+ ++  L ++LD+ KE
Sbjct  297   EAYRTIQLKRKEDEANWERHEKAEWAIYLCNRREEELEYLIKEEVTRKEELRKDLDAEKE  356

Query  455   elyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIEN  276
             + ++++ ++E+ + KL+ + E Q EL +++ + +     AE +L +A+  +T+M+  ++ 
Sbjct  357   QFHKIKMDIEDSKKKLSLVAEQQSELLNRLHIYTLAVPQAETKLGKALAEKTEMLMEMDG  416

Query  275   LrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGN  96
             LR+QR+ + R IEF + K       RL E     R+++  EI  AT  FSE+ RLK  GN
Sbjct  417   LRKQRNAMNRSIEFFQRKRCHKNECRLIEKGCGLREYTKEEITLATQNFSEQMRLKSDGN  476

Query  95    WTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             WTNVY+G +N   VAIK+ +    LS+  FQ
Sbjct  477   WTNVYRGQINHSTVAIKMLNHVPDLSQLDFQ  507



>ref|XP_008347753.1| PREDICTED: putative U-box domain-containing protein 50 [Malus 
domestica]
Length=524

 Score =   270 bits (691),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 185/442 (42%), Positives = 272/442 (62%), Gaps = 23/442 (5%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTIC-RDYVYTPIGRLPSSS  1326
             + E+VYV +G ++ DGF++LEW LR   SQS +I+IL+   +I  +DYVY P G+LP++S
Sbjct  4     RREKVYVALGNELQDGFKTLEWTLRRWKSQSISIVILHVTYSISGKDYVYNPFGKLPAAS  63

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             V++EKLK L +YE+ K DKIL+ YIAFCG VK EILK++++D S  K+++DLIS L ITK
Sbjct  64    VSDEKLKILRRYEQEKIDKILSKYIAFCGNVKTEILKVEKYDESSHKLILDLISGLHITK  123

Query  1145  LVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             LV+  +F+K   W+ + A+   F+IH  K + CELF++ GGK VFL  EN + +++D  G
Sbjct  124   LVVGFSFIKSSSWRPKIAISVAFYIHEHKAESCELFIICGGKEVFLRGENDQIIMEDGKG  183

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
              ++ + +++       K L+E++ L      E R     S +   S+   L + WE    
Sbjct  184   VMVAKMKDEV----SIKFLIEKMFL------ENRHSSLASPTKKDSI--NLQNLWENFAQ  231

Query  785   EIELYLSQLSSS--KTDCDAAN--------DPLEDCVKEPTMPENMTTKERIEALKAKIR  636
             EIE+Y  QL S+    D +  N         P E  + +     NM+  E+ E+L+ KI 
Sbjct  232   EIEVYYQQLCSNLDAEDYELGNGTGTSQLPSPTEAIMMQMNGNPNMSLPEKYESLRTKIS  291

Query  635   EVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKe  456
             E Q  ++L KKEAK    R AKAE AI LC  RA++L+  + EE   R  L++ELD+ KE
Sbjct  292   ETQARMRLKKKEAKENANRHAKAERAICLCERRAQELDVHVKEEGDNRRELKKELDTQKE  351

Query  455   elyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIEN  276
             +L+    +++E R K+ S++ELQ EL+ K+ +S   KS A++QLE  V  R  MV+ IE 
Sbjct  352   QLHAEVKDIQESRNKIRSLIELQSELSHKLHISKMAKSQAKVQLENEVMKRVDMVRDIEV  411

Query  275   LrrqrdvlrrRIEFCKEKDAIG  210
             LRR+RDV RRRIEF   K +I 
Sbjct  412   LRRERDVFRRRIEFVAAKPSIN  433



>ref|XP_009150641.1| PREDICTED: putative U-box domain-containing protein 50 [Brassica 
rapa]
Length=798

 Score =   276 bits (705),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 202/532 (38%), Positives = 304/532 (57%), Gaps = 67/532 (13%)
 Frame = -3

Query  1529  KRQCMEESQKE----ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDY  1362
             + Q +EE  K     E+VY+ +G D+ +GF++++W L+  ++   +I++L+   +I +D+
Sbjct  5     QNQVLEEEAKGSTTVEKVYIAVGNDLQEGFKTIDWALKKWNNIPISIVLLHLC-SISKDF  63

Query  1361  VYTPIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIE  1188
             VYTP G+LP+SSV+EEKL+ L KYE+ K +K+L+ Y+ FC K  VKAE+ K+++ D SI+
Sbjct  64    VYTPFGKLPASSVSEEKLQVLRKYEDQKINKLLSKYVTFCKKLQVKAELHKVEKEDDSIQ  123

Query  1187  KIMVDLISSLQITKLVLSLTFMKPLLWKSRS-ALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              +++DLI+ L+ITKLV+ +TFM+         A+ G FHI+  KPDFCE +++ GGK+V 
Sbjct  124   VLILDLITKLRITKLVMGITFMRSSSSWKSKSAISGSFHIYQNKPDFCEFYIICGGKMVL  183

Query  1010  LIEENGESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspssssss  831
             L  EN  +   + +   IG+        H     L+R                       
Sbjct  184   LKRENDAN---NNIRSWIGK------MFHDPGRNLDR-----------------------  211

Query  830   svSNGLADQ------WEKNQSEIELYLSQLSSSKTDCDAANDPLEDCVKEPT--------  693
               SNG  D       W+KN  E+E+Y  QL S   + D      ED V+E          
Sbjct  212   -SSNGSDDPAASGSPWDKNLQEMEIYFQQLLSLNLEEDD-----EDNVQEEEDEDGGAEV  265

Query  692   ---MPENMTTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLE  522
                + +++   E++E ++ K+ E + V+  N +E K   ER  KAEWAI LC  R E+LE
Sbjct  266   ALDVLQHLNVGEKLEYVRRKVNEAKLVIDENMREVKVNAERSDKAEWAISLCNCRIEELE  325

Query  521   ACINEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKS  342
             A I EE  +R  L+E LDS +E + + + +VE+ +AKL S+ EL+ EL+SKV+     K 
Sbjct  326   AGIKEETERREKLQETLDSDRECIEQTKNDVEKGKAKLVSLGELREELSSKVETMRDAKL  385

Query  341   HAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFS  162
              AE +LER    + +M+  IE L+ QRDV  RRIEFCKEK+A G A    E     R++ 
Sbjct  386   QAEAELERVALEKGEMIMEIEKLKNQRDVFNRRIEFCKEKEATGFAS--DEVKCGYREYV  443

Query  161   AAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             A +IR AT  +S+R RLK GGNWTNVY+G +    +A+K+      LS+E F
Sbjct  444   AEDIRLATESYSDRLRLKSGGNWTNVYRGRIKHTTMAVKVI--GDRLSDEEF  493



>ref|XP_004509787.1| PREDICTED: putative U-box domain-containing protein 50-like [Cicer 
arietinum]
Length=625

 Score =   271 bits (692),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 180/513 (35%), Positives = 303/513 (59%), Gaps = 20/513 (4%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQ-STTILILYAANTICRDYVYTPIGRLP  1335
             ++ +  ++YV +G DV DGFQ+L+W L+  +S  + +I+IL+      +D+VYT +G+LP
Sbjct  2     DATQTNKIYVAVGYDVLDGFQTLDWALKKWNSHPNISIIILHVKYNPSKDHVYTLLGKLP  61

Query  1334  SSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQ  1155
             +    EEKL  + KYE+   +K+L+ YIA C K+ AE  +++R D  ++ + +DLI  L 
Sbjct  62    AKGACEEKLDCIRKYEQNIINKLLSKYIALCDKIPAETFEVERFDEPMQNLTLDLILGLG  121

Query  1154  ITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKD  975
             ITKLV+  +FM+P + KS+ A+ GLF++H  KPDFCELF++ GGK V    +NGE  ++D
Sbjct  122   ITKLVMGFSFMRPSI-KSKDAMNGLFYVHQHKPDFCELFIICGGKQVSPRVKNGEITMED  180

Query  974   EVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEK  795
             + G  + + R+K      FK  LER++  +  D   ++      SS+      L    E+
Sbjct  181   DNGVKVAKMRDKM----SFKDWLERMISDKTIDSNHKNSSRSPISSTY-----LEAHLEQ  231

Query  794   NQ-SEIELYLSQLSS--------SKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAK  642
             N   EIE YL +L S         + + D+   P+E   ++  + +N +  E+ E L  K
Sbjct  232   NYIQEIENYLHELVSLNFEEGSFGQDNHDSFVTPIEPYFQKLQISDNKSAAEKFEILTDK  291

Query  641   IREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSA  462
             + E    +Q+ +KE K  +E+ AKAEWAI +C  R E++E   +EE+ ++  L++E+++ 
Sbjct  292   LNEAYNTIQVKRKEEKDNLEKHAKAEWAIYICNRREEEVEYLKSEELTRKDELKKEVNAE  351

Query  461   KeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGI  282
              E++ +++  VEE + +L+S+ ELQ EL +K+ +S  + S  E +LE+    R +M+  I
Sbjct  352   NEKINKIRMSVEESKQRLHSLKELQLELQNKLHVSKLKFSEFETKLEKVNAARNEMLMKI  411

Query  281   ENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCG  102
             E L RQRD++ + I F KEK+    + ++ E     R+++  +I  AT+ FSE  RLK  
Sbjct  412   EELSRQRDIMNKWIMFIKEKNVTKISTKVIENECGLREYTKEDIILATHNFSEHLRLKSC  471

Query  101   GNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
              NW+NV++G ++    AIK+   +  LS++ FQ
Sbjct  472   ENWSNVFRGYIDHSNAAIKMLDSTLGLSQQDFQ  504



>ref|XP_010547594.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X2 [Tarenaya hassleriana]
Length=767

 Score =   273 bits (698),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 188/502 (37%), Positives = 293/502 (58%), Gaps = 57/502 (11%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G  V DGF++++W L+     + +I+IL+ +N +  D VYTP G+LP+SSV+E
Sbjct  11    EKVYVAVGNGVEDGFKTIDWALKKWDPINISIVILHISN-LSNDLVYTPFGKLPASSVSE  69

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL            ++L  Y     KVKAE LK++  D  I+ +++DLIS L+ITKLV+
Sbjct  70    EKL------------QVLRKYEE--EKVKAETLKVEMQDDPIQVLILDLISKLKITKLVM  115

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVI  957
              +TFM+   WK++SA+ G F+++  KP+FCE  ++ GGK+V L  ++  +  ++  G + 
Sbjct  116   GITFMRSSSWKAKSAISGSFYVYRHKPEFCEFHIICGGKMVALRRDDDGNNTRNWFGKMF  175

Query  956   GRAREkkkkKHGFKVLLERI--MLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
                       H     L+R   +  +  D E                    + W+KN  E
Sbjct  176   ----------HDPTRNLDRSSSVGEDPMDSE--------------------NPWDKNSRE  205

Query  782   IELYLSQLSSSKTDCDAANDPL---EDCVKEPTMPENMTTKERIEALKAKIREVQQVVQL  612
              + Y  QL S   D D   +     ED   E    + M   E+++ +K K +E Q++++ 
Sbjct  206   TDDYYHQLLSLNVDDDTDGNNFVEEEDGDVELDALQRMNAGEKMKYVKRKAKEAQEMIEQ  265

Query  611   NKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqte  432
             NK+EAKA  ER AKAE AI LC+ R ++LE  + EE  +R  ++E L++ KE L E+  +
Sbjct  266   NKREAKANAERYAKAERAISLCSCRIQELETQVQEESERRVKIDEILETEKELLDEVIRD  325

Query  431   veEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvl  252
             V+E++AKL+S+ +LQREL+SK+   +  KS AE +LE+ V  R + V+ +E  R QRD+ 
Sbjct  326   VQEEKAKLSSLGKLQRELSSKLSTVTTAKSEAETRLEKVVSQRNETVREMEKSRHQRDIF  385

Query  251   rrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGC  72
              RRIEFCKE++AIG   RL       R+++A ++R AT++FS+R RLK GGNW  VY+G 
Sbjct  386   NRRIEFCKEREAIGLVSRL-----SYREYAAEDVRLATDDFSDRWRLKSGGNWRRVYRGR  440

Query  71    LNSERVAIKLYHKSTSLSEETF  6
             +N   +A+K+   S  LS++ F
Sbjct  441   INHTTMAVKM--TSDCLSDQDF  460



>ref|XP_010463003.1| PREDICTED: putative U-box domain-containing protein 50 [Camelina 
sativa]
Length=803

 Score =   272 bits (696),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 203/533 (38%), Positives = 305/533 (57%), Gaps = 64/533 (12%)
 Frame = -3

Query  1529  KRQCMEE-----SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRD  1365
             K Q +EE     S   E+VY+ +G DV +G++++ W ++  ++   +I++L+  N I +D
Sbjct  5     KNQELEEEAGLGSTTMEKVYIAVGNDVQEGYKTIHWAIKKWNNIPISIVLLHLCN-ISQD  63

Query  1364  YVYTPIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSI  1191
             +VYTP G+LP+SSV+EEKL+ L KYEE K DK+L+ YIAFCGK  VKAE+LK+++ D SI
Sbjct  64    FVYTPFGKLPASSVSEEKLQVLRKYEEQKIDKLLSKYIAFCGKLQVKAELLKVEKQDDSI  123

Query  1190  EKIMVDLISSLQITKLVLSLTFMKPLLWKSRS-ALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             + +++DLIS L+ITKLV+ +TFM+         A+ G F+++  KP++CE +++ GGK+V
Sbjct  124   QVLILDLISKLRITKLVMGITFMRSSSSWKSKSAISGSFYVYQNKPEYCEFYIICGGKMV  183

Query  1013  FLIEENGESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssss  834
              L  EN E+   + +   IG+                      +     R+ D  S S+ 
Sbjct  184   SLKRENDEN---NNIRSWIGK----------------------MFHDPGRNLDRSSGSND  218

Query  833   ssvSNGLADQWEKNQSEIELYLSQLSSSKTDC-----------------DAANDPLEDCV  705
              S ++G +  W+ N   IE Y  QL S   +                  D A D L+   
Sbjct  219   DSTASG-SSTWDNNLQVIENYFQQLLSLNLEEEEDENGVEEEQEGEEEEDLALDVLQ---  274

Query  704   KEPTMPENMTTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDL  525
                    +M   E++E ++ K+ E + ++   ++E K   ER  KAEWAI LC SR E+L
Sbjct  275   -------HMNVAEKLEYVRRKVNEAKLMIDEKREEVKVNSERSDKAEWAISLCNSRIEEL  327

Query  524   EACINEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEK  345
             EA I EE  +R  L+  LDS    + E +  VE+ + KL+S+ ELQ +L+SKV+   ++K
Sbjct  328   EAWIKEESERREKLQVTLDSDISCIEEAKNYVEKGKTKLHSLGELQEKLSSKVKTMMEDK  387

Query  344   SHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQF  165
                E++LER V  + +M+  IE L+ QRDV   RIEFCKEK+A G      E     R++
Sbjct  388   LQVEVELERVVLQKGEMITEIEKLKNQRDVFNLRIEFCKEKEARGLVPEEEEVKCGYREY  447

Query  164   SAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
              AA+IR AT  +S+R RLK GGNWTNVY+G +    VA+K+     SLS+E F
Sbjct  448   VAADIRLATESYSDRLRLKSGGNWTNVYRGRIERTTVAVKVI--GDSLSDEDF  498



>emb|CDY67215.1| BnaAnng23860D [Brassica napus]
Length=798

 Score =   271 bits (694),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 200/533 (38%), Positives = 303/533 (57%), Gaps = 69/533 (13%)
 Frame = -3

Query  1529  KRQCMEESQKE----ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDY  1362
             + Q +EE  K     E+VY+ +G D+ +GF++++W L+  ++   +I++L+   +I +D+
Sbjct  5     QNQVLEEEAKGSTTVEKVYIAVGNDLQEGFKTIDWALKKWNNIPISIVLLHLC-SISQDF  63

Query  1361  VYTPIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIE  1188
             VYTP G+LP+SSV+EEKL+ L KYE+ K +K+L+ Y+ FC K  VKAE+ K+++ D SI+
Sbjct  64    VYTPFGKLPASSVSEEKLQVLRKYEDQKINKLLSKYVTFCKKLQVKAELHKVEKEDDSIQ  123

Query  1187  KIMVDLISSLQITKLVLSLTFMKPLLWKSRS-ALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              +++DLI+ L+ITKLV+ +TFM+         A+ G FHI+  KPDFCE +++ GGK+V 
Sbjct  124   VLILDLITKLRITKLVMGITFMRSSSSWKSKSAISGSFHIYQNKPDFCEFYIICGGKMVL  183

Query  1010  LIEEN-GESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssss  834
             L  EN   + I+  +G +           H     L+R                      
Sbjct  184   LKRENDANNNIRSWIGKMF----------HDPGRNLDR----------------------  211

Query  833   ssvSNGLADQ------WEKNQSEIELYLSQLSSSKTDCDAANDPLEDCVKEPT-------  693
                SNG  D       W+KN  E+E+Y  QL S   D D      ED V+E         
Sbjct  212   --SSNGSDDPAASGSPWDKNLQEMEIYFQQLLSLNLDEDD-----EDNVQEEEDEDGGEK  264

Query  692   ----MPENMTTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDL  525
                 + +++   E++E ++ K+ E + ++  N +E K   ER  KAEWAI LC  R E+L
Sbjct  265   VALDVLQHLNVGEKLEYVRRKVNEAKLMIDGNMREVKVNAERSDKAEWAISLCNCRIEEL  324

Query  524   EACINEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEK  345
             EA I EE  +R  L+  LDS +E + + + ++E+ +AKL S+ EL+ EL+SKV+   + K
Sbjct  325   EAGIKEESERREKLQGTLDSDRECIEQTKNDIEKGKAKLVSLGELREELSSKVETMREAK  384

Query  344   SHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQF  165
                E +LER    + +M+  IE LR QRDV  RRIEFCKEK+A G A    E     R++
Sbjct  385   LQTEAELERVALEKGEMIMEIEKLRNQRDVFNRRIEFCKEKEATGFAA--DEVKCGYREY  442

Query  164   SAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
              A +IR AT  +S+R RLK GGNWTNVY+G +    +A+K+      LS+E F
Sbjct  443   VAEDIRLATESYSDRLRLKSGGNWTNVYRGRIKHTTMAVKVI--GDRLSDEEF  493



>ref|NP_201353.4| U-box domain-containing protein kinase family protein [Arabidopsis 
thaliana]
 gb|AED98064.1| U-box domain-containing protein kinase family protein [Arabidopsis 
thaliana]
Length=791

 Score =   268 bits (686),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 191/506 (38%), Positives = 289/506 (57%), Gaps = 36/506 (7%)
 Frame = -3

Query  1514  EESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLP  1335
             E   + E+VY+ +G DV +G++++ W L+  ++   +I++L+  N I +D+VYTP G+LP
Sbjct  14    ESGSRMEKVYIAVGNDVQEGYKTIHWALKKWNNIPISIVLLHLCN-ISQDFVYTPFGKLP  72

Query  1334  SSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQ  1155
             +SSV+EEKL+ L KYE+ K DK+L+ YI FCGKVKAE+LK+++   SI+ +++DLIS L+
Sbjct  73    ASSVSEEKLQVLRKYEDQKIDKLLSKYITFCGKVKAELLKVEKQHDSIQVLILDLISKLR  132

Query  1154  ITKLVLSLTFMKPLLWKSRS-ALRGLFHIHNQKPDFCELFVVFGGKLVFL--IEENGESV  984
             ITKLV+ +TFM+         A+ G F+++  KP+FCE +++ GGK+V L     N  S 
Sbjct  133   ITKLVMGITFMRSSSSWKSKSAISGSFYVYQNKPEFCEFYIICGGKMVSLKNDVNNNNSN  192

Query  983   IKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQ  804
             I+  +G +         +  G                            ++         
Sbjct  193   IRSWIGKMFHDPGRNLDRSSG----------------------------NNDDPTASGSS  224

Query  803   WEKNQSEIELYLSQLSSSKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQQ  624
             W+KN  EIE Y  QL S     +   + +E+  ++         +  ++ L+ K+ E + 
Sbjct  225   WDKNLQEIENYFQQLLSLNLAEEETENVVEEEQEDDDDVALNVLQHMVKILR-KVNEAKL  283

Query  623   VVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelye  444
             ++    +E K   ER  +AEWAI LC SR  + EA I EE  +R  L+  LDS KE + E
Sbjct  284   MIDEKSREVKVNAERSNRAEWAISLCNSRIGEFEAWIKEESERREKLQATLDSDKECIEE  343

Query  443   lqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrq  264
              +  VE+ + KL+S+ ELQ  L+SKV+   + KS AE++LER V  R +M+  IE LR Q
Sbjct  344   AKNYVEKGKTKLHSLAELQEVLSSKVKTMMEAKSQAEVELERVVLQRGEMITEIEKLRSQ  403

Query  263   rdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNV  84
             RDV  RRIEFCKE++ IG   +  E     R++ A +IR AT  +S+R RLK GGNWTNV
Sbjct  404   RDVFNRRIEFCKEREVIGSVSK-EEVKCGYREYVAEDIRLATETYSDRLRLKSGGNWTNV  462

Query  83    YKGCLNSERVAIKLYHKSTSLSEETF  6
             Y+G +    VA+K+     SLS+E F
Sbjct  463   YRGRIKHTTVAVKVI--GDSLSDEAF  486



>ref|XP_004160941.1| PREDICTED: putative U-box domain-containing protein 50-like [Cucumis 
sativus]
Length=775

 Score =   267 bits (683),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 191/510 (37%), Positives = 282/510 (55%), Gaps = 53/510 (10%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             K ++V+V IG D+ DGF++L W LR   S   +I+IL+ ++    +YV+TP G+LP SSV
Sbjct  4     KPDKVFVAIGNDLQDGFKTLGWTLRKWKSHPISIVILHVSHNNSMEYVHTPFGKLPVSSV  63

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             +EEK++ L +YE+ K +K+L+ Y+ FCGKV+AEILK++R D  + K++VDL+S L IT L
Sbjct  64    SEEKVEVLRRYEQEKINKLLSKYVDFCGKVRAEILKVERSDKPVHKLIVDLVSELGITNL  123

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGG  963
             V+  TFMK   WK ++A+ G F+I+  K  FCEL+V++GGK VFL +E    +++D+ G 
Sbjct  124   VIGFTFMKSSSWKPKNAISGSFYIYRNKAHFCELYVIWGGKQVFLRDER---IMEDDRGV  180

Query  962   VIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
              I +       KH  +  L ++ + +      R+    SSS  +S S    + W+ N  E
Sbjct  181   RISKI----STKHSLRGWLGKMFMEDPTYSSDRNLSLSSSSPRNSNSMSSRNYWDHNVQE  236

Query  782   IELYLSQLSS----SKTDCDAANDPL--EDCVKE----PTMPENMTTKERIEALKAKIRE  633
             +E Y  +L S     + DC+   D +    C  +      +  N   +ERIE L+ KI E
Sbjct  237   LENYYEELLSLNVQEEEDCEQDQDGVLENSCSTQFNILDYLDSNTNPEERIEHLRTKIEE  296

Query  632   VQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKee  453
              ++ +QL + E K   ERQAKAEWAI LC+ R ++LEA I EE+  R             
Sbjct  297   ARKSIQLMRDETKGSSERQAKAEWAINLCSQRTDELEAKIKEEVTIRE------------  344

Query  452   lyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENL  273
                                ELQ+EL S+       K      +    + +  M + IE L
Sbjct  345   -------------------ELQKELGSQATNFHSRKIAFRGSIGEDSKNKKGMEREIEEL  385

Query  272   rrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW  93
             RRQR++L RRIEFCK+KDAIG  +R  E S   R ++  EI  AT+ FSE+ RL      
Sbjct  386   RRQREILHRRIEFCKDKDAIGMGERSTEVSCSTRVYTVEEISLATDNFSEQMRLS-----  440

Query  92    TNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             + VY+G +N   VAI++      LSE+ FQ
Sbjct  441   SRVYRGRINHMSVAIQMIASGNRLSEDDFQ  470



>ref|XP_006394022.1| hypothetical protein EUTSA_v10003671mg [Eutrema salsugineum]
 gb|ESQ31308.1| hypothetical protein EUTSA_v10003671mg [Eutrema salsugineum]
Length=794

 Score =   267 bits (683),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 197/520 (38%), Positives = 304/520 (58%), Gaps = 47/520 (9%)
 Frame = -3

Query  1529  KRQCMEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTP  1350
             K   ++E    E+VY+ +G D+ +GF++++W L+  ++ S +I++L+    I +D+VYTP
Sbjct  5     KNHEIKEGSTTEKVYIAVGNDLQEGFKTIDWALKKWNNISISIVLLHLC-YISQDFVYTP  63

Query  1349  IGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMV  1176
              G+LP+SSV+EEKL+ L KYEE K +K+L+ Y+ FCGK  VKAE+LK+++ D S++ +++
Sbjct  64    FGKLPASSVSEEKLEVLRKYEEQKINKLLSKYVTFCGKLQVKAELLKVEKQDDSVQVLIL  123

Query  1175  DLISSLQITKLVLSLTFMKPLL-WKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEE  999
             DLIS L+ITK V+ +TFM+    WK++SA+ G F+++  KP+FCE  ++ GGK+V L  E
Sbjct  124   DLISKLRITKFVMGITFMRSSSSWKTKSAISGSFYVYQNKPEFCEFHIICGGKMVSLKRE  183

Query  998   NGESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSN  819
             N +    + +   IG+        H     L+R     I + ++ +              
Sbjct  184   N-DVNNNNNIRSWIGKM------FHDPGRNLDR---SSINNDDQTAS-------------  220

Query  818   GLADQWEKNQSEIELYLSQLSSSKTDCDAANDPLEDCVKEPT---------MPENMTTKE  666
                  W+ N  E+E Y  QL S   + D      E+ V++           + ++M   E
Sbjct  221   --GSPWDNNLQEMENYFQQLLSLNLEED------ENAVEDNDDDDDGVALDVLQHMNVAE  272

Query  665   RIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAH  486
             ++E ++ K+ E + + +   +E K   ER  KA+WAI LC  R E+LEA I EE  KR  
Sbjct  273   KLEYVRRKVNEAKLMTEEKMREVKVNAERSDKADWAISLCNCRIEELEAGIKEESEKREK  332

Query  485   LEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRT  306
             L+  LDS +E + E + EVE+ + KL S+ EL+ EL+SKV+   + KS AE +LER V  
Sbjct  333   LQGVLDSDRECIEEARNEVEKGKTKLVSLGELREELSSKVKTMMEAKSKAEAELERVVIM  392

Query  305   RTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFS  126
             + + +  IE LR QRDV  RRI FCKEK+AIG   +  E     R++ A +I  AT  +S
Sbjct  393   KGETMMEIEKLRNQRDVFNRRIAFCKEKEAIGLVSK-EEVKCGYREYVAEDIILATESYS  451

Query  125   ERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             +R RLK GGNWTNVY+G +    VA+K+      LS+E F
Sbjct  452   DRLRLKSGGNWTNVYRGRIKHTTVAVKVI--GDRLSDEGF  489



>ref|XP_010484349.1| PREDICTED: putative U-box domain-containing protein 50 [Camelina 
sativa]
Length=805

 Score =   267 bits (683),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 193/509 (38%), Positives = 294/509 (58%), Gaps = 43/509 (8%)
 Frame = -3

Query  1493  RVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             +VY+ +G DV +G++++ W ++  +    +I++L+  N I +D+VYTP G+LP+SSV+EE
Sbjct  22    KVYIAVGNDVQEGYKTIHWAIKKWNDIPISIVLLHLCN-ISQDFVYTPFGKLPASSVSEE  80

Query  1313  klkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
             KL+ L +YEE K +K+L+ YI FCGK  VKAE+LK+++ D SI+ +++D+IS L+ITKLV
Sbjct  81    KLQVLRQYEEQKINKLLSKYITFCGKLQVKAELLKVEKQDDSIQVLILDIISKLRITKLV  140

Query  1139  LSLTFMKPLLWKSRS-ALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGG  963
             + +TFM+         A+ G F+++  KP++CE +++ GGK+V L  EN    +   +  
Sbjct  141   MGITFMRSSSSWKSKSAISGSFYVYQNKPEYCEFYIICGGKMVSLKREND---VNSNIRS  197

Query  962   VIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
              IG+                      +     R+ D  S S+  S ++G +  WE N   
Sbjct  198   WIGK----------------------MFHDPGRNLDRSSGSNDDSTASG-SSTWENNLQV  234

Query  782   IELYLSQLSSSKTD----------CDAANDPLEDCVKEPTMPENMTTKERIEALKAKIRE  633
             IE Y  QL S   +           +      ED +    + ++M   E++E ++ K+ E
Sbjct  235   IENYFQQLLSLNLEEEEEELENGVAEEQEGEEEDVLALDVL-QHMNVAEKLEYVRRKVNE  293

Query  632   VQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKee  453
              + ++   ++E K   ER  KAEWAI LC SR E+LEA I EE  +R  L+  LDS  + 
Sbjct  294   AKLMIDEKREEVKVNAERSDKAEWAISLCNSRIEELEAWIKEESERRDKLQVTLDSDIKC  353

Query  452   lyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENL  273
             + E +  VE+ + KL+S+ ELQ EL+SKV+   + K   E++LERAV  R  M+  IE L
Sbjct  354   IEEAKNYVEKGKTKLHSLGELQEELSSKVKTMMEAKLQVEVELERAVSQRGDMITEIEKL  413

Query  272   rrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW  93
             + QRDV   RIEFCKEK+A G      E     R++  A+IR AT  +S+R RLK GGNW
Sbjct  414   KNQRDVFNLRIEFCKEKEARGLVPEEEEVKCGYREYVGADIRLATESYSDRLRLKSGGNW  473

Query  92    TNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             TNVY+G +    VA+K+     SLS+E F
Sbjct  474   TNVYRGRIERTTVAVKVI--GDSLSDEDF  500



>emb|CDX81289.1| BnaC09g07000D [Brassica napus]
Length=799

 Score =   267 bits (683),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 192/511 (38%), Positives = 291/511 (57%), Gaps = 41/511 (8%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E    E+VY+ +G D+ +GF++++W L+   +   +I++L+  N I +D+VYTP G+LP+
Sbjct  14    EGSATEKVYIAVGSDIQEGFKTIDWALKKWHNTPISIVLLHFCN-ILQDFVYTPFGKLPA  72

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLISSL  1158
             SSV+EEKL+ L KYE+ K +K+L+ Y+ FCGK  VKAE+LK++  D SI+ +++DLISSL
Sbjct  73    SSVSEEKLEVLRKYEDQKINKLLSKYVTFCGKLQVKAELLKVENQDDSIQMLILDLISSL  132

Query  1157  QITKLVLSLTFMKPLLWKSRS----ALRGLFHIHNQKPDFCELFVVFGGKLVFLIEEN-G  993
             +ITKLV+ +TFM+     S      A+ G F+++  KPDFCE +++ GG +V L  +N  
Sbjct  133   KITKLVMGITFMRSSSSSSSWKSKSAISGSFYVYQNKPDFCEFYIICGGNMVMLKRDNDA  192

Query  992   ESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGL  813
              + IK  +G +           H     L+R       D                   G 
Sbjct  193   NNNIKSWIGKMF----------HDPGRNLDRSSSGNDDDSA-----------------GS  225

Query  812   ADQWEKNQSEIELYLSQLSS-----SKTDCDAANDPLEDCVKEPTMPENMTTKERIEALK  648
                W+KN  E+E Y  QL S        +    +D  E+      + ++M   E++E ++
Sbjct  226   GSPWDKNLQEMESYFQQLLSLNLEEDDVEETEEDDNEEEVEVALNVLQHMNVAEKLEYMR  285

Query  647   AKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELD  468
              K+ E + +++ N +E K   ER  KAEWAI LC  R E+LEA + +E  +R  L+  LD
Sbjct  286   RKVNEAKLMIEENMREVKVNSERSDKAEWAISLCTCRIEELEAGVKQESERRKKLQMTLD  345

Query  467   SAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQ  288
             S KE + E + +VEE + KL S+  L+ EL SK +   + KS AE +LE  V  + +MV 
Sbjct  346   SDKECIQEAKNDVEEGKTKLVSLGGLKEELTSKAKTMMEAKSEAEAELESVVLKKGEMVM  405

Query  287   GIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLK  108
              IE LR QRD+   RIEFCKEK+A G   +  E     R++ A +I+ AT  +S+R RLK
Sbjct  406   EIEKLRNQRDIFNLRIEFCKEKEATGLDSK-EEVKCGYREYVADDIKLATESYSDRLRLK  464

Query  107   CGGNWTNVYKGCLNSERVAIKLYHKSTSLSE  15
              GGNWTNVY+G +    +A+K+   S S +E
Sbjct  465   SGGNWTNVYRGKIKHTTMAVKVIGDSLSDAE  495



>ref|XP_011021853.1| PREDICTED: LOW QUALITY PROTEIN: putative U-box domain-containing 
protein 50 [Populus euphratica]
Length=792

 Score =   267 bits (682),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 195/513 (38%), Positives = 296/513 (58%), Gaps = 44/513 (9%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAA----NTICRDYVYTPIGRLPSS  1329
             E+V V +G D+  GF++ +W L    S +   ++  +       + +D+VYTP  + P+S
Sbjct  6     EKVCVALGNDLQHGFKTXDWTLGKWKSINPISVVFLSPCDPQYNVSKDFVYTPSWKPPAS  65

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
             SV++EKL+ L KYE  K DK+L+ YIAF GKV   +LK+++ D +I K++VDLIS+L+IT
Sbjct  66    SVSDEKLEVLRKYEXGKIDKLLSEYIAFRGKVCWHLLKVEKSDETIHKVIVDLISTLRIT  125

Query  1148  KLVLSLTFMKPLLWKSRS-ALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDE  972
             KLV+ L FM+          + G  HIH   P F           V L  E  E  ++D+
Sbjct  126   KLVMRLAFMESSSSWRSKSVISGSSHIHQHNPKF-----------VLLKGEKEEGFMEDD  174

Query  971   VGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKN  792
              G ++ +          F+  L ++      D  +    S +  +         +QWE  
Sbjct  175   QGVMVAKKA-------NFRSWLGKMFTDNSHDPHQLPASSKALENE--------NQWENY  219

Query  791   QSEIELYLSQLSSSKTD---CDAANDPLEDCVKEPTMPEN------MTTKERIEALKAKI  639
               EIE Y   L S   D   C   ND L+    EP + E+      M+   ++ +++ ++
Sbjct  220   AQEIENYFEHLLSLNLDEEICKEENDILQAGSTEPGVAEDAVSTMAMSVAAKMASMRRRM  279

Query  638   REVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAK  459
                Q+++Q+ ++E+K   ER AKAEWA  LC SR E+LEA I EE+  R  L + LD+  
Sbjct  280   EGTQKMIQMKREESKVNSERCAKAEWAKCLCNSRVEELEAKIQEEVLNRLDLSKSLDAEN  339

Query  458   eelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIE  279
             E++ E++ +++E + +L+S++EL+ E+ SK+Q S+  +SH E+QLE+AV  R QMV+ IE
Sbjct  340   EQIQEIRRDIQESKKRLSSLVELRSEVYSKLQTSTMARSHVEVQLEKAVIARAQMVREIE  399

Query  278   NLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCC--RQFSAAEIRAATNEFSERQRLKC  105
              LRRQRDVLRRRIEFCKEKDA+G   +L E   CC  R+++  +IR+AT+ FSE  RLK 
Sbjct  400   ELRRQRDVLRRRIEFCKEKDAVGTVAKLNE--LCCGYREYTTKDIRSATDNFSESLRLKS  457

Query  104   GGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             GG+ TNVY+G +N   VAIK+ +    LS+E F
Sbjct  458   GGHLTNVYRGRINHTTVAIKMLNFDYGLSQEAF  490



>emb|CDY54713.1| BnaA09g52450D [Brassica napus]
Length=798

 Score =   267 bits (682),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 200/514 (39%), Positives = 302/514 (59%), Gaps = 43/514 (8%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E    E+VY+ +G D+ +GF++++W L+   +   +I++L+  N I +D+VYTP G+LP+
Sbjct  14    EGSTTEKVYIAVGSDIQEGFKTIDWALKKWHNTPISIVLLHFCN-ILQDFVYTPFGKLPA  72

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLISSL  1158
             SSV+EEKL+ L KYE+ K +K+L+ Y+ FCGK  VKAE+LK++  D  I  +++DLIS L
Sbjct  73    SSVSEEKLEVLRKYEDQKINKLLSKYVTFCGKLQVKAELLKVENQDDFIPTLILDLISKL  132

Query  1157  QITKLVLSLTFMKPLLWKSRS----ALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGE  990
             +ITKLV+ +TFM+     S      A+ G F+++  KPDFCE +++ GGK+V L  EN  
Sbjct  133   KITKLVMGITFMRSSSSSSSWKSKSAISGSFYVYQNKPDFCEFYIICGGKMVMLKREND-  191

Query  989   SVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLA  810
               + + +   IG+                      +     RS D  SSS+  S  +G  
Sbjct  192   --VNNNMRSWIGK----------------------MFHDPGRSLDRSSSSNDDSTGSG--  225

Query  809   DQWEKNQSEIELYLSQLSSSKTDCDAANDPLEDCVKEPTMPEN----MTTKERIEALKAK  642
               W+KN  E+E Y  QL S   + D   +  ED  +E  +  N    M   E++E ++ K
Sbjct  226   SPWDKNLQEMESYFQQLLSLNLEEDDVEETEEDDDEEEGVALNVLQHMNVAEKLEYVRRK  285

Query  641   IREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSA  462
             + E + +++ N +E K   ER  KAEWAI LC  R E+LEA I +E  +R +L+  LDS 
Sbjct  286   VNEAKLMIEENMREVKVNSERSDKAEWAISLCTCRIEELEAGIKQESERRKNLQVTLDSD  345

Query  461   KeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGI  282
             KE + E + +VE+ + KL S+  L+ EL+SK Q   + KS AE +LE  V  + +MV  I
Sbjct  346   KECIQEAKNDVEKGKTKLVSLGGLKEELSSKAQTMMEAKSQAEAELESVVLKKGEMVMEI  405

Query  281   ENLrrqrdvlrrRIEFCKEKDAIG-EAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKC  105
             E LR QRD+   RIEFCKEK+A G +AK   E     R++ A +++ AT  +S+R RLK 
Sbjct  406   EKLRNQRDIFNLRIEFCKEKEATGLDAKE--EVKCGYREYVADDVKLATESYSDRLRLKS  463

Query  104   GGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             GGNWTNVY+G +    +A+K+     +LS+E F+
Sbjct  464   GGNWTNVYRGRIKHTTMAVKVI--GDTLSDEVFK  495



>emb|CDY14575.1| BnaC03g48840D [Brassica napus]
Length=798

 Score =   266 bits (680),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 194/528 (37%), Positives = 299/528 (57%), Gaps = 59/528 (11%)
 Frame = -3

Query  1529  KRQCMEESQKE----ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDY  1362
             + Q +EE  K     E+VY+ +G D+ +GF++++W L+   +   +I++L+   +I +D+
Sbjct  5     QNQVLEEEAKGSTTVEKVYIAVGNDLQEGFKTIDWALKKWDNIPISIVLLHLC-SISQDF  63

Query  1361  VYTPIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIE  1188
             VYTP G+LP+SSV+EEKL+ L KYE+ K +K+L+ Y+ FC K  VKAE+ K+++ D SI+
Sbjct  64    VYTPFGKLPASSVSEEKLQVLRKYEDQKINKLLSKYVTFCKKLQVKAELHKVEKEDDSIQ  123

Query  1187  KIMVDLISSLQITKLVLSLTFMKPLLWKSRS-ALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              +++DLI+  +ITKLV+ +TFM+         A+ G FHI+  KPDFCE +++ GGK+V 
Sbjct  124   VLILDLITKFRITKLVMGITFMRSSSSWKSKSAISGSFHIYQNKPDFCEFYIICGGKMVL  183

Query  1010  LIEEN-GESVIKDEVGGVI-GRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspssss  837
             L  EN   + I+  +G +     R   +  +G          PE +              
Sbjct  184   LKRENDANNNIRSWIGKMFHDPGRNLDRSSNGSDD-------PEAS--------------  222

Query  836   sssvSNGLADQWEKNQSEIELYLSQLSSSKTDCDAANDPLEDCVKEPT-----------M  690
                        W+KN  E+E+Y  QL S   + D      ED V+E             +
Sbjct  223   --------GSPWDKNLQEMEIYFQQLLSLNLEEDD-----EDNVQEEEDEDGGDEVALDV  269

Query  689   PENMTTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACIN  510
              +++   E++E ++ K+ E + ++  N +E K   ER  KAEWAI LC  R E+LEA I 
Sbjct  270   LQHLNVGEKLEYVRRKVNEAKLMIDENMREVKVNAERLDKAEWAISLCNCRIEELEAGIK  329

Query  509   EEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEI  330
             EE  +R  L+  LDS +E + + + +VE+ +AKL S+ EL+ EL+SKV+   + K  AE 
Sbjct  330   EETERREKLQGTLDSDRECIEQTKNDVEKGKAKLVSLGELREELSSKVETMREAKQRAEA  389

Query  329   QLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEI  150
             +LER    + +M+  IE L+ QRDV  RRIEFCKEK  +   K   E     R++ A +I
Sbjct  390   ELERVALEKGEMIMEIEKLKNQRDVFNRRIEFCKEKGLLDSKKE--EVKCGYREYVAEDI  447

Query  149   RAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             R AT  +S+R RLK GGNWTNVY+G +    +A+K+      LS+E F
Sbjct  448   RLATESYSDRLRLKSGGNWTNVYRGRIKHTTMAVKVI--GDRLSDEEF  493



>ref|XP_009112188.1| PREDICTED: putative U-box domain-containing protein 50 [Brassica 
rapa]
Length=798

 Score =   263 bits (672),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 194/513 (38%), Positives = 296/513 (58%), Gaps = 41/513 (8%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E    E+VY+ +G D+ +GF++++W L+   +   +I++L+  N I +D+VYTP G+LP+
Sbjct  14    EGSTTEKVYIAVGSDIQEGFKTIDWALKKWHNTPISIVLLHFCN-ILQDFVYTPFGKLPA  72

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLISSL  1158
             SSV+EEKL+ L KYE+ K +K+L+ Y+ FCGK  VKAE+LK++  D  I  +++DLIS L
Sbjct  73    SSVSEEKLEVLRKYEDQKINKLLSKYVTFCGKLQVKAELLKVENQDDFIPTLILDLISKL  132

Query  1157  QITKLVLSLTFMKPLLWKSRS----ALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGE  990
             +ITKLV+ +TFM+     S      A+ G F+++  KPDFCE +++ GGK+V L  EN  
Sbjct  133   KITKLVMGITFMRSSSSSSSWKSKSAISGSFYVYQNKPDFCEFYIICGGKMVMLKRENDA  192

Query  989   SVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLA  810
             +   + +   IG+                        D  +    S SS+  S    G  
Sbjct  193   N---NNMRSWIGKM---------------------FHDPGRSLDLSSSSNDDS---TGSG  225

Query  809   DQWEKNQSEIELYLSQLSSSKTDCDAANDPLEDCVKEPTMPEN----MTTKERIEALKAK  642
               W+KN  E+E Y  QL S   + D   +  ED  +E  +  N    M   E++E ++ K
Sbjct  226   SPWDKNLQEMESYFQQLLSLNLEEDDVEETEEDDDEEEGVALNVLQHMNVAEKLEYVRRK  285

Query  641   IREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSA  462
             + E + +++ N +E K   ER  KAEWAI LC  R E+LE  I +E  +R  L+  LDS 
Sbjct  286   VNEAKLMIEENMREVKVNCERSDKAEWAISLCTCRIEELEGGIKQESERREKLQVTLDSD  345

Query  461   KeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGI  282
             KE + E + +VE+ + KL S+  ++ EL+SK +  ++ KS AE +LE  V  + +MV  I
Sbjct  346   KECIQEAKNDVEKGKTKLVSLGGIKEELSSKAKTMTEAKSQAEAELESVVLKKGEMVMEI  405

Query  281   ENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCG  102
             E LR QRD+   RIEFCKEK+A G   +  E     R++ A +I+ AT  +S+R RLK G
Sbjct  406   EKLRNQRDIFNLRIEFCKEKEATGLDSK-EEVKCGYREYVADDIKLATESYSDRLRLKSG  464

Query  101   GNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             GNWTNVY+G +    +A+K+     +LS+E F+
Sbjct  465   GNWTNVYRGRIKHTTMAVKVI--GDTLSDEVFK  495



>ref|XP_010444515.1| PREDICTED: putative U-box domain-containing protein 50 [Camelina 
sativa]
Length=807

 Score =   258 bits (658),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 202/532 (38%), Positives = 303/532 (57%), Gaps = 60/532 (11%)
 Frame = -3

Query  1529  KRQCMEE-----SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRD  1365
             K Q +EE     S   E+VY+ +G DV +G++++ W ++  ++   +I++L+  N I +D
Sbjct  5     KNQELEEDAGLGSTTMEKVYIAVGNDVQEGYKTIHWAIKKWNNIPISIVLLHLCN-ISQD  63

Query  1364  YVYTPIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSI  1191
             +VYTP G+LP+SSV+EEKL+ L +YEE K +K+L+ YI FCGK  VKAE+LKI++ D SI
Sbjct  64    FVYTPFGKLPASSVSEEKLQVLRQYEEQKINKLLSKYIIFCGKLQVKAELLKIEKQDDSI  123

Query  1190  EKIMVDLISSLQITKLVLSLTFMK-PLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             + +++DLIS L+ITKLV+ +TFM+    WKS+SA+ G F+++  KP++CE +++ GGK+V
Sbjct  124   QVLILDLISKLRITKLVMGITFMRSSSSWKSKSAISGSFYVYQNKPEYCEFYIICGGKMV  183

Query  1013  FLIEENGESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssss  834
              L  EN    + + +   IG+                      +     R+ D  S S+ 
Sbjct  184   SLKREND---VNNNIRSWIGK----------------------MFHDPGRNLDRSSGSND  218

Query  833   ssvSNGLADQWEKNQSEIELYLSQ---------------LSSSKTDCDAANDPLEDCVKE  699
              S ++G +  WE     IE Y  Q                   +   +  +D   D ++ 
Sbjct  219   DSTASG-SSTWENKLQVIENYFQQLLSLNLKEEEEELENGVEEEQQEEEEDDLALDVLQH  277

Query  698   PTMPENM-TTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLE  522
               + E +   + ++   K  I E ++ V++N        ER  KAEWAI LC SR E+LE
Sbjct  278   MNVGEKLEYVRRKVNEAKLMIDEKREEVKVNS-------ERSDKAEWAISLCNSRIEELE  330

Query  521   ACINEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKS  342
             A I EE  +R  L+  LDS  + + E +  VE+ + KL+S+ ELQ EL+SKV+   ++K 
Sbjct  331   AWIKEESERREKLQVTLDSDIKCIEEAKNYVEKGKTKLHSLGELQEELSSKVKTMMEDKL  390

Query  341   HAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFS  162
               E++LER V  R  M+  IE LR QRDV   RIEFCKEK+A G      E     R ++
Sbjct  391   QVEVELERVVLQRGDMITEIEKLRNQRDVFNLRIEFCKEKEARGLVPEEEEVKCGYRAYA  450

Query  161   AAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             AA+IR AT  +S+R RLK GGNWTNVY+G +    VA+K+     SLS+E F
Sbjct  451   AADIRLATESYSDRLRLKSGGNWTNVYRGRIERTTVAVKVI--GDSLSDEDF  500



>ref|XP_008802350.1| PREDICTED: putative U-box domain-containing protein 50 [Phoenix 
dactylifera]
Length=825

 Score =   258 bits (658),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 200/528 (38%), Positives = 303/528 (57%), Gaps = 56/528 (11%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             ++E+VYV +G+D+  G  +L W LRN SSQS + +IL+   ++ +D +YTP G+LP+SSV
Sbjct  4     QQEKVYVAVGKDLQQGLGTLGWALRNWSSQSVSFVILHV--SVSKDLIYTPFGKLPTSSV  61

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             N+E L+DL   E+   DK+L  Y+AFC KVK E+LKI+R D SI K +++LISSLQI KL
Sbjct  62    NDEMLEDLRMREKDTVDKLLGKYMAFCSKVKPEVLKIERSDESIHKTIIELISSLQIRKL  121

Query  1142  VLSLTFMKPLLWKSRS----------ALRGLFHIHNQ--------------KPDFCELFV  1035
              + ++F K L   SRS           +R  +H++ +              KP+FC++F+
Sbjct  122   AVGISFTKSL---SRSDFANPHAIDIYIRIFYHLNRKLKDDTSIPYYVRKHKPEFCDIFM  178

Query  1034  VFGGKLVFLIEE-NGESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRsc  858
             V GGKLVFL EE +G    +DE G ++   R+K  +K   K  L +I+            
Sbjct  179   VCGGKLVFLREEEDGGDYFEDEQGMMVADLRKKSMEKCCLKGWLGKILSDGSLCCTDHGS  238

Query  857   dspsssssssvSNGLADQWEKNQSEIELYLSQLSSSKTDC---------------DAAND  723
                 +S  ++V   +  +WE +  EIE Y+  L SS  +                D AN 
Sbjct  239   SRLLASPPNTVMPEVTSRWEDHWEEIENYIQCLVSSNPEGSSLEEENKTMSLGSKDQAN-  297

Query  722   PLEDCVKEPTMPENMTTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCA  543
              LE  V +   P      + IEAL+AK+ E Q++V+  K EAK  VER+ +AEW   LC 
Sbjct  298   -LETTVSDMRPP---IIIKGIEALEAKVEEAQKMVEEKKIEAKTDVERRRRAEWFTSLCN  353

Query  542   SRAEDLEACINEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQ  363
              RAE++EA + EE+AK+A L EELD  K++L ++  EV EK   L S+  L + L  K++
Sbjct  354   QRAEEIEASLKEEIAKQAKLTEELDMVKDQLTKVSDEVVEKGGVLKSMRALNKALMIKLE  413

Query  362   LSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPS  183
             LSS +K+  E +LE+ V  +T+M +  E +RRQRD+L ++I++ +E++A+  A    + S
Sbjct  414   LSSWDKTRIEAELEKVVCAKTEMAREAEEIRRQRDMLLQKIKYYEEREALAAA----DGS  469

Query  182   FCC-RQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKL  42
              C  R+F+A E+  AT  FSER  ++ G   + +YKG +    VAI+ 
Sbjct  470   SCVYREFTADEVWNATGGFSERMVIQAGAE-SMLYKGVIGHTTVAIQF  516



>ref|XP_006279476.1| hypothetical protein CARUB_v10025893mg, partial [Capsella rubella]
 gb|EOA12374.1| hypothetical protein CARUB_v10025893mg, partial [Capsella rubella]
Length=825

 Score =   255 bits (651),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 193/520 (37%), Positives = 291/520 (56%), Gaps = 64/520 (12%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VY+ +G DV +G++++ W ++  ++   +I++L+  N I +D+VYTP G+LP+SSV+E
Sbjct  42    EKVYIAVGNDVQEGYKTIHWAIKKWNNIPISIVLLHLCN-ISQDFVYTPFGKLPASSVSE  100

Query  1316  eklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             EKL+ L KYEE K DK+L+ YI FCGK  VKAE+LK+++ D SI+ +++DLI+ L+ITKL
Sbjct  101   EKLQVLRKYEEQKIDKLLSKYITFCGKLQVKAELLKVEKQDDSIQVLILDLITKLRITKL  160

Query  1142  VLSLTFMKPLLWKSRS-ALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             V+ +TFM+         A+ G F+++  KP+FCE F +  G  + L++   +    + + 
Sbjct  161   VMGITFMRSSSSWKSKSAISGSFYVYQNKPEFCE-FYIICGGKMVLLKRENDVNNNNNIR  219

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
               +G+        H     L+R                  SSSS+         W+ N  
Sbjct  220   SWLGKM------FHDPGRNLDR------------------SSSSNDDPTASGSPWDNNLQ  255

Query  785   EIELYLSQLSSSKTDC------------------DAANDPLEDCVKEPTMPENMTTKERI  660
              IE Y  QL S   +                   D A D L+          +M   E++
Sbjct  256   VIENYFQQLLSLNLEEEEVVEEHESRVEEEQEEDDLALDVLQ----------HMNVAEKL  305

Query  659   EALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLE  480
             + ++ K+ E + ++   ++E K   ER  KAEWAI LC SR E+LEA I EE  +R  L+
Sbjct  306   DYVRRKVNEAKLMIDEKREEVKVNAERSDKAEWAISLCISRIEELEAWIKEENERREKLQ  365

Query  479   EELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRT  300
               LDS KE + + +  VE+ + KL+S+ ELQ EL+SKV+   + K   E++LER V  R 
Sbjct  366   GTLDSDKECIEQAKNYVEKGKTKLHSLGELQEELSSKVKTRMEAKLQVEVELERVVLQRG  425

Query  299   QMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCC--RQFSAAEIRAATNEFS  126
             +M+  IE L  QRDV  RRIEFCKEK+A G    + E    C  R++ A +IR AT  +S
Sbjct  426   EMITEIEKLSNQRDVFNRRIEFCKEKEARG---LVSEEEVTCGYREYVAEDIRMATESYS  482

Query  125   ERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             +R RLK GGNWTNVY+G +    VA+K+      LS++ F
Sbjct  483   DRLRLKSGGNWTNVYRGRIEHTTVAVKVI--GAGLSDDDF  520



>ref|XP_008368020.1| PREDICTED: putative U-box domain-containing protein 50 isoform 
X2 [Malus domestica]
Length=667

 Score =   251 bits (641),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 232/366 (63%), Gaps = 5/366 (1%)
 Frame = -3

Query  1100  RSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVIGRAREkkkkKHG  921
             +SA+ G F++HN KPDFCELFV+ GG+ VFL  EN + VI+D+ G  + + REK      
Sbjct  2     KSAVSGSFYVHNHKPDFCELFVICGGRRVFLRGENSKGVIEDDQGVTVAKIREKS----S  57

Query  920   FKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIELYLSQLSSSKTD  741
             FK  L ++     A             S++  S    +Q      E+E Y   L S K D
Sbjct  58    FKAWLAKMFNENPAYSLDTISHPSLGFSTNPYSXSSQNQRGNCVHELENYFQHLLSLKMD  117

Query  740   CDAANDPLEDCVKEPTMPENMTTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEW  561
                 N+P E    E     +M   E IE+ K  ++E Q++++L +KEAKA +ER  KA+ 
Sbjct  118   EGXHNNPXELATPEHA-DSDMIAAEDIESRKKTLKEAQEMIKLKRKEAKANLERSTKAQR  176

Query  560   AIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRE  381
             AI LC  RAE LEA INEE  KR  L++ LDS KE+L+E+  + EE + +L+S+LELQ E
Sbjct  177   AISLCNRRAEQLEAKINEEATKREELKKALDSEKEQLHEVILDTEESKNRLSSLLELQFE  236

Query  380   LASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAK  201
             L++K+Q+S+  KS++E QLE+AV TR +MV+ IE LR+QRDVL RRIEFCKEKDAIG   
Sbjct  237   LSNKLQISTFAKSNSEAQLEKAVSTRAEMVREIEELRQQRDVLHRRIEFCKEKDAIGMVA  296

Query  200   RLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSL  21
             RL + S   ++++A EIR ATN+FSER R+K GG+WT++Y+G +N   VAIK+ +    L
Sbjct  297   RLSDTSCGFKEYTAEEIRLATNDFSERLRIKPGGDWTSIYRGRINHATVAIKMLNSGNEL  356

Query  20    SEETFQ  3
             S++ FQ
Sbjct  357   SKQDFQ  362



>gb|KDO60543.1| hypothetical protein CISIN_1g003594mg [Citrus sinensis]
Length=683

 Score =   249 bits (635),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 173/388 (45%), Positives = 239/388 (62%), Gaps = 19/388 (5%)
 Frame = -3

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGV  960
             + L+FM P   KSR+A+ G + +H+  PD+CELF++ GGKLV L  EN E +++D+ G  
Sbjct  1     MGLSFMIPSAGKSRTAVSGSYFVHHHMPDYCELFIICGGKLVSLKGENDEGIMEDDQGVK  60

Query  959   IGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEI  780
               + RE+      F  L  ++      +  + S  S    + S  S      WE    EI
Sbjct  61    FAKMRERV----NFGNLWTKMFSGNGRNPNRLSICSRGPDADSPYSRS---TWENCVQEI  113

Query  779   ELYLSQLSSSKTDCDAAN-----DPLEDCVKEPTMPE----NMTTKERIEALKAKIREVQ  627
             E+Y   L+S   D DA+N     + L+    EP   E    NM+  ER E +K+KI E +
Sbjct  114   EIYFQHLASFNLD-DASNSEDGDEILQTRAIEPNAAEQIDSNMSVAERTEFMKSKINEAR  172

Query  626   QVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeely  447
             ++++L KKE K   ER AKA+WAI LC SRA+ LE+   E++A R  ++ +LDS KE+  
Sbjct  173   EMIRLKKKETKDDAERCAKAKWAICLCNSRADQLESLTKEDVASRMEIQRDLDSLKEQSC  232

Query  446   elqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrr  267
             E+  +VEE + +L+S++ELQ EL++K+QLS+  K HAE QLE+AV  R ++V+ IE LRR
Sbjct  233   EVIRDVEESKNRLSSLIELQSELSNKLQLSTMAKGHAEAQLEKAVIARAEIVKDIEELRR  292

Query  266   qrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTN  87
             QRDVL RRIEFCKEKDAIG   R  E S   R+++A +IR AT +FSER RLKC G+WTN
Sbjct  293   QRDVLHRRIEFCKEKDAIGMVIRSSELSCAFREYAAEDIRLATEDFSERFRLKCAGDWTN  352

Query  86    VYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             VY+G LN   VAIK    +  LSEE FQ
Sbjct  353   VYRGRLNHASVAIKTL--NNGLSEEDFQ  378



>ref|XP_002533954.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF28423.1| ATP binding protein, putative [Ricinus communis]
Length=724

 Score =   247 bits (631),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 188/452 (42%), Positives = 267/452 (59%), Gaps = 42/452 (9%)
 Frame = -3

Query  1349  IGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDL  1170
             +G+LP+SSV+EEKL+ L KYE  K +K+L+ YIAFCGKV      +  H           
Sbjct  13    VGKLPASSVSEEKLQVLRKYEHEKIEKLLSKYIAFCGKVNFFAFGVCFHSS---------  63

Query  1169  ISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGE  990
                                 W+S++A+ G F+IH  KP FCE F+V GGKLV L  EN +
Sbjct  64    ---------------WDSASWRSKNAISGSFYIHQHKPSFCEFFIVCGGKLVILRGENED  108

Query  989   SVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLA  810
              +++D  G  + R       K   K  L + M  E     +RS  S  S  S +  N   
Sbjct  109   VIMEDNQGLTVER-------KGNLKSWLGK-MFNEHYSLARRSTASSKSLDSLNEQN---  157

Query  809   DQWEKNQSEIELYLSQLSS----SKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAK  642
              QWE    EI+ Y   L S     +   +  +D LE  V E T  E+M+   + E +++K
Sbjct  158   -QWENCTIEIQNYYEHLLSLNLDEENCEEENDDSLEGGVPETT--ESMSVAAKSEYMRSK  214

Query  641   IREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSA  462
             I + Q++++L K+EAKA  ER AKAEWA+ LC +RAEDLEA I EE+A R  +++ LD  
Sbjct  215   IDDAQKIIRLKKEEAKANAERSAKAEWAVCLCNTRAEDLEAKIKEEVANRIEIKKALDGE  274

Query  461   KeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGI  282
             +E++ E+++++ E + +L S++ LQ EL SK+QLS+  +SH E QLE+AV  R +MV+ I
Sbjct  275   REQIQEMRSDIAENKNRLKSLVVLQSELTSKLQLSTLARSHGEAQLEKAVIARAEMVRDI  334

Query  281   ENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCG  102
             E LR QRDVL+RR+EFCKEKDAIG  K+L E +   R++SA +IR AT+ FSE  R K G
Sbjct  335   EKLRGQRDVLQRRVEFCKEKDAIGTVKKLTELTCGYREYSAEDIRLATDGFSETLRFKSG  394

Query  101   GNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
              +WTNVY+G +++  VAIK+ +   +LS E F
Sbjct  395   RDWTNVYRGRIHNAAVAIKMLNPDHALSREDF  426



>ref|XP_002866675.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42934.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=767

 Score =   241 bits (616),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 184/505 (36%), Positives = 275/505 (54%), Gaps = 71/505 (14%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VY+ +G DV +G++++ W L+  ++   +I++L+  N I +D+VYTP G+LP+SSV+E
Sbjct  21    EKVYIAVGNDVQEGYKTIHWALKKWNNIPISIVLLHLCN-ISQDFVYTPFGKLPASSVSE  79

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             EKL+ L KYEE K DK+L+ YI FCGKV                                
Sbjct  80    EKLQVLRKYEEQKIDKLLSKYITFCGKV-----------------------------CPF  110

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEEN---GESVIKDEVG  966
             S+ F+  L  KS+SA+ G F+++  KP+FCEL+++ GGK+V L  +N     S I+  +G
Sbjct  111   SVNFV--LSGKSKSAISGSFYVYQNKPEFCELYIICGGKMVSLKRDNDVNNNSNIRSWIG  168

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
              +            G                            ++         W+KN  
Sbjct  169   KMFHDPGRNLDSSSG----------------------------NNDDPTSSGSSWDKNLH  200

Query  785   EIELYLSQLSSSKTDCDAANDPLEDCVKEP-----TMPENMTTKERIEALKAKIREVQQV  621
             EIE+Y  QL S   + +   + +E+  +E       + ++M   E++E ++ K+ E + +
Sbjct  201   EIEIYFEQLLSLNLEEEVNENVVEEEHEEDNDVALNVLQHMNVAEKLEYVRRKVNEAKLM  260

Query  620   VQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyel  441
             +   + E K   ER  KAEWAI LC+SR E+LEA I EE  +R  L+  LDS KE + E 
Sbjct  261   IDEKRLEVKVNAERSDKAEWAISLCSSRIEELEAWIKEESERREKLQVTLDSDKECIEEA  320

Query  440   qteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqr  261
             +  VE+ + KL+S+ ELQ EL+SKV+   + KS  E++LER V  R +M+  IE LR QR
Sbjct  321   KNYVEKGKTKLHSLAELQEELSSKVKTMMEAKSQTEVELERVVLQRGEMIMEIEKLRNQR  380

Query  260   dvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVY  81
             DV  RRIEFCK+K+AIG   +  E     R++ A +IR AT  +S+R RLK GGNWTNVY
Sbjct  381   DVFNRRIEFCKKKEAIGSVSK-EEVKCGYREYVAEDIRLATESYSDRLRLKSGGNWTNVY  439

Query  80    KGCLNSERVAIKLYHKSTSLSEETF  6
             +G +    VA+K+      LS+E F
Sbjct  440   RGRIEHTTVAVKVI--GDCLSDEDF  462



>sp|Q9FGD7.1|PUB50_ARATH RecName: Full=Putative U-box domain-containing protein 50; AltName: 
Full=Plant U-box protein 50 [Arabidopsis thaliana]
 dbj|BAB11278.1| unnamed protein product [Arabidopsis thaliana]
Length=765

 Score =   233 bits (595),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 275/510 (54%), Gaps = 70/510 (14%)
 Frame = -3

Query  1514  EESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLP  1335
             E   + E+VY+ +G DV +G++++ W L+  ++   +I++L+  N I +D+VYTP G+LP
Sbjct  14    ESGSRMEKVYIAVGNDVQEGYKTIHWALKKWNNIPISIVLLHLCN-ISQDFVYTPFGKLP  72

Query  1334  SSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQ  1155
             +SSV+EEKL+ L KYE+ K DK+L+ YI FCGKV                          
Sbjct  73    ASSVSEEKLQVLRKYEDQKIDKLLSKYITFCGKV--------------------------  106

Query  1154  ITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFL--IEENGESVI  981
                  LS+ F+  L  KS+SA+ G F+++  KP+FCE +++ GGK+V L     N  S I
Sbjct  107   ---CPLSVNFV--LFGKSKSAISGSFYVYQNKPEFCEFYIICGGKMVSLKNDVNNNNSNI  161

Query  980   KDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQW  801
             +  +G +           H     L+R                  SS ++         W
Sbjct  162   RSWIGKMF----------HDPGRNLDR------------------SSGNNDDPTASGSSW  193

Query  800   EKNQSEIELYLSQLSS-----SKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIR  636
             +KN  EIE Y  QL S      +T+     +  +D      + ++M   E++E ++ K+ 
Sbjct  194   DKNLQEIENYFQQLLSLNLAEEETENVVEEEQEDDDDVALNVLQHMDVAEKLEYVRRKVN  253

Query  635   EVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKe  456
             E + ++    +E K   ER  +AEWAI LC SR  + EA I EE  +R  L+  LDS KE
Sbjct  254   EAKLMIDEKSREVKVNAERSNRAEWAISLCNSRIGEFEAWIKEESERREKLQATLDSDKE  313

Query  455   elyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIEN  276
              + E +  VE+ + KL+S+ ELQ  L+SKV+   + KS AE++LER V  R +M+  IE 
Sbjct  314   CIEEAKNYVEKGKTKLHSLAELQEVLSSKVKTMMEAKSQAEVELERVVLQRGEMITEIEK  373

Query  275   LrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGN  96
             LR QRDV  RRIEFCKE++ IG   +  E     R++ A +IR AT  +S+R RLK GGN
Sbjct  374   LRSQRDVFNRRIEFCKEREVIGSVSK-EEVKCGYREYVAEDIRLATETYSDRLRLKSGGN  432

Query  95    WTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             WTNVY+G +    VA+K+     SLS+E F
Sbjct  433   WTNVYRGRIKHTTVAVKVI--GDSLSDEAF  460



>ref|XP_010113446.1| Putative U-box domain-containing protein 50 [Morus notabilis]
 gb|EXC35473.1| Putative U-box domain-containing protein 50 [Morus notabilis]
Length=779

 Score =   233 bits (595),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 204/513 (40%), Positives = 289/513 (56%), Gaps = 62/513 (12%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             +E+ +YV +G D  +GF++L W L     Q  +I+IL+   T  ++ V T  G++P+SSV
Sbjct  10    QEKAIYVALGNDRDEGFKTLRWTLIKWKFQPISIIILHIDIT--KETVMTYFGKMPASSV  67

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             NEE L+ L K E+ + DK+L+ Y AFCGKVKAEI K+ +++  I + ++DLIS L IT L
Sbjct  68    NEEMLEVLRKNEQGQIDKLLSQYKAFCGKVKAEIFKVDKYEKPIPEHIIDLISGLHITNL  127

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGG  963
             V+ LTFMK    KS+SA+ G F+IH  KP+FCE          F I   G+ ++  E   
Sbjct  128   VMGLTFMKSSSRKSKSAISGCFYIHQNKPEFCE----------FFIISGGKQILMQEDKF  177

Query  962   VIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSE  783
             V                                +  SPS SSS+  S  + +QWE    E
Sbjct  178   V------------------------------DSNLGSPSPSSSNPDSPNVENQWENCAEE  207

Query  782   IELYLSQLSSSKTD-----CDAAND----PLEDCVKEPTMPENMTTKERIEALKAKIREV  630
             +E YL  L S   D     C+  ND    P+E  +KE     NM+  E+ E L+ +I+E 
Sbjct  208   MENYLHHLLSLNLDEEQEVCEQENDSHYSPMEAEMKE-LQNSNMSVAEKSELLRRRIKET  266

Query  629   QQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeel  450
              +  +  + E     ER AKAE+AI LC  R E +EA I  E+  RA L++ELD+ +E L
Sbjct  267   NERTKSKRNED---TERLAKAEFAISLCNRREEGVEALIAREVTNRAELKKELDATRELL  323

Query  449   yelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLr  270
              E   +VEE   +LNS+ + + +L+ ++Q S+  +S AE +L+ A   R +    +E LR
Sbjct  324   REALADVEESMKRLNSLADPRSDLSEELQRSAAARSEAEERLKAATIGRAKTAAEMEKLR  383

Query  269   rqrdvlrrRIEFCKEKDAIGE----AKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCG  102
             RQRDV RRRIEFC+E+DAIG     A+R+ E     R+FS  EI++ATN FSE  R K G
Sbjct  384   RQRDVFRRRIEFCRERDAIGNGNGMAERVSEWRCELREFS-GEIKSATNNFSEHLRFKSG  442

Query  101   GNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             G+WT VYKG +N + VAIK+   + SL EE FQ
Sbjct  443   GDWTAVYKGRINLQTVAIKVI--NASLPEEEFQ  473



>gb|EPS69941.1| hypothetical protein M569_04821 [Genlisea aurea]
Length=534

 Score =   218 bits (555),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 171/483 (35%), Positives = 280/483 (58%), Gaps = 41/483 (8%)
 Frame = -3

Query  1442  EWVLRN-CSSQSTTILILY-AANTICRDYVYTPIGRLPSSSVNeeklkdldkyeeaKTDK  1269
             +W L N  + + T+++ILY AA  + +DY+ TP+    SS VNEEK+K L+K EEA+TDK
Sbjct  39    QWALNNPFNHRITSVVILYSAAGGVNKDYILTPLAPFHSSYVNEEKIKMLEKIEEARTDK  98

Query  1268  ILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSLTFMKPLL-WKSRSA  1092
             IL+ ++AFCGKVKAE++K+++ +  + + +++++S+ +IT+LVLSL FMK +  WK RSA
Sbjct  99    ILSQFVAFCGKVKAEVIKLEKDEVPLHQKILEMVSTHKITRLVLSLEFMKTVSSWKPRSA  158

Query  1091  LRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVGGVIGRAREkkkkKHGFKV  912
             + G  ++  +KP FCE+F+++ G+LVF+  EN E +++ + G  I + R+K +     K 
Sbjct  159   IAGAHYVLARKPHFCEVFLIWEGRLVFIRGENDEVLMESDGGVTIAKLRDKNRT---VKK  215

Query  911   LLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQSEIELYLSQLSSSKTDCDA  732
              L R+    +++                      + WEK   +IE Y+++LS  + D + 
Sbjct  216   WLGRVFQSNVSESAGSFSSH--------------NHWEKYGRDIEDYVNELSK-QGDAED  260

Query  731   ANDPLEDCVKEPTMPENMTTKE----RIEALKAKIREVQQVVQLNKKEAKAIVERQAKAE  564
              +D  E+ V    +   ++ +E    +IE L+ +IR  Q++V   K +A    ERQ KA 
Sbjct  261   EDDGTEEAVSSELLQNVVSLEEGGVEKIEILQDRIRRAQELVLFYKNKAIDDEERQEKAN  320

Query  563   WAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQR  384
             WAI +C +R E+LEA ++ E++ + +L  E ++ KEE+  L+ E+EEKR  L+S+LEL  
Sbjct  321   WAISICNNRVEELEASVSNEVSIKNNLNYEWNALKEEISRLEMEMEEKRNSLDSLLELHE  380

Query  383   ELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEA  204
              L  K+ LSS   S  E  LE+    R  ++Q IE LR+QRD+ + R+E   ++ A    
Sbjct  381   RLVDKLHLSSSAASLYEAMLEKEEGKRVDVLQRIEELRKQRDLFQLRVESGGDRGAA---  437

Query  203   KRLGEPSFCCRQFSAAEIRAATNEFSERQRLKC--------GGNWTNVYKGCLNSERVAI  48
                   + C R+FS  EI  AT+ FS   R +         GG  + VY G ++   V+I
Sbjct  438   ---STDAGCLRRFSTMEISQATDNFSHHLRARDDDDDDDDEGG--SAVYVGKIDRMTVSI  492

Query  47    KLY  39
             K++
Sbjct  493   KVF  495



>gb|KHN37751.1| Putative U-box domain-containing protein 50 [Glycine soja]
Length=751

 Score =   220 bits (560),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 166/511 (32%), Positives = 272/511 (53%), Gaps = 60/511 (12%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             ++ + E++YV +G D+ DGFQ+L W ++  +S   +I+IL+      + YV T +G+LP+
Sbjct  2     DATETEKIYVAVGYDIVDGFQTLSWAMKKWNSHPCSIVILHVNYNTSKKYVPTLLGKLPA  61

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
                +E+ L+ + K+E+    K+L+ YIA C  V AE L++++ D  +EK  +DLI  L I
Sbjct  62    KGASEKILERIRKHEQRIIQKLLSKYIALCDNVPAETLEVEKFDEPMEKRTIDLIHGLGI  121

Query  1151  TKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDE  972
             TKL++  +FMKP L KS   + GLF+++  KP FCELFV+FGGK V    +N E +++D+
Sbjct  122   TKLIMGFSFMKPSL-KSEVDVNGLFYVNQHKPPFCELFVIFGGKQVTPRVKNDEIIMEDD  180

Query  971   VGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKN  792
              G  I   R+K          LER+   +  D + RS  +PSSSS++       ++W+ +
Sbjct  181   NGFKIASMRDKINCID----WLERMFFDKTIDTQHRSSCAPSSSSTNFEPYLNQNEWKFS  236

Query  791   QSEIELYLSQL--------SSSKTDCDAANDPLEDCVKEPTMPENMTTKERIEALKAKIR  636
               EIE Y  +L        SS + +  +  +P+E  VKE     NM              
Sbjct  237   FQEIENYAQELMSLNLEEGSSGQDNHVSHFNPIEPYVKERNSSNNM--------------  282

Query  635   EVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKe  456
                                               E+LE  I EE+ ++  L ++LD+ KE
Sbjct  283   ---------------------------------EEELEYLIKEEVTRKEELRKDLDAEKE  309

Query  455   elyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIEN  276
             + ++++ ++E+ + KL+ + E Q EL +++ + +     AE +L +A+  +T+M+  ++ 
Sbjct  310   QFHKIKMDIEDSKKKLSLVAEQQSELLNRLHIYTLAVPQAETKLGKALAEKTEMLMEMDG  369

Query  275   LrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGN  96
             LR+QR+ + R IEF + K       RL E     R+++  EI  AT  FSE+ RLK  GN
Sbjct  370   LRKQRNAMNRSIEFFQRKRCHKNECRLIEKGCGLREYTKEEITLATQNFSEQMRLKSDGN  429

Query  95    WTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             WTNVY+G +N   VAIK+ +    LS+  FQ
Sbjct  430   WTNVYRGQINHSTVAIKMLNHVPDLSQLDFQ  460



>gb|KCW54616.1| hypothetical protein EUGRSUZ_I00562 [Eucalyptus grandis]
Length=687

 Score =   216 bits (551),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 165/386 (43%), Positives = 237/386 (61%), Gaps = 13/386 (3%)
 Frame = -3

Query  1139  LSLTFMKPLL--WKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             + LTFMK     WK + A+ G F++H  KPDFC+L+++  GKLV    E  + +++D+ G
Sbjct  1     MGLTFMKSFSSSWKPKGAISGSFYVHRHKPDFCQLYLISAGKLVHQRWEGEDGIMEDDQG  60

Query  965   GVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLADQWEKNQS  786
               + + +EK      FK  L ++    I+   +R+  S   S ++S S  L  QWE    
Sbjct  61    VTVAKLKEKSI----FKGWLGKMFNDNIS--LERNSSSTPPSPANSDSPNLHCQWEHYAE  114

Query  785   EIELYLSQLSSSKTDCDAANDPLEDCVKEPTMPEN----MTTKERIEALKAKIREVQQVV  618
             EIE Y  +L  S  + D   D       +P +PE+    M   E+IEALK KI E  Q +
Sbjct  115   EIEAYFQELLISCKEDDNFEDHGMGSPVKPEVPEDAITTMNPAEKIEALKRKIEEAHQTI  174

Query  617   QLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelq  438
             QL KKE+K  +ER +KAEWAI LC  R ED+EA   EE+  R  L+++L++ K++LYE+ 
Sbjct  175   QLKKKESKENMERHSKAEWAITLCNERLEDIEARAKEEVTNRVALQKDLEAEKDKLYEMS  234

Query  437   teveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrd  258
              + EE R+KL  +L+LQ EL++K+Q+S+  K HAE +LE+AV TR +MV+ IE LRRQRD
Sbjct  235   RDNEESRSKLKLLLQLQSELSNKLQISNLAKVHAEARLEKAVITRGEMVREIEELRRQRD  294

Query  257   vlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYK  78
             VL+RRIEFC+EKD I    RL E S   ++++  EIR AT+ F+E  RLK GG WTNVY+
Sbjct  295   VLQRRIEFCREKDTIEMVNRLTEVSCGFQEYTEDEIRLATDNFAECLRLKSGGEWTNVYR  354

Query  77    GCLN-SERVAIKLYHKSTSLSEETFQ  3
             G +N +  VA K+      LS++ F+
Sbjct  355   GRINHATTVAFKMLKSPNGLSQDDFR  380



>ref|XP_010312654.1| PREDICTED: putative U-box domain-containing protein 50 [Solanum 
lycopersicum]
Length=555

 Score =   209 bits (532),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 172/237 (73%), Gaps = 0/237 (0%)
 Frame = -3

Query  713  DCVKEPTMPENMTTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRA  534
            + + E  M ENMT +E+ EAL+ K  EV++ +QL++ EAK+ VE QAKA+WAI LC  RA
Sbjct  24   NIITELVMAENMTMQEKKEALRIKFLEVKEAIQLSRDEAKSHVEAQAKAQWAITLCTRRA  83

Query  533  EDLEACINEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSS  354
            E+++ CIN+E+A++  L+ ELD+ K+EL EL TEVE  ++KL+S  ELQ EL++K+QLSS
Sbjct  84   EEIDGCINDELARKPDLKRELDATKDELSELHTEVEVTKSKLSSSFELQHELSTKMQLSS  143

Query  353  QEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCC  174
              +S AE+Q+E+ ++ R   VQ IE  RRQRDVLRRRI FC+EKDAIG A  L EP    
Sbjct  144  VARSRAEVQVEKLLKQRMDTVQEIEEFRRQRDVLRRRITFCREKDAIGNASMLIEPRLEY  203

Query  173  RQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
            ++FSAAEIR AT+ FS   RLK GG+WT+VYK  L+   VAIKLY  +   SE+TFQ
Sbjct  204  KEFSAAEIRTATDGFSNLMRLKSGGDWTDVYKAKLHHTSVAIKLYSSADVDSEDTFQ  260



>ref|XP_002310308.2| kinase family protein [Populus trichocarpa]
 gb|EEE90758.2| kinase family protein [Populus trichocarpa]
Length=718

 Score =   188 bits (478),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 122/279 (44%), Positives = 180/279 (65%), Gaps = 13/279 (5%)
 Frame = -3

Query  809  DQWEKNQSEIELYLSQLSSSKTD---CDAANDPLEDCVKEPTMPEN------MTTKERIE  657
            +QWE    EIE Y   L S   D   C   ND L+    EP + E+      M+   ++ 
Sbjct  140  NQWENYAQEIENYFEHLLSLNLDEEICKEENDILQADSTEPGVAEDAVSTMAMSVAAKMA  199

Query  656  ALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEE  477
            +++ ++   Q+++Q+ ++E+K   ER AKAEWA  LC SR E+LEA I EE+  R  L +
Sbjct  200  SMRRRMEGTQKMIQMKREESKVNSERCAKAEWAKCLCNSRVEELEAKIQEEVLNRLDLSK  259

Query  476  ELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQ  297
             LD+  E++ E++ +++E + +L+S++EL+ E+ SK+Q S+  +SH E+QLE+AV  R Q
Sbjct  260  SLDAENEQIQEIRRDIQESKKRLSSLVELRSEVYSKLQTSTMARSHVEVQLEKAVIARAQ  319

Query  296  MVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCC--RQFSAAEIRAATNEFSE  123
            MV+ IE LR+QRD+LRRRIEFCKEKDA+G   +L E   CC  R+++  +IR+AT+ FSE
Sbjct  320  MVREIEELRKQRDILRRRIEFCKEKDAVGTVAKLNE--LCCGYREYTTKDIRSATDNFSE  377

Query  122  RQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
              RLK GG+WTNVY+G +N   VAIK+      LS+E F
Sbjct  378  SLRLKSGGHWTNVYRGRINHTTVAIKMLSFDNGLSQEAF  416



>ref|XP_008361114.1| PREDICTED: putative U-box domain-containing protein 50 [Malus 
domestica]
Length=315

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 118/270 (44%), Positives = 167/270 (62%), Gaps = 10/270 (4%)
 Frame = -3

Query  782  IELYLSQLSSSKT--DCDAAN--------DPLEDCVKEPTMPENMTTKERIEALKAKIRE  633
            +E+Y  QL S+    +CD  N         P E  + +     NM+  E+IE L+  I E
Sbjct  1    MEIYYQQLCSNLDVENCDQXNGTGTSQQPSPTEAIMLQINGNPNMSPAEKIEFLRKTISE  60

Query  632  VQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKee  453
             + ++++ KKEAK   +R AKAE AI LC  RA++L+  I EE   R  L +ELD+ KE+
Sbjct  61   TRGMIRMKKKEAKENADRHAKAERAICLCERRAQELDVQIKEEGDNRRELNKELDTEKEQ  120

Query  452  lyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENL  273
            L+E+   +EE   K+ S++ELQ EL+ K+ +S   KS AE+QLE  V  RT M + IE L
Sbjct  121  LHEVVNNIEESXNKMKSLIELQYELSHKLHMSKMAKSQAEVQLENEVMKRTDMERKIEVL  180

Query  272  rrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRLKCGGNW  93
            RR+RDV  RRIEFC+++DA G A+ L E S   R+++  EI+ ATNEFSER RLK G + 
Sbjct  181  RRERDVFXRRIEFCRQQDATGTAEGLSELSCRLREYTDEEIKQATNEFSERFRLKSGSDL  240

Query  92   TNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
            ++VYKG +N   V IK+ + +  LS+E FQ
Sbjct  241  SSVYKGRINHVTVGIKVLNSANGLSQEDFQ  270



>gb|KHG01315.1| Putative U-box domain-containing 50 -like protein [Gossypium 
arboreum]
Length=448

 Score =   143 bits (360),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 138/220 (63%), Gaps = 14/220 (6%)
 Frame = -3

Query  662  IEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHL  483
            +EA++ KI E  + + L KKE KA VER AKA+ AI LC ++AEDLE  I EE+ +   +
Sbjct  1    MEAVQCKIDEAHEAIILKKKETKADVERHAKAKSAIDLCNAKAEDLETQIKEEVTQWLEI  60

Query  482  EEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTR  303
            +  LD  KE+L+E++ EVEE + +LNS  +LQ EL++K+Q SSQ +++A  QLE A  TR
Sbjct  61   KNVLDIEKEKLFEVKREVEESKNRLNSFKDLQVELSNKLQKSSQARANAVAQLEMAAVTR  120

Query  302  TQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSE  123
             +MV  IE L              +EKDA+    R  E     R++ A +IR AT++FSE
Sbjct  121  AKMVMEIEEL--------------REKDALRMVARSNELRCGYREYMAEDIRLATDDFSE  166

Query  122  RQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
            R RLK  G+W+NVY+G +N   VAIK+ +    +S+E FQ
Sbjct  167  RLRLKVSGDWSNVYRGRINHSTVAIKMLNSVNGMSQEDFQ  206



>gb|KFK28250.1| hypothetical protein AALP_AA8G491900, partial [Arabis alpina]
Length=544

 Score =   135 bits (339),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 136/229 (59%), Gaps = 3/229 (1%)
 Frame = -3

Query  692  MPENMTTKERIEALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACI  513
            M ++M   E+++ ++ K+ E + +++   +E K   ER  KAEWAI LC  R E+LEA I
Sbjct  23   MLQHMNVAEKLDYVRRKVNEAKLIIEETMREVKVNAERSDKAEWAISLCNCRIEELEAGI  82

Query  512  NEEMAKRAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAE  333
             EE  +R  L+  LDS  E + E + +VE  + KL  + EL+ EL+SKV+   +  S AE
Sbjct  83   KEESERREKLQRTLDSDIECIEEAKHDVERGKTKLYWLRELREELSSKVKTKKEASSQAE  142

Query  332  IQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAE  153
             +LE     R +MV  IE LR QRDV   R+EFCKEK+A G   +  E +   R++ A +
Sbjct  143  AELESVALKRGEMVMEIEKLRSQRDVFNLRVEFCKEKEASGLVSK-EELTCGYREYVAED  201

Query  152  IRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
            IR AT  +S+R RLK GGNWTNVY+G +    VA+K+      LS E F
Sbjct  202  IRLATESYSDRLRLKSGGNWTNVYRGRIKHTIVAVKVI--GDRLSYEDF  248



>ref|XP_010914320.1| PREDICTED: putative U-box domain-containing protein 50 [Elaeis 
guineensis]
Length=502

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 124/203 (61%), Gaps = 6/203 (3%)
 Frame = -3

Query  608  KKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDSAKeelyelqtev  429
            K E KA VER+ KAE    LC    E++EA + EE+AK+A L+EE+D  K++  ++  EV
Sbjct  6    KIEIKADVERRGKAERFTSLCNQWVEEIEASLKEEIAKQAKLKEEMDKVKDQATKVADEV  65

Query  428  eEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQGIENLrrqrdvlr  249
             EK + L S+L L ++L  +++ SS EKS  E +L++AV  + +M + +E +RRQRD+L 
Sbjct  66   AEKASTLESVLGLNKDLTMQLEASSWEKSQMEARLQKAVCAKNEMARQVEEIRRQRDMLF  125

Query  248  rRIEFCKEKDAIGEAKRLGEPSFC-CRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGC  72
            ++I++  +++A+  A    + S C  R+F+A E+R AT++FSE          T +Y+G 
Sbjct  126  QKIKYYMQREAVAAA----DGSSCGYREFTAREVRDATDDFSECMMTYADTEGT-LYRGV  180

Query  71   LNSERVAIKLYHKSTSLSEETFQ  3
            +    VAI+   + +  S + F+
Sbjct  181  IGHITVAIQFKTEFSLQSPDGFK  203



>ref|XP_008385687.1| PREDICTED: putative U-box domain-containing protein 50 [Malus 
domestica]
Length=398

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = -3

Query  347  KSHAEIQLERAVRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQ  168
            KS A++QLE  V  R  MV+ IE LRR+RDV RRRIEFC++KDA    + L E S C R+
Sbjct  3    KSQAKVQLENEVMKRVDMVRDIEVLRRERDVFRRRIEFCRQKDATETTEGLSELSCCLRE  62

Query  167  FSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKL  42
            ++  EI+ AT++FSER RLK G + T+VYKG +N   VAIKL
Sbjct  63   YTDEEIKLATDKFSERFRLKSGIDLTSVYKGRINHVTVAIKL  104



>ref|XP_006476873.1| PREDICTED: U-box domain-containing protein 33-like isoform X2 
[Citrus sinensis]
Length=256

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 76/159 (48%), Gaps = 6/159 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D       L+W L +  S    I +++  + +   Y+ TP+GRL  S +N+E+
Sbjct  55    VYVAVGKD---DLHVLKWALDHAVSPGARIYLVHVFSPVT--YINTPVGRLARSQLNQEQ  109

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             ++     E  +   +L  YI  C   K  +  +     +  K ++DLIS   +T LV+  
Sbjct  110   VRVYVNEENNRRRNLLQKYIRLCNDAKVTVETMLVESKATAKAILDLISVANVTSLVMGT  169

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
                 P    ++   +G F +    PD+CE+ +V  GK V
Sbjct  170   KLSPPSRLFTKKLSKGEF-VKKNAPDYCEVTIVHDGKKV  207



>ref|XP_003634243.1| PREDICTED: putative U-box domain-containing protein 50 [Vitis 
vinifera]
 emb|CBI14964.3| unnamed protein product [Vitis vinifera]
Length=240

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 80/169 (47%), Gaps = 6/169 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G D  D    L+W L +  S    I +++      + Y+ TP+GRL  S +++E+
Sbjct  46    VYVAVGRDDLD---VLKWALDHSVSPQARIFLVHVFPP--QTYISTPVGRLSRSQLSKEQ  100

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             LK     E  +   +L  YI  C   K  +  +     +  K ++DLI  L IT LV+  
Sbjct  101   LKVYINEENNRRRNLLQKYIRLCTDAKVTVDTMLLESNTTTKAILDLIPVLNITNLVIG-  159

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESV  984
             T   P   +S   L     I    P+FCE+ +VF GK V   E+ GE V
Sbjct  160   TKRPPCPRRSWKKLGTGEFIQKNAPEFCEVTIVFDGKKVLDGEQVGELV  208



>ref|XP_010251075.1| PREDICTED: U-box domain-containing protein 52-like [Nelumbo nucifera]
Length=234

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 81/159 (51%), Gaps = 6/159 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G++  D    L+W L +  SQ   + +++    I  +Y+ TP+GR+  S +++E 
Sbjct  42    VYVAVGKNDLD---VLKWALDHVVSQGARLYLIHVFPPI--NYIPTPVGRVAKSQMSQEH  96

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             +K+  + E  + + +L  YI  C   K  +  +        K +++LI  L IT LV+  
Sbjct  97    VKEYIQVENTRREYLLQKYIRLCRDAKVAVDTMLIESDHTAKAILELIPVLNITNLVMG-  155

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             T   P   +SR  L     +    P+FCE+ +VFGG+ V
Sbjct  156   TKRTPSSRRSRKGLGKSEFVQKNAPEFCEVNIVFGGRKV  194



>gb|KHG08653.1| Putative U-box domain-containing 50 -like protein [Gossypium 
arboreum]
Length=311

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  173  RQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
            R++ A +IR AT++FSER RLK  G+W+NVY+G +N   VAIK+ +    +S+E FQ
Sbjct  13   REYMAEDIRLATDDFSERLRLKVSGDWSNVYRGRINHSTVAIKMLNSVNGMSQEDFQ  69



>ref|XP_006467260.1| PREDICTED: uncharacterized protein LOC102607885 [Citrus sinensis]
 gb|KDO78594.1| hypothetical protein CISIN_1g021587mg [Citrus sinensis]
Length=307

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 88/167 (53%), Gaps = 7/167 (4%)
 Frame = -3

Query  1508  SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSS  1329
             +Q+E+ +YV +G+       +L W LR+  + ST I +++    +   +V +P+G+LP +
Sbjct  107   TQEEDIIYVAVGKS-QSSMDALSWTLRHAVNPSTLIFLIHVFPQV--KFVPSPLGKLPRN  163

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
              VN E+L+     E  K  ++L  ++  C + K  +  +      + K ++DLI  L I 
Sbjct  164   QVNPEQLETFMAQETGKRRQLLQKFLDTCSQSKVMVDTVLIESDLVAKAILDLIPVLNIR  223

Query  1148  KLVLSLTFMKPLLWKSRSA-LRGLF-HIHNQKPDFCELFVVFGGKLV  1014
             KLV+  T  K  L KS+S  + G+  HI    P+ CE+ VV  GK V
Sbjct  224   KLVVGTT--KSSLRKSKSGRISGMADHILQTAPETCEIKVVCEGKEV  268



>ref|XP_009618903.1| PREDICTED: U-box domain-containing protein 33-like [Nicotiana 
tomentosiformis]
Length=853

 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 93/201 (46%), Gaps = 24/201 (12%)
 Frame = -3

Query  1526  RQCMEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI  1347
             R+ +EE Q E +VY+ +G+ V+     ++W  +   +    I  +   +     Y+ T +
Sbjct  43    REIVEE-QNEPKVYIAVGKSVNKNVALVQWACKTFGNSEICIFHVLEPSP----YIPTLL  97

Query  1346  GRLPSSSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVD  1173
             GRLP++  N E +      E  +  K+L+ Y++ C   KVKA +  ++ H   + K ++D
Sbjct  98    GRLPATQANAEVVSAFRNVEREEARKLLSRYLSICCKSKVKASVAIVEAH--FVLKGILD  155

Query  1172  LISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFL-----  1008
              ++   I KL++      P   K + + +   +     P FCE+F V+ GKLV+      
Sbjct  156   FVNKHNIRKLIIGAI---PDCVKVKKSSQKASYAAANFPSFCEIFFVYKGKLVWTRQPPD  212

Query  1007  -------IEENGESVIKDEVG  966
                    I  N  +VI D  G
Sbjct  213   CSSFIGPISANTRAVIADACG  233



>ref|XP_008802697.1| PREDICTED: U-box domain-containing protein 35 [Phoenix dactylifera]
Length=238

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 75/159 (47%), Gaps = 6/159 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+    G  +L W L+  +  S+ + +++    I   ++ TP+G  P   + EE+
Sbjct  43    VYVAVGKS-SSGMDALSWALKYVAKPSSFVYLIHVFPEI--HHIPTPLGTFPKHQLGEEQ  99

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             ++     E  K  ++L  Y+  C   K E+  +        K +VDLI  L IT+L++  
Sbjct  100   VESHMNQERTKRQEMLQKYLNLCHSSKVEVDTLLIESDQTAKAIVDLIPVLNITRLIVGT  159

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             T      W+  S       IH   PD+CE+ ++  G+ V
Sbjct  160   TKSNLRRWRRNSKAE---QIHKNAPDYCEVKIICDGREV  195



>ref|XP_006449946.1| hypothetical protein CICLE_v10016013mg [Citrus clementina]
 gb|ESR63186.1| hypothetical protein CICLE_v10016013mg [Citrus clementina]
Length=309

 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 88/167 (53%), Gaps = 7/167 (4%)
 Frame = -3

Query  1508  SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSS  1329
             +Q+E+ +YV +G+       +L W LR+  + ST I +++    +   +V +P+G+LP +
Sbjct  109   TQEEDIIYVAVGKS-QCSMDALSWTLRHAVNPSTLIFLIHVFPQV--KFVPSPLGKLPRN  165

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
              VN E+L+     E  K  ++L  ++  C + K  +  +      + K ++DLI  L I 
Sbjct  166   QVNPEQLETFMAQETGKRRQLLQKFLDTCSQSKVMVDTVLIESDLVAKAILDLIPVLNIR  225

Query  1148  KLVLSLTFMKPLLWKSRSA-LRGLF-HIHNQKPDFCELFVVFGGKLV  1014
             KLV+  T  K  L KS+S  + G+  HI    P+ CE+ VV  GK V
Sbjct  226   KLVVGTT--KSSLRKSKSGRISGMADHILQSAPETCEIKVVCEGKEV  270



>emb|CAN79356.1| hypothetical protein VITISV_010065 [Vitis vinifera]
Length=230

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 75/160 (47%), Gaps = 6/160 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G D  D    L+W L +  S    I +++      + Y+ TP+GRL  S +++E+
Sbjct  46    VYVAVGRDDLD---VLKWALDHSVSPQARIFLVHVFPP--QTYISTPVGRLSRSQLSKEQ  100

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             LK     E  +   +L  YI  C   K  +  +     +  K ++DLI  L IT LV+  
Sbjct  101   LKXYINEENNRRRNLLQKYIRLCTDAKVTVDTMLLESNTTTKAILDLIPVLNITNLVIG-  159

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
             T   P   +S   L     I    P+FCE+ +VF GK V 
Sbjct  160   TKRPPCPRRSWKKLGTGEFIQKNAPEFCEVTIVFDGKKVL  199



>ref|XP_008440971.1| PREDICTED: uncharacterized protein LOC103485222 [Cucumis melo]
Length=284

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 89/162 (55%), Gaps = 8/162 (5%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVN  1320
             E+ VYVGIG++      +L+W L+N  + STT++ L       R Y+ +P+G++P + V+
Sbjct  80    EDCVYVGIGKN-DSSVDALQWTLKNAITTSTTVVYLLHVFPEIR-YIPSPLGKIPINQVS  137

Query  1319  eeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             +E++      EE+K    L N++  C   KVKA+ + I+     + K ++D+I  L I K
Sbjct  138   KEQVAIHVAQEESKRKDFLQNFLDSCSAAKVKADTVLIE--SDMVAKAILDVIPILNIRK  195

Query  1145  LVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGK  1020
             LVL +   + L  +  S +     I  + P++CE+ VV  GK
Sbjct  196   LVLGVNKSRKLRSRGGSGIAN--EILQKAPEYCEVKVVCEGK  235



>ref|XP_008239323.1| PREDICTED: U-box domain-containing protein 52-like [Prunus mume]
Length=253

 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 74/159 (47%), Gaps = 6/159 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D  D    L+W L N  S  T + +++    I   Y+ TP+GRL  S + E++
Sbjct  66    VYVAVGKDDTD---VLKWTLDNAVSPGTRVFLVHVFAPIT--YIPTPVGRLAKSQLTEDQ  120

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             ++     E  K   +L  Y++ C   K  +  +        K ++DLI  L I  LV+  
Sbjct  121   VRLHINEESNKRRNLLQKYVSLCNDAKVTVETMLLDSKDTAKAILDLIPVLSIIHLVIG-  179

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             T   P   + R  L     +    PDFCE+ +V  GK V
Sbjct  180   TKRPPHSRRVREKLSLGEFVRKNAPDFCEVSIVHEGKKV  218



>ref|XP_006476872.1| PREDICTED: U-box domain-containing protein 33-like isoform X1 
[Citrus sinensis]
Length=257

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 79/162 (49%), Gaps = 11/162 (7%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D       L+W L +  S    I +++  + +   Y+ TP+GRL  S +N+E+
Sbjct  55    VYVAVGKD---DLHVLKWALDHAVSPGARIYLVHVFSPVT--YINTPVGRLARSQLNQEQ  109

Query  1310  lkdldkyeeaKTDKILANYIAFCG---KVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
             ++     E  +   +L  YI  C    +V  E + ++    +  K ++DLIS   +T LV
Sbjct  110   VRVYVNEENNRRRNLLQKYIRLCNDAKQVTVETMLVE--SKATAKAILDLISVANVTSLV  167

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             +      P    ++   +G F +    PD+CE+ +V  GK V
Sbjct  168   MGTKLSPPSRLFTKKLSKGEF-VKKNAPDYCEVTIVHDGKKV  208



>gb|KDO69501.1| hypothetical protein CISIN_1g025166mg [Citrus sinensis]
Length=256

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 75/159 (47%), Gaps = 6/159 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D       L+W L +  S    I +++  + +   Y+ TP+GRL  S +N+E+
Sbjct  55    VYVAVGKD---DLHVLKWALDHAVSPGARIYLVHVFSPVT--YINTPVGRLARSQLNQEQ  109

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             ++     E  +   +L  YI  C   K  +  +     +  K ++DLIS   +T LV+  
Sbjct  110   VRVYVNEENNRRRNLLQKYIRLCNDAKVTVETMLVESKATAKAILDLISVANVTSLVMGT  169

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
                      ++   +G F +    PD+CE+ +V  GK V
Sbjct  170   KLSPRSRLFTKKLSKGEF-VKKNAPDYCEVTIVHDGKKV  207



>ref|XP_006439910.1| hypothetical protein CICLE_v10021791mg [Citrus clementina]
 gb|ESR53150.1| hypothetical protein CICLE_v10021791mg [Citrus clementina]
Length=256

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 75/159 (47%), Gaps = 6/159 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D       L+W L +  S    I +++  + +   Y+ TP+GRL  S +N+E+
Sbjct  55    VYVAVGKD---DLHVLKWALDHAVSPGARIYLVHVFSPVT--YINTPVGRLARSQLNQEQ  109

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             ++     E  +   +L  YI  C   K  +  +     +  K ++DLIS   +T LV+  
Sbjct  110   VRVYVNEENNRRRNLLQKYIRLCNDAKVTVETMLVESKATAKAILDLISVANVTSLVMGT  169

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
                      ++   +G F +    PD+CE+ +V  GK V
Sbjct  170   KLSPRSRLFTKKLSKGEF-VKKNAPDYCEVTIVHDGKKV  207



>gb|KDO78593.1| hypothetical protein CISIN_1g021587mg [Citrus sinensis]
Length=310

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 88/168 (52%), Gaps = 6/168 (4%)
 Frame = -3

Query  1508  SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSS  1329
             +Q+E+ +YV +G+       +L W LR+  + ST I +++    +   +V +P+G+LP +
Sbjct  107   TQEEDIIYVAVGKS-QSSMDALSWTLRHAVNPSTLIFLIHVFPQV--KFVPSPLGKLPRN  163

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
              VN E+L+     E  K  ++L  ++  C + K  +  +      + K ++DLI  L I 
Sbjct  164   QVNPEQLETFMAQETGKRRQLLQKFLDTCSQSKVMVDTVLIESDLVAKAILDLIPVLNIR  223

Query  1148  KLVLSLTFMK-PLLWKSRSA-LRGLF-HIHNQKPDFCELFVVFGGKLV  1014
             KLV+  T     +L KS+S  + G+  HI    P+ CE+ VV  GK V
Sbjct  224   KLVVGTTKSSLRVLRKSKSGRISGMADHILQTAPETCEIKVVCEGKEV  271



>ref|XP_007132069.1| hypothetical protein PHAVU_011G064400g [Phaseolus vulgaris]
 gb|ESW04063.1| hypothetical protein PHAVU_011G064400g [Phaseolus vulgaris]
Length=800

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/172 (24%), Positives = 88/172 (51%), Gaps = 5/172 (3%)
 Frame = -3

Query  1517  MEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRL  1338
             M++ + +E+V+V +G+ +      ++W   + SS    +L +Y  +T+    + T +G+L
Sbjct  18    MDDYECDEKVHVAVGKSLKKDTTLIQWCFTHFSSAHICLLHVYRPSTM----IPTLLGKL  73

Query  1337  PSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSL  1158
             P+S  + E +      E   + +++  Y++ C   K ++  I      ++K +VDL++  
Sbjct  74    PASQASPEVVSAYRIEEREDSKRLMEKYLSLCRAAKVKVTSIIGEADQVQKGIVDLVTVH  133

Query  1157  QITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
              I KLV+     +  +   R++ +  F + N  P FCE++ V+ GK ++  E
Sbjct  134   NIRKLVIGAITPENCMKLKRNSSKANFAVKNVPP-FCEIWFVYKGKHIWTRE  184



>ref|XP_011042691.1| PREDICTED: U-box domain-containing protein 33-like [Populus euphratica]
Length=837

 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 80/170 (47%), Gaps = 6/170 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             ERVYV +G  +      L WV  N  ++   +L ++  + +    + TP+G+LP+S  N 
Sbjct  46    ERVYVAVGNSLEKALSLLNWVFNNFGTRQICLLHVHRPSPL----IPTPLGKLPASQANA  101

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             E +    + E  +T K++  Y+  C + K E   I   +  + K +V+L++   + KLV+
Sbjct  102   EVVSAFRREENEQTKKLIDYYLIICSRAKVEATIIVIENDQVHKGIVELVNRHGVRKLVM  161

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGES  987
                    +  K  S+     +     P FCE++ +  GK V+  E +  S
Sbjct  162   GAVTENCMKVKKSSSKEN--YAAKYAPLFCEIWFINKGKHVWTREASENS  209



>ref|XP_007016431.1| U-box domain-containing protein kinase family protein isoform 
3 [Theobroma cacao]
 gb|EOY34050.1| U-box domain-containing protein kinase family protein isoform 
3 [Theobroma cacao]
Length=571

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 89/179 (50%), Gaps = 6/179 (3%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             ++++V+V +G+ V      L W LR    +   +L ++  + +    + T +G+LP+S  
Sbjct  50    EKDKVFVAVGKSVEKAVNLLRWTLRRFGGKDICLLHVHQPSPL----IPTLLGKLPASQA  105

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             N E +    + E+ +  K+L +Y +FCGK+K +   I      + K +V+L++   I  L
Sbjct  106   NGEVVSAYRREEKEELRKLLEHYSSFCGKLKVKTSIITIEADQVHKGIVELVNRHTIRNL  165

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             V+       +  K  S+ +  +   N  P FC+++ V  GKLV++ E + E      VG
Sbjct  166   VMGAIPENCMRIKKNSS-KACYAARN-APCFCDIWFVNKGKLVWMREASEEPSSLPPVG  222



>ref|XP_006449945.1| hypothetical protein CICLE_v10016013mg [Citrus clementina]
 gb|ESR63185.1| hypothetical protein CICLE_v10016013mg [Citrus clementina]
Length=312

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 88/169 (52%), Gaps = 6/169 (4%)
 Frame = -3

Query  1508  SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSS  1329
             +Q+E+ +YV +G+       +L W LR+  + ST I +++    +   +V +P+G+LP +
Sbjct  109   TQEEDIIYVAVGKS-QCSMDALSWTLRHAVNPSTLIFLIHVFPQV--KFVPSPLGKLPRN  165

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
              VN E+L+     E  K  ++L  ++  C + K  +  +      + K ++DLI  L I 
Sbjct  166   QVNPEQLETFMAQETGKRRQLLQKFLDTCSQSKVMVDTVLIESDLVAKAILDLIPVLNIR  225

Query  1148  KLVLSLTFMK-PLLWKSRSA-LRGLF-HIHNQKPDFCELFVVFGGKLVF  1011
             KLV+  T     +L KS+S  + G+  HI    P+ CE+ VV  GK V 
Sbjct  226   KLVVGTTKSSLRVLRKSKSGRISGMADHILQSAPETCEIKVVCEGKEVI  274



>ref|XP_007016430.1| U-box domain-containing protein kinase family protein isoform 
2 [Theobroma cacao]
 gb|EOY34049.1| U-box domain-containing protein kinase family protein isoform 
2 [Theobroma cacao]
Length=853

 Score = 62.8 bits (151),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 89/179 (50%), Gaps = 6/179 (3%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             ++++V+V +G+ V      L W LR    +   +L ++  + +    + T +G+LP+S  
Sbjct  50    EKDKVFVAVGKSVEKAVNLLRWTLRRFGGKDICLLHVHQPSPL----IPTLLGKLPASQA  105

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             N E +    + E+ +  K+L +Y +FCGK+K +   I      + K +V+L++   I  L
Sbjct  106   NGEVVSAYRREEKEELRKLLEHYSSFCGKLKVKTSIITIEADQVHKGIVELVNRHTIRNL  165

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             V+       +  K  S+ +  +   N  P FC+++ V  GKLV++ E + E      VG
Sbjct  166   VMGAIPENCMRIKKNSS-KACYAARN-APCFCDIWFVNKGKLVWMREASEEPSSLPPVG  222



>ref|XP_007016429.1| U-box domain-containing protein kinase family protein isoform 
1 [Theobroma cacao]
 gb|EOY34048.1| U-box domain-containing protein kinase family protein isoform 
1 [Theobroma cacao]
Length=797

 Score = 62.8 bits (151),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 89/179 (50%), Gaps = 6/179 (3%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             ++++V+V +G+ V      L W LR    +   +L ++  + +    + T +G+LP+S  
Sbjct  50    EKDKVFVAVGKSVEKAVNLLRWTLRRFGGKDICLLHVHQPSPL----IPTLLGKLPASQA  105

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             N E +    + E+ +  K+L +Y +FCGK+K +   I      + K +V+L++   I  L
Sbjct  106   NGEVVSAYRREEKEELRKLLEHYSSFCGKLKVKTSIITIEADQVHKGIVELVNRHTIRNL  165

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDEVG  966
             V+       +  K  S+ +  +   N  P FC+++ V  GKLV++ E + E      VG
Sbjct  166   VMGAIPENCMRIKKNSS-KACYAARN-APCFCDIWFVNKGKLVWMREASEEPSSLPPVG  222



>ref|XP_009773923.1| PREDICTED: U-box domain-containing protein 33-like [Nicotiana 
sylvestris]
Length=852

 Score = 62.8 bits (151),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 81/169 (48%), Gaps = 11/169 (7%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E Q E +VY+ +G+ V+     ++W  +   +  + I I Y        Y+ T +GRLP+
Sbjct  47    EEQNEPKVYIAVGKSVNKNVALVQWACKTFGN--SEICIFYVLEP--SPYIPTLLGRLPA  102

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSL  1158
             +  N E +      E  +  K+L+ Y+  C   KVKA +  ++ H   + K ++D ++  
Sbjct  103   TQANAEVVSAFRDAEREEARKLLSRYLNVCCKSKVKASVAIVEAH--FVLKGILDFVNKH  160

Query  1157  QITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              I KL++      P   K + + +         P FCE+F V+ GKLV+
Sbjct  161   NIRKLIIGAI---PDCVKVKKSSQKASFAAAYFPSFCEIFFVYKGKLVW  206



>gb|EYU27649.1| hypothetical protein MIMGU_mgv1a020618mg, partial [Erythranthe 
guttata]
Length=249

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 74/160 (46%), Gaps = 5/160 (3%)
 Frame = -3

Query  1487  YVGIGEDVHD--GFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             YV +G    +     +L WVL N    S+T+L L       + Y+ TP+G+LP S VN E
Sbjct  44    YVAVGRQSEETSSMGALIWVLDNVVVPSSTLLFLIHVFPETK-YIPTPLGKLPISQVNSE  102

Query  1313  klkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLS  1134
             + +     E AKT   L  +I  C   + ++  I        K ++DLI  L I KLVL 
Sbjct  103   QKEKYMSKERAKTRDFLQKFINLCSPTQVKVETILIESDMEAKAILDLIPILNIKKLVLG  162

Query  1133  LTFMKPLLWKSRSALRGLF--HIHNQKPDFCELFVVFGGK  1020
              T       +SR    G+    I +  P+ CE+ ++  GK
Sbjct  163   STKSNLRKMRSRKGNSGVLADQILHNAPEICEVKIICEGK  202



>ref|XP_010942862.1| PREDICTED: U-box domain-containing protein 33 [Elaeis guineensis]
Length=237

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 78/159 (49%), Gaps = 6/159 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+       +L W L++ +  S+ + +++    +   ++ TP+G  P   ++E++
Sbjct  43    VYVAVGKS-SSSMDALSWALKHLAKPSSFVYLIHVFPEV--HHIPTPLGTFPKHQLSEDQ  99

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             ++     E  K  ++L  Y+  C   K E+         I K +VDLI  L I +L++  
Sbjct  100   VESYMHQERTKRQEMLQKYLNLCHSSKVEVDTFLIESDQIVKAVVDLIPVLNIKRLIVGT  159

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             T      W+ R++  G   IH   PD+CE+ ++  G+ V
Sbjct  160   TKANVRRWR-RNSKAG--QIHKDAPDYCEVKIICDGREV  195



>ref|XP_008464309.1| PREDICTED: U-box domain-containing protein 35-like [Cucumis melo]
Length=272

 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 75/157 (48%), Gaps = 4/157 (3%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYVGI ++      +L+W L      ST + + +    I   ++ +P+G LP S V+ + 
Sbjct  67    VYVGISDNFDSSMDALQWTLHFAVLPSTIVYLFHVFPEI--RFIPSPLGMLPRSQVSPKL  124

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             ++     E AK    L  ++  C  V+  +  +      + + ++DLI+  QI KL+L  
Sbjct  125   VEKFRTEERAKRRMFLQKFVDKCSAVQVSVEVVMIESDMVSRAILDLIALFQIKKLILGS  184

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGK  1020
             +  KP  W+S+       H+     +FC++ ++  GK
Sbjct  185   S--KPRKWRSKGGKGIARHVLQNAEEFCDVKIICEGK  219



>ref|XP_011002346.1| PREDICTED: U-box domain-containing protein 35-like [Populus euphratica]
Length=286

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 79/161 (49%), Gaps = 2/161 (1%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYVG+G+       +L W L+N    S T++ L         ++ +P+GRLP S V+  +
Sbjct  86    VYVGVGKS-ESSMDTLSWTLKNAIIDSNTMVFLIHIFPEIH-HIPSPLGRLPKSQVSARQ  143

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             L++    E  K  ++L   I  C   K ++  I     ++ K MVDLI+ L + KL+L  
Sbjct  144   LENYMAQERDKRRELLQKLINMCSASKVKVDTILVESDAVGKAMVDLITVLNMRKLILGT  203

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFL  1008
             +  K    +S+        +  + P+FC++ ++  GK V +
Sbjct  204   SKSKLRKLRSKRGNGIADQVIQKAPEFCDVKIICDGKEVVI  244



>ref|XP_002308753.1| hypothetical protein POPTR_0006s00580g [Populus trichocarpa]
 gb|EEE92276.1| hypothetical protein POPTR_0006s00580g [Populus trichocarpa]
Length=289

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 8/172 (5%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYVG+G+       +L W L+N    S T++ L         Y+ +P+GRLP S V+ ++
Sbjct  88    VYVGVGKS-ESSMDALSWTLKNAIIDSNTMVFLIHIFPEIH-YIPSPLGRLPKSQVSAQQ  145

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             +++    E  K  ++L  +I  C   K ++  I     ++ K M+DLI+ + + KL+L  
Sbjct  146   VENYMAQERDKRRELLQKFINMCSASKVKVDTILVESDAVGKAMMDLITVVNMRKLILGT  205

Query  1130  TFMKPLLWKSRSALRG---LFHIHNQKPDFCELFVVFGGKLVFLIEENGESV  984
             +  K  L K RS  RG      +    P+FC++ ++  GK V + +  G  +
Sbjct  206   S--KSNLRKLRSK-RGNGIADQVIQNAPEFCDVKIICDGKEVVIDQMVGSPI  254



>gb|KCW49231.1| hypothetical protein EUGRSUZ_K02804, partial [Eucalyptus grandis]
Length=233

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 79/160 (49%), Gaps = 7/160 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVL-RNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             VYV +G+D  D    ++W L  + +     + +++    +   Y+ TP+GRL  S ++++
Sbjct  46    VYVAVGKDDMD---VVKWALDHHVAPHHARVFLVHVFPPVA--YIPTPVGRLSRSQLSQD  100

Query  1313  klkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLS  1134
             +++     E  +   +L  YI  C   K  +  +     +I K ++DLI  + ITKLV+ 
Sbjct  101   QVRVYINEESNRRRNLLQKYIRLCADAKVTVDTMLIEHRNIAKAILDLIPVVNITKLVIG  160

Query  1133  LTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
                       +++  +G F +    PD+CE+ VV+ G+ V
Sbjct  161   TKRAPSSRRLTKNLAKGKF-LKKHAPDYCEVTVVYNGQKV  199



>ref|XP_011005723.1| PREDICTED: U-box domain-containing protein 35-like [Populus euphratica]
Length=286

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 79/161 (49%), Gaps = 2/161 (1%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYVG+G +      +L W L+N    S T++ L         ++ +P+GRLP S V+  +
Sbjct  86    VYVGVG-NSESSMDTLSWTLKNAIIDSNTMVFLIHIFPEIH-HIPSPLGRLPKSQVSARQ  143

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             L++    E  K  ++L   I  C   K ++  I     ++ K MVDLI+ L + KL+L  
Sbjct  144   LENYMAQERDKRRELLQKLINMCSASKVKVDTILVESDAVGKAMVDLITVLNMRKLILGT  203

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFL  1008
             +  K    +S+        +  + P+FC++ ++  GK V +
Sbjct  204   SKSKLRKLRSKRGNGIADQVIEKAPEFCDVKIICDGKEVVI  244



>ref|XP_004138091.1| PREDICTED: U-box domain-containing protein 52-like [Cucumis sativus]
 ref|XP_004168109.1| PREDICTED: U-box domain-containing protein 52-like [Cucumis sativus]
 gb|KGN63540.1| hypothetical protein Csa_1G004060 [Cucumis sativus]
Length=239

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 78/161 (48%), Gaps = 10/161 (6%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D  D    L+W L +  S    + +L+    +   Y+ TP+GRL  S +++E+
Sbjct  47    VYVAVGKDDID---VLKWALDHAVSPGCCVFLLHVFPPL--TYIPTPVGRLARSQLSQEQ  101

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             L+     E  +   +L  YI  C   K  +  +     +  K ++ LI  L IT LV+  
Sbjct  102   LRVYINEENNRRRNLLQKYIRLCTDAKVTVDTLLLESNTTAKAILQLIPVLNITNLVIGT  161

Query  1130  TFMKPLLWK--SRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
                KPL  K   +   +G F +    P++CE+ VV+ GK V
Sbjct  162   K--KPLSSKLLGKRMTKGEF-VKKNAPEYCEVTVVYEGKKV  199



>ref|XP_007026391.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
 gb|EOY29013.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
Length=267

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 78/164 (48%), Gaps = 3/164 (2%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVN  1320
             E+ VYV +G+       +L W L +  S S+ + +++    I   ++ +P+G LP S V+
Sbjct  68    EDIVYVAVGKS-ESSIDALSWTLSHFVSTSSVLYLIHVFPEI--HHIPSPLGMLPKSKVS  124

Query  1319  eeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
               ++++    E  K  ++L  ++  C   K ++  +      + K ++DLI  L I KLV
Sbjct  125   PAQVENYMAQERGKRRELLQKFLNICSASKVKVDTMLIESDMVAKAILDLIPILNIRKLV  184

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFL  1008
             +  +   P   KSR        I    PD CE+ VV  GK V +
Sbjct  185   VGTSNCSPRKLKSRRGFGIADQIFQNAPDTCEVKVVCEGKEVII  228



>ref|XP_010918573.1| PREDICTED: U-box domain-containing protein 33-like [Elaeis guineensis]
Length=885

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 89/168 (53%), Gaps = 12/168 (7%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             +EE+VYV +G++   G  +L WVLR C+S+   I+I++         +    GR P+SS+
Sbjct  22    EEEKVYVAVGQEFKAGKANLSWVLR-CTSRDAKIVIVHVHRPA--QMINMLGGRFPASSL  78

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
               +++    ++E  K +K L  YIA C ++K    K+     ++ K +V+LI+   ITKL
Sbjct  79    KPQQVNAYRQFERDKMNKSLDEYIALCSQLKVRAEKLVIETDNVGKGLVELIAQYGITKL  138

Query  1142  VLSLT----FMKPL-LWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             V+       + K + + KS++A+     +  +    C+++ V  G L+
Sbjct  139   VMGAAADKHYTKKMKVPKSKTAIT----VKEEADPSCKIWFVCKGSLI  182



>ref|XP_003632149.1| PREDICTED: U-box domain-containing protein 33-like [Vitis vinifera]
Length=836

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 83/165 (50%), Gaps = 5/165 (3%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             +RV+V +G+ V      L W  R   S    ++ ++  + +    + T +G+LP+S  N 
Sbjct  50    DRVHVAVGKSVEKAESLLHWTFRRFGSCEICLVHVHQPSPL----IPTLLGKLPASQANG  105

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             E +    + E+ +T+K+L NY   C ++K +   I      ++K +VDL++   I KLV+
Sbjct  106   EVVSAHRREEKKQTNKLLLNYSNICSRMKVKPSIITIEADHVQKGIVDLVNRHGIRKLVM  165

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
               T  +  +    S+ +  +    + P+FCE++ +  GK V+  E
Sbjct  166   GGTVPENCMKVKMSSSKANY-AAKKAPEFCEIWFIHKGKHVWTKE  209



>gb|KDO69500.1| hypothetical protein CISIN_1g025166mg [Citrus sinensis]
Length=257

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 78/162 (48%), Gaps = 11/162 (7%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D       L+W L +  S    I +++  + +   Y+ TP+GRL  S +N+E+
Sbjct  55    VYVAVGKD---DLHVLKWALDHAVSPGARIYLVHVFSPVT--YINTPVGRLARSQLNQEQ  109

Query  1310  lkdldkyeeaKTDKILANYIAFCG---KVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
             ++     E  +   +L  YI  C    +V  E + ++    +  K ++DLIS   +T LV
Sbjct  110   VRVYVNEENNRRRNLLQKYIRLCNDAKQVTVETMLVE--SKATAKAILDLISVANVTSLV  167

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             +           ++   +G F +    PD+CE+ +V  GK V
Sbjct  168   MGTKLSPRSRLFTKKLSKGEF-VKKNAPDYCEVTIVHDGKKV  208



>ref|XP_007210790.1| hypothetical protein PRUPE_ppa018702mg [Prunus persica]
 gb|EMJ11989.1| hypothetical protein PRUPE_ppa018702mg [Prunus persica]
Length=271

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 77/161 (48%), Gaps = 10/161 (6%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D  D    L+W L N  S  T + +++    I   Y+ TP+GRL    + E++
Sbjct  85    VYVAVGKDDTD---VLKWTLDNAVSPGTRVFLVHVFPPIT--YIPTPVGRLSKGQLTEDQ  139

Query  1310  lkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             ++     E  K   +L  Y++ C   KV  E + I   D +  K ++DLI  L I  LV+
Sbjct  140   VRLYINEESNKRRNLLQKYVSLCNDAKVTVETMLIDSKDTA--KAILDLIPVLSIIHLVI  197

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
               T   P   + +  L     +    PDFCE+ ++  GK V
Sbjct  198   G-TKRPPHSRRVQKKLSLGEFVRKNAPDFCEVSIIHEGKKV  237



>emb|CBI16147.3| unnamed protein product [Vitis vinifera]
Length=820

 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 83/165 (50%), Gaps = 5/165 (3%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             +RV+V +G+ V      L W  R   S    ++ ++  + +    + T +G+LP+S  N 
Sbjct  50    DRVHVAVGKSVEKAESLLHWTFRRFGSCEICLVHVHQPSPL----IPTLLGKLPASQANG  105

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             E +    + E+ +T+K+L NY   C ++K +   I      ++K +VDL++   I KLV+
Sbjct  106   EVVSAHRREEKKQTNKLLLNYSNICSRMKVKPSIITIEADHVQKGIVDLVNRHGIRKLVM  165

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
               T  +  +    S+ +  +    + P+FCE++ +  GK V+  E
Sbjct  166   GGTVPENCMKVKMSSSKANY-AAKKAPEFCEIWFIHKGKHVWTKE  209



>ref|XP_010037522.1| PREDICTED: U-box domain-containing protein 52-like [Eucalyptus 
grandis]
Length=241

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 79/160 (49%), Gaps = 7/160 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVL-RNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             VYV +G+D  D    ++W L  + +     + +++    +   Y+ TP+GRL  S ++++
Sbjct  46    VYVAVGKDDMD---VVKWALDHHVAPHHARVFLVHVFPPVA--YIPTPVGRLSRSQLSQD  100

Query  1313  klkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLS  1134
             +++     E  +   +L  YI  C   K  +  +     +I K ++DLI  + ITKLV+ 
Sbjct  101   QVRVYINEESNRRRNLLQKYIRLCADAKVTVDTMLIEHRNIAKAILDLIPVVNITKLVIG  160

Query  1133  LTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
                       +++  +G F +    PD+CE+ VV+ G+ V
Sbjct  161   TKRAPSSRRLTKNLAKGKF-LKKHAPDYCEVTVVYNGQKV  199



>ref|XP_006439911.1| hypothetical protein CICLE_v10021791mg [Citrus clementina]
 gb|ESR53151.1| hypothetical protein CICLE_v10021791mg [Citrus clementina]
Length=257

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 78/162 (48%), Gaps = 11/162 (7%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D       L+W L +  S    I +++  + +   Y+ TP+GRL  S +N+E+
Sbjct  55    VYVAVGKD---DLHVLKWALDHAVSPGARIYLVHVFSPVT--YINTPVGRLARSQLNQEQ  109

Query  1310  lkdldkyeeaKTDKILANYIAFCG---KVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
             ++     E  +   +L  YI  C    +V  E + ++    +  K ++DLIS   +T LV
Sbjct  110   VRVYVNEENNRRRNLLQKYIRLCNDAKQVTVETMLVE--SKATAKAILDLISVANVTSLV  167

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             +           ++   +G F +    PD+CE+ +V  GK V
Sbjct  168   MGTKLSPRSRLFTKKLSKGEF-VKKNAPDYCEVTIVHDGKKV  208



>ref|XP_008464515.1| PREDICTED: U-box domain-containing protein 52-like [Cucumis melo]
Length=239

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 78/161 (48%), Gaps = 10/161 (6%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D  D    L+W L +  S    + +L+    +   Y+ TP+GRL  S +++E+
Sbjct  47    VYVAVGKDDID---VLKWALDHAVSPGCCVFLLHVFPPL--TYIPTPVGRLARSQLSQEQ  101

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             L+     E  +   +L  YI  C   K  +  +     +  K ++ LI  L IT LV+  
Sbjct  102   LRVYINEENNRRRNLLQKYIRLCTDAKVTVDTLLLEGNTTAKAILQLIPVLNITNLVIGT  161

Query  1130  TFMKPLLWK--SRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
                KPL  K   +   +G F +    P++CE+ +V+ GK V
Sbjct  162   K--KPLSTKLLGKRMTKGEF-VKKNAPEYCEVTIVYEGKKV  199



>ref|XP_004134989.1| PREDICTED: uncharacterized protein LOC101213489 [Cucumis sativus]
 ref|XP_004167106.1| PREDICTED: uncharacterized LOC101213489 [Cucumis sativus]
Length=279

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 87/162 (54%), Gaps = 8/162 (5%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVN  1320
             E+ VYVG+G++      +L+W L+N    STT++ L       R Y+ +P+G++P + V+
Sbjct  75    EDCVYVGVGKN-DSSVDALQWTLKNAVITSTTVVYLLHVFPEIR-YIPSPLGKIPINQVS  132

Query  1319  eeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             +E++      EE+K    L N+I  C   KVKA+ + I+     + + ++D+I  L I K
Sbjct  133   KEQVAIHVAQEESKRKDFLQNFIDSCSAAKVKADTVLIESD--MVARAILDVIPILNIRK  190

Query  1145  LVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGK  1020
             LVL +   + L  +  S +     I  +  ++CE+ VV  GK
Sbjct  191   LVLGVNKSRKLRSRGGSGIAN--EILQKAAEYCEVKVVCEGK  230



>ref|XP_010241166.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
Length=210

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 78/169 (46%), Gaps = 23/169 (14%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVN  1320
              ++VYV +G++ H    +L W L N +  ST + +++    +   Y+ TP+G +P   V 
Sbjct  50    HDKVYVAVGKN-HWSMDALLWTLNNLTKPSTFVHLIHVFPEV--RYIPTPLGNVPKGQVK  106

Query  1319  eeklkdldkyeeaKTDKILANYIAFCG--KVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
              E ++            +L  ++  C   KV A+IL I+    +  K ++DLI  L I K
Sbjct  107   TEMVEAYVNQVRMYRRGLLQKFLDTCSAFKVSADILLIESDLKA--KAVLDLIPVLNIRK  164

Query  1145  LVLSLTFMKPLLWKSRSALRGL-------FHIHNQKPDFCELFVVFGGK  1020
             LV+            RS+LR L         I    PDFCE+ ++  GK
Sbjct  165   LVMG---------TPRSSLRNLRRGSPVAHGISKNAPDFCEVKLICEGK  204



>emb|CDP12743.1| unnamed protein product [Coffea canephora]
Length=240

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 79/163 (48%), Gaps = 12/163 (7%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D       ++WVL N  S  T + +++    I   Y+ TP+GRL  S +++++
Sbjct  45    VYVAVGKD---DLHVVQWVLDNAVSPGTRLFLVHVFPPIT--YINTPVGRLSRSQLSQDQ  99

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             L+     ++ +   +L  YI  C   K  +  +     +  K ++ LI  + IT LV+  
Sbjct  100   LRVYLNEDQNRRKYLLEKYIRMCNDAKVPVDTMLLESNATAKAILGLIPVVNITNLVMG-  158

Query  1130  TFMKPLLWKSRSALRGLF---HIHNQKPDFCELFVVFGGKLVF  1011
             T   P    +R  ++G     ++    P+ CE+ +V+ G+ + 
Sbjct  159   TKRSPF---TRQLMKGQGKGEYVQKNAPECCEVTIVYNGRRII  198



>ref|XP_002314184.2| hypothetical protein POPTR_0009s03570g [Populus trichocarpa]
 gb|EEE88139.2| hypothetical protein POPTR_0009s03570g [Populus trichocarpa]
Length=837

 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 77/165 (47%), Gaps = 6/165 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             ERVYV +G  +      L WV     ++   +L ++  + +    + TP+G+LP+S  N 
Sbjct  46    ERVYVAVGNSLEKALSLLNWVFNIFGTRQICLLHVHRPSPL----IPTPLGKLPASQANA  101

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             E +    + E  +T K++  Y+  C + K E   I   +  + K +V+L++   + KLV+
Sbjct  102   EVVSAFRREENEQTKKLIDYYLIICSRAKVEATIIIIENDQVHKGIVELVNRHGVRKLVM  161

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
                    L  K  S+     +     P FCE++ +  GK V+  E
Sbjct  162   GAVTENCLKVKKSSSKEN--YAAKYAPLFCEIWFINKGKHVWTRE  204



>gb|KGN49029.1| hypothetical protein Csa_6G510960 [Cucumis sativus]
Length=351

 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 87/162 (54%), Gaps = 8/162 (5%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVN  1320
             E+ VYVG+G++      +L+W L+N    STT++ L       R Y+ +P+G++P + V+
Sbjct  147   EDCVYVGVGKN-DSSVDALQWTLKNAVITSTTVVYLLHVFPEIR-YIPSPLGKIPINQVS  204

Query  1319  eeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             +E++      EE+K    L N+I  C   KVKA+ + I+     + + ++D+I  L I K
Sbjct  205   KEQVAIHVAQEESKRKDFLQNFIDSCSAAKVKADTVLIE--SDMVARAILDVIPILNIRK  262

Query  1145  LVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGK  1020
             LVL +   + L  +  S +     I  +  ++CE+ VV  GK
Sbjct  263   LVLGVNKSRKLRSRGGSGIAN--EILQKAAEYCEVKVVCEGK  302



>ref|XP_010043562.1| PREDICTED: U-box domain-containing protein 33-like [Eucalyptus 
grandis]
 gb|KCW85576.1| hypothetical protein EUGRSUZ_B02373 [Eucalyptus grandis]
Length=847

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 92/201 (46%), Gaps = 25/201 (12%)
 Frame = -3

Query  1517  MEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTP----  1350
             +E +   ERVYV +G+        + W LR            +A   IC  +V+ P    
Sbjct  43    LEMAAAPERVYVAVGKSAEKARDLILWSLRR-----------FAGAEICIFHVHQPSPLI  91

Query  1349  ---IGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFC---GKVKAEILKIQRHDGSIE  1188
                +G+LP+S  + E +    + E  +TDK+L  Y+A C    +V+A +L  +   G ++
Sbjct  92    PTLLGKLPASRASVEVVAAYRREEREQTDKLLQQYLAICSTTSEVRATVLSTE--AGQVQ  149

Query  1187  KIMVDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFL  1008
             K +V+++    I +LV+       +  K +S+ +  +   N  P FCE+  V  G+ ++ 
Sbjct  150   KGIVEMVIKYGIRRLVMGAVPENCIKVK-KSSSKANYAAKN-APGFCEISFVNKGRRIWT  207

Query  1007  IEENGESVIKDEVGGVIGRAR  945
              + NG  V  D +      AR
Sbjct  208   RDANGGPVPLDSLSQPQTSAR  228



>ref|XP_006424819.1| hypothetical protein CICLE_v10027788mg [Citrus clementina]
 gb|ESR38059.1| hypothetical protein CICLE_v10027788mg [Citrus clementina]
Length=887

 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 85/175 (49%), Gaps = 11/175 (6%)
 Frame = -3

Query  1517  MEESQKEERVYVGIGEDVHDGFQSLEWVL-RNCSSQSTTILILYAANTICRDYVYTPIGR  1341
             +EE   +E+VYV +G+ V  G   L W L R  SS+   IL ++  + +    + T +G+
Sbjct  87    VEEEGGDEKVYVALGKCVEKGLSLLHWTLQRFGSSREICILHVHQPSPV----IPTLLGK  142

Query  1340  LPSSSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLI  1167
             LP+S  + E L      E     K+L NY+  C   KVKA I+  +     I+K +V L+
Sbjct  143   LPASQASAEVLSAFRAEERQNMKKLLDNYLRICVEAKVKARIITTE--ADKIQKAIVQLM  200

Query  1166  SSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
             +   I KLV+   F    + K +   R   +     P FCE++ V  GK V+  E
Sbjct  201   NIHGIQKLVMG-AFPDNCM-KVKMGSRKASYAAKNAPMFCEIWFVNKGKHVWTKE  253



>ref|XP_008380654.1| PREDICTED: U-box domain-containing protein 52-like [Malus domestica]
Length=265

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 71/153 (46%), Gaps = 12/153 (8%)
 Frame = -3

Query  1460  DGFQSLEWVLRNC-SSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeeklkdldkyee  1284
             D    L+W L N  SS ST + +++    +   +V TP+GRL  S +N+++++   K E 
Sbjct  64    DDTDVLKWTLENAASSGSTRVFLVHVFPPVT--HVPTPVGRLARSQLNDDQVRLYVKEES  121

Query  1283  aKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSLTFMKPLLWK  1104
              K   ++  Y+  C   K     I       EK +V+LI  L IT LV+           
Sbjct  122   NKRSNLMQKYVNLCNDAKVTAETILLESNCTEKSIVELIPVLSITHLVIGTK------RH  175

Query  1103  SRSALRGLF---HIHNQKPDFCELFVVFGGKLV  1014
             SR A + L     + N  PDFCE+ +V  G  V
Sbjct  176   SRPARKQLLLGEFVKNNAPDFCEVSIVHKGNKV  208



>ref|XP_006424818.1| hypothetical protein CICLE_v10027788mg [Citrus clementina]
 gb|ESR38058.1| hypothetical protein CICLE_v10027788mg [Citrus clementina]
Length=842

 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 85/175 (49%), Gaps = 11/175 (6%)
 Frame = -3

Query  1517  MEESQKEERVYVGIGEDVHDGFQSLEWVL-RNCSSQSTTILILYAANTICRDYVYTPIGR  1341
             +EE   +E+VYV +G+ V  G   L W L R  SS+   IL ++  + +    + T +G+
Sbjct  87    VEEEGGDEKVYVALGKCVEKGLSLLHWTLQRFGSSREICILHVHQPSPV----IPTLLGK  142

Query  1340  LPSSSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLI  1167
             LP+S  + E L      E     K+L NY+  C   KVKA I+  +     I+K +V L+
Sbjct  143   LPASQASAEVLSAFRAEERQNMKKLLDNYLRICVEAKVKARIITTE--ADKIQKAIVQLM  200

Query  1166  SSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
             +   I KLV+   F    + K +   R   +     P FCE++ V  GK V+  E
Sbjct  201   NIHGIQKLVMG-AFPDNCM-KVKMGSRKASYAAKNAPMFCEIWFVNKGKHVWTKE  253



>ref|XP_007036324.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
 gb|EOY20825.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
Length=237

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 79/169 (47%), Gaps = 6/169 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G D  D    L+W L +  S    + +++    I   +V TP+G+L  + +NEE+
Sbjct  45    VYVAVGRDDLD---VLKWALDHAVSPGARVFLVHVFAPI--TFVRTPVGKLSKNQLNEEQ  99

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             L+     E  +   +LA YI  C   K  +  +     S+ K +++LI  L IT LV+  
Sbjct  100   LRVYVNEENNRRKNLLAKYIRLCIDSKVTVDTMLIESNSLSKAILELIPVLNITCLVIGS  159

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESV  984
                     + R    G   I N  PD+CE+ VV  GK V   ++  E V
Sbjct  160   KHPPSSRQRRRKQRIGEL-IKNNAPDYCEVTVVHDGKKVQDCQQEPEQV  207



>emb|CBI23514.3| unnamed protein product [Vitis vinifera]
Length=223

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             +E+ VYV +G+       +L W L++  + ST + +++    I   +V TP+G+LP S  
Sbjct  20    REDNVYVAVGK-CESSTDALAWTLKHAVTPSTIVYLVHVFPEI--RHVATPLGKLPKSQA  76

Query  1322  NeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
             N  +L+     E  K  ++L  ++  C   +VKA+ + I+     + K ++DLI  L + 
Sbjct  77    NPLQLESHMAQERGKRRELLQKFLDMCSSSQVKADTMLIE--SDMVGKAILDLIPVLNVR  134

Query  1148  KLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENG  993
             KLV+          ++R        +    P++C++ +V  GK V + + NG
Sbjct  135   KLVVGAAKSSLRKLRTRRGSGIADQLVQNAPEYCDVKIVCEGKEVSMEQMNG  186



>ref|XP_006852311.1| hypothetical protein AMTR_s00049p00196550 [Amborella trichopoda]
 gb|ERN13778.1| hypothetical protein AMTR_s00049p00196550 [Amborella trichopoda]
Length=252

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 84/177 (47%), Gaps = 14/177 (8%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E + ++ +YV +G+     + +L W +         + +++    +  +Y+ +P+GR+P 
Sbjct  45    ERESKDDIYVAVGKK-ESSYDALRWAINFVVKPGCLVYLVHVFPPV--NYIPSPVGRIPK  101

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSL  1158
             S V  E LK     E  +   +L  YI+ C   KVK +I+ I+     +EK +V+LI  L
Sbjct  102   SQVGPEYLKAYMNEESVRRRSLLQKYISLCSKSKVKVDIMLIESE--IVEKAIVELIPVL  159

Query  1157  QITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGES  987
              I +LV+          +   A      +    P++CE+ VV  GK+V    EN E+
Sbjct  160   NIKRLVMGSRRSSRRQRRHGKAEL----VRKNAPEYCEVTVVNAGKVV---PENQET  209



>ref|XP_002511332.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51934.1| ATP binding protein, putative [Ricinus communis]
Length=315

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 69/153 (45%), Gaps = 6/153 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D       L+W L    S  T + +++    I   Y+ TP+GRL  S +++++
Sbjct  50    VYVAVGKD---DLHVLKWALDRAVSPGTRVFLVHVFPPI--TYIPTPVGRLSRSQLSQDQ  104

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             ++     E  +   IL  YI  C   K  +  +        K ++DLI  L IT LV+  
Sbjct  105   VRFYINEEHNRRRSILQKYIRLCNDAKVTVDTMLIESNETAKAILDLIPVLNITNLVMGT  164

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVV  1032
             T   P     R  L     +    PD+CE+ VV
Sbjct  165   T-RPPRSRLLRKRLAKAEFVKKNAPDYCEVTVV  196



>gb|KDO78596.1| hypothetical protein CISIN_1g021587mg [Citrus sinensis]
Length=261

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 76/148 (51%), Gaps = 14/148 (9%)
 Frame = -3

Query  1508  SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSS  1329
             +Q+E+ +YV +G+       +L W LR+  + ST I +++    +   +V +P+G+LP +
Sbjct  107   TQEEDIIYVAVGKS-QSSMDALSWTLRHAVNPSTLIFLIHVFPQV--KFVPSPLGKLPRN  163

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
              VN E+L+     E  K  ++L  ++  C + K  +  +      + K ++DLI  L I 
Sbjct  164   QVNPEQLETFMAQETGKRRQLLQKFLDTCSQSKVMVDTVLIESDLVAKAILDLIPVLNIR  223

Query  1148  KLVLSLTFMKPLLWKSRSALRGLFHIHN  1065
             KLV+  T         +S+LR  FH H+
Sbjct  224   KLVVGTT---------KSSLR--FHFHS  240



>ref|XP_006339578.1| PREDICTED: U-box domain-containing protein 33-like isoform X1 
[Solanum tuberosum]
 ref|XP_006339579.1| PREDICTED: U-box domain-containing protein 33-like isoform X2 
[Solanum tuberosum]
Length=892

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 80/187 (43%), Gaps = 21/187 (11%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS-------  1332
             +YV +G+D+ +   +L W L     +   IL           +V+TP  ++P        
Sbjct  47    MYVAVGKDLKETEPTLTWALHKSGGRKICIL-----------HVHTPAQKIPMMGTKFNI  95

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
               ++  +++   + E     KIL  YI  CG+      KI     SIEK +V+LIS   I
Sbjct  96    DQLDVHQVRAYHEKERQVMHKILEKYILICGRAGVRADKIVLEMDSIEKGIVELISQHGI  155

Query  1151  TKLVLSLTFMKPLLWKSRSALRG--LFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIK  978
              KLV+     K    K  S LR     ++  Q P FC ++ V  G L++  E   E +  
Sbjct  156   GKLVMGAAANK-CYSKKMSDLRSKKAIYVRLQAPTFCCIWFVCKGNLIYTRESKPERLNT  214

Query  977   DEVGGVI  957
             D V   I
Sbjct  215   DSVSPSI  221



>ref|XP_004168891.1| PREDICTED: U-box domain-containing protein 52-like, partial [Cucumis 
sativus]
Length=342

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 5/157 (3%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D  D    L+W L +  S    + +++    +   Y+ TP+GRL  S ++ E+
Sbjct  47    VYVAVGKDDID---VLKWALNHVVSPGCCVFLVHVFPLLT--YIPTPVGRLARSQLSREQ  101

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             L+     E  +   +L  YI  C   K  +  +     +  K ++ LI  L IT LV+  
Sbjct  102   LRVYINEENNRRRNLLQKYIRLCTDAKVTVDTLLLESNTTTKAILQLIPVLNITNLVIGT  161

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGK  1020
               + PL       +R    +  + P+FCE+ +V+ GK
Sbjct  162   KDLFPLGLLLGKRMRTGEIVKKKAPEFCEVSIVYEGK  198



>emb|CDP08808.1| unnamed protein product [Coffea canephora]
Length=316

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 81/184 (44%), Gaps = 21/184 (11%)
 Frame = -3

Query  1508  SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILY-AANTICRDYVYTPIGRLPS  1332
             +  ++ VYV +G++V +   +L W L NC  + T IL ++  A  I       PI RL  
Sbjct  44    TDSDDAVYVALGKEVKEAELTLSWALHNCGGRKTIILHVHQPAQKISMMGANVPISRLEE  103

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
               V         + E     K+L  Y+  C K   ++ K+     SIEK +V+LI    I
Sbjct  104   YRVR-----AHHEAERQDMQKLLDKYMLICKKAGVQVDKLYIVKDSIEKGIVELILLHCI  158

Query  1151  TKLVL--------SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEEN  996
              KLV+        S   M+P   +S+ A+    ++  Q P FC++  +  G L+   E  
Sbjct  159   KKLVMGGAAKGHYSRKMMEP---RSKKAI----YVRQQAPSFCQIRFICKGHLIHTREGT  211

Query  995   GESV  984
                V
Sbjct  212   PSGV  215



>ref|XP_010096480.1| U-box domain-containing protein 33 [Morus notabilis]
 gb|EXB64600.1| U-box domain-containing protein 33 [Morus notabilis]
Length=300

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 78/167 (47%), Gaps = 2/167 (1%)
 Frame = -3

Query  1508  SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSS  1329
             S ++  VYV +G+       +L+W LR+  +  +T + L       R  + TP+G+LP S
Sbjct  80    STEDHSVYVAVGKS-PSSLDALDWALRHAVNPPSTTVYLIHIYPETRQ-IPTPLGKLPLS  137

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
              V+ E++++    E  K  ++L  +I  C     ++  I      + K ++DLI  L I 
Sbjct  138   QVSPEQVENHMAQERGKRRELLQKFIYKCSAANVKVDTILIESDGLPKAILDLIDILNIR  197

Query  1148  KLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFL  1008
             K+VL  T       KSR     +  I    P+ CE+ ++  G  V +
Sbjct  198   KVVLGTTKSSLRKLKSRKGTGTVDQILKSAPETCEVKIICEGNEVMI  244



>emb|CDP09046.1| unnamed protein product [Coffea canephora]
Length=846

 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 11/172 (6%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G+ V      L+W  R        IL ++  + +    + T +G+LP+S  N 
Sbjct  51    EKVYVAVGKSVAKAGALLQWCFRTFVGSEICILHVHKPSPL----IPTLLGKLPASQANP  106

Query  1316  eklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             E +      E   T K+L NY   C   KVKA I+  +     +E  +V+L+S   I KL
Sbjct  107   EVVTAFRNEEWEATGKLLQNYKKICSTSKVKASIVTSEADQVQLE--IVNLVSRHDIKKL  164

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGES  987
             V+      P   K +       +     P FC+++ V  GKLV+  +++  S
Sbjct  165   VIGAI---PDCSKLKKCSSKASYAAKMAPPFCKIWFVNKGKLVWTRQDSQSS  213



>ref|XP_003529681.1| PREDICTED: U-box domain-containing protein 33-like [Glycine max]
Length=295

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 68/126 (54%), Gaps = 6/126 (5%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVN  1320
             ++ VYV +G+D     ++L W L++  + S T+ I++    +    + +P+G++P S VN
Sbjct  84    DDVVYVAVGKDGDSSMEALSWALKHAVTPSATVCIVHVFPQV--KLIPSPLGKIPRSHVN  141

Query  1319  eeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
              E +      E+ K   +L  +   C   KVK E+  I+  +  + K +VDL+ +L I K
Sbjct  142   LEYVNMHLTQEKGKRKLLLQKFTDLCVDSKVKVEMKLIEGDN--VAKTIVDLVGNLNIRK  199

Query  1145  LVLSLT  1128
             LV+ +T
Sbjct  200   LVIGIT  205



>ref|XP_011072175.1| PREDICTED: U-box domain-containing protein 52-like [Sesamum indicum]
Length=248

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 76/154 (49%), Gaps = 8/154 (5%)
 Frame = -3

Query  1490  VYVGIGE-DVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             VYV +G+ D+H     L+W L +  S  + + +++    +   Y+ TP+GRL  S ++++
Sbjct  59    VYVAVGKNDLH----VLKWALDHAVSPGSRVFLVHVFPPVS--YIPTPVGRLSRSQLSKD  112

Query  1313  klkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLS  1134
             +L+   + E  K   +L  YI  C + K  +  +     +  K +++LI    IT LV+ 
Sbjct  113   QLQVYIREESNKRKNLLEKYIRLCNESKVVVDTMLVESNASTKAILELIPVANITNLVMG  172

Query  1133  LTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVV  1032
              T   P    SR  L    ++    PD+CE+ VV
Sbjct  173   -TKQSPFSRLSRKGLGKGEYVKKYAPDYCEVTVV  205



>ref|XP_011095890.1| PREDICTED: U-box domain-containing protein 51 isoform X2 [Sesamum 
indicum]
Length=278

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 90/185 (49%), Gaps = 24/185 (13%)
 Frame = -3

Query  1511  ESQKEERVY-VGIGED---VHDGFQS-------LEWVLRNCSSQSTTILILYAANTICRD  1365
             ES +EE VY +G GED   V  G QS       L W L N    S+T++ L       + 
Sbjct  57    ESIREESVYSLGSGEDAVYVAVGRQSEETSMDALRWALNNEVDPSSTVVFLIHVFPETK-  115

Query  1364  YVYTPIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCG----KVKAEILKIQRHDG  1197
             Y+ +P+G+LP S VN E+ ++    E  KT + L  ++  C     +VK E + I+    
Sbjct  116   YIPSPLGKLPISQVNGEQRENYLAQERGKTREFLQKFVDVCSASSQQVKVETILIESDME  175

Query  1196  SIEKIMVDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQ----KPDFCELFVVF  1029
             +  K +VDLI  L I KLV+  T  K  L + RS       + +Q     P+FC + ++ 
Sbjct  176   A--KAIVDLIPILNIRKLVVGTT--KSNLRRMRSRRGNGSGVADQILQNAPEFCNVIIIC  231

Query  1028  GGKLV  1014
              GK +
Sbjct  232   EGKQI  236



>ref|XP_010670316.1| PREDICTED: U-box domain-containing protein 33-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=395

 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/179 (25%), Positives = 89/179 (50%), Gaps = 11/179 (6%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E++YV + ++      +LEWV+RN  S+  T+  ++  +     Y+Y    + P+SS++E
Sbjct  15    EKIYVAVSKEWKAWKTNLEWVVRN--SKGKTLCFVHVHHPA--QYIYLFGAKFPTSSLSE  70

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
              ++K   + E     KIL  YI  C K   ++ K+     ++E  +V+LIS  +I +LV+
Sbjct  71    PEVKAHREKERQDMCKILDEYIRICTKAGVQVEKLYIEKQTVESGLVELISQHKIERLVM  130

Query  1136  SL----TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDE  972
                   ++ + +L    +  +   ++    P  C ++ +  G+L+   E   +S + DE
Sbjct  131   GAAADKSYSRKMLEPKSNKAK---YVRQYAPACCHIWFICKGRLICKREGIKQSRLDDE  186



>ref|XP_010670323.1| PREDICTED: U-box domain-containing protein 33-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=394

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/179 (25%), Positives = 89/179 (50%), Gaps = 11/179 (6%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E++YV + ++      +LEWV+RN  S+  T+  ++  +     Y+Y    + P+SS++E
Sbjct  15    EKIYVAVSKEWKAWKTNLEWVVRN--SKGKTLCFVHVHHPA--QYIYLFGAKFPTSSLSE  70

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
              ++K   + E     KIL  YI  C K   ++ K+     ++E  +V+LIS  +I +LV+
Sbjct  71    PEVKAHREKERQDMCKILDEYIRICTKAGVQVEKLYIEKQTVESGLVELISQHKIERLVM  130

Query  1136  SL----TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIKDE  972
                   ++ + +L    +  +   ++    P  C ++ +  G+L+   E   +S + DE
Sbjct  131   GAAADKSYSRKMLEPKSNKAK---YVRQYAPACCHIWFICKGRLICKREGIKQSRLDDE  186



>ref|XP_002299877.2| hypothetical protein POPTR_0001s24600g [Populus trichocarpa]
 gb|EEE84682.2| hypothetical protein POPTR_0001s24600g [Populus trichocarpa]
Length=736

 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 78/175 (45%), Gaps = 6/175 (3%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E+   ERVYV +G  +      L WV  +  ++   +L ++  + +    + T +G+LP+
Sbjct  11    EASSSERVYVALGNSIEKAVSLLNWVFESLGARQICLLHVHRPSPL----IPTLLGKLPA  66

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
             S  N E +    + E  +T K+   Y+  C + K E   +      + K +V+L++   +
Sbjct  67    SQANAEVVSAFRREENERTKKLFDYYLIICRRAKVEATIVTIESDQVHKGIVELVNRHGV  126

Query  1151  TKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGES  987
              KLV+       +  K  S        H   P FCE++ +  GK ++  E +  S
Sbjct  127   RKLVMGTVKENCMKVKKSSCKENYAAKH--APLFCEIWFINKGKCIWTREASENS  179



>ref|XP_002269050.1| PREDICTED: U-box domain-containing protein 36 [Vitis vinifera]
Length=275

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = -3

Query  1502  KEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             +E+ VYV +G+       +L W L++  + ST + +++    I   +V TP+G+LP S  
Sbjct  72    REDNVYVAVGK-CESSTDALAWTLKHAVTPSTIVYLVHVFPEI--RHVATPLGKLPKSQA  128

Query  1322  NeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
             N  +L+     E  K  ++L  ++  C   +VKA+ + I+     + K ++DLI  L + 
Sbjct  129   NPLQLESHMAQERGKRRELLQKFLDMCSSSQVKADTMLIESD--MVGKAILDLIPVLNVR  186

Query  1148  KLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENG  993
             KLV+          ++R        +    P++C++ +V  GK V + + NG
Sbjct  187   KLVVGAAKSSLRKLRTRRGSGIADQLVQNAPEYCDVKIVCEGKEVSMEQMNG  238



>ref|XP_006449947.1| hypothetical protein CICLE_v10016013mg [Citrus clementina]
 gb|ESR63187.1| hypothetical protein CICLE_v10016013mg [Citrus clementina]
Length=263

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 76/148 (51%), Gaps = 14/148 (9%)
 Frame = -3

Query  1508  SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSS  1329
             +Q+E+ +YV +G+       +L W LR+  + ST I +++    +   +V +P+G+LP +
Sbjct  109   TQEEDIIYVAVGKS-QCSMDALSWTLRHAVNPSTLIFLIHVFPQV--KFVPSPLGKLPRN  165

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
              VN E+L+     E  K  ++L  ++  C + K  +  +      + K ++DLI  L I 
Sbjct  166   QVNPEQLETFMAQETGKRRQLLQKFLDTCSQSKVMVDTVLIESDLVAKAILDLIPVLNIR  225

Query  1148  KLVLSLTFMKPLLWKSRSALRGLFHIHN  1065
             KLV+  T         +S+LR  FH H+
Sbjct  226   KLVVGTT---------KSSLR--FHFHS  242



>ref|XP_009773940.1| PREDICTED: U-box domain-containing protein 33 isoform X1 [Nicotiana 
sylvestris]
Length=885

 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 80/187 (43%), Gaps = 21/187 (11%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS-------  1332
             +YV +G+D+ +   +L+W L                + IC  +V+TP  ++P        
Sbjct  46    IYVAVGKDLKESEPTLKWALHKS-----------GGSRICILHVHTPAQKIPMMGTKFNI  94

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
               ++  +++   + E     KIL  Y+  CG+      K+     SIEK +V+L+S   I
Sbjct  95    DQLDVHQVRTYHEKERQDMHKILEKYVLICGRAGVRADKLVVEMDSIEKGIVELVSQRGI  154

Query  1151  TKLVLSLTFMKPLLWKSRSALRG--LFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIK  978
              KLV+     K    K  + LR     ++  Q P FC ++ V  G LV+  E   E    
Sbjct  155   GKLVMGAAANK-CYSKKMTDLRSKKAIYVRLQAPTFCCIWFVCKGNLVYTRESKSERPNT  213

Query  977   DEVGGVI  957
             D V   I
Sbjct  214   DSVSPSI  220



>ref|XP_007220262.1| hypothetical protein PRUPE_ppa001267mg [Prunus persica]
 gb|EMJ21461.1| hypothetical protein PRUPE_ppa001267mg [Prunus persica]
Length=867

 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 85/188 (45%), Gaps = 29/188 (15%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI-------GR  1341
             E+ +YV + +DV D   +L W + N                IC  +V+ P        G 
Sbjct  17    EDMIYVAVAKDVKDSKSTLVWAVHNS-----------GGKKICLAHVHQPSQKIPCMGGW  65

Query  1340  LPSSSVNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLI  1167
              P+SS+ +E+++   + E    +KIL +Y   C +  V+AE L I+     IEK +V+LI
Sbjct  66    FPASSLKDEEVRAYREIERQNMNKILEDYFRICRQMGVRAEKLHIEM--DCIEKGIVELI  123

Query  1166  SSLQITKLVLSLTFMKPLLWKSRSAL----RGLFHIHNQKPDFCELFVVFGGKLVFLIEE  999
             S   I KLV+     K   + SR  +    +   ++  Q P  C +  +  G L++  E 
Sbjct  124   SQHGIRKLVMGAAADK---YHSRKMMDLKSKKAIYVRQQAPVSCHIQFICKGHLIYTREG  180

Query  998   NGESVIKD  975
             N + V  D
Sbjct  181   NSDGVDTD  188



>ref|XP_008370963.1| PREDICTED: U-box domain-containing protein 35 [Malus domestica]
 ref|XP_008345786.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=330

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 84/171 (49%), Gaps = 9/171 (5%)
 Frame = -3

Query  1514  EESQKEERVYVGIGEDVHDGFQSLEWVLRNC--SSQSTTILILYAANTICRDYVYTPIGR  1341
             + S  +E VYVG+G+       +L W L++    S STT+ +++    +   Y+ +P+G+
Sbjct  103   DHSSHDESVYVGVGKG-ESSMDALTWSLKHAVDPSSSTTVYLIHVFPEVT--YIPSPLGK  159

Query  1340  LPSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISS  1161
             LP + V  ++++     E  K   +L  +I  C   K ++  I      I + ++DLI  
Sbjct  160   LPKNQVTSQQVETYMAEERGKRRVLLHKFIDKCSAAKVKVDTILIESDMIGRAILDLIPI  219

Query  1160  LQITKLVLSL--TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
             L ITKLV+    + ++ ++ K  S +     I    P+ CE+ ++  G  V
Sbjct  220   LNITKLVIGTNRSNLRKVMSKKGSGIGA--QILQSAPEGCEVNIICQGNPV  268



>ref|XP_009773947.1| PREDICTED: U-box domain-containing protein 33 isoform X2 [Nicotiana 
sylvestris]
Length=884

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 80/187 (43%), Gaps = 21/187 (11%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS-------  1332
             +YV +G+D+ +   +L+W L                + IC  +V+TP  ++P        
Sbjct  46    IYVAVGKDLKESEPTLKWALHKS-----------GGSRICILHVHTPAQKIPMMGTKFNI  94

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
               ++  +++   + E     KIL  Y+  CG+      K+     SIEK +V+L+S   I
Sbjct  95    DQLDVHQVRTYHEKERQDMHKILEKYVLICGRAGVRADKLVVEMDSIEKGIVELVSQRGI  154

Query  1151  TKLVLSLTFMKPLLWKSRSALRG--LFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIK  978
              KLV+     K    K  + LR     ++  Q P FC ++ V  G LV+  E   E    
Sbjct  155   GKLVMGAAANK-CYSKKMTDLRSKKAIYVRLQAPTFCCIWFVCKGNLVYTRESKSERPNT  213

Query  977   DEVGGVI  957
             D V   I
Sbjct  214   DSVSPSI  220



>ref|XP_010253186.1| PREDICTED: U-box domain-containing protein 33-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010253187.1| PREDICTED: U-box domain-containing protein 33-like isoform X2 
[Nelumbo nucifera]
Length=837

 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 83/170 (49%), Gaps = 12/170 (7%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             V+V +G  +      L W  R   +    +L ++  +      + T +G+LP++  N+E 
Sbjct  53    VHVAVGNSIEKTIALLYWTFRRFKNLYICLLHIHQPSPT----IPTLLGKLPANQANQET  108

Query  1310  lkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             +    K E  +T K+L NY+  C   KVKA I+ I+   G ++K ++DL++   I KLV+
Sbjct  109   VSAYRKEEMERTKKLLFNYLGICHRAKVKASIIAIE--SGQVQKGILDLVNMRSIKKLVM  166

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGES  987
                    +  K+ +      ++    P FC+++ V  GK V+   E+ ES
Sbjct  167   GTASDNCMKVKNSTKAN---YVAKNAPAFCQVWFVNKGKHVW-TRESSES  212



>ref|XP_006601425.1| PREDICTED: uncharacterized protein LOC100816919 [Glycine max]
Length=309

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 84/170 (49%), Gaps = 14/170 (8%)
 Frame = -3

Query  1508  SQKEERV---YVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRL  1338
             S K+ RV   YV +G+D       ++W L +  S  + I +++ ++ I    + TP+G+ 
Sbjct  106   SNKDRRVDDLYVAVGKD---DLNVVKWALDHAVSPGSRIFLIHVSSPIT--LIPTPVGKF  160

Query  1337  PSSSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLIS  1164
               S +  ++++        K   +L  YI      KV AE L ++ +D    K ++DLIS
Sbjct  161   ERSQLTPQQVRLYVNEVNNKRKDLLQKYIQMSNEAKVTAETLLLESNDKG--KAILDLIS  218

Query  1163  SLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
              L IT +V+ +  + P   ++    +G F I    P  CE+ +V+ GK++
Sbjct  219   ILTITNIVIGIKKL-PFTRRNNKLSKGEF-IKKHAPSSCEVTLVYNGKVL  266



>ref|XP_011095889.1| PREDICTED: uncharacterized protein LOC105175223 isoform X1 [Sesamum 
indicum]
Length=280

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 90/187 (48%), Gaps = 26/187 (14%)
 Frame = -3

Query  1511  ESQKEERVY-VGIGED---VHDGFQS-------LEWVLRNCSSQSTTILILYAANTICRD  1365
             ES +EE VY +G GED   V  G QS       L W L N    S+T++ L       + 
Sbjct  57    ESIREESVYSLGSGEDAVYVAVGRQSEETSMDALRWALNNEVDPSSTVVFLIHVFPETK-  115

Query  1364  YVYTPIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCG------KVKAEILKIQRH  1203
             Y+ +P+G+LP S VN E+ ++    E  KT + L  ++  C       +VK E + I+  
Sbjct  116   YIPSPLGKLPISQVNGEQRENYLAQERGKTREFLQKFVDVCSASSQKQQVKVETILIESD  175

Query  1202  DGSIEKIMVDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQ----KPDFCELFV  1035
               +  K +VDLI  L I KLV+  T  K  L + RS       + +Q     P+FC + +
Sbjct  176   MEA--KAIVDLIPILNIRKLVVGTT--KSNLRRMRSRRGNGSGVADQILQNAPEFCNVII  231

Query  1034  VFGGKLV  1014
             +  GK +
Sbjct  232   ICEGKQI  238



>ref|XP_004299136.1| PREDICTED: U-box domain-containing protein 35-like [Fragaria 
vesca subsp. vesca]
Length=252

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 80/172 (47%), Gaps = 14/172 (8%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D  D    L+WVL N  S  + + +++    I   ++ TP+GRL +S +++++
Sbjct  57    VYVAVGKDDTD---VLKWVLDNAVSPGSRVFLVHVFPPIT--HIPTPVGRLSTSHLSQDQ  111

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLS-  1134
             ++     E  K   +L  Y+  C   K  +  +        K + DLI  L I+ LV+  
Sbjct  112   VRFYINEENNKRRNLLQKYVYLCNNAKVTVDTMLLESSDRAKAIADLIPVLMISHLVIGT  171

Query  1133  -------LTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEE  999
                      ++   + K +    G F +    P++CE+ +V  G  V + E+
Sbjct  172   KRPPHSRFNYVVHAIRKKKKLSLGEF-VRKNAPEYCEVSIVHQGNKVMVDEQ  222



>ref|XP_006661585.1| PREDICTED: U-box domain-containing protein 33-like [Oryza brachyantha]
Length=797

 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 111/516 (22%), Positives = 218/516 (42%), Gaps = 50/516 (10%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVN  1320
             + RV+V +G         L W  R  +     ++ ++  + +    + T +G++P++   
Sbjct  37    DSRVHVAVGRSPEKTLGLLRWAFRRFACAHLVLVHVHQPSPL----IPTLLGKIPAAQAT  92

Query  1319  eeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKI---QRHDGSIEKIMVDLISSLQ  1155
             EE +    K ++ +  KIL  Y+ FC   +V+A +L     Q HDG     +V L+    
Sbjct  93    EELVLSHRKSDKDEMTKILHTYLTFCHRAQVQATLLVTENEQIHDG-----IVTLVKHHG  147

Query  1154  ITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEE-----NGE  990
             IT+LV+  T      +K +++      +    P FCE++ V+ G+ ++  E      N  
Sbjct  148   ITRLVMGST--PDSCFKLKASYGKTSFMAKNAPSFCEIWFVWRGRHIWTREATAAIGNNN  205

Query  989   SVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssvSNGLA  810
             +V  ++   +  R R          +L E  ++ E +    R         SS   NG  
Sbjct  206   AVYNEDDVMIRKRIRFSSTSNSAEPILNEGYIVCEASIPADR-------YESSISDNGQP  258

Query  809   DQWEKNQSEIELYLSQLSSSKTDCDAANDPLEDCVKEPTMPENMTTKERI-----EALKA  645
             + +E        Y + + + + +  A N   +        P +    E +     E L  
Sbjct  259   NDYEPLVGGNHFYNTSVPNLQHEQSAFNSTFQ--------PGSSVHMESLVLYPQEILDK  310

Query  644   KIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAKRAHLEEELDS  465
               +++    + ++K+A   + ++   E  +    +RA+D E    +EM  R  LE  L +
Sbjct  311   NFKQIIVEAERSRKDAFVELLKRKDTESRVASVIARAKDSEFAQKQEMKMREELEALLTA  370

Query  464   AKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERAVRTRTQMVQG  285
              +++  +L  + E+  A L+S +     L ++ +  + + + AE +LE    +   + QG
Sbjct  371   TRKQHEDLVKDKEKATAGLDSSMRKLAILDARAKSITIQMNEAEAELELIQSSIETLNQG  430

Query  284   IENLrrqrdvlrrRIEFCKEKDAIGEAKRLGEPSFCCRQFSAAEIRAATNEFSERQRL--  111
                 ++   +L  R+E C    +   A  L    +  R+ + + I+AAT +FSE  ++  
Sbjct  431   NPKTKKLEHLLAERVEGCTNCSSTVCADEL----YNFRELTLSNIQAATCKFSESFKIQP  486

Query  110   KCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETFQ  3
             +C G    VYKG + +  V I  +H     S   F+
Sbjct  487   RCLG---CVYKGEILNRSVMIYKFHSRIIQSSMQFK  519



>ref|XP_010942860.1| PREDICTED: U-box domain-containing protein 33-like isoform X1 
[Elaeis guineensis]
Length=278

 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 77/161 (48%), Gaps = 6/161 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             ++VYV +GE       +L W LR   ++  ++ +++    +   Y+ TP+G  P   +N+
Sbjct  41    DKVYVAVGES-SSSMDALLWALRPDVAKPRSVCLIHVHPEV--HYIPTPLGIFPKHQLND  97

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
              +++   + E+ K  ++L  Y+  C   K E          I K +V LI  L I +L++
Sbjct  98    RQVERFTQQEKTKIQEMLQKYLNSCQSSKVEADTHLIESDQIVKAIVGLIPVLNIKRLIV  157

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
               T  K  L + R   +    IH   PD+CE+ ++  G+ V
Sbjct  158   GAT--KANLRRGRRNSKAA-QIHKNAPDYCEVEIICDGREV  195



>ref|XP_010942861.1| PREDICTED: U-box domain-containing protein 33-like isoform X2 
[Elaeis guineensis]
Length=277

 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 77/166 (46%), Gaps = 17/166 (10%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             ++VYV +GE       +L W LR   ++  ++ +++    +   Y+ TP+G  P   +N+
Sbjct  41    DKVYVAVGES-SSSMDALLWALRPDVAKPRSVCLIHVHPEV--HYIPTPLGIFPKHQLND  97

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
              +++   + E+ K  ++L  Y+  C   K E          I K +V LI  L I +L++
Sbjct  98    RQVERFTQQEKTKIQEMLQKYLNSCQSSKVEADTHLIESDQIVKAIVGLIPVLNIKRLIV  157

Query  1136  SLTFMKPLLWKSRSALRG-----LFHIHNQKPDFCELFVVFGGKLV  1014
               T         ++ LRG        IH   PD+CE+ ++  G+ V
Sbjct  158   GAT---------KANLRGRRNSKAAQIHKNAPDYCEVEIICDGREV  194



>gb|KDO78595.1| hypothetical protein CISIN_1g021587mg [Citrus sinensis]
Length=244

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 67/127 (53%), Gaps = 3/127 (2%)
 Frame = -3

Query  1508  SQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSS  1329
             +Q+E+ +YV +G+       +L W LR+  + ST I +++    +   +V +P+G+LP +
Sbjct  107   TQEEDIIYVAVGKS-QSSMDALSWTLRHAVNPSTLIFLIHVFPQV--KFVPSPLGKLPRN  163

Query  1328  SVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQIT  1149
              VN E+L+     E  K  ++L  ++  C + K  +  +      + K ++DLI  L I 
Sbjct  164   QVNPEQLETFMAQETGKRRQLLQKFLDTCSQSKVMVDTVLIESDLVAKAILDLIPVLNIR  223

Query  1148  KLVLSLT  1128
             KLV+  T
Sbjct  224   KLVVGTT  230



>ref|XP_006590986.1| PREDICTED: U-box domain-containing protein 33-like [Glycine max]
Length=786

 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/169 (24%), Positives = 83/169 (49%), Gaps = 6/169 (4%)
 Frame = -3

Query  1517  MEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRL  1338
             M+E +  E V+V +G+ +      L+W   + S     +L ++  +T+    + T +G+L
Sbjct  3     MDEYECHEMVHVAVGKSLKKAATLLQWCFTHFSKPQIFLLHVHQPSTM----IPTLLGKL  58

Query  1337  PSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSL  1158
             P+S  + E +      E+  T ++L  Y++ C   K +   +      ++K +VDL++  
Sbjct  59    PASQASPEVVSAYRIEEKEDTKRLLEKYLSLCRAAKVKASSVIGEADQVQKGIVDLVTVH  118

Query  1157  QITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              + KLV+       +  K R++ +  +   N  P FCE++ V+ GK ++
Sbjct  119   NVRKLVIGAIPENCMKIK-RNSSKANYAAKN-APPFCEIWFVYNGKHIW  165



>ref|XP_009353686.1| PREDICTED: U-box domain-containing protein 33-like [Pyrus x bretschneideri]
Length=828

 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 85/170 (50%), Gaps = 10/170 (6%)
 Frame = -3

Query  1514  EESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLP  1335
             EE    ++V+V +G+ V      L W  ++       IL ++  + +    + TP+G+LP
Sbjct  48    EEGGGGDKVHVAVGKSVDKALSLLRWTFKHFGCNEICILHVHQPSPL----IPTPLGKLP  103

Query  1334  SSSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISS  1161
             +S  N+E +    + E  +  ++L NY+  C   KVKA I+ ++ ++  I K +V+L+++
Sbjct  104   ASQANDEVVTAFRREERERKMELLQNYLRACSRAKVKASIVMVEANE--IHKGIVELVNN  161

Query  1160  LQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
               + KLV+       +  K  S+     ++    P FCE+  +  GK V+
Sbjct  162   NGVRKLVMGAVPEDCMKVKKSSSKAN--YVAKCAPLFCEIRFINKGKHVW  209



>ref|XP_004250953.1| PREDICTED: U-box domain-containing protein 33-like [Solanum lycopersicum]
Length=855

 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 80/164 (49%), Gaps = 11/164 (7%)
 Frame = -3

Query  1493  RVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             +V+V +G+ V  G   ++W  +   +    IL +   +     Y+ T +G+LP +  N +
Sbjct  57    KVFVAVGKYVDKGVALVQWACKTFGNSEICILHVLQPSP----YIPTLLGKLPVTQANAK  112

Query  1313  klkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
              +      E  +  K+++ Y++ C   KVKA +  ++     + K ++D ++   I KL+
Sbjct  113   MVAAFRYAEREEAWKLMSRYLSVCCKSKVKATVAIVE--SDQVLKGILDFVNKHNIRKLI  170

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFL  1008
             +      P   K + + R   +   + P FCE+F V+ G+L+++
Sbjct  171   IGAI---PDCVKVKKSSRKASYAATKFPTFCEIFFVYKGRLIWI  211



>ref|XP_008385126.1| PREDICTED: U-box domain-containing protein 33-like [Malus domestica]
Length=826

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 86/178 (48%), Gaps = 24/178 (13%)
 Frame = -3

Query  1517  MEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTP----  1350
              EE    ++V+V +G+ V      L W +++           +  N IC  +V+ P    
Sbjct  47    FEEGGGGDKVHVAVGKSVEKALSLLRWTVKH-----------FGCNEICILHVHQPSPLI  95

Query  1349  ---IGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEK  1185
                +G+LP+S  N+E +    + E  +  K+L NY+  C   KVKA I+ ++ ++  I K
Sbjct  96    PTLLGKLPASQANDEVVTAFRREERERKMKLLQNYLRACSRAKVKASIVMVEANE--IHK  153

Query  1184  IMVDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              +V+L+++  + KLV+       +  K + + R   ++    P FCE+  +  GK V+
Sbjct  154   GIVELVNNNGVRKLVMGAVPEDCM--KVKKSSRKANYVAKCAPVFCEIRFINKGKHVW  209



>ref|XP_006348991.1| PREDICTED: U-box domain-containing protein 33-like [Solanum tuberosum]
Length=854

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 79/163 (48%), Gaps = 11/163 (7%)
 Frame = -3

Query  1493  RVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             +V+V +G+ V  G   ++W  +   +    IL +   +     Y+ T +G+LP +  N +
Sbjct  56    KVFVAVGKYVDKGVALVQWACKTFGNSEICILHVLQPSP----YIPTLLGKLPVTQANAK  111

Query  1313  klkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
              +      E  +  K+++ Y++ C   KVKA +  ++     + K ++D ++   I KL+
Sbjct  112   MVAAFRNAEREEAWKLISRYLSVCCKSKVKASVAIVE--SDQVLKGILDFVNKHNIRKLI  169

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
             +      P   K + + R   +   + P FCE+F V+ G+L++
Sbjct  170   IGAI---PDCVKVKKSSRKASYAATKFPTFCEIFFVYKGRLIW  209



>ref|XP_004140646.1| PREDICTED: U-box domain-containing protein 52-like [Cucumis sativus]
 gb|KGN46441.1| hypothetical protein Csa_6G093610 [Cucumis sativus]
Length=240

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 76/160 (48%), Gaps = 12/160 (8%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D  D    L+W L +  S    + +++    +   Y+ TP+GRL  S ++ E+
Sbjct  47    VYVAVGKDDID---VLKWALNHVVSPGCCVFLVHVFPLL--TYIPTPVGRLARSQLSREQ  101

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             L+     E  +   +L  YI  C   K  +  +     +  K ++ LI  L IT LV+  
Sbjct  102   LRVYINEENNRRRNLLQKYIRLCTDAKVTVDTLLLESNTTTKAILQLIPVLNITNLVIGT  161

Query  1130  TFMKPL---LWKSRSALRGLFHIHNQKPDFCELFVVFGGK  1020
                +PL   L   R  +R    +  + P+FCE+ +V+ GK
Sbjct  162   K--RPLSTRLLGKR--MRTGEIVKKKAPEFCEVSIVYEGK  197



>ref|XP_008338844.1| PREDICTED: U-box domain-containing protein 33 [Malus domestica]
Length=894

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 81/178 (46%), Gaps = 15/178 (8%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI--GRLPSSS  1326
             E+ +YV +G+DV D   +L W + N   +   IL ++    +       P+   R P+SS
Sbjct  44    EDMIYVAVGKDVKDSKSTLVWAVHNSGGKKICILHVHQPAQM------IPLMGTRFPASS  97

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             + +++++   + E    +KIL +Y   C ++     KI      IEK +V LIS L I K
Sbjct  98    LKDQEVRAYREIERQHMNKILDDYXCICRQMGIRAEKIHTEMDCIEKGIVKLISQLGIRK  157

Query  1145  LVLSLTFMKPLLWKSRSAL----RGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESV  984
             LV+     K     SR  +    +   ++  Q P  C +  +  G L+   E N + +
Sbjct  158   LVMGAAADK---HHSRKMMDLRSKKAIYVCQQAPVSCHIQFICKGHLIHTREGNSDGL  212



>ref|XP_009629843.1| PREDICTED: U-box domain-containing protein 33 isoform X2 [Nicotiana 
tomentosiformis]
Length=884

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 81/190 (43%), Gaps = 21/190 (11%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS----  1332
             ++ +YV +G+D+ +   +L+W L     +   IL           +V+TP  ++P     
Sbjct  43    DDMIYVAVGKDLKESEPTLKWALHKSGGRRICIL-----------HVHTPAQKIPMMGTK  91

Query  1331  ---SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISS  1161
                  ++  +++   + E     KIL  YI  CG+      K+     SIE  +V+L+S 
Sbjct  92    FNIDQLDVHQVRAYHEKERQDMHKILEKYILICGRAGVRADKLVVEMDSIETGIVELVSQ  151

Query  1160  LQITKLVLSLTFMKPLLWKSRSALRG--LFHIHNQKPDFCELFVVFGGKLVFLIEENGES  987
               I KLV+     K    K  + LR     ++  Q P FC ++ V  G L++  E   E 
Sbjct  152   RGIGKLVMGAAANK-CYSKKMTDLRSKKAIYVRLQAPTFCCIWFVCKGNLIYTRESESER  210

Query  986   VIKDEVGGVI  957
                D V   I
Sbjct  211   PNTDSVSPPI  220



>ref|XP_009629842.1| PREDICTED: U-box domain-containing protein 33 isoform X1 [Nicotiana 
tomentosiformis]
Length=885

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 81/190 (43%), Gaps = 21/190 (11%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS----  1332
             ++ +YV +G+D+ +   +L+W L     +   IL           +V+TP  ++P     
Sbjct  43    DDMIYVAVGKDLKESEPTLKWALHKSGGRRICIL-----------HVHTPAQKIPMMGTK  91

Query  1331  ---SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISS  1161
                  ++  +++   + E     KIL  YI  CG+      K+     SIE  +V+L+S 
Sbjct  92    FNIDQLDVHQVRAYHEKERQDMHKILEKYILICGRAGVRADKLVVEMDSIETGIVELVSQ  151

Query  1160  LQITKLVLSLTFMKPLLWKSRSALRG--LFHIHNQKPDFCELFVVFGGKLVFLIEENGES  987
               I KLV+     K    K  + LR     ++  Q P FC ++ V  G L++  E   E 
Sbjct  152   RGIGKLVMGAAANK-CYSKKMTDLRSKKAIYVRLQAPTFCCIWFVCKGNLIYTRESESER  210

Query  986   VIKDEVGGVI  957
                D V   I
Sbjct  211   PNTDSVSPPI  220



>ref|XP_008459869.1| PREDICTED: U-box domain-containing protein 36-like isoform X1 
[Cucumis melo]
Length=293

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 76/160 (48%), Gaps = 8/160 (5%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D  D    L+W L +  S    + +++    +   Y+ TP+GRL  S +  E+
Sbjct  99    VYVAVGKDDID---VLKWALNHVVSPGCCVFLVHVFPLL--TYIPTPVGRLARSQLTREQ  153

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             L+     E  +   +L  YI  C   K ++  +     +  K ++ LI  L IT LV+  
Sbjct  154   LRVYINEENNRRRNLLEKYIRLCTDAKVKVDTLLLESNTTTKAILRLIPVLNITNLVMGT  213

Query  1130  -TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
              T +   L   R  +R    +  + P+FCE+ +V+ GK V
Sbjct  214   KTPLSTRLLGKR--MRTGEIVKKKAPEFCEVTIVYEGKKV  251



>gb|KHN18419.1| U-box domain-containing protein 36 [Glycine soja]
Length=337

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 84/170 (49%), Gaps = 14/170 (8%)
 Frame = -3

Query  1508  SQKEERV---YVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRL  1338
             S K+ RV   YV +G+D       ++W L +  S  + I +++ ++ I    + TP+G+ 
Sbjct  106   SNKDRRVDDLYVAVGKD---DLNVVKWALDHAVSPGSRIFLIHVSSPIT--LIPTPVGKF  160

Query  1337  PSSSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLIS  1164
               S +  ++++        K   +L  YI      KV AE L ++ +D    K ++DLIS
Sbjct  161   ERSQLTPQQVRLYVNEVNNKRKDLLQKYIQMSNEAKVTAETLLLESNDKG--KAILDLIS  218

Query  1163  SLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
              L IT +V+ +  + P   ++    +G F I    P  CE+ +V+ GK++
Sbjct  219   ILTITNIVIGIKKL-PFTRRNNKLSKGEF-IKKHAPSSCEVTLVYNGKVL  266



>ref|XP_006488315.1| PREDICTED: U-box domain-containing protein 33-like [Citrus sinensis]
Length=887

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 81/167 (49%), Gaps = 11/167 (7%)
 Frame = -3

Query  1493  RVYVGIGEDVHDGFQSLEWVL-RNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             +VYV +G+ V  G   L W L R  SS+   IL ++  + +    + T +G+LP+S  + 
Sbjct  95    KVYVALGKCVEKGLSLLHWTLQRFGSSREICILHVHQPSPV----IPTLLGKLPASQASA  150

Query  1316  eklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             E L      E  K  K+L NY+  C   KVKA I+  +     I+K +V L++   I KL
Sbjct  151   EVLSAFRAEERQKMKKLLDNYLRICVEAKVKARIITTE--ADKIQKAIVQLMNIHGIQKL  208

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
             V+   F    + K +   R   +     P FCE++ V  GK V+  E
Sbjct  209   VMG-AFPDNCM-KVKMGSRKASYAAKNAPMFCEIWFVNKGKHVWTKE  253



>emb|CDY40543.1| BnaC02g33490D [Brassica napus]
Length=242

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 78/169 (46%), Gaps = 19/169 (11%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVN  1320
             E+ VYVG+G+      ++L W L N  + ++T+L L       R   Y P+GRL     +
Sbjct  39    EDNVYVGVGKG-DSSMEALRWALDNLITSTSTLLYLIHVFPETRSIPY-PLGRLTREQAS  96

Query  1319  eeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
             +E+L+     E  K   +L  +I  C   K ++  I     S+ K + DLI+ L I KLV
Sbjct  97    QEQLETFMSQEREKRRTLLNKFIHACSASKVKVETILVESDSVAKALQDLITILHIKKLV  156

Query  1139  LSLTFMKPLLWKSRSALRGLFHIHNQKP---------DFCELFVVFGGK  1020
             L +   KP   K+ S  RG     N  P         + CE+ V+  GK
Sbjct  157   LGID--KPNARKANST-RG-----NSVPEQIMRSTAAELCEVKVICQGK  197



>ref|XP_009361868.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=333

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 84/170 (49%), Gaps = 9/170 (5%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNC--SSQSTTILILYAANTICRDYVYTPIGRL  1338
              S  +E VYVG+G+       +L W L++    S STT+ +++    +   Y+ +P+G+L
Sbjct  107   HSSHDESVYVGVGKG-ESSMDALTWALKHAVDPSSSTTVYLIHVFPGVT--YIPSPLGKL  163

Query  1337  PSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSL  1158
             P + V+ ++++     E  K   +L  +I  C   K ++  I      I + ++DLI  L
Sbjct  164   PKNQVSSQQVETYMAEERGKRRVLLHKFIDKCSVAKVKVDTILIESDMIGRAILDLIPIL  223

Query  1157  QITKLVLSL--TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
              ITKLV+    + ++ ++ K  S +     I    P+ C++ ++  G  V
Sbjct  224   NITKLVIGTNKSNLRKVMAKKGSGIGA--QILQSAPEGCDVDIICQGNQV  271



>ref|XP_008669387.1| PREDICTED: U-box domain-containing protein 33-like isoform X2 
[Zea mays]
Length=798

 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 82/176 (47%), Gaps = 8/176 (5%)
 Frame = -3

Query  1514  EESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLP  1335
             E+   E  V+V +G         L W LR        +L ++  + +    + T +G++P
Sbjct  23    EQHHGETWVHVAVGRSPEKTLSLLRWALRRFGCSRIVLLHVHHPSPL----IPTLLGKIP  78

Query  1334  SSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQ  1155
             +    EE +    K E+ + +KIL  Y+AFC + K +   +   +G I   ++ L+   +
Sbjct  79    AVQATEEVVLSHRKSEKEEMNKILLTYLAFCHRAKVQARLLVTENGQIHDGILSLVDHHR  138

Query  1154  ITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGES  987
             ITKLV+  T      +K +     L  + +  P FC+++ V+ G+ ++  E +  +
Sbjct  139   ITKLVMGST--PDNCFKLKYGKESL--MASSAPAFCQIWFVWRGRHIWTREASAAT  190



>gb|KEH31791.1| universal stress family protein [Medicago truncatula]
Length=303

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 83/174 (48%), Gaps = 14/174 (8%)
 Frame = -3

Query  1532  GKRQCMEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYT  1353
             GK   +++ ++ + +YV +GED  D    ++WVL +  S    I +++ +  I    + T
Sbjct  101   GKSITIKKDRRVDDLYVAVGEDDMD---VVKWVLDHAVSPGARIFLVHVSPPIT--LIPT  155

Query  1352  PIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIM  1179
             P+G L  S +  ++++        K   +L  YI      KV AE L ++  D    K +
Sbjct  156   PVGMLGRSQLTPQQVRRYLNEVNNKRKDLLQKYIQLSTEAKVTAETLILESKDKG--KAI  213

Query  1178  VDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKL  1017
             +DLIS L IT LVL +  +     +    LR    +    P  C++ +++ G+L
Sbjct  214   LDLISILNITNLVLGVKKL-----RRNDKLREGEFVKKNAPKTCDVTLIYNGEL  262



>gb|KDP44229.1| hypothetical protein JCGZ_05696 [Jatropha curcas]
Length=843

 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 77/165 (47%), Gaps = 6/165 (4%)
 Frame = -3

Query  1496  ERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             E+VYV +G+ V      L+W ++    +   IL ++  +++    + T +G+LP+S  N 
Sbjct  45    EKVYVAVGKSVEKAVDLLQWSIKLFGKKQICILHVHQPSSV----IPTLLGKLPASQANA  100

Query  1316  eklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVL  1137
             E +    + E   T K+L N +A C K K E   I      + K +V+LI+     KL++
Sbjct  101   EVVSAHRREERELTKKLLENCLAICHKAKVEASIITTECEQVHKGIVELINRHGARKLIM  160

Query  1136  SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
                    +  K + +      +    P FCE++ +  GK V+  E
Sbjct  161   GAVPESCM--KVKKSNNKANSVAKDAPLFCEIWFINKGKHVWTRE  203



>emb|CAN67166.1| hypothetical protein VITISV_015820 [Vitis vinifera]
Length=881

 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI--GRLPSSS  1326
             E++++V +G++V +    L W L+N   +  +I+ ++    +       PI  G+ P+S 
Sbjct  45    EDKIFVAVGKEVKESKSILVWALQNSGGKRISIVHVHQPAQMI------PIMGGKFPASK  98

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLISSLQI  1152
             + E+++K     E     KIL +YI  C K  V+AE L I+  +  +EK +++LIS   I
Sbjct  99    LKEQEVKAYRDLERQDMHKILNDYILICRKAGVRAEKLYIESEN--VEKGILELISEHGI  156

Query  1151  TKLVL--------SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              KLV+        S   ++P   KS+ A     ++ ++ P FC ++ V  G L++
Sbjct  157   KKLVVGAAADKHYSRRMLEP---KSKKAA----YVRDKAPLFCHIWFVCRGHLIY  204



>ref|XP_010241160.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
Length=251

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 62/122 (51%), Gaps = 3/122 (2%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVN  1320
             E+ +YV +G+  + G  +L W L +    S+ + +++    +   ++ TP+G+LP   VN
Sbjct  53    EDYIYVAVGKS-NSGMDALRWTLNHLLKPSSLVFLIHVFPEV--RHIPTPLGKLPKEQVN  109

Query  1319  eeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLV  1140
              E++++    E  K  ++L  Y+  C      +  I      I K ++DLI  L ITKLV
Sbjct  110   PEQVENYMNQERRKIRQLLQKYLDLCNASMVNVDTILIESDFIAKAVIDLIPILNITKLV  169

Query  1139  LS  1134
             + 
Sbjct  170   VG  171



>ref|XP_007213955.1| hypothetical protein PRUPE_ppa011059mg [Prunus persica]
 gb|EMJ15154.1| hypothetical protein PRUPE_ppa011059mg [Prunus persica]
Length=225

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 81/178 (46%), Gaps = 22/178 (12%)
 Frame = -3

Query  1514  EESQKEERVYVGIGEDVHDGFQSLEWVLRNCS-SQSTTILILYAANTICRDYVYTPIGRL  1338
              + +    VYVG+G+      ++L W L++ +   STT+ +++    I   ++ +P+G+L
Sbjct  13    HDHRSSNSVYVGVGKS-ESSMEALTWTLKHAADPSSTTVYLIHVFPEI--HFIPSPLGKL  69

Query  1337  PSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSL  1158
             P S V+ ++++     E  K  ++L  ++  C     ++  +      I + ++DLI  L
Sbjct  70    PKSQVSSQQVETYMAQETGKRRELLHKFLDKCSAANVKVDTVLIESDMIARAILDLIPIL  129

Query  1157  QITKLVLSLTFMKPLLWKSRSALRGLF---------HIHNQKPDFCELFVVFGGKLVF  1011
              IT LVL  T         +S LR L           I    PD CE+ ++  G  V 
Sbjct  130   NITTLVLGTT---------KSNLRKLISGKGSGIADQILQAAPDGCEIKIICQGNQVM  178



>ref|XP_009367846.1| PREDICTED: U-box domain-containing protein 33-like isoform X1 
[Pyrus x bretschneideri]
Length=898

 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 82/184 (45%), Gaps = 27/184 (15%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI-------GR  1341
             E+ +YV +G+DV +   SL W ++N                IC  +++ P         +
Sbjct  50    EDMIYVAVGKDVKESKSSLVWAVQNS-----------GGKKICLVHIHQPAQMIPLMGAK  98

Query  1340  LPSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISS  1161
              P+SS+  ++L+   + E    +KIL +YI  C ++   + K+      IEK +V+LIS 
Sbjct  99    FPASSLTNQQLRLHRETERQHMNKILDDYICICLQMGVRVEKLHIERDCIEKGIVELISQ  158

Query  1160  LQITKLVLSLTF-----MKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEEN  996
               I KLV+          K +  KS+ A+     +  Q P  C +  +  G L+   E N
Sbjct  159   HGIRKLVMGAAADKHHSKKMMDLKSKKAI----FVRQQAPVSCHIQFICKGYLIHTREGN  214

Query  995   GESV  984
              + V
Sbjct  215   SDVV  218



>ref|XP_010102485.1| U-box domain-containing protein 33 [Morus notabilis]
 gb|EXB93549.1| U-box domain-containing protein 33 [Morus notabilis]
Length=266

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 80/161 (50%), Gaps = 12/161 (7%)
 Frame = -3

Query  1487  YVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeekl  1308
             YV +G+D       + W + +  S    + +++    I   ++ TP+G+L  S + EE++
Sbjct  71    YVAVGKD---DLDVVRWAIDHVVSPGARLYLVHVFPPIT--HIPTPVGKLSRSQLTEEQV  125

Query  1307  kdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSLT  1128
             +   + EE +   IL  YI  C   K  +  +     +  K +VDLI+  +IT LVL L 
Sbjct  126   RFYIEEEENRRRNILQKYIRLCKDAKVNVDTVLVEHDATAKAIVDLIAIHRITNLVLGLK  185

Query  1127  FMKPL---LWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
               KP    + K+R A +G + +    P+FCE+ +V  GK V
Sbjct  186   --KPPNSRILKTRMA-KGEY-VKKSAPEFCEVTIVHDGKKV  222



>gb|KDP31037.1| hypothetical protein JCGZ_11413 [Jatropha curcas]
Length=242

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/170 (23%), Positives = 78/170 (46%), Gaps = 6/170 (4%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNeek  1311
             VYV +G+D       L+W L +  S    + +++ ++ +   Y+ TP+GRL  S +++++
Sbjct  46    VYVAVGKD---DLYVLKWALDHVVSPGAKVFLVHVSSPLT--YISTPVGRLSRSQLSQDQ  100

Query  1310  lkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLSL  1131
             ++     E  +   +L  YI  C   K  +  I        + +++LI  L I  LV+  
Sbjct  101   VRFYVNEEHNRRRNLLQKYIRLCNDAKVTVDTILLESNETARAILELIPVLNINSLVMGT  160

Query  1130  TFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESVI  981
             T      +  +   +G F +    P+ C++ +V   K V   ++  E V+
Sbjct  161   TRSPRSRFMRKKLAKGEF-VKKNSPESCDVTIVHDSKKVLHNQQTTELVL  209



>ref|XP_008669386.1| PREDICTED: U-box domain-containing protein 33-like isoform X1 
[Zea mays]
 tpg|DAA37705.1| TPA: putative U-box domain protein kinase family [Zea mays]
Length=827

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 82/176 (47%), Gaps = 8/176 (5%)
 Frame = -3

Query  1514  EESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLP  1335
             E+   E  V+V +G         L W LR        +L ++  + +    + T +G++P
Sbjct  23    EQHHGETWVHVAVGRSPEKTLSLLRWALRRFGCSRIVLLHVHHPSPL----IPTLLGKIP  78

Query  1334  SSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQ  1155
             +    EE +    K E+ + +KIL  Y+AFC + K +   +   +G I   ++ L+   +
Sbjct  79    AVQATEEVVLSHRKSEKEEMNKILLTYLAFCHRAKVQARLLVTENGQIHDGILSLVDHHR  138

Query  1154  ITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIEENGES  987
             ITKLV+  T      +K +     L  + +  P FC+++ V+ G+ ++  E +  +
Sbjct  139   ITKLVMGST--PDNCFKLKYGKESL--MASSAPAFCQIWFVWRGRHIWTREASAAT  190



>ref|XP_011035331.1| PREDICTED: U-box domain-containing protein 33-like [Populus euphratica]
Length=736

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 72/167 (43%), Gaps = 6/167 (4%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             E    ERVYV +G  +      L WV  +  ++   +L ++  + +    + T +G+LP+
Sbjct  11    EENSSERVYVALGNSIEKAVGLLNWVFESLGTRQICLLHVHRPSPL----IPTLLGKLPA  66

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
             S  N E +      E  +T K+   Y+  C + K E   +      + K +V+L++   +
Sbjct  67    SQANAEVVSAFRSEENERTKKLFDYYLIICRRAKVEATIVTIESDQVHKGIVELVNRHGV  126

Query  1151  TKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              KLV+       +  K  S        H   P FCE+  +  GK ++
Sbjct  127   RKLVMGAVKESCMKVKKSSCKENYAAKH--APLFCEIRFINKGKCIW  171



>ref|XP_008804030.1| PREDICTED: U-box domain-containing protein 33-like [Phoenix dactylifera]
Length=885

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 67/130 (52%), Gaps = 21/130 (16%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI-------GR  1341
             EE+VYV +GE+   G  +  WVLR+ S  +  ++           +V+ P        GR
Sbjct  24    EEKVYVAVGEEFKAGKANFSWVLRSVSRDAKIVIA----------HVHRPAQMINMLGGR  73

Query  1340  LPSSSVNeeklkdldkyeeaKTDKILANYIAFCG--KVKAEILKIQRHDGSIEKIMVDLI  1167
              P+SS+   ++    + E  K ++ L  YIA C   KV+AE L I+  +  + K +V+LI
Sbjct  74    FPASSLKPLQVNAYRQLEREKMNRSLDGYIAVCSQLKVRAEKLVIEMDN--VGKGLVELI  131

Query  1166  SSLQITKLVL  1137
             +   ITKLV+
Sbjct  132   AQHGITKLVM  141



>ref|XP_004515904.1| PREDICTED: U-box domain-containing protein 36-like [Cicer arietinum]
Length=273

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 83/175 (47%), Gaps = 13/175 (7%)
 Frame = -3

Query  1532  GKRQCMEESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYT  1353
             GK   + + ++ + +YV +GE   D    ++W L +  S    I +++ A  I    + T
Sbjct  96    GKSITINKDRRVDDLYVAVGE---DDLDVVKWALDHAVSPGARIFLVHVAPPIT--LIPT  150

Query  1352  PIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQ-RHDGSIEKI  1182
             P+G    S +  ++++        K   IL  YI      KV AE L ++ ++ G   K 
Sbjct  151   PVGMFERSQLTPQQVRRYVNEVNHKRKDILQKYIQLSTEAKVTAETLLLESKYRG---KA  207

Query  1181  MVDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKL  1017
             ++DLIS L IT LV  +  + P  W++   L  +  +    P  C++ +V+ G+L
Sbjct  208   ILDLISILNITNLVFGIKKL-PCTWRN-DKLSEVELVKKNAPKTCDVTLVYNGEL  260



>ref|XP_004486362.1| PREDICTED: U-box domain-containing protein 35-like [Cicer arietinum]
Length=238

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 82/171 (48%), Gaps = 7/171 (4%)
 Frame = -3

Query  1514  EESQKEERVYVGIGEDVHDGFQSLEWVLRN--CSSQSTTILILYAANTICRDYVYTP--I  1347
             EE++ E+  YV +G+     FQ+L W L N   +  ST + +++    I  +++  P  +
Sbjct  31    EENEVEDTFYVAVGKS-KSSFQALSWTLNNLVITPSSTLLYLIHVFPQI--NHIPNPLGV  87

Query  1346  GRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLI  1167
             G +P   V++++++     E  K  ++L N+I  C   K ++  I      I K ++DLI
Sbjct  88    GMVPKDQVSDDQVESYVAQERGKRRELLHNFIQSCSASKVQVDTILIESDFIAKAIIDLI  147

Query  1166  SSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLV  1014
               LQI  LV+     +    +SR        +    P+ C++ ++  GK V
Sbjct  148   PILQIQNLVIGANNSQLRKIRSRKGNGIADQVLQNAPEICKVRIICDGKEV  198



>ref|XP_002530423.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF31954.1| ATP binding protein, putative [Ricinus communis]
Length=264

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 81/164 (49%), Gaps = 4/164 (2%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRN-CSSQSTTILILYAANTICRDYVYTPIGRLPSSSV  1323
             E+ VYV +G+       ++ W L+N  ++ ST + +++    I   ++ +P+G+LP + V
Sbjct  88    EDCVYVAVGKS-ESSMDAVSWTLKNLVNNDSTVVYLIHIYPEI--HHIPSPLGKLPKNQV  144

Query  1322  NeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             + E+++     E  K  ++L  +I  C   K ++  +     ++ K ++DLI  L I KL
Sbjct  145   SPEQVEIYMAQERGKRRELLQKFIRICSASKVKVDTMLIESDNVAKAIMDLIPILNIKKL  204

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
             VL  T       ++R        I     +FC++ V++ GK V 
Sbjct  205   VLGTTKSGLRRLRARKGSGIADQILQNASEFCDIKVIYDGKEVM  248



>gb|KDO72866.1| hypothetical protein CISIN_1g003481mg [Citrus sinensis]
Length=816

 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 81/167 (49%), Gaps = 11/167 (7%)
 Frame = -3

Query  1493  RVYVGIGEDVHDGFQSLEWVL-RNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             +VYV +G+ V  G   L W L R  SS+   IL ++  + +    + T +G+LP+S  + 
Sbjct  24    KVYVALGKCVEKGLSLLHWTLQRFGSSREICILHVHQPSPV----IPTLLGKLPASQASA  79

Query  1316  eklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             E L      E  K  K+L NY+  C   +VKA I+  +     I+K +V L++   I KL
Sbjct  80    EVLSAFRAEERQKMKKLLDNYLRICVEAEVKARIITTE--ADKIQKAIVQLMNIHGIQKL  137

Query  1142  VLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
             V+   F    + K +   R   +     P FCE++ V  GK V+  E
Sbjct  138   VMG-AFPDNCM-KVKMGSRKASYAAKNAPMFCEIWFVNKGKHVWTKE  182



>ref|XP_011086282.1| PREDICTED: uncharacterized protein LOC105168059 [Sesamum indicum]
Length=309

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 79/168 (47%), Gaps = 6/168 (4%)
 Frame = -3

Query  1511  ESQKEERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPS  1332
             + + E+ VYV +G +      +L W L +     ++ L+          ++ +P+G LP 
Sbjct  84    QERGEDVVYVAVGGNKQTSMDALIWTLNHAVLNPSSTLVFLIRVFPETKFIPSPLGMLPV  143

Query  1331  SSVNeeklkdldkyeeaKTDKILANYIAFCG--KVKAEILKIQRHDGSIEKIMVDLISSL  1158
             S VN E+ +     E  K  + L  ++  C   ++KA+ + I+    +  K ++DLI  L
Sbjct  144   SQVNPEQKEIYMAQERRKRREFLRKFLIVCSASQIKADTIVIESDTEA--KAILDLIPIL  201

Query  1157  QITKLVLSLT--FMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGK  1020
              I KLVL  T   ++ +L  SR        I    P+FCE+ ++  GK
Sbjct  202   NIRKLVLGATKSTVRRILRSSRKGNGVADEIVQNAPEFCEVKIICEGK  249



>ref|XP_010661796.1| PREDICTED: U-box domain-containing protein 33 isoform X2 [Vitis 
vinifera]
Length=854

 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI--GRLPSSS  1326
             E++++V +G++V +    L W L+N   +  +I+ ++    +       PI  G+ P+S 
Sbjct  18    EDKIFVAVGKEVKESKSILVWALQNSGGKRISIVHVHQPAQM------IPIMGGKFPASK  71

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLISSLQI  1152
             + E+++K     E     KIL +Y+  C K  V+AE L I+  +  +EK +++LIS   I
Sbjct  72    LKEQEVKAYRDLERQDMHKILNDYLLICRKAGVRAEKLYIESEN--VEKGILELISEHGI  129

Query  1151  TKLVL--------SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              KLV+        S   ++P   KS+ A     ++ ++ P FC ++ V  G L++
Sbjct  130   KKLVVGAAADKHYSRRMLEP---KSKKAA----YVRDKAPLFCHIWFVCRGHLIY  177



>ref|XP_009340098.1| PREDICTED: U-box domain-containing protein 33-like [Pyrus x bretschneideri]
Length=892

 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 81/178 (46%), Gaps = 15/178 (8%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI--GRLPSSS  1326
             E+ +YV +G+DV D   +L W + N   +   IL ++    +       P+   R P+SS
Sbjct  42    EDMIYVAVGKDVKDSKSTLLWAVHNSGGKKICILHVHQPAQM------IPLMGTRFPASS  95

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITK  1146
             + E++++   + E    +KIL +Y+  C ++     KI      IEK +V+LIS   I K
Sbjct  96    LKEQEVQAYREIERQHMNKILDDYLRICRQMGIRAEKIHTEMDCIEKEIVELISQHGIRK  155

Query  1145  LVLSLTFMKPLLWKSRSAL----RGLFHIHNQKPDFCELFVVFGGKLVFLIEENGESV  984
             LV+     K     SR  +    +   ++    P  C +  +  G L+   E N + +
Sbjct  156   LVMGAAADK---HHSRKMMDLRSKKAIYVRQHAPVSCHIQFICKGHLIHTREGNSDGL  210



>ref|XP_008784570.1| PREDICTED: U-box domain-containing protein 33-like [Phoenix dactylifera]
Length=847

 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 110/481 (23%), Positives = 203/481 (42%), Gaps = 50/481 (10%)
 Frame = -3

Query  1361  VYTPIGRLPSSSVNeeklkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKI  1182
             + T +G++P+S  NEE +    + E+  T ++L  Y+ FC K + +   I      I   
Sbjct  86    IPTLLGKIPASQANEELVSTYRRTEKEITKRLLLTYLRFCHKAQVQPSIIMTEAEQIHNG  145

Query  1181  MVDLISSLQITKLVLSLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVFLIE  1002
             +VDL+    I +L++  T       K  S+ +  +   N  P FCE++ V  G  V+  E
Sbjct  146   IVDLVVQHGIRRLIMGSTPDNCFKLKGSSS-KATYAAKNAPP-FCEIWFVSKGGHVWTRE  203

Query  1001  EN-GESVIKDEVGGVIGRAREkkkkKHGFKVLLERIMLPEIADKEKRscdspsssssssv  825
              + G +             RE+ +  +  K   E +  PE          +  +++    
Sbjct  204   ASEGTNSFLSVFSPEAAVLREQIRLSYLHKDYCEPMPNPEYV------LSNTFTTADLQG  257

Query  824   SNGLADQWEKNQSEIELYLSQLSSSKTDCDAANDP--LEDCVKEPTMPENMTTKERI---  660
               G+ +Q E N + + +       + T+   +  P  L D    PT P ++    +I   
Sbjct  258   DTGM-NQTESNSTGVVVSTDSSIVNSTNLSNSQYPSSLPDTPSYPTSPVDIGFSSKINSQ  316

Query  659   -----EALKAKIREVQQVVQLNKKEAKAIVERQAKAEWAIRLCASRAEDLEACINEEMAK  495
                  E    +++EV   V+ +KKEA   + ++ + E  +    +R + LEA    E+  
Sbjct  317   DKLEPEVSFDQLKEVNLEVERSKKEAFVELVKRREVESEVEEALNRVKALEAAHAREIKI  376

Query  494   RAHLEEELDSAKeelyelqteveEKRAKLNSILELQRELASKVQLSSQEKSHAEIQLERA  315
             R  LE+ L + K    EL         +  ++ ELQ  L++   L ++ +  + ++ E A
Sbjct  377   REELEDLLTTIKLHHKELI------NQRDETMKELQNALSTTATLDARAREMSLLKDEAA  430

Query  314   VRTRTQMVQGIENLrrqrdvlrrRIEFCKEKDAIGEAKR-----------------LGEP  186
                    +  I++      + R++I+  +EK A+ + +R                 LG  
Sbjct  431   AE-----LDLIQSFVAILRLERQKIQEQEEK-AVAQLERRRCSSKATSPNYSQLIGLGSD  484

Query  185   SFCCRQFSAAEIRAATNEFSERQRLKCGGNWTNVYKGCLNSERVAIKLYHKSTSLSEETF  6
             S+   +FS +++ +AT  FSE  +L  GG +  VYKG + +  V IK  H      +  F
Sbjct  485   SYNFTEFSLSDLESATCGFSESFKLGQGG-YGCVYKGEIFNRSVVIKKLHPHNVRGQMEF  543

Query  5     Q  3
             Q
Sbjct  544   Q  544



>ref|XP_007154065.1| hypothetical protein PHAVU_003G088000g [Phaseolus vulgaris]
 gb|ESW26059.1| hypothetical protein PHAVU_003G088000g [Phaseolus vulgaris]
Length=321

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 70/139 (50%), Gaps = 16/139 (12%)
 Frame = -3

Query  1490  VYVGIG--EDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNe  1317
             VYV +G  ED     ++L W L++  + S T++ L       +  + +P+G++P S VN 
Sbjct  105   VYVAVGKDEDSSPSMEALSWALKHAVTPSATVVCLLHVFPQVK-LIPSPLGKIPRSHVNL  163

Query  1316  eklkdldkyeeaKTDKILANYIAFC--GKVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             E        E AK   +L  +I  C   KVK EI+ I+    ++ + +VDL+ +L I KL
Sbjct  164   EYTNMHLTQERAKRKLLLQKFIDLCVHSKVKVEIMLIE--GDNVGRAIVDLVRNLNIRKL  221

Query  1142  VLSLTFMKPLLWKSRSALR  1086
             V+ +         SRS LR
Sbjct  222   VIGI---------SRSNLR  231



>ref|XP_010523753.1| PREDICTED: U-box domain-containing protein 33 isoform X1 [Tarenaya 
hassleriana]
Length=853

 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (48%), Gaps = 19/178 (11%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI--GRLPSSS  1326
             EE+VYV +G+DV     +L W L+N   +   IL ++    +       P+   + P+S+
Sbjct  44    EEKVYVAVGKDVAKSKSTLIWALQNTGGKKICILHVHQPAQMI------PVMGAKFPASA  97

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLISSLQI  1152
             V EE+++   + E  K   IL  Y+  C +  V+AE + I+    S+EK +V LIS   I
Sbjct  98    VKEEEVRVYRETEREKVHMILDEYLRLCQQRGVRAEKMYIEM--DSVEKGIVRLISQHGI  155

Query  1151  TKLVLSLTFMKPLLWKSRSAL----RGLFHIHNQKPDFCELFVVFGGKLVFLIEENGE  990
              KLV+     K   + S+  +    R    +  + P  C ++    G L++L E   +
Sbjct  156   RKLVMGAAADK---YHSKKMMDLRSRKAISVRREAPATCHIWFTCKGSLIYLREATAD  210



>ref|XP_002274993.2| PREDICTED: U-box domain-containing protein 33 isoform X1 [Vitis 
vinifera]
 emb|CBI40383.3| unnamed protein product [Vitis vinifera]
Length=881

 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -3

Query  1499  EERVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPI--GRLPSSS  1326
             E++++V +G++V +    L W L+N   +  +I+ ++    +       PI  G+ P+S 
Sbjct  45    EDKIFVAVGKEVKESKSILVWALQNSGGKRISIVHVHQPAQM------IPIMGGKFPASK  98

Query  1325  VNeeklkdldkyeeaKTDKILANYIAFCGK--VKAEILKIQRHDGSIEKIMVDLISSLQI  1152
             + E+++K     E     KIL +Y+  C K  V+AE L I+  +  +EK +++LIS   I
Sbjct  99    LKEQEVKAYRDLERQDMHKILNDYLLICRKAGVRAEKLYIESEN--VEKGILELISEHGI  156

Query  1151  TKLVL--------SLTFMKPLLWKSRSALRGLFHIHNQKPDFCELFVVFGGKLVF  1011
              KLV+        S   ++P   KS+ A     ++ ++ P FC ++ V  G L++
Sbjct  157   KKLVVGAAADKHYSRRMLEP---KSKKAA----YVRDKAPLFCHIWFVCRGHLIY  204



>ref|XP_010326469.1| PREDICTED: U-box domain-containing protein 33 isoform X2 [Solanum 
lycopersicum]
Length=892

 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 78/183 (43%), Gaps = 21/183 (11%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLP--SSSVNe  1317
             +YV +G+D+ +   +L W L     +            IC  +V+TP  ++P   +  N 
Sbjct  47    MYVAVGKDLKETEPTLTWALHKSGGRK-----------ICIVHVHTPAQKIPMMGTKFNI  95

Query  1316  eklkdldkyeeaKTDK-----ILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
             ++L         + +K     IL  YI  CG+      K+     SIEK +V+LIS   I
Sbjct  96    DQLDVHQVRAYHEKEKQDMHMILEKYILICGRAGVCADKLVLEMDSIEKGIVELISQHGI  155

Query  1151  TKLVLSLTFMKPLLWKSRSALRG--LFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIK  978
              KLV+     K    K  S LR     ++  Q P FC +  V  G L+F  E   + +  
Sbjct  156   GKLVMGAAANK-CYSKKMSDLRSKKAIYVRLQAPTFCCICFVCKGNLIFTRESKSDRLNT  214

Query  977   DEV  969
             D V
Sbjct  215   DSV  217



>ref|XP_004229888.1| PREDICTED: U-box domain-containing protein 33 isoform X1 [Solanum 
lycopersicum]
Length=894

 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 78/183 (43%), Gaps = 21/183 (11%)
 Frame = -3

Query  1490  VYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLP--SSSVNe  1317
             +YV +G+D+ +   +L W L     +            IC  +V+TP  ++P   +  N 
Sbjct  47    MYVAVGKDLKETEPTLTWALHKSGGRK-----------ICIVHVHTPAQKIPMMGTKFNI  95

Query  1316  eklkdldkyeeaKTDK-----ILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQI  1152
             ++L         + +K     IL  YI  CG+      K+     SIEK +V+LIS   I
Sbjct  96    DQLDVHQVRAYHEKEKQDMHMILEKYILICGRAGVCADKLVLEMDSIEKGIVELISQHGI  155

Query  1151  TKLVLSLTFMKPLLWKSRSALRG--LFHIHNQKPDFCELFVVFGGKLVFLIEENGESVIK  978
              KLV+     K    K  S LR     ++  Q P FC +  V  G L+F  E   + +  
Sbjct  156   GKLVMGAAANK-CYSKKMSDLRSKKAIYVRLQAPTFCCICFVCKGNLIFTRESKSDRLNT  214

Query  977   DEV  969
             D V
Sbjct  215   DSV  217



>gb|EMT09986.1| U-box domain-containing protein 33 [Aegilops tauschii]
Length=880

 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 86/159 (54%), Gaps = 13/159 (8%)
 Frame = -3

Query  1493  RVYVGIGEDVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             ++YV +G+D+ D   +L W  RN  +    +++L+       D +   + ++P+S V E+
Sbjct  79    KLYVAVGKDIKDSRSNLVWAARNLFAGDPKLVLLHVHQPA--DRIMIGLCKVPASQVEEK  136

Query  1313  klkdldkyeeaKTDKILANYIAFCG---KVKAEILKIQRHDGSIEKIMVDLISSLQITKL  1143
             +LK   K E+ + + +L  Y+ FC    K++AE L I+++  S    +++LI   +ITKL
Sbjct  137   ELKAYRKIEKEEMNTLLNQYLNFCRVSLKMQAETLVIEKN--SPANGIIELIDQNRITKL  194

Query  1142  VLSLT--FMKPLLWKSRSALRGLFHIHNQKPDFCELFVV  1032
             V+  +   +K  + KS+ A      +H Q   +C++F +
Sbjct  195   VMGTSSFSVKRKVPKSKVAA----SVHLQAKPYCQIFYI  229



>ref|XP_009798369.1| PREDICTED: U-box domain-containing protein 52-like [Nicotiana 
sylvestris]
Length=218

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 78/164 (48%), Gaps = 20/164 (12%)
 Frame = -3

Query  1490  VYVGIGE-DVHDGFQSLEWVLRNCSSQSTTILILYAANTICRDYVYTPIGRLPSSSVNee  1314
             VYV +G+ D+H     L+W L +  S    I +++    I   Y+ +P+G+L  S ++ E
Sbjct  28    VYVAVGKNDLH----VLQWALDHVISPGIRICLVHIFPPIT--YIPSPVGKLSKSQLSRE  81

Query  1313  klkdldkyeeaKTDKILANYIAFCGKVKAEILKIQRHDGSIEKIMVDLISSLQITKLVLS  1134
             +++     E  +   +L  YI  C   K  +  +     S  K ++DLI+ + +T LV+ 
Sbjct  82    QVQAYINQESNRRKNLLEKYIRLCNDAKVPVDTVLVESKSPAKTLLDLIAVVNVTSLVIG  141

Query  1133  LTFMKPLLWKSRSALR-----GLF-HIHNQKPDFCELFVVFGGK  1020
                      +S S +R     G+  ++    PDFC++ VV  GK
Sbjct  142   TK-------RSLSTIRVKKGHGVGEYVQKNAPDFCQVKVVSEGK  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4826968840940