BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23858_g1_i4 len=2473 path=[24380:0-461 12335:462-470 13867:471-677
3652:678-710 16307:711-1004 14469:1005-1245 @11594@!:1246-2076
25531:2077-2155 17671:2156-2266 17782:2267-2472]

Length=2473
                                                                      Score     E

ref|XP_011077976.1|  PREDICTED: beta-galactosidase-like                 987   0.0     
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 979   0.0     
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      975   0.0     
ref|XP_006353531.1|  PREDICTED: beta-galactosidase-like                 974   0.0     
gb|AAC25984.1|  beta-galactosidase                                      973   0.0     Solanum lycopersicum
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      972   0.0     
gb|ADO34789.1|  beta-galactosidase STBG4                                972   0.0     
ref|XP_009762312.1|  PREDICTED: beta-galactosidase-like                 972   0.0     
ref|XP_009599425.1|  PREDICTED: beta-galactosidase-like                 972   0.0     
pdb|3W5F|A  Chain A, Crystal Structure Of Tomato Beta-galactosida...    972   0.0     
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      971   0.0     
ref|NP_001234842.1|  ss-galactosidase precursor                         968   0.0     
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      966   0.0     
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      966   0.0     
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      962   0.0     
dbj|BAC10578.2|  beta-galactosidase                                     959   0.0     Capsicum annuum
gb|ADV41669.1|  beta-D-galactosidase                                    958   0.0     
gb|AAK40304.1|  beta-galactosidase                                      958   0.0     Capsicum annuum
ref|XP_011093727.1|  PREDICTED: beta-galactosidase-like                 956   0.0     
gb|EYU45189.1|  hypothetical protein MIMGU_mgv1a003101mg                954   0.0     
gb|AHG94613.1|  beta-galactosidase                                      927   0.0     
gb|EYU28411.1|  hypothetical protein MIMGU_mgv1a024117mg                925   0.0     
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      919   0.0     
emb|CBI27912.3|  unnamed protein product                                917   0.0     
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             917   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      917   0.0     Vitis vinifera
gb|KDP33829.1|  hypothetical protein JCGZ_07400                         913   0.0     
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1           913   0.0     
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           912   0.0     
gb|KDO57765.1|  hypothetical protein CISIN_1g004219mg                   912   0.0     
ref|XP_002514108.1|  beta-galactosidase, putative                       909   0.0     Ricinus communis
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                 909   0.0     
ref|XP_007138730.1|  hypothetical protein PHAVU_009G232500g             909   0.0     
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4      907   0.0     
ref|XP_007012844.1|  Beta-galactosidase                                 906   0.0     
gb|AAF67341.1|  beta galactosidase                                      904   0.0     Vigna radiata var. radiata [golden gram]
gb|ACC78255.1|  beta-galactosidase                                      904   0.0     Carica papaya [mamon]
gb|KHN24609.1|  Beta-galactosidase                                      904   0.0     
ref|XP_003546457.1|  PREDICTED: beta-galactosidase-like isoform X1      904   0.0     
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      902   0.0     
gb|AAC77377.1|  beta-galactosidase precursor                            902   0.0     Carica papaya [mamon]
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3      901   0.0     
gb|KCW79522.1|  hypothetical protein EUGRSUZ_C00898                     900   0.0     
ref|XP_006587007.1|  PREDICTED: beta-galactosidase-like                 900   0.0     
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                 899   0.0     
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             899   0.0     
ref|NP_001266133.1|  beta-galactosidase-like                            899   0.0     
ref|XP_011045964.1|  PREDICTED: beta-galactosidase-like isoform X1      899   0.0     
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g             899   0.0     
gb|ACF22882.1|  beta-galactosidase                                      899   0.0     Glycine max [soybeans]
gb|AAB61470.1|  beta-D-galactosidase                                    898   0.0     Mangifera indica
gb|ABY71826.1|  beta-galactosidase                                      897   0.0     Prunus salicina [Japanese plum]
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    896   0.0     
gb|KDO57766.1|  hypothetical protein CISIN_1g004219mg                   895   0.0     
gb|KDO57768.1|  hypothetical protein CISIN_1g004219mg                   895   0.0     
gb|ABV32546.1|  beta-galactosidase protein 1                            894   0.0     Prunus persica
gb|KHN06610.1|  Beta-galactosidase                                      893   0.0     
gb|KDO57764.1|  hypothetical protein CISIN_1g004219mg                   892   0.0     
ref|XP_006451459.1|  hypothetical protein CICLE_v10007531mg             892   0.0     
gb|AES59331.2|  beta-like galactosidase                                 892   0.0     
gb|KDO57763.1|  hypothetical protein CISIN_1g004219mg                   892   0.0     
ref|XP_006451461.1|  hypothetical protein CICLE_v10007531mg             892   0.0     
ref|XP_010090040.1|  hypothetical protein L484_027271                   890   0.0     
ref|NP_001275845.1|  beta-galactosidase                                 889   0.0     
ref|NP_001265889.1|  beta-galactosidase-like precursor                  885   0.0     
gb|EPS64494.1|  beta-galactosidase                                      885   0.0     
gb|KEH39519.1|  beta-galactosidase                                      884   0.0     
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               883   0.0     
ref|XP_003597608.1|  Beta-galactosidase                                 883   0.0     
gb|KEH37473.1|  beta-like galactosidase                                 880   0.0     
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 880   0.0     
ref|XP_008450854.1|  PREDICTED: beta-galactosidase-like                 880   0.0     
gb|AES65414.2|  beta-like galactosidase                                 880   0.0     
gb|KDO57767.1|  hypothetical protein CISIN_1g004219mg                   880   0.0     
ref|XP_003595163.1|  Beta-galactosidase                                 879   0.0     
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               879   0.0     
ref|XP_003595162.1|  Beta-galactosidase                                 879   0.0     
gb|KHN32687.1|  Beta-galactosidase 1                                    879   0.0     
ref|XP_004158444.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    879   0.0     
ref|XP_004158465.1|  PREDICTED: beta-galactosidase-like                 878   0.0     
ref|XP_010536861.1|  PREDICTED: beta-galactosidase 12                   878   0.0     
ref|XP_004135712.1|  PREDICTED: beta-galactosidase-like                 877   0.0     
gb|ABK96254.1|  unknown                                                 877   0.0     Populus trichocarpa x Populus deltoides
ref|XP_006385360.1|  beta-galactosidase 1 family protein                877   0.0     
gb|KDO57762.1|  hypothetical protein CISIN_1g004219mg                   876   0.0     
ref|XP_006451460.1|  hypothetical protein CICLE_v10007531mg             876   0.0     
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               874   0.0     
gb|ABV32545.1|  beta-galactosidase protein 2                            874   0.0     Prunus persica
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    873   0.0     
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             873   0.0     
gb|KHN30042.1|  Beta-galactosidase 1                                    872   0.0     
gb|KGN66238.1|  hypothetical protein Csa_1G587980                       872   0.0     
ref|XP_008450853.1|  PREDICTED: beta-galactosidase-like                 872   0.0     
ref|XP_009352652.1|  PREDICTED: beta-galactosidase                      872   0.0     
dbj|BAE72073.1|  pear beta-galactosidase1                               872   0.0     Pyrus communis
ref|XP_010106660.1|  Beta-galactosidase 1                               872   0.0     
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 871   0.0     
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               871   0.0     
emb|CAH18936.1|  beta-galactosidase                                     871   0.0     Pyrus communis
dbj|BAB21492.1|  beta-D-galactosidase                                   871   0.0     Pyrus pyrifolia [sha li]
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             871   0.0     
ref|XP_010049746.1|  PREDICTED: beta-galactosidase-like                 870   0.0     
emb|CAA09467.1|  exo galactanase                                        870   0.0     Lupinus angustifolius
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    870   0.0     
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    867   0.0     
sp|P48981.1|BGAL_MALDO  RecName: Full=Beta-galactosidase; AltName...    867   0.0     Malus domestica [apple tree]
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               866   0.0     
gb|AHG94611.1|  beta-galactosidase                                      866   0.0     
ref|XP_004287560.1|  PREDICTED: beta-galactosidase-like                 866   0.0     
emb|CAC44500.1|  beta-galactosidase                                     866   0.0     Fragaria x ananassa
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      865   0.0     
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 865   0.0     
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    865   0.0     
gb|KCW53602.1|  hypothetical protein EUGRSUZ_J02867                     864   0.0     
emb|CBI35944.3|  unnamed protein product                                864   0.0     
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 864   0.0     
ref|NP_001280755.1|  beta-galactosidase precursor                       863   0.0     
ref|XP_002527409.1|  beta-galactosidase, putative                       863   0.0     Ricinus communis
gb|KCW53601.1|  hypothetical protein EUGRSUZ_J02867                     863   0.0     
emb|CDO97918.1|  unnamed protein product                                862   0.0     
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 862   0.0     
gb|KDO65278.1|  hypothetical protein CISIN_1g002867mg                   862   0.0     
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               862   0.0     
gb|KEH18344.1|  beta-galactosidase                                      862   0.0     
dbj|BAF31233.1|  beta-D-galactosidase                                   862   0.0     Persea americana
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                   861   0.0     
ref|XP_008451151.1|  PREDICTED: beta-galactosidase-like                 855   0.0     
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                   862   0.0     
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   861   0.0     
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               861   0.0     
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    860   0.0     
emb|CAC44502.1|  beta-galactosidase                                     856   0.0     Fragaria x ananassa
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                      860   0.0     
ref|NP_001234303.1|  beta-galactosidase precursor                       860   0.0     
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      860   0.0     
gb|ADO34788.1|  beta-galactosidase STBG3                                860   0.0     
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             860   0.0     
ref|NP_001234465.1|  beta-galactosidase precursor                       860   0.0     
ref|XP_010545349.1|  PREDICTED: beta-galactosidase 12-like isofor...    850   0.0     
gb|KHG01120.1|  Beta-galactosidase                                      860   0.0     
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 859   0.0     
ref|XP_007024475.1|  Beta galactosidase 1                               858   0.0     
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               858   0.0     
dbj|BAE72074.1|  pear beta-galactosidase2                               853   0.0     Pyrus communis
ref|NP_001266102.1|  beta-galactosidase 1-like precursor                858   0.0     
ref|XP_008450855.1|  PREDICTED: beta-galactosidase-like                 852   0.0     
ref|NP_001289260.1|  beta-galactosidase precursor                       852   0.0     
gb|ACP18875.1|  beta-galactosidase pBG(a)                               856   0.0     Carica papaya [mamon]
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    856   0.0     
ref|XP_004287559.1|  PREDICTED: beta-galactosidase-like                 851   0.0     
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             856   0.0     
ref|XP_011077977.1|  PREDICTED: beta-galactosidase-like                 851   0.0     
ref|XP_010911412.1|  PREDICTED: beta-galactosidase-like                 845   0.0     
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               855   0.0     
ref|NP_187988.1|  beta galactosidase 1                                  855   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHN39301.1|  Beta-galactosidase 1                                    854   0.0     
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             854   0.0     
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               854   0.0     
ref|XP_010545348.1|  PREDICTED: beta-galactosidase 12-like isofor...    849   0.0     
gb|AGW47883.1|  beta-galactosidase precursor                            853   0.0     
gb|AAM13196.1|  galactosidase, putative                                 853   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             852   0.0     
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      852   0.0     
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg             852   0.0     
ref|NP_194344.2|  beta-galactosidase 12                                 843   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    850   0.0     
ref|XP_010448320.1|  PREDICTED: beta-galactosidase 12-like isofor...    846   0.0     
ref|XP_003589080.1|  Beta-galactosidase                                 845   0.0     
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               850   0.0     
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1-like               850   0.0     
gb|AFD54987.1|  beta-galactosidase                                      845   0.0     
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    850   0.0     
ref|XP_004144120.1|  PREDICTED: beta-galactosidase-like                 847   0.0     
ref|XP_006413222.1|  hypothetical protein EUTSA_v10024511mg             845   0.0     
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             849   0.0     
ref|XP_010049745.1|  PREDICTED: beta-galactosidase-like                 844   0.0     
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               848   0.0     
ref|XP_004170887.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    842   0.0     
ref|XP_010433545.1|  PREDICTED: beta-galactosidase 12-like isofor...    842   0.0     
gb|KDO57770.1|  hypothetical protein CISIN_1g004219mg                   840   0.0     
ref|XP_009402923.1|  PREDICTED: beta-galactosidase-like                 842   0.0     
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      846   0.0     
ref|XP_010448319.1|  PREDICTED: beta-galactosidase 12-like isofor...    841   0.0     
ref|XP_006285652.1|  hypothetical protein CARUB_v10007108mg             840   0.0     
ref|XP_010438797.1|  PREDICTED: beta-galactosidase 12 isoform X2        840   0.0     
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg             842   0.0     
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      842   0.0     
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                    842   0.0     
emb|CDX97513.1|  BnaA05g25660D                                          842   0.0     
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      842   0.0     
ref|XP_010433544.1|  PREDICTED: beta-galactosidase 12-like isofor...    837   0.0     
ref|NP_849553.1|  beta-galactosidase 12                                 836   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDX94367.1|  BnaC01g18170D                                          835   0.0     
gb|KDP33831.1|  hypothetical protein JCGZ_07402                         839   0.0     
emb|CDY51738.1|  BnaA01g37210D                                          840   0.0     
emb|CAB39679.1|  putative beta-galactosidase                            835   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438795.1|  PREDICTED: beta-galactosidase 12 isoform X1        835   0.0     
ref|XP_009139949.1|  PREDICTED: beta-galactosidase 12 isoform X2        835   0.0     
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like               838   0.0     
emb|CDY23637.1|  BnaC05g39570D                                          838   0.0     
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           837   0.0     
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           837   0.0     
ref|XP_010049744.1|  PREDICTED: beta-galactosidase-like                 832   0.0     
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               837   0.0     
ref|XP_002867577.1|  beta-galactosidase 12                              832   0.0     
ref|XP_009388558.1|  PREDICTED: beta-galactosidase-like                 832   0.0     
gb|KHN17668.1|  Beta-galactosidase                                      833   0.0     
ref|XP_009408846.1|  PREDICTED: beta-galactosidase-like                 831   0.0     
ref|XP_006403764.1|  hypothetical protein EUTSA_v10010152mg             831   0.0     
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               834   0.0     
dbj|BAF31234.1|  beta-D-galactosidase                                   834   0.0     Persea americana
ref|XP_009139943.1|  PREDICTED: beta-galactosidase 12 isoform X1        830   0.0     
gb|AEG76892.1|  putative beta-galactosidase                             829   0.0     
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 834   0.0     
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               832   0.0     
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 832   0.0     
ref|XP_010443345.1|  PREDICTED: beta-galactosidase 4-like               827   0.0     
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 832   0.0     
emb|CDY37486.1|  BnaC01g37460D                                          831   0.0     
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 830   0.0     
ref|XP_010667155.1|  PREDICTED: putative beta-galactosidase             825   0.0     
emb|CDY11899.1|  BnaC03g13250D                                          825   0.0     
ref|XP_010483173.1|  PREDICTED: beta-galactosidase 4                    825   0.0     
ref|XP_009132166.1|  PREDICTED: beta-galactosidase 4                    825   0.0     
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               829   0.0     
gb|KFK34528.1|  hypothetical protein AALP_AA5G157800                    823   0.0     
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               829   0.0     
gb|KHG11296.1|  Beta-galactosidase                                      823   0.0     
ref|XP_009409594.1|  PREDICTED: beta-galactosidase-like                 824   0.0     
gb|EPS62826.1|  beta-galactosidase                                      819   0.0     
ref|XP_002876169.1|  AT3g52840/F8J2_10                                  823   0.0     
ref|XP_009409593.1|  PREDICTED: beta-galactosidase-like                 822   0.0     
gb|KCW82506.1|  hypothetical protein EUGRSUZ_C03898                     822   0.0     
ref|NP_200498.1|  beta-galactosidase 4                                  822   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137581.1|  PREDICTED: beta-galactosidase 12-like              822   0.0     
gb|AAK96780.1|  beta-galactosidase                                      822   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               827   0.0     
ref|XP_006401275.1|  hypothetical protein EUTSA_v10012847mg             819   0.0     
gb|ACC60981.1|  beta-galactosidase 1 precursor                          824   0.0     Petunia x hybrida [garden petunia]
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    823   0.0     
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    823   0.0     Asparagus officinalis
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like                 822   0.0     
dbj|BAB83260.1|  beta-D-galactosidase                                   820   0.0     Persea americana
ref|NP_190852.2|  beta-galactosidase 2                                  817   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090042.1|  Beta-galactosidase 1                               817   0.0     
ref|XP_007046795.1|  Beta-galactosidase 3 isoform 2                     815   0.0     
ref|XP_010451557.1|  PREDICTED: beta-galactosidase 4-like               816   0.0     
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like               820   0.0     
ref|XP_009761050.1|  PREDICTED: beta-galactosidase 5                    815   0.0     
ref|XP_002510455.1|  beta-galactosidase, putative                       820   0.0     Ricinus communis
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                    819   0.0     
gb|KCW82245.1|  hypothetical protein EUGRSUZ_C03662                     816   0.0     
ref|XP_008672351.1|  PREDICTED: hypothetical protein isoform X1         818   0.0     
gb|KDO71054.1|  hypothetical protein CISIN_1g003044mg                   811   0.0     
gb|KDP38567.1|  hypothetical protein JCGZ_04492                         819   0.0     
ref|XP_010051543.1|  PREDICTED: beta-galactosidase                      816   0.0     
ref|XP_007204246.1|  hypothetical protein PRUPE_ppa002271mg             812   0.0     
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870          818   0.0     
ref|XP_009409595.1|  PREDICTED: beta-galactosidase-like                 814   0.0     
ref|XP_010504030.1|  PREDICTED: beta-galactosidase 2-like               813   0.0     
ref|XP_010515757.1|  PREDICTED: beta-galactosidase 2 isoform X1         813   0.0     
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    818   0.0     
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               817   0.0     
emb|CAB86888.1|  beta-galactosidase precursor-like protein              813   0.0     Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ96054.1|  predicted protein                                      818   0.0     
emb|CDX95380.1|  BnaC04g27780D                                          813   0.0     
dbj|BAK07157.1|  predicted protein                                      817   0.0     
ref|XP_006369293.1|  beta-galactosidase 1 family protein                816   0.0     
gb|KDO84692.1|  hypothetical protein CISIN_1g003076mg                   809   0.0     
ref|XP_002514109.1|  beta-galactosidase, putative                       816   0.0     Ricinus communis
ref|XP_010426910.1|  PREDICTED: beta-galactosidase 2-like               812   0.0     
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3-like               817   0.0     
ref|XP_002864484.1|  predicted protein                                  812   0.0     
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     816   0.0     
ref|XP_009148743.1|  PREDICTED: beta-galactosidase 2 isoform X1         811   0.0     
ref|XP_006280080.1|  hypothetical protein CARUB_v10025963mg             811   0.0     
ref|NP_001043405.1|  Os01g0580200                                       815   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 3-like               815   0.0     
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               815   0.0     
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    814   0.0     
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    814   0.0     
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    813   0.0     
gb|AAN60229.1|  unknown                                                 803   0.0     
gb|EYU21377.1|  hypothetical protein MIMGU_mgv1a001631mg                811   0.0     
gb|EMT10014.1|  Beta-galactosidase 5                                    813   0.0     
ref|XP_002306893.1|  beta-galactosidase family protein                  813   0.0     
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like               812   0.0     
gb|AAW47739.1|  beta-galactosidase                                      813   0.0     
ref|XP_009603021.1|  PREDICTED: beta-galactosidase 5                    808   0.0     
emb|CAN78072.1|  hypothetical protein VITISV_013292                     813   0.0     
emb|CBI19767.3|  unnamed protein product                                813   0.0     
ref|XP_002305449.1|  beta-galactosidase family protein                  808   0.0     
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              812   0.0     
ref|XP_006412010.1|  hypothetical protein EUTSA_v10024387mg             803   0.0     
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               812   0.0     
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             811   0.0     
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               811   0.0     
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                    810   0.0     
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    810   0.0     
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               810   0.0     
dbj|BAD91082.1|  beta-D-galactosidase                                   810   0.0     
gb|KHN27041.1|  Beta-galactosidase 3                                    810   0.0     
gb|KDO84691.1|  hypothetical protein CISIN_1g003076mg                   805   0.0     
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                   808   0.0     
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                   808   0.0     
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                   808   0.0     
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             809   0.0     
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    809   0.0     
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               809   0.0     
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   809   0.0     
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               809   0.0     
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    809   0.0     
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               808   0.0     
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   808   0.0     
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    807   0.0     
ref|XP_006342225.1|  PREDICTED: beta-galactosidase 3-like               802   0.0     
ref|XP_011037170.1|  PREDICTED: beta-galactosidase 5-like               804   0.0     
gb|EEE54862.1|  hypothetical protein OsJ_02342                          806   0.0     
gb|KFK27244.1|  hypothetical protein AALP_AA8G356800                    801   0.0     
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               806   0.0     
ref|NP_001049068.1|  Os03g0165400                                       805   0.0     
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed       805   0.0     
ref|XP_007160714.1|  hypothetical protein PHAVU_001G010900g             801   0.0     
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                    800   0.0     
emb|CDP01954.1|  unnamed protein product                                805   0.0     
emb|CDP07463.1|  unnamed protein product                                804   0.0     
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          804   0.0     
gb|AAM22973.1|AF499737_1  beta-galactosidase                            804   0.0     
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    804   0.0     
emb|CDY32919.1|  BnaC02g12030D                                          799   0.0     
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             804   0.0     
ref|XP_004158882.1|  PREDICTED: beta-galactosidase 3-like               804   0.0     
sp|Q00662.1|BGAL_DIACA  RecName: Full=Putative beta-galactosidase...    799   0.0     
ref|XP_004951447.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    798   0.0     
gb|EYU31167.1|  hypothetical protein MIMGU_mgv1a001956mg                799   0.0     
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    803   0.0     
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like               802   0.0     
gb|KHN00504.1|  Beta-galactosidase 3                                    802   0.0     
ref|XP_010552493.1|  PREDICTED: beta-galactosidase 5                    797   0.0     
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    802   0.0     
gb|KHG23756.1|  Beta-galactosidase 5 -like protein                      798   0.0     
ref|XP_002512959.1|  beta-galactosidase, putative                       797   0.0     
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3-like               802   0.0     
emb|CDX75569.1|  BnaA01g01330D                                          801   0.0     
ref|XP_006380782.1|  hypothetical protein POPTR_0007s13540g             793   0.0     
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    801   0.0     
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             801   0.0     
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    801   0.0     
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    801   0.0     
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             801   0.0     
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                      796   0.0     
dbj|BAJ34544.1|  unnamed protein product                                801   0.0     
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               801   0.0     
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    801   0.0     
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...    800   0.0     
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               801   0.0     
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    800   0.0     
ref|XP_007042084.1|  Beta-galactosidase 3 isoform 2                     791   0.0     
gb|KHF99404.1|  Beta-galactosidase 1 -like protein                      798   0.0     
ref|XP_010061261.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    794   0.0     
ref|XP_008679838.1|  PREDICTED: beta-galactosidase 4                    794   0.0     
ref|XP_004238611.1|  PREDICTED: beta-galactosidase 5                    794   0.0     
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             798   0.0     
gb|AAQ21369.1|  beta-galactosidase                                      797   0.0     
gb|KHN12675.1|  Beta-galactosidase 5                                    793   0.0     
gb|EEC74580.1|  hypothetical protein OsI_10152                          798   0.0     
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                798   0.0     
gb|EEE58382.1|  hypothetical protein OsJ_09539                          798   0.0     
gb|EPS70273.1|  beta-galactosidase                                      789   0.0     
gb|ACG30563.1|  beta-galactosidase precursor                            793   0.0     
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    797   0.0     
ref|XP_007042083.1|  Beta-galactosidase 3 isoform 1                     791   0.0     
emb|CDY59693.1|  BnaC07g51120D                                          796   0.0     
gb|KGN66239.1|  hypothetical protein Csa_1G587990                       787   0.0     
ref|XP_010110010.1|  Beta-galactosidase 3                               795   0.0     
ref|XP_002455836.1|  hypothetical protein SORBIDRAFT_03g025990          793   0.0     
ref|XP_006283100.1|  hypothetical protein CARUB_v10004117mg             794   0.0     
emb|CDX69219.1|  BnaC01g02340D                                          794   0.0     
ref|NP_001130532.1|  beta-galactosidase isoform 1 precursor             790   0.0     
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    795   0.0     
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                795   0.0     
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               795   0.0     
ref|XP_007017651.1|  Beta-galactosidase 5 isoform 1                     791   0.0     
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    794   0.0     
ref|XP_002453540.1|  hypothetical protein SORBIDRAFT_04g007660          790   0.0     
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             794   0.0     
ref|NP_001265904.1|  beta-galactosidase 5-like precursor                790   0.0     
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    793   0.0     
ref|XP_004292017.1|  PREDICTED: beta-galactosidase 3-like               793   0.0     
gb|AAF67342.1|  beta galactosidase                                      789   0.0     
gb|ABR16628.1|  unknown                                                 793   0.0     
ref|XP_002310279.2|  beta-galactosidase family protein                  793   0.0     
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               792   0.0     
ref|XP_007136038.1|  hypothetical protein PHAVU_009G012700g             788   0.0     
ref|XP_010113483.1|  Beta-galactosidase 3                               792   0.0     
ref|XP_002437187.1|  hypothetical protein SORBIDRAFT_10g022620          788   0.0     
gb|KHN36067.1|  Beta-galactosidase 3                                    792   0.0     
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               792   0.0     
ref|XP_010234045.1|  PREDICTED: beta-galactosidase 4                    787   0.0     
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               792   0.0     
gb|AGR44466.1|  beta-D-galactosidase 7                                  792   0.0     
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    791   0.0     
ref|XP_006648459.1|  PREDICTED: beta-galactosidase 4-like               788   0.0     
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               791   0.0     
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               791   0.0     
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    791   0.0     
dbj|BAD91084.1|  beta-D-galactosidase                                   791   0.0     
gb|KHN20946.1|  Beta-galactosidase 5                                    786   0.0     
ref|NP_849506.1|  beta-galactosidase 3                                  790   0.0     
emb|CAB16852.1|  beta-galactosidase like protein                        790   0.0     
ref|XP_009126921.1|  PREDICTED: beta-galactosidase 4-like               785   0.0     
ref|NP_568001.1|  beta-galactosidase 3                                  790   0.0     
emb|CDX92753.1|  BnaC07g40110D                                          784   0.0     
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               788   0.0     
emb|CDY20708.1|  BnaA02g08480D                                          784   0.0     
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               788   0.0     
dbj|BAK05933.1|  predicted protein                                      783   0.0     
sp|Q6Z6K4.1|BGAL4_ORYSJ  RecName: Full=Beta-galactosidase 4; Shor...    783   0.0     
ref|NP_001234317.1|  TBG6 protein precursor                             787   0.0     
gb|EEC70952.1|  hypothetical protein OsI_02561                          786   0.0     
ref|XP_004500970.1|  PREDICTED: beta-galactosidase 5-like isoform X2    779   0.0     
gb|EAZ22260.1|  hypothetical protein OsJ_05915                          783   0.0     
ref|XP_003523710.1|  PREDICTED: beta-galactosidase 3-like isoform 1     782   0.0     
ref|XP_009777047.1|  PREDICTED: beta-galactosidase 3-like               781   0.0     
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               786   0.0     
gb|KHN41933.1|  Beta-galactosidase 3                                    786   0.0     
gb|ADO34791.1|  beta-galactosidase STBG6                                786   0.0     
ref|XP_006362025.1|  PREDICTED: beta-galactosidase 3-like               781   0.0     
ref|XP_010315322.1|  PREDICTED: beta-galactosidase 3-like               780   0.0     
gb|KFK36177.1|  hypothetical protein AALP_AA4G088200                    780   0.0     
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             785   0.0     
sp|A2X2H7.1|BGAL4_ORYSI  RecName: Full=Beta-galactosidase 4; Shor...    780   0.0     
ref|XP_006656180.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    779   0.0     
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    783   0.0     
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    783   0.0     
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               782   0.0     
gb|KCW68186.1|  hypothetical protein EUGRSUZ_F01855                     776   0.0     
ref|XP_004291830.1|  PREDICTED: beta-galactosidase 5-like               777   0.0     
gb|KDP40776.1|  hypothetical protein JCGZ_24775                         769   0.0     
ref|XP_003563718.1|  PREDICTED: beta-galactosidase 9                    776   0.0     
emb|CDY42755.1|  BnaA03g47840D                                          776   0.0     
ref|XP_006393673.1|  hypothetical protein EUTSA_v10011265mg             776   0.0     
ref|XP_004500969.1|  PREDICTED: beta-galactosidase 5-like isoform X1    776   0.0     
ref|XP_004135714.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    775   0.0     
ref|XP_006487343.1|  PREDICTED: beta-galactosidase 3-like               775   0.0     
ref|XP_009614464.1|  PREDICTED: beta-galactosidase 3-like               775   0.0     
gb|KEH36209.1|  beta-galactosidase-like protein                         775   0.0     
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    780   0.0     
ref|XP_003589339.1|  Beta-galactosidase                                 775   0.0     
ref|XP_009129554.1|  PREDICTED: beta-galactosidase 5                    773   0.0     
gb|KHN45883.1|  Beta-galactosidase 5                                    773   0.0     
ref|XP_004966041.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    771   0.0     
emb|CDY47949.1|  BnaA10g28210D                                          771   0.0     
gb|EYU42595.1|  hypothetical protein MIMGU_mgv1a001990mg                771   0.0     
ref|XP_010107841.1|  Beta-galactosidase 3                               776   0.0     
gb|EMS53990.1|  Beta-galactosidase 2                                    774   0.0     
gb|EMT13456.1|  Beta-galactosidase 9                                    771   0.0     
ref|XP_006423393.1|  hypothetical protein CICLE_v10030257mg             771   0.0     
gb|EEE65914.1|  hypothetical protein OsJ_21762                          764   0.0     
emb|CDY53959.1|  BnaCnng25850D                                          770   0.0     
gb|KDP41747.1|  hypothetical protein JCGZ_26765                         768   0.0     
tpg|DAA43551.1|  TPA: beta-galactosidase                                776   0.0     
ref|XP_004135819.1|  PREDICTED: beta-galactosidase-like                 766   0.0     
emb|CAA18137.1|  beta-galactosidase like protein                        773   0.0     
ref|XP_003612092.1|  Beta-galactosidase                                 773   0.0     
dbj|BAD91085.1|  beta-D-galactosidase                                   773   0.0     
emb|CAB64741.1|  putative beta-galactosidase                            768   0.0     
ref|XP_006306871.1|  hypothetical protein CARUB_v10008424mg             768   0.0     
emb|CDO97013.1|  unnamed protein product                                767   0.0     
gb|KCW69753.1|  hypothetical protein EUGRSUZ_F031302                    759   0.0     
ref|NP_175127.1|  beta-galactosidase 5                                  767   0.0     
gb|EAZ01416.1|  hypothetical protein OsI_23450                          766   0.0     
gb|AAL24206.1|  At1g45130/F27F5_20                                      766   0.0     
ref|XP_002891311.1|  hypothetical protein ARALYDRAFT_473836             766   0.0     
gb|KCW69752.1|  hypothetical protein EUGRSUZ_F031302                    759   0.0     
ref|XP_010066193.1|  PREDICTED: beta-galactosidase 5-like isoform X2    765   0.0     
emb|CDY36028.1|  BnaA08g04330D                                          764   0.0     
ref|XP_007017653.1|  Beta-galactosidase 5 isoform 3                     757   0.0     
ref|XP_010066194.1|  PREDICTED: beta-galactosidase 5-like isoform X3    763   0.0     
ref|NP_001057920.1|  Os06g0573600                                       763   0.0     
ref|XP_009107461.1|  PREDICTED: beta-galactosidase 5-like isoform X1    762   0.0     
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like               767   0.0     
ref|XP_010066191.1|  PREDICTED: beta-galactosidase 5-like isoform X1    762   0.0     
gb|EPS69033.1|  beta-galactosidase                                      758   0.0     
ref|XP_007017652.1|  Beta-galactosidase 5 isoform 2                     755   0.0     
gb|EMS60063.1|  Beta-galactosidase 5                                    762   0.0     
gb|AHL69742.1|  beta-galactosidase                                      760   0.0     
ref|NP_001168664.1|  uncharacterized protein LOC100382452               758   0.0     
gb|ACP18874.1|  beta-galactosidase pBG(b)                               746   0.0     
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like               754   0.0     
ref|XP_007042087.1|  Beta-galactosidase 3 isoform 5                     741   0.0     
ref|XP_006451463.1|  hypothetical protein CICLE_v10010258mg             745   0.0     
ref|XP_006475426.1|  PREDICTED: beta-galactosidase-like                 746   0.0     
gb|KDP32675.1|  hypothetical protein JCGZ_13673                         747   0.0     
ref|XP_010313633.1|  PREDICTED: ss-galactosidase isoform X1             738   0.0     
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 3-like               748   0.0     
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    745   0.0     
ref|XP_010479073.1|  PREDICTED: beta-galactosidase 5                    736   0.0     
ref|XP_009372992.1|  PREDICTED: beta-galactosidase 3-like               736   0.0     
gb|KHF97862.1|  Beta-galactosidase 3                                    722   0.0     



>ref|XP_011077976.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=729

 Score =   987 bits (2551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/563 (81%), Positives = 507/563 (90%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD ++FIINGKRRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  27    RATVSYDDKAFIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  86

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
              SPGKYNFEGR+DLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGIEFRTD
Sbjct  87    ASPGKYNFEGRFDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIEFRTD  146

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQGFV KIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYT WA 
Sbjct  147   NQPFKVAMQGFVEKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTAWAA  206

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQE APDPIIDTCNG+YCE F PNKP+KPKM+TE+WTGWYTQ+GG
Sbjct  207   KMAVGLNTGVPWIMCKQETAPDPIIDTCNGFYCEGFRPNKPWKPKMWTEVWTGWYTQYGG  266

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AF++ARF+QNNGSF NYYMYHGGTNFGRTAA LFIATSYDYDAPLDEYGL
Sbjct  267   PVPRRPAEDLAFAIARFVQNNGSFFNYYMYHGGTNFGRTAAGLFIATSYDYDAPLDEYGL  326

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
              NEPKYGHL +LH+AIK  EPALVSSYP +TW GKNQEVHVFRS++GAC AFLSNYDP +
Sbjct  327   PNEPKYGHLTNLHKAIKQCEPALVSSYPTITWPGKNQEVHVFRSKSGACAAFLSNYDPTY  386

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S K+TF N QY+LPPWSISILPDCK  VYNTA + S     KM+PV  G SWQSY+EE  
Sbjct  387   STKLTFQNRQYELPPWSISILPDCKTEVYNTARISSKGSTAKMVPVSGGLSWQSYSEETP  446

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+DD DT+A  G+WEQ+NVTRDSSDYLWY+T+VNIAP+E FL++G+ PV+T MSAGHA+H
Sbjct  447   SADDRDTLAMQGLWEQVNVTRDSSDYLWYLTQVNIAPNEGFLKSGQWPVLTAMSAGHALH  506

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGTVYGGL  PKLTYT  V LRAG+NKISLLSVAVGLPNVGLH+E+WNAGVLG
Sbjct  507   VFVNGKLSGTVYGGLDNPKLTYTGYVNLRAGVNKISLLSVAVGLPNVGLHYERWNAGVLG  566

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRDLT Q+W YKV
Sbjct  567   PVTLKGLNEGTRDLTKQSWSYKV  589


 Score =   170 bits (431),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+ VTGSSSVEW +G LLA  QPLTWYK TF+AP+GNDP+ALDM SMGKG
Sbjct  588   KVGLKGEALTLDNVTGSSSVEWVEGSLLAQKQPLTWYKTTFNAPQGNDPVALDMISMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIWVNGE +GRHWPGYTA+GSC   CNYAGT+ +KKCQ  CGQPSQ
Sbjct  648   EIWVNGESIGRHWPGYTAKGSCGG-CNYAGTFTEKKCQSGCGQPSQ  692



>ref|XP_009768469.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=837

 Score =   979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/563 (80%), Positives = 503/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R SV+YD R+ +INGKRRILISGSIHYPRSTP+MWP L+QKAKDGGLDVI+TYVFWNGHE
Sbjct  23    RASVTYDDRAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVFWNGHE  82

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGK+NFEGRYDLVKFIKL Q+AGLYV+LRIGPY+C EWNFGGFP+WLKYVPG+EFR D
Sbjct  83    PSPGKFNFEGRYDLVKFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRAD  142

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQGFV KIVNMMKS  LFE QGGPIIM+QIENEYGP+EW +G PGK Y KWA 
Sbjct  143   NQPFKVAMQGFVEKIVNMMKSGNLFEPQGGPIIMAQIENEYGPIEWGVGDPGKPYAKWAA  202

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNKPYKPKM+TE+WT WYT+FGG
Sbjct  203   EMAVGLDTGVPWIMCKQEDAPDPVIDTCNGFYCENFKPNKPYKPKMWTEVWTAWYTKFGG  262

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AF+VARFIQNNGS+ NYYMYHGGTNFGRTAA  FIATSYDYDAPLDEYGL
Sbjct  263   PVPRRPAEDVAFAVARFIQNNGSYFNYYMYHGGTNFGRTAAGRFIATSYDYDAPLDEYGL  322

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPALVSSY  VTW GKNQE HV+ S++G C AFLSNYDP F
Sbjct  323   LNEPKYGHLRDLHKAIKLSEPALVSSYATVTWLGKNQEAHVYNSKSGLCAAFLSNYDPTF  382

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S +VTF N+ YDLPPWS+SILPDCK  VYNTA + S S Q KM  VG G SW+SY+EE  
Sbjct  383   SVRVTFQNMLYDLPPWSVSILPDCKTAVYNTARISSRSSQMKMTSVGGGLSWESYSEETP  442

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+DD DT++A G+WEQINVTRDS+DYLWYMT VNIA DE FL+NGK+P +TVMSAGHA+H
Sbjct  443   SADDSDTISATGLWEQINVTRDSTDYLWYMTNVNIASDEGFLKNGKEPFLTVMSAGHALH  502

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYGGL  PKLTY+++VKLRAGINKIS+LSVAVGLPNVGLHFE WNAGVLG
Sbjct  503   VFINGQLSGTVYGGLDNPKLTYSSNVKLRAGINKISMLSVAVGLPNVGLHFETWNAGVLG  562

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEGTRDLT Q W YKV
Sbjct  563   PVTLSGLNEGTRDLTKQRWAYKV  585


 Score =   176 bits (446),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++GMKGESL+L+T++GSSSVEW     LA  QPLTWYKATFDAPEGNDPLALDM SMGKG
Sbjct  584   KVGMKGESLNLHTLSGSSSVEWAKDSFLAQKQPLTWYKATFDAPEGNDPLALDMRSMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGEG+GRHWPGY AQG+C  ECNYAG Y++KKC  NCGQPSQ
Sbjct  644   QIWINGEGIGRHWPGYIAQGNC-GECNYAGLYSEKKCHTNCGQPSQ  688



>ref|XP_009757671.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana sylvestris]
Length=839

 Score =   975 bits (2520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/563 (80%), Positives = 504/563 (90%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD R+ IINGKRRILISGSIHYPRSTP+MWPGL+QKAKDGGLD+I+TYVFWN HE
Sbjct  25    RATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNAHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGK+ FEGRYDLVKFIKL Q+AGLYV+LRIGPYICGEWNFGGFP+WLKYVPG+EFR D
Sbjct  85    PSPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRAD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK+AMQGFV KIVNMMKSE LFE QGGPII++QIENEYGP+EWE+G+PGKAYTKWA 
Sbjct  145   NHPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
              MAVGL+ GVPWIMCKQEDAPDP+IDTCNG+YCE+F PNKPYKPKM+TE+WT WYT+FGG
Sbjct  205   AMAVGLEIGVPWIMCKQEDAPDPVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AFSVARFIQNNGSF NYYMYHGGTNFGRT +ALFIATSYDYDAPL+EYGL
Sbjct  265   PVPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLNEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPAL+SSYP V W GKNQE HVFRS++G C AFLSNYD ++
Sbjct  325   LNEPKYGHLRDLHQAIKLSEPALLSSYPTVNWLGKNQEAHVFRSKSGDCAAFLSNYDTKY  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S KVTF   QYDLPPWSISILPDCK  VYNTA + S S Q  M PV    SWQSY+EE  
Sbjct  385   SVKVTFQTTQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAPVVGSLSWQSYSEETP  444

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++ DT++A+G+ EQIN+TRDSSDYLWYMT+VN+ PDE FL+NGKDP +TVMSAGHAMH
Sbjct  445   SAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHAMH  504

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYGGL  PKLTY+ +VKLRAGINKISLLSVAVGLPNVGLHFE WN GVLG
Sbjct  505   VFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGVLG  564

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLN+GTRDLT Q W YKV
Sbjct  565   PVTLSGLNDGTRDLTIQRWSYKV  587


 Score =   175 bits (443),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLS +T +G SSVEW +G LLA  QPLTWYKATFDAPEGNDP+ALDM SMGKG
Sbjct  586   KVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNGEGVGRHWPGY A+G C  ECNYAG Y +KKCQ NCGQPSQ
Sbjct  646   QIWVNGEGVGRHWPGYIAKGHC-GECNYAGEYTEKKCQTNCGQPSQ  690



>ref|XP_006353531.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=726

 Score =   974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/563 (80%), Positives = 504/563 (90%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD R+ IINGKR+ILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWN HE
Sbjct  24    KASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNAHE  83

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKYNFEGRYDLV+FIKLAQ+AGLYV+LRIGPYIC EWNFGGFP+WLKYVPG+EFRTD
Sbjct  84    PSPGKYNFEGRYDLVRFIKLAQRAGLYVNLRIGPYICAEWNFGGFPVWLKYVPGMEFRTD  143

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQGFV KIVNMMKSE LFE QGGPIIM+QIENEYGPVEWEIGAPGKA+TKWA 
Sbjct  144   NQPFKVAMQGFVQKIVNMMKSENLFEPQGGPIIMAQIENEYGPVEWEIGAPGKAFTKWAA  203

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGLKTGVPWIMCKQEDAPDP+IDTCNG+YCE F PNKPYKPKM+TE+WTGWYT+FGG
Sbjct  204   QMAVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWYTKFGG  263

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             P+ +RPAEDIAFSVARF+QNNGSF NYYMYHGGTNFGRT++ LFIATSYDYDAPLDEYGL
Sbjct  264   PIPQRPAEDIAFSVARFVQNNGSFFNYYMYHGGTNFGRTSSGLFIATSYDYDAPLDEYGL  323

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPALVSSY  VT  G NQE HV+RS++GAC AFLSNYD ++
Sbjct  324   LNEPKYGHLRDLHKAIKLSEPALVSSYATVTSLGSNQEAHVYRSKSGACAAFLSNYDSRY  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S KVTF N  YDLPPWSISILPDCK  VYNTA V S S   KM P G G SWQSY EE  
Sbjct  384   SVKVTFQNRPYDLPPWSISILPDCKTAVYNTARVNSRSSSIKMTPAGGGLSWQSYNEETP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD DT++A+G+WEQ NVTRDSSDYLWYMT+VNIA +E FL+NGKDP  TVMSAGH +H
Sbjct  444   TADDSDTLSANGLWEQKNVTRDSSDYLWYMTDVNIASNEGFLKNGKDPYFTVMSAGHVLH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGTVYG L  PKLTY+ +VKLRAGINKISLLSV+VGLPNVG+H++ WNAGVLG
Sbjct  504   VFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGINKISLLSVSVGLPNVGVHYDTWNAGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEG+R+L  Q W YKV
Sbjct  564   PVTLSGLNEGSRNLAKQRWSYKV  586


 Score =   156 bits (394),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW  G L+A  QPLTWYKATF+AP GN+PLALDM+SMGKG
Sbjct  585   KVGLKGESLSLHSLSGSSSVEWIRGSLVAQKQPLTWYKATFNAPGGNEPLALDMASMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGEGVGRHWPGY AQG C S+C+YAGT+N+KKCQ NCGQPSQ
Sbjct  645   QIWINGEGVGRHWPGYIAQGDC-SKCSYAGTFNEKKCQTNCGQPSQ  689



>gb|AAC25984.1| beta-galactosidase [Solanum lycopersicum]
Length=724

 Score =   973 bits (2515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/563 (80%), Positives = 504/563 (90%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD R+ IINGKR+ILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWNGHE
Sbjct  22    KASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHE  81

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKYNFEGRYDLV+FIK+ Q+AGLYV+LRIGPY+C EWNFGGFP+WLKYVPG+EFRT+
Sbjct  82    PSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRTN  141

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQGFV KIVNMMKSE LFESQGGPIIM+QIENEYGPVEWEIGAPGKAYTKWA 
Sbjct  142   NQPFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQIENEYGPVEWEIGAPGKAYTKWAA  201

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGLKTGVPWIMCKQEDAPDP+IDTCNG+YCE F PNKPYKPKM+TE+WTGWYT+FGG
Sbjct  202   QMAVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWYTKFGG  261

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             P+ +RPAEDIAFSVARF+QNNGSF NYYMYHGGTNFGRT++ LFIATSYDYDAPLDEYGL
Sbjct  262   PIPQRPAEDIAFSVARFVQNNGSFFNYYMYHGGTNFGRTSSGLFIATSYDYDAPLDEYGL  321

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPALVSSY  VT  G NQE HV+RS++GAC AFLSNYD ++
Sbjct  322   LNEPKYGHLRDLHKAIKLSEPALVSSYAAVTSLGSNQEAHVYRSKSGACAAFLSNYDSRY  381

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S KVTF N  Y+LPPWSISILPDCK  VYNTA V S S   KM P G G SWQSY EE  
Sbjct  382   SVKVTFQNRPYNLPPWSISILPDCKTAVYNTAQVNSQSSSIKMTPAGGGLSWQSYNEETP  441

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD DT+ A+G+WEQ NVTRDSSDYLWYMT VNIA +E FL+NGKDP +TVMSAGH +H
Sbjct  442   TADDSDTLTANGLWEQKNVTRDSSDYLWYMTNVNIASNEGFLKNGKDPYLTVMSAGHVLH  501

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGTVYG L  PKLTY+ +VKLRAGINKISLLSV+VGLPNVG+H++ WNAGVLG
Sbjct  502   VFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGINKISLLSVSVGLPNVGVHYDTWNAGVLG  561

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEG+R+L  Q W YKV
Sbjct  562   PVTLSGLNEGSRNLAKQKWSYKV  584


 Score =   158 bits (400),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW  G L+A  QPLTWYKATF+AP GNDPLALDM+SMGKG
Sbjct  583   KVGLKGESLSLHSLSGSSSVEWVRGSLMAQKQPLTWYKATFNAPGGNDPLALDMASMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGEGVGRHWPGY AQG C S+C+YAGT+N+KKCQ NCGQPSQ
Sbjct  643   QIWINGEGVGRHWPGYIAQGDC-SKCSYAGTFNEKKCQTNCGQPSQ  687



>ref|XP_009757670.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana sylvestris]
Length=839

 Score =   972 bits (2514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/563 (80%), Positives = 503/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD R+ IINGKRRILISGSIHYPRSTP+MWPGL+QKAKDGGLD+I+TYVFWN HE
Sbjct  25    RATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNAHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGK+ FEGRYDLVKFIKL Q+AGLYV+LRIGPYICGEWNFGGFP+WLKYVPG+EFR D
Sbjct  85    PSPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRAD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK+AMQGFV KIVNMMKSE LFE QGGPII++QIENEYGP+EWE+G+PGKAYTKWA 
Sbjct  145   NHPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
              MAVGL+ GVPWIMCKQEDAPDP+IDTCNG+YCE+F PNKPYKPKM+TE+WT WYT+FGG
Sbjct  205   AMAVGLEIGVPWIMCKQEDAPDPVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AFSVARFIQNNGSF NYYMYHGGTNFGRT +ALFIATSYDYDAPL+EYGL
Sbjct  265   PVPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLNEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPAL+SSYP V W GKNQE HVFRS++G C AFLSNYD ++
Sbjct  325   LNEPKYGHLRDLHQAIKLSEPALLSSYPTVNWLGKNQEAHVFRSKSGDCAAFLSNYDTKY  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S KVTF   QYDLPPWSISILPDCK  VYNTA + S S Q  M PV    SWQSY+EE  
Sbjct  385   SVKVTFQTTQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAPVVGSLSWQSYSEETP  444

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++ DT++A+G+ EQIN+TRDSSDYLWYMT+VN+  DE FL+NGKDP +TVMSAGHAMH
Sbjct  445   SAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGSDEGFLKNGKDPFLTVMSAGHAMH  504

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYGGL  PKLTY+ +VKLRAGINKISLLSVAVGLPNVGLHFE WN GVLG
Sbjct  505   VFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGVLG  564

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLN+GTRDLT Q W YKV
Sbjct  565   PVTLSGLNDGTRDLTIQRWSYKV  587


 Score =   175 bits (443),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLS +T +G SSVEW +G LLA  QPLTWYKATFDAPEGNDP+ALDM SMGKG
Sbjct  586   KVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNGEGVGRHWPGY A+G C  ECNYAG Y +KKCQ NCGQPSQ
Sbjct  646   QIWVNGEGVGRHWPGYIAKGHC-GECNYAGEYTEKKCQTNCGQPSQ  690



>gb|ADO34789.1| beta-galactosidase STBG4 [Solanum lycopersicum]
Length=724

 Score =   972 bits (2514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/563 (80%), Positives = 504/563 (90%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD R+ IINGKR+ILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWNGHE
Sbjct  22    KASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHE  81

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKYNFEGRYDLV+FIK+ Q+AGLYV+LRIGPY+C EWNFGGFP+WLKYVPG+EFRT+
Sbjct  82    PSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRTN  141

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQGFV KIVNMMKSE LFESQGGPIIM+QIENEYGPVEWEIGAPGKAYTKWA 
Sbjct  142   NQPFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQIENEYGPVEWEIGAPGKAYTKWAA  201

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGLKTGVPWIMCK+EDAPDP+IDTCNG+YCE F PNKPYKPKM+TE+WTGWYT+FGG
Sbjct  202   QMAVGLKTGVPWIMCKREDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWYTKFGG  261

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             P+ +RPAEDIAFSVARF+QNNGSF NYYMYHGGTNFGRT++ LFIATSYDYDAPLDEYGL
Sbjct  262   PIPQRPAEDIAFSVARFVQNNGSFFNYYMYHGGTNFGRTSSGLFIATSYDYDAPLDEYGL  321

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPALVSSY  VT  G NQE HV+RS++GAC AFLSNYD ++
Sbjct  322   LNEPKYGHLRDLHKAIKLSEPALVSSYAAVTSLGSNQEAHVYRSKSGACAAFLSNYDSRY  381

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S KVTF N  Y+LPPWSISILPDCK  VYNTA V S S   KM P G G SWQSY EE  
Sbjct  382   SVKVTFQNRPYNLPPWSISILPDCKTAVYNTAQVNSQSSSIKMTPAGGGLSWQSYNEETP  441

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD DT+ A+G+WEQ NVTRDSSDYLWYMT VNIA +E FLRNGKDP +TVMSAGH +H
Sbjct  442   TADDSDTLTANGLWEQKNVTRDSSDYLWYMTNVNIASNEGFLRNGKDPYLTVMSAGHVLH  501

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGTVYG L  PKLTY+ +VKLRAGINKISLLSV+VGLPNVG+H++ WNAGVLG
Sbjct  502   VFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGINKISLLSVSVGLPNVGVHYDTWNAGVLG  561

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEG+R+L  Q W YKV
Sbjct  562   PVTLSGLNEGSRNLAKQKWSYKV  584


 Score =   155 bits (391),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW  G L+A  QPLTWYKATF+AP GNDPLAL M+SMGKG
Sbjct  583   KVGLKGESLSLHSLSGSSSVEWVRGSLVAQKQPLTWYKATFNAPGGNDPLALGMASMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGEGVGRHWPGY AQG C S+C+YAGT+N+KKCQ NCGQPSQ
Sbjct  643   QIWINGEGVGRHWPGYIAQGDC-SKCSYAGTFNEKKCQTNCGQPSQ  687



>ref|XP_009762312.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=725

 Score =   972 bits (2513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/563 (80%), Positives = 502/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD R+ IING+R+ILISGSIHYPRSTP+MWP L+QKAKDGGLDVI+TYVFWNGHE
Sbjct  23    KATVSYDDRAIIINGRRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVFWNGHE  82

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKYNFEGRYDLVKF+KL QKAGLYV+LRIGPY+C EWNFGGFPIWLKY+PG+EFRTD
Sbjct  83    PSPGKYNFEGRYDLVKFVKLVQKAGLYVNLRIGPYVCAEWNFGGFPIWLKYIPGMEFRTD  142

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQGFV KIVNMMKSEKLFE QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  143   NQPFKVAMQGFVQKIVNMMKSEKLFEPQGGPIIIAQIENEYGPVEWEIGAPGKAYTKWTA  202

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGLKTGVPWIMCKQEDAPDP+IDTCNG+YCE F PNKPYKPKM+TE+WTGWYT+FGG
Sbjct  203   QMAVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWYTKFGG  262

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV +RP EDIAFSVARF+QNNGSF NYYMYHGGTNFGRT++ LFIATSYDYDAPLDEYGL
Sbjct  263   PVPQRPVEDIAFSVARFVQNNGSFFNYYMYHGGTNFGRTSSGLFIATSYDYDAPLDEYGL  322

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL EPALVSSYP VT  G NQE HV+RS++G C AFLSNYD ++
Sbjct  323   LNEPKYGHLRDLHKAIKLCEPALVSSYPTVTKIGNNQEAHVYRSKSGNCAAFLSNYDSKY  382

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S KVTF N  YDLPPWSISILPDCK  VYNTA V S S   KM   G+G SWQSY EE  
Sbjct  383   SVKVTFQNKPYDLPPWSISILPDCKTAVYNTAKVSSRSSSIKMTSTGSGLSWQSYNEETP  442

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD DT++A+G+WEQ NVTRDSSDYLWYMT+VNIA  E FL+NGKDP +TVMSAGH +H
Sbjct  443   TADDSDTLSANGLWEQKNVTRDSSDYLWYMTDVNIASGEGFLKNGKDPYLTVMSAGHVLH  502

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLTY+ +VKLRAGINKISLLSV+VGLPNVG+HF+ WNAGVLG
Sbjct  503   VFINGKLSGTVYGTLDNPKLTYSGNVKLRAGINKISLLSVSVGLPNVGVHFDTWNAGVLG  562

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             P++LSGLNEG RDLT Q W YKV
Sbjct  563   PITLSGLNEGKRDLTKQRWSYKV  585


 Score =   176 bits (447),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESL L+T++GSSSVEW  G L+A  QPLTWYKATF+AP GNDPLALDM+SMGKG
Sbjct  584   KVGLKGESLRLHTLSGSSSVEWIKGSLVAQKQPLTWYKATFNAPGGNDPLALDMASMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIW+NGEGVGRHWPGY AQG C  +CNYAGT+N+KKCQ NCGQPSQ
Sbjct  644   EIWINGEGVGRHWPGYIAQGDC-GKCNYAGTFNEKKCQTNCGQPSQ  688



>ref|XP_009599425.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=725

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/563 (80%), Positives = 501/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD R+ +INGKR+ILISGSIHYPRSTP+MWP L+QKAKDGGLDVI+TYVFWNGHE
Sbjct  23    KATVSYDDRAILINGKRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVFWNGHE  82

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKYNFEGRYDL+KF+KL QKAGLYV+LRIGPY+C EWNFGGFP+WLKYVPG+EFRTD
Sbjct  83    PSPGKYNFEGRYDLIKFVKLVQKAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRTD  142

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQGFV +IVNMMKSEKLFE QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  143   NQPFKVAMQGFVQRIVNMMKSEKLFEPQGGPIIIAQIENEYGPVEWEIGAPGKAYTKWTA  202

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAV LKTGVPWIMCKQEDAPDP+IDTCNG+YCE F PNKPYKPKM+TE+WTGWYT+FGG
Sbjct  203   QMAVSLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWYTKFGG  262

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV +RPAEDIAFSVARF+QNNGSF NYYMYHGGTNFGRT++ LFIATSYDYDAPLDEYGL
Sbjct  263   PVPQRPAEDIAFSVARFVQNNGSFFNYYMYHGGTNFGRTSSGLFIATSYDYDAPLDEYGL  322

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL EPALVSSYP VT  G NQE HVFRS++G C AFLSNYD ++
Sbjct  323   LNEPKYGHLRDLHKAIKLCEPALVSSYPTVTKIGSNQEAHVFRSKSGNCAAFLSNYDSKY  382

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             + KVTF N  YDLPPWSISILPDCK  VYNTA V S S   KM   G G SWQSY EE  
Sbjct  383   AVKVTFQNKPYDLPPWSISILPDCKTAVYNTAKVSSRSSSIKMTSTGGGLSWQSYNEETP  442

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD DT++A+G+WEQ NVTRDSSDYLWYMT+VNIA DE FL+NGKDP +TVMSAGH +H
Sbjct  443   TADDSDTLSANGLWEQKNVTRDSSDYLWYMTDVNIASDEGFLKNGKDPYLTVMSAGHVLH  502

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLTY+ +VKLRAGINKISLLSV+VGLPNVG+HF+ WNAGVLG
Sbjct  503   VFINGKLSGTVYGTLDSPKLTYSGNVKLRAGINKISLLSVSVGLPNVGVHFDTWNAGVLG  562

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEG RDL  Q W YKV
Sbjct  563   PVTLSGLNEGKRDLAKQRWSYKV  585


 Score =   176 bits (446),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T++GSSSVEW  G L+A  QPLTWYKATF+AP G+DPLALDM+SMGKG
Sbjct  584   KVGLKGESLSLHTLSGSSSVEWIKGSLVAQKQPLTWYKATFNAPGGSDPLALDMASMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIW+NGEGVGRHWPGY AQG C  +CNYAGT+N+KKCQ NCGQPSQ
Sbjct  644   EIWINGEGVGRHWPGYIAQGEC-GKCNYAGTFNEKKCQTNCGQPSQ  688



>pdb|3W5F|A Chain A, Crystal Structure Of Tomato Beta-galactosidase 4
 pdb|3W5F|B Chain B, Crystal Structure Of Tomato Beta-galactosidase 4
 pdb|3W5G|A Chain A, Crystal Structure Of Tomato Beta-galactosidase 4 In 
Complex With Galactose
 pdb|3W5G|B Chain B, Crystal Structure Of Tomato Beta-galactosidase 4 In 
Complex With Galactose
Length=718

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/561 (80%), Positives = 503/561 (90%), Gaps = 0/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD R+ IINGKR+ILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWNGHEPS
Sbjct  7     SVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEPS  66

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKYNFEGRYDLV+FIK+ Q+AGLYV+LRIGPY+C EWNFGGFP+WLKYVPG+EFRT+NQ
Sbjct  67    PGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRTNNQ  126

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFKVAMQGFV KIVNMMKSE LFESQGGPIIM+QIENEYGPVEWEIGAPGKAYTKWA QM
Sbjct  127   PFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQIENEYGPVEWEIGAPGKAYTKWAAQM  186

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGLKTGVPWIMCKQEDAPDP+IDTCNG+YCE F PNKPYKPKM+TE+WTGWYT+FGGP+
Sbjct  187   AVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWYTKFGGPI  246

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
              +RPAEDIAFSVARF+QNNGSF NYYMYHGGTNFGRT++ LFIATSYDYDAPLDEYGL+N
Sbjct  247   PQRPAEDIAFSVARFVQNNGSFFNYYMYHGGTNFGRTSSGLFIATSYDYDAPLDEYGLLN  306

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPKYGHLRDLH+AIKL+EPALVSSY  VT  G NQE HV+RS++GAC AFLSNYD ++S 
Sbjct  307   EPKYGHLRDLHKAIKLSEPALVSSYAAVTSLGSNQEAHVYRSKSGACAAFLSNYDSRYSV  366

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KVTF N  Y+LPPWSISILPDCK  VYNTA V S S   KM P G G SWQSY EE  ++
Sbjct  367   KVTFQNRPYNLPPWSISILPDCKTAVYNTAQVNSQSSSIKMTPAGGGLSWQSYNEETPTA  426

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             DD DT+ A+G+WEQ NVTRDSSDYLWYMT VNIA +E FL+NGKDP +TVMSAGH +HVF
Sbjct  427   DDSDTLTANGLWEQKNVTRDSSDYLWYMTNVNIASNEGFLKNGKDPYLTVMSAGHVLHVF  486

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +LSGTVYG L  PKLTY+ +VKLRAGINKISLLSV+VGLPNVG+H++ WNAGVLGPV
Sbjct  487   VNGKLSGTVYGTLDNPKLTYSGNVKLRAGINKISLLSVSVGLPNVGVHYDTWNAGVLGPV  546

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +LSGLNEG+R+L  Q W YKV
Sbjct  547   TLSGLNEGSRNLAKQKWSYKV  567


 Score =   158 bits (399),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW  G L+A  QPLTWYKATF+AP GNDPLALDM+SMGKG
Sbjct  566   KVGLKGESLSLHSLSGSSSVEWVRGSLMAQKQPLTWYKATFNAPGGNDPLALDMASMGKG  625

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGEGVGRHWPGY AQG C S+C+YAGT+N+KKCQ NCGQPSQ
Sbjct  626   QIWINGEGVGRHWPGYIAQGDC-SKCSYAGTFNEKKCQTNCGQPSQ  670



>ref|XP_009760185.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana sylvestris]
Length=839

 Score =   971 bits (2509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/563 (80%), Positives = 503/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD R+ IINGKRRILISGSIHYPRSTP+MWPGL+QKAKDGGLD+I+TYVFWNGHE
Sbjct  25    RATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGK+ FEGRYDLVKFIKL Q+AGLYV+LRIGPYICGEWNFGGFP+WLKYVPG+EFR D
Sbjct  85    PSPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRAD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK+AMQGFV KIVNMMKSE LFE QGGPII++QIENEYGP+EWE+G+PGKAYTKWA 
Sbjct  145   NHPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL+ GVPWIMCKQEDAPD +IDTCNG+YCE+F PNKPYKPKM+TE+WT WYT+FGG
Sbjct  205   EMAVGLEIGVPWIMCKQEDAPDHVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AFSVARFIQNNGSF NYYMYHGGTNFGRT +ALFIATSYDYDAPLDEYGL
Sbjct  265   PVPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPAL+SSYP V W GKNQE HVFRS++G C AFLSNYD ++
Sbjct  325   LNEPKYGHLRDLHKAIKLSEPALISSYPTVNWLGKNQEAHVFRSKSGDCAAFLSNYDTKY  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S KVTF  +QYDL PWSISILP CK  VYNTA + S   Q  M PV    SWQSY+EE  
Sbjct  385   SVKVTFQTMQYDLSPWSISILPYCKTAVYNTARISSQCSQMMMAPVVGSLSWQSYSEETP  444

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++ DT++A+G+ EQIN+TRDSSDYLWYMT+VN+ PDE FL+NGKDP +TVMSAGHAMH
Sbjct  445   SAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHAMH  504

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYGGL  PKLTY+ +VKLRAGINKISLLSVAVGLPNVGLHFE WN GVLG
Sbjct  505   VFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGVLG  564

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLN+GTRDLT Q W YKV
Sbjct  565   PVTLSGLNDGTRDLTIQRWSYKV  587


 Score =   172 bits (435),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLS +T +G SSVEW +G LLA  QPLTWYKATFDAPEGNDP+ALDM SMGKG
Sbjct  586   KVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNGEGVGR WPGY A+G C  ECNYAG Y +KKCQ NCGQPSQ
Sbjct  646   QIWVNGEGVGRQWPGYIAKGHC-GECNYAGEYTEKKCQTNCGQPSQ  690



>ref|NP_001234842.1| ss-galactosidase precursor [Solanum lycopersicum]
 emb|CAA10175.1| ss-galactosidase [Solanum lycopersicum]
Length=724

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/563 (80%), Positives = 503/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD R+ IINGKR+ILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWNGH 
Sbjct  22    KASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHG  81

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKYNFEGRYDLV+FIK+ Q+AGLYV+LRIGPY+C EWNFGGFP+WLKYVPG+EFRT+
Sbjct  82    PSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRTN  141

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAM+GFV KIVNMMKSE LFESQGGPIIM+QIENEYGPVEWEIGAPGKAYTKWA 
Sbjct  142   NQPFKVAMRGFVQKIVNMMKSENLFESQGGPIIMAQIENEYGPVEWEIGAPGKAYTKWAA  201

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGLKTGVPWIMCKQEDAPDP+IDTCNG+YCE F PNKPYKPKM+TE+WTGWYT+FGG
Sbjct  202   QMAVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWYTKFGG  261

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             P+ +RPAEDIAFSVARF+QNNGSF NYYMYHGGTNFGRT++ LFIATSYDYDAPLDEYGL
Sbjct  262   PIPQRPAEDIAFSVARFVQNNGSFFNYYMYHGGTNFGRTSSGLFIATSYDYDAPLDEYGL  321

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPALVSSY  VT  G NQE HV+RS++GAC AFLSNYD ++
Sbjct  322   LNEPKYGHLRDLHKAIKLSEPALVSSYAAVTSLGSNQEAHVYRSKSGACAAFLSNYDSRY  381

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S KVTF N  Y+LPPWSISILPDCK  VYNTA V S S   KM P G G SWQSY EE  
Sbjct  382   SVKVTFQNRPYNLPPWSISILPDCKTAVYNTAQVNSQSSSIKMTPAGGGLSWQSYNEETP  441

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD DT+ A+G+WEQ NVTRDSSDYLWYMT VNIA +E FL+NGKDP +TVMSAGH +H
Sbjct  442   TADDSDTLTANGLWEQKNVTRDSSDYLWYMTNVNIASNEGFLKNGKDPYLTVMSAGHVLH  501

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGTVYG L  PKLTY+ +VKLRAGINKISLLSV+VGLPNVG+H++ WNAGVLG
Sbjct  502   VFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGINKISLLSVSVGLPNVGVHYDTWNAGVLG  561

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEG+R+L  Q W YKV
Sbjct  562   PVTLSGLNEGSRNLAKQKWSYKV  584


 Score =   158 bits (399),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW  G L+A  QPLTWYKATF+AP GNDPLALDM+SMGKG
Sbjct  583   KVGLKGESLSLHSLSGSSSVEWVRGSLVAQKQPLTWYKATFNAPGGNDPLALDMASMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGEGVGRHWPGY AQG C S+C+YAGT+N+KKCQ NCGQPSQ
Sbjct  643   QIWINGEGVGRHWPGYIAQGDC-SKCSYAGTFNEKKCQTNCGQPSQ  687



>ref|XP_009611028.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana tomentosiformis]
Length=837

 Score =   966 bits (2498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/563 (79%), Positives = 500/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD R+ IINGKRRILISGSIHYPRSTP+MWP L+QKAKDGGLD+I+TYVFWNGHE
Sbjct  23    RATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDIIETYVFWNGHE  82

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
              SPGK+ FEGRYDLVKFIKL Q+AGLY++LRIGPYICGEWNFGGFP+WLKYVPG+EFR D
Sbjct  83    LSPGKFKFEGRYDLVKFIKLVQQAGLYINLRIGPYICGEWNFGGFPVWLKYVPGMEFRAD  142

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK+AMQGFV +IVNMMKSE LFE QGGPII++QIENEYGP+EWE+G+PGKAYTKWA 
Sbjct  143   NHPFKLAMQGFVQRIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAA  202

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAV L  GVPWIMCKQEDAPDP+IDTCNG+YCE+F PNKPYKPKM+TE+WT WYT+FGG
Sbjct  203   EMAVSLDIGVPWIMCKQEDAPDPVIDTCNGFYCEDFSPNKPYKPKMWTEVWTAWYTKFGG  262

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AFSVARFIQNNGSF NYYMYHGGTNFGRT +ALFIATSYDYDAPLDEYGL
Sbjct  263   PVPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGL  322

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPALVSSYP V W GKNQE HVFRS++G C AFLSNYD ++
Sbjct  323   LNEPKYGHLRDLHKAIKLSEPALVSSYPTVNWLGKNQEAHVFRSKSGDCSAFLSNYDTKY  382

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S KVTF N+QYDLPPWSISILPDCK  VYNTA + S S Q  M PV    SWQSY EE  
Sbjct  383   SVKVTFQNIQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAPVVGSLSWQSYNEETP  442

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++ DT++A+G+ EQIN+TRDSSDYLWYMT+VN+  DE FL+NGKDP +TVMSAGHAMH
Sbjct  443   SAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGSDEGFLKNGKDPFLTVMSAGHAMH  502

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN + SGTVYGGL  PKLTY+ +VKLRAG NKISLLSVAVGLPNVGLHFE WN GVLG
Sbjct  503   VFINGQQSGTVYGGLDNPKLTYSGNVKLRAGTNKISLLSVAVGLPNVGLHFETWNTGVLG  562

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEGTRDLT Q W YKV
Sbjct  563   PVTLSGLNEGTRDLTIQRWSYKV  585


 Score =   175 bits (443),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLS +T +G SSVEW +G LLA  QPLTWYKATFDAPEGNDP+ALDM SMGKG
Sbjct  584   KVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNGEGVGRHWPGY A+G C  ECNYAG Y +KKCQ NCGQPSQ
Sbjct  644   QIWVNGEGVGRHWPGYIAKGHC-GECNYAGDYTEKKCQTNCGQPSQ  688



>ref|XP_009760184.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana sylvestris]
Length=841

 Score =   966 bits (2497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/565 (79%), Positives = 503/565 (89%), Gaps = 2/565 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD R+ IINGKRRILISGSIHYPRSTP+MWPGL+QKAKDGGLD+I+TYVFWNGHE
Sbjct  25    RATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGK+ FEGRYDLVKFIKL Q+AGLYV+LRIGPYICGEWNFGGFP+WLKYVPG+EFR D
Sbjct  85    PSPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRAD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK+AMQGFV KIVNMMKSE LFE QGGPII++QIENEYGP+EWE+G+PGKAYTKWA 
Sbjct  145   NHPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL+ GVPWIMCKQEDAPD +IDTCNG+YCE+F PNKPYKPKM+TE+WT WYT+FGG
Sbjct  205   EMAVGLEIGVPWIMCKQEDAPDHVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AFSVARFIQNNGSF NYYMYHGGTNFGRT +ALFIATSYDYDAPLDEYGL
Sbjct  265   PVPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQE--VHVFRSETGACVAFLSNYDP  1467
             +NEPKYGHLRDLH+AIKL+EPAL+SSYP V W GKNQE   HVFRS++G C AFLSNYD 
Sbjct  325   LNEPKYGHLRDLHKAIKLSEPALISSYPTVNWLGKNQEQQAHVFRSKSGDCAAFLSNYDT  384

Query  1468  QFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEE  1647
             ++S KVTF  +QYDL PWSISILP CK  VYNTA + S   Q  M PV    SWQSY+EE
Sbjct  385   KYSVKVTFQTMQYDLSPWSISILPYCKTAVYNTARISSQCSQMMMAPVVGSLSWQSYSEE  444

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               S+++ DT++A+G+ EQIN+TRDSSDYLWYMT+VN+ PDE FL+NGKDP +TVMSAGHA
Sbjct  445   TPSAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHA  504

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             MHVFIN +LSGTVYGGL  PKLTY+ +VKLRAGINKISLLSVAVGLPNVGLHFE WN GV
Sbjct  505   MHVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGV  564

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+LSGLN+GTRDLT Q W YKV
Sbjct  565   LGPVTLSGLNDGTRDLTIQRWSYKV  589


 Score =   172 bits (435),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLS +T +G SSVEW +G LLA  QPLTWYKATFDAPEGNDP+ALDM SMGKG
Sbjct  588   KVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNGEGVGR WPGY A+G C  ECNYAG Y +KKCQ NCGQPSQ
Sbjct  648   QIWVNGEGVGRQWPGYIAKGHC-GECNYAGEYTEKKCQTNCGQPSQ  692



>ref|XP_009611026.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana tomentosiformis]
Length=839

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/565 (79%), Positives = 500/565 (88%), Gaps = 2/565 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD R+ IINGKRRILISGSIHYPRSTP+MWP L+QKAKDGGLD+I+TYVFWNGHE
Sbjct  23    RATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDIIETYVFWNGHE  82

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
              SPGK+ FEGRYDLVKFIKL Q+AGLY++LRIGPYICGEWNFGGFP+WLKYVPG+EFR D
Sbjct  83    LSPGKFKFEGRYDLVKFIKLVQQAGLYINLRIGPYICGEWNFGGFPVWLKYVPGMEFRAD  142

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK+AMQGFV +IVNMMKSE LFE QGGPII++QIENEYGP+EWE+G+PGKAYTKWA 
Sbjct  143   NHPFKLAMQGFVQRIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAA  202

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAV L  GVPWIMCKQEDAPDP+IDTCNG+YCE+F PNKPYKPKM+TE+WT WYT+FGG
Sbjct  203   EMAVSLDIGVPWIMCKQEDAPDPVIDTCNGFYCEDFSPNKPYKPKMWTEVWTAWYTKFGG  262

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AFSVARFIQNNGSF NYYMYHGGTNFGRT +ALFIATSYDYDAPLDEYGL
Sbjct  263   PVPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGL  322

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQE--VHVFRSETGACVAFLSNYDP  1467
             +NEPKYGHLRDLH+AIKL+EPALVSSYP V W GKNQE   HVFRS++G C AFLSNYD 
Sbjct  323   LNEPKYGHLRDLHKAIKLSEPALVSSYPTVNWLGKNQEQQAHVFRSKSGDCSAFLSNYDT  382

Query  1468  QFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEE  1647
             ++S KVTF N+QYDLPPWSISILPDCK  VYNTA + S S Q  M PV    SWQSY EE
Sbjct  383   KYSVKVTFQNIQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAPVVGSLSWQSYNEE  442

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               S+++ DT++A+G+ EQIN+TRDSSDYLWYMT+VN+  DE FL+NGKDP +TVMSAGHA
Sbjct  443   TPSAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGSDEGFLKNGKDPFLTVMSAGHA  502

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             MHVFIN + SGTVYGGL  PKLTY+ +VKLRAG NKISLLSVAVGLPNVGLHFE WN GV
Sbjct  503   MHVFINGQQSGTVYGGLDNPKLTYSGNVKLRAGTNKISLLSVAVGLPNVGLHFETWNTGV  562

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+LSGLNEGTRDLT Q W YKV
Sbjct  563   LGPVTLSGLNEGTRDLTIQRWSYKV  587


 Score =   175 bits (444),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLS +T +G SSVEW +G LLA  QPLTWYKATFDAPEGNDP+ALDM SMGKG
Sbjct  586   KVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNGEGVGRHWPGY A+G C  ECNYAG Y +KKCQ NCGQPSQ
Sbjct  646   QIWVNGEGVGRHWPGYIAKGHC-GECNYAGDYTEKKCQTNCGQPSQ  690



>dbj|BAC10578.2| beta-galactosidase [Capsicum annuum]
Length=724

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/563 (78%), Positives = 500/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD R+ +INGKR+ILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWNGHE
Sbjct  22    KANVSYDDRAIVINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHE  81

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKYNFEGRYDLVKFIKL Q AGLYV+LRIGPYIC EWNFGG P+WLKYV G+EFRTD
Sbjct  82    PSPGKYNFEGRYDLVKFIKLVQGAGLYVNLRIGPYICAEWNFGGLPVWLKYVSGMEFRTD  141

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQGFV KIV+MMKSEKLFE QGGPIIM+QIENEYGPVEWEIGAPGKAYTKWA 
Sbjct  142   NQPFKVAMQGFVQKIVSMMKSEKLFEPQGGPIIMAQIENEYGPVEWEIGAPGKAYTKWAA  201

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGLKT VPWIMCKQEDAPDP+IDTCNG+YCE F PNKPYKPKM+TE+WTGW+T+FGG
Sbjct  202   QMAVGLKTDVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWFTKFGG  261

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             P+ +RPAEDIAFSVARF+QNNGS+ NYYMYHGGTNFGRT++ LFIATSYDYDAP+DEYGL
Sbjct  262   PIPQRPAEDIAFSVARFVQNNGSYFNYYMYHGGTNFGRTSSGLFIATSYDYDAPIDEYGL  321

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLR+LH+AIK  EPALVSSYP VT  G NQE HV+RS++GAC AFLSNYD ++
Sbjct  322   LNEPKYGHLRELHKAIKQCEPALVSSYPTVTSLGSNQEAHVYRSKSGACAAFLSNYDAKY  381

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S +V+F NL YDLPPWSISILPDCK VVYNTA V S     KM P G G SWQSY E+  
Sbjct  382   SVRVSFQNLPYDLPPWSISILPDCKTVVYNTAKVSSQGSSIKMTPAGGGLSWQSYNEDTP  441

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD DT+ A+G+WEQ NVTRDSSDYLWYMT++NIA +E FL++GKDP +TVMSAGH +H
Sbjct  442   TADDSDTLRANGLWEQRNVTRDSSDYLWYMTDINIASNEGFLKSGKDPYLTVMSAGHVLH  501

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GTVYG L  PKLTY+ +VKL AGINKISLLSV+VGLPNVG+H++ WNAGVLG
Sbjct  502   VFVNGKLAGTVYGALDNPKLTYSGNVKLNAGINKISLLSVSVGLPNVGVHYDTWNAGVLG  561

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEG+RDL  Q W YKV
Sbjct  562   PVTLSGLNEGSRDLAKQKWSYKV  584


 Score =   174 bits (441),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T++GSSSVEW  G L+A  QPLTWYKATF AP GN+PLALDM+SMGKG
Sbjct  583   KVGLKGESLSLHTLSGSSSVEWVQGSLVARTQPLTWYKATFSAPGGNEPLALDMASMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGEGVGRHWPGY AQG C S+C+YAGT+N+KKCQ NCGQPSQ
Sbjct  643   QIWINGEGVGRHWPGYAAQGDC-SKCSYAGTFNEKKCQTNCGQPSQ  687



>gb|ADV41669.1| beta-D-galactosidase [Actinidia deliciosa var. deliciosa]
Length=728

 Score =   958 bits (2476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/563 (79%), Positives = 499/563 (89%), Gaps = 2/563 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YDG++  ING+RRIL SGSIHYPRSTP+MWPGL+QKAK+GGLDVIQTYVFWNGHEP
Sbjct  27    ASVTYDGKAIKINGQRRILFSGSIHYPRSTPEMWPGLIQKAKEGGLDVIQTYVFWNGHEP  86

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+Y FEGRYDLV+FIKLAQ+AGLYVHLRIG Y+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  87    SPGQYYFEGRYDLVRFIKLAQQAGLYVHLRIGLYVCAEWNFGGFPVWLKYVPGIAFRTDN  146

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIVN+MKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA +
Sbjct  147   GPFKAAMQKFTEKIVNLMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAAE  206

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQEDAPDPIIDTCNG+YCE F PNK YKPKM+TE WTGWYT+FGGP
Sbjct  207   MAVGLDTGVPWIMCKQEDAPDPIIDTCNGFYCEGFTPNKNYKPKMWTEAWTGWYTEFGGP  266

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             +H RP ED+A+SVARFIQNNGSFVNYYMYHGGTNFGRTAA LF+ATSYDYDAP+DEYGL 
Sbjct  267   IHNRPVEDLAYSVARFIQNNGSFVNYYMYHGGTNFGRTAAGLFVATSYDYDAPIDEYGLP  326

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHLRDLH+AIKL EP+LVS+YP VTW GKN EVHVF+S++ +C AFL+NYDP   
Sbjct  327   REPKWGHLRDLHKAIKLCEPSLVSAYPTVTWPGKNLEVHVFKSKS-SCAAFLANYDPSSP  385

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPV-GNGFSWQSYTEEIA  1653
             AKVTF N+QYDLPPWSISILPDCKN V+NTA V S S Q KM PV G  FSWQSY EE  
Sbjct  386   AKVTFQNMQYDLPPWSISILPDCKNAVFNTARVSSKSSQMKMTPVSGGAFSWQSYIEETV  445

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+DD DT+A +G+WEQI++TRD SDYLWY+T+VNI P+E FL+NG+ PV+TVMSAGHA+H
Sbjct  446   SADDSDTIAKNGLWEQISITRDGSDYLWYLTDVNIHPNEGFLKNGQSPVLTVMSAGHALH  505

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +L+GTVYG L  PKLT++N+VKLRAGINKISLLS AVGLPNVGLHFE WN GVLG
Sbjct  506   VFINGQLAGTVYGSLENPKLTFSNNVKLRAGINKISLLSAAVGLPNVGLHFETWNTGVLG  565

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRDLT Q W YKV
Sbjct  566   PVTLKGLNEGTRDLTKQKWSYKV  588


 Score =   157 bits (397),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE LSL+T++GSSSVEW  G LLA  QPLTWYKATF+APEGNDPLALDM++MGKG
Sbjct  587   KVGLKGEDLSLHTLSGSSSVEWVQGSLLAQKQPLTWYKATFNAPEGNDPLALDMNTMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGE +GRHWP Y A G+C   C+YAG Y +KKC  NCG+ SQ
Sbjct  647   QIWINGESIGRHWPEYKASGNCGG-CSYAGIYTEKKCLSNCGEASQ  691



>gb|AAK40304.1| beta-galactosidase [Capsicum annuum]
Length=724

 Score =   958 bits (2476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/563 (78%), Positives = 500/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD R+ +INGKR+ILISGSIHYPRSTPQMWP L++KAKDGGLDVI+TYVFWNGHE
Sbjct  22    KANVSYDDRAIVINGKRKILISGSIHYPRSTPQMWPDLIEKAKDGGLDVIETYVFWNGHE  81

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKYNFEGRYDLVKFIKL Q AGLYV+LRIGPYIC EWNFGG P+WLKYV G+EFRTD
Sbjct  82    PSPGKYNFEGRYDLVKFIKLVQGAGLYVNLRIGPYICAEWNFGGLPVWLKYVSGMEFRTD  141

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQGFV KIV+MMKSEKLFE QGGPIIM+QIENEYGPVEWEIGAPGKAYTKWA 
Sbjct  142   NQPFKVAMQGFVQKIVSMMKSEKLFEPQGGPIIMAQIENEYGPVEWEIGAPGKAYTKWAA  201

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGLKT VPWIMCKQEDAPDP+IDTCNG+YCE F PNKPYKPKM+TE+WTGW+T+FGG
Sbjct  202   QMAVGLKTDVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWTEVWTGWFTKFGG  261

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             P+ +RPAEDIAFSVARF+QNNGS+ NYYMYHGGTNFGRT++ LFIATSYDYDAP+DEYGL
Sbjct  262   PIPQRPAEDIAFSVARFVQNNGSYFNYYMYHGGTNFGRTSSGLFIATSYDYDAPIDEYGL  321

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLR+LH+AIK  EPALVSSYP VT  G NQE HV+RS++GAC AFLSNYD ++
Sbjct  322   LNEPKYGHLRELHKAIKQCEPALVSSYPTVTSLGSNQEAHVYRSKSGACAAFLSNYDAKY  381

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S +V+F NL YDLPPWSISILPDCK VVYNTA V S     KM P G G SWQSY E+  
Sbjct  382   SVRVSFQNLPYDLPPWSISILPDCKTVVYNTAKVSSQGSSIKMTPAGGGLSWQSYNEDTP  441

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD DT+ A+G+WEQ NVTRDSSDYLWYMT+VNIA +E FL++GKDP +TVMSAGH +H
Sbjct  442   TADDSDTLRANGLWEQRNVTRDSSDYLWYMTDVNIASNEGFLKSGKDPYLTVMSAGHVLH  501

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GTVYG L  PKLTY+ +VKL AGINKISLLSV+VGLPNVG+H++ WNAGVLG
Sbjct  502   VFVNGKLAGTVYGALDNPKLTYSGNVKLNAGINKISLLSVSVGLPNVGVHYDTWNAGVLG  561

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEG+RDL  Q W YKV
Sbjct  562   PVTLSGLNEGSRDLAKQKWSYKV  584


 Score =   174 bits (441),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T++GSSSVEW  G L+A  QPLTWYKATF AP GN+PLALDM+SMGKG
Sbjct  583   KVGLKGESLSLHTLSGSSSVEWVQGSLVARTQPLTWYKATFSAPGGNEPLALDMASMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGEGVGRHWPGY AQG C S+C+YAGT+N+KKCQ NCGQPSQ
Sbjct  643   QIWINGEGVGRHWPGYAAQGDC-SKCSYAGTFNEKKCQTNCGQPSQ  687



>ref|XP_011093727.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=730

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/563 (79%), Positives = 493/563 (88%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R  VSYD ++FIINGKRRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  28    RADVSYDDKAFIINGKRRILVSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  87

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKYNFEGR+DLVKFIKL  ++GLYVHLRIGPY+C EWNFGGFP+WLKYVPGIEFRTD
Sbjct  88    PSPGKYNFEGRFDLVKFIKLVHQSGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIEFRTD  147

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQ FV KIV+MMKSE LFE QGGPIIMSQIENEYGPVEWE+GA GKAYT WA 
Sbjct  148   NQPFKVAMQRFVQKIVDMMKSESLFEPQGGPIIMSQIENEYGPVEWELGAAGKAYTAWAA  207

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+ APDPIIDTCNG+YCE F PNKPYKPKM+TE W+GWYTQFGG
Sbjct  208   KMAVGLDTGVPWIMCKQDTAPDPIIDTCNGFYCEGFRPNKPYKPKMWTEAWSGWYTQFGG  267

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AFSVARF+QNNGSF NYYMYHGGTNFGR AA LF+ATSYDYDAP+DEYGL
Sbjct  268   PVPHRPAEDLAFSVARFVQNNGSFFNYYMYHGGTNFGRNAAGLFVATSYDYDAPIDEYGL  327

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIK +E ALVSSYP VTW GKNQEVHVFRS++GAC AFLSNYD  +
Sbjct  328   LNEPKWGHLRDLHKAIKQSEAALVSSYPTVTWPGKNQEVHVFRSKSGACAAFLSNYDRTY  387

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
               K+TF N+QYDLPPWSISILPDCK  VYNTA + S S Q KM+P+    SWQSY E+  
Sbjct  388   PTKLTFRNIQYDLPPWSISILPDCKTEVYNTARISSMSSQAKMVPISGDLSWQSYNEQTP  447

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+DD DT+A DG+WEQINVTRDSSDYLWY+TEV IA DE FL++G+ P++TVMSAGHA+H
Sbjct  448   SADDSDTLAMDGLWEQINVTRDSSDYLWYLTEVGIASDEGFLKSGQWPLLTVMSAGHALH  507

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN  LSGTVYG L   KLTY  +V LRAGINKISLLSVAVGLPN G+H+E+WN GVLG
Sbjct  508   VFINGLLSGTVYGSLDSTKLTYGGNVDLRAGINKISLLSVAVGLPNAGMHYERWNTGVLG  567

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRDLT Q W YK 
Sbjct  568   PVTLQGLNEGTRDLTKQRWSYKA  590


 Score =   169 bits (429),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +2

Query  2162  GMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKGEI  2341
             G+KGESLSL+TV+GSSSVEW +G LLA  QPLTWYK TFDAPEG+DPLA+DM SMGKGEI
Sbjct  591   GLKGESLSLDTVSGSSSVEWIEGLLLAQKQPLTWYKTTFDAPEGSDPLAIDMISMGKGEI  650

Query  2342  WVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             W+NG+ +GRHWPGY A+GSC  ECNYAGT+++KKCQ  C QPSQ
Sbjct  651   WINGQSIGRHWPGYKAKGSC-GECNYAGTFSEKKCQRGCDQPSQ  693



>gb|EYU45189.1| hypothetical protein MIMGU_mgv1a003101mg [Erythranthe guttata]
Length=608

 Score =   954 bits (2467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/563 (77%), Positives = 501/563 (89%), Gaps = 0/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD ++FIING+R+ILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  21    RATVSYDDKAFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  80

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG YNFEGR+DLVKFIKLA +AGLYVHLRIGPY+CGEWNFGGFP+WLKYVPGIEFRTD
Sbjct  81    PSPGNYNFEGRFDLVKFIKLAHQAGLYVHLRIGPYVCGEWNFGGFPVWLKYVPGIEFRTD  140

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFKVAMQ FV KIVN+MKSE LFE +GGPIIMSQIENEYGP+EWEIGAPGKAY+ WA 
Sbjct  141   NQPFKVAMQRFVEKIVNLMKSENLFEPRGGPIIMSQIENEYGPIEWEIGAPGKAYSAWAA  200

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQE APDP+IDTCNG+YCE F PN+P KPKM+TE WTGWYTQFGG
Sbjct  201   KMAVGLDTGVPWIMCKQETAPDPMIDTCNGFYCEGFTPNRPNKPKMWTEAWTGWYTQFGG  260

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AFSVARF+QNNGSF NYYMYHGGTNFGR AA LF+ATSYDYDAP+DEYGL
Sbjct  261   PVPYRPAEDLAFSVARFVQNNGSFFNYYMYHGGTNFGRNAAGLFVATSYDYDAPIDEYGL  320

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIK +E ALVSSYP VTW GKNQEVHVF+S++GAC AFLSN+D  +
Sbjct  321   LNEPKWGHLRDLHKAIKQSEAALVSSYPTVTWPGKNQEVHVFQSKSGACAAFLSNFDTTY  380

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S K+TF N+QYDLPPWSISILPDCK  VYNTAT+ S   + KM+P+ +G +W+SY E+  
Sbjct  381   STKLTFRNMQYDLPPWSISILPDCKTAVYNTATINSKGSEAKMVPISSGLNWESYNEQTP  440

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+DDGDT+A  G+WEQ+NVTRDSSDYLWY+T++NIA +E FL++G+ P++TVMSAG  +H
Sbjct  441   SADDGDTLAMQGLWEQVNVTRDSSDYLWYLTDINIASNEGFLKSGQWPLLTVMSAGDTLH  500

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN + SGTVYG L  PKLTY+  V LRAGINK+SLLSV+VGLPNVG+H+E+WN GVLG
Sbjct  501   VFINGQFSGTVYGSLDKPKLTYSKYVNLRAGINKVSLLSVSVGLPNVGVHYERWNTGVLG  560

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             P++L G+NEGTRDLT Q WFYKV
Sbjct  561   PITLKGVNEGTRDLTKQRWFYKV  583



>gb|AHG94613.1| beta-galactosidase [Camellia sinensis]
Length=725

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/562 (77%), Positives = 484/562 (86%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYDGR+ IING+RRILISGSIHYPRSTP+MWPGL++KAKDGGLDVIQTYVFWNGHEP
Sbjct  25    ASVSYDGRAIIINGQRRILISGSIHYPRSTPEMWPGLIRKAKDGGLDVIQTYVFWNGHEP  84

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               G+YNF GRYDLV+FIK+ Q+AGLYVHLRIGPYIC EWNFGGFP+WLKYVPGI FRTDN
Sbjct  85    IQGQYNFAGRYDLVQFIKVVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDN  144

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIV MMKSE LF++QGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA Q
Sbjct  145   GPFKAAMQKFTEKIVTMMKSENLFQTQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAAQ  204

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDP+IDTCNG+YCE F PNK YKPKMFTE WTGWYTQFGG 
Sbjct  205   MAVGLNTGVPWVMCKQEDAPDPVIDTCNGFYCEGFKPNKDYKPKMFTENWTGWYTQFGGA  264

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED+AFSVARFIQNNGSF+NYYMYHGGTNFGRTAA LFIATSYDYDAP+DEYGL+
Sbjct  265   VPYRPVEDLAFSVARFIQNNGSFMNYYMYHGGTNFGRTAAGLFIATSYDYDAPIDEYGLL  324

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHL +LH+AIK  EPALVSSYP VTW G N EVHVF++ + AC AFL+NYD    
Sbjct  325   REPKWGHLTNLHKAIKQCEPALVSSYPTVTWPGNNLEVHVFKTRS-ACAAFLANYDTNSP  383

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A VTF N QY LPPWS+SILPDCKN ++NTA + + S Q KM P   GFSWQS TE+  S
Sbjct  384   ATVTFQNAQYYLPPWSVSILPDCKNAIFNTAKITASSYQPKMTPASGGFSWQSSTEQTVS  443

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +DD DT+A  G+ EQI+VTRD+SDYLWY+T VNI P E FL+NG+ P +T+MSAGHA+HV
Sbjct  444   ADDSDTIAKAGLLEQISVTRDTSDYLWYLTNVNIQPGEGFLKNGQYPTLTIMSAGHALHV  503

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTV+G L  PKLTY+++VKLRAGINKISLLSVAVGLPNVG+H++ WN GVLGP
Sbjct  504   FINGQLSGTVFGSLENPKLTYSSTVKLRAGINKISLLSVAVGLPNVGVHYDTWNTGVLGP  563

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDLT Q W YKV
Sbjct  564   VTLKGLNEGTRDLTKQQWSYKV  585


 Score =   162 bits (409),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE L L+T+ GSSSVEW +G LLA+ QPLTWYK TF+AP GNDPLALDM++MGKG
Sbjct  584   KVGLKGEGLKLHTLDGSSSVEWAEGSLLATKQPLTWYKTTFNAPAGNDPLALDMNTMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             E+WVNG+ +GRHWPGY A G+C + C+YAGT+ +KKC+ NCGQ SQ
Sbjct  644   EVWVNGQSIGRHWPGYKANGNCGA-CSYAGTFTEKKCRFNCGQSSQ  688



>gb|EYU28411.1| hypothetical protein MIMGU_mgv1a024117mg [Erythranthe guttata]
Length=723

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/563 (76%), Positives = 487/563 (87%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +V+YD ++ IING RRILISGSIHYPRSTP+MWP ++Q AK+GGLDVIQTYVFW+GHE
Sbjct  21    RAAVTYDDKAIIINGNRRILISGSIHYPRSTPEMWPDIIQTAKNGGLDVIQTYVFWDGHE  80

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG YNFEGR+D++KFIKL Q+AGLYV+LRIGPY C EWNFGGFP+WLKYVPGIEFRTD
Sbjct  81    PSPGTYNFEGRFDIIKFIKLVQQAGLYVNLRIGPYACAEWNFGGFPVWLKYVPGIEFRTD  140

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPFK AMQGFV KIV+MMKSE LFE QGGPIIMSQIENEYGP+EWEIGAPGKAY+ WA 
Sbjct  141   NQPFKAAMQGFVEKIVSMMKSENLFEPQGGPIIMSQIENEYGPIEWEIGAPGKAYSAWAA  200

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL  GVPWIMCKQE APDP+IDTCNG+YCE F PNKPYKPKM+TE+W+GWYTQFGG
Sbjct  201   KMAVGLDIGVPWIMCKQETAPDPMIDTCNGFYCEGFTPNKPYKPKMWTEVWSGWYTQFGG  260

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              +  RPAED+AFSVARF+QNNGSF NYYMYHGGTNFGRT+   FIATSY++DAPLDEYGL
Sbjct  261   AIPYRPAEDLAFSVARFVQNNGSFFNYYMYHGGTNFGRTSGR-FIATSYNFDAPLDEYGL  319

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
              NEPK+ HL +LH+AIK  EPALVSSYPIVTW G NQEVHVF+S++GAC AFLSNYDP F
Sbjct  320   PNEPKWSHLTNLHKAIKQCEPALVSSYPIVTWPGNNQEVHVFKSQSGACAAFLSNYDPTF  379

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +AK+TF N++YDLPPWSISILPDCK  VYNTA +     + KM  V +GFSWQSYTE   
Sbjct  380   AAKLTFQNMEYDLPPWSISILPDCKTEVYNTAKISFKGSKAKMTTVSSGFSWQSYTENTP  439

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+DD DT+A   +WEQ+NVTRDSSDYLWY+T+V IA DE FL++G+ P++T MSAGH +H
Sbjct  440   SADDKDTLAMQNLWEQVNVTRDSSDYLWYLTQVEIASDEGFLKSGEWPLLTAMSAGHVLH  499

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN  LSGTVYG L  PKLTY   V LRAGINKISLLSVAVGLPNVGLH+E WNAGVLG
Sbjct  500   VFINGRLSGTVYGSLDNPKLTYNGKVNLRAGINKISLLSVAVGLPNVGLHYETWNAGVLG  559

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLNEGT DLT QTW YKV
Sbjct  560   PVTLSGLNEGTADLTKQTWTYKV  582


 Score =   153 bits (387),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGESL L+++ GSSSV+W +G LLA   PLTWYK  FDAP GND L +DM  M KG
Sbjct  581   KVGTKGESLKLDSIAGSSSVQWVEGSLLAKKTPLTWYKTRFDAPTGNDSLGIDMLGMTKG  640

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIW+NGE +GRHWPGYT +G C+ +CNYAGT+ + KC   CGQPSQ
Sbjct  641   EIWINGESIGRHWPGYTVKGKCNDDCNYAGTFTETKCLTGCGQPSQ  686



>ref|XP_011045966.1| PREDICTED: beta-galactosidase-like isoform X2 [Populus euphratica]
Length=838

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/561 (76%), Positives = 486/561 (87%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING+RRILISGSIHYPRSTP+MWP L+QKAKDGG+DVIQTYVFWNGHEPS
Sbjct  27    SVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYVFWNGHEPS  86

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG Y FE RYDLVKFIKL Q+AGLY+HLRIGPYIC EWNFGGFP+WLKYVPGIEFRTDN 
Sbjct  87    PGNYYFEDRYDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGIEFRTDNG  146

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV MMKSEKLFE+QGGPII+SQIENEYGPVEWEIGAPGKAYTKWA  M
Sbjct  147   PFKAAMQKFTEKIVGMMKSEKLFENQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAADM  206

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV L TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPK++TE WTGWYT+FGG V
Sbjct  207   AVKLGTGVPWIMCKQEDAPDPMIDTCNGFYCENFKPNKDYKPKIWTEAWTGWYTEFGGAV  266

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQN GS++NYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL  
Sbjct  267   PHRPAEDMAFSVARFIQNGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLPR  326

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIKL EPALVS  P VT  G NQEVHVF+S++  C AFL+NYD ++S 
Sbjct  327   EPKWGHLRDLHKAIKLCEPALVSVDPTVTSLGSNQEVHVFKSKS-VCAAFLANYDTKYSV  385

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KVTF N QY+LPPWSISILPDCK VVYNTA + S S Q KM+P  + FSWQSY EE AS+
Sbjct  386   KVTFGNGQYELPPWSISILPDCKTVVYNTARLGSQSSQMKMVPASSSFSWQSYNEETASA  445

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             DD DT   +G+WEQINVTRD++DYLWY+T+V I  DE FL++G++P++T+ SAGHA+HVF
Sbjct  446   DDDDTTTMNGLWEQINVTRDATDYLWYLTDVKIDADEGFLKSGQNPLLTIFSAGHALHVF  505

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +L+GT YGGL+ PKLT++ ++KL  GINKISLLSVAVGLPNVGLHFE WNAGVLGPV
Sbjct  506   INGQLAGTAYGGLSNPKLTFSQNIKLTEGINKISLLSVAVGLPNVGLHFETWNAGVLGPV  565

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEGTRDL+ Q W YK+
Sbjct  566   TLKGLNEGTRDLSGQKWSYKI  586


 Score =   162 bits (409),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESL L+T +GS SVEW +G LLA  Q LTWYK  FDAP GNDPLALDMSSMGKG
Sbjct  585   KIGLKGESLGLHTASGSESVEWVEGSLLAQKQALTWYKTAFDAPPGNDPLALDMSSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWPGY A GSC  +CNYAGT++ KKC+ NCG+PSQ
Sbjct  645   QMWINGQNIGRHWPGYIAHGSC-GDCNYAGTFDDKKCRTNCGEPSQ  689



>emb|CBI27912.3| unnamed protein product [Vitis vinifera]
Length=833

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/561 (76%), Positives = 489/561 (87%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD RSFIING+R+ILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  22    SVTYDKRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  81

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FEGRYDLV+FIK+ Q AGLYVHLRIGPYIC EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  82    RGKYYFEGRYDLVRFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDNG  141

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFKVAMQGF  KIV+MMKSEKLF+ QGGPIIMSQIENEYGPVE+EIGAPGKAYTKWA +M
Sbjct  142   PFKVAMQGFTQKIVDMMKSEKLFQPQGGPIIMSQIENEYGPVEYEIGAPGKAYTKWAAEM  201

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV L TGVPW+MCKQEDAPDP+ID CNG+YCENF PNK YKPKMFTE WTGWYT+FGG +
Sbjct  202   AVQLGTGVPWVMCKQEDAPDPVIDACNGFYCENFFPNKDYKPKMFTEAWTGWYTEFGGAI  261

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+A+SVARFIQN GSF+NYYMYHGGTNFGRTA   FI+TSYDYDAP+DEYGL +
Sbjct  262   PNRPAEDLAYSVARFIQNRGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEYGLPS  321

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIKL EPALVS+ P VT+ G N E HV+++++GAC AFL+NYDP+ SA
Sbjct  322   EPKWGHLRDLHKAIKLCEPALVSADPTVTYLGTNLEAHVYKAKSGACAAFLANYDPKSSA  381

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KVTF N QYDLPPWS+SILPDCKNVV+NTA + + S Q KM PV   FSWQSY EE AS+
Sbjct  382   KVTFGNTQYDLPPWSVSILPDCKNVVFNTARIGAQSSQMKMNPVST-FSWQSYNEETASA  440

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                DT   DG+ EQIN+TRD++DYLWYMTEV+I PDE FL+ G+ PV+TVMSAGHA+HVF
Sbjct  441   YTEDTTTMDGLLEQINITRDTTDYLWYMTEVHIKPDEGFLKTGQYPVLTVMSAGHALHVF  500

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L+ PK+T++++VKL  G NKISLLSVA+GLPNVGLHFE WNAGVLGPV
Sbjct  501   INGQLSGTVYGELSNPKVTFSDNVKLTVGTNKISLLSVAMGLPNVGLHFETWNAGVLGPV  560

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEGT D+++  W YK+
Sbjct  561   TLKGLNEGTVDMSSWKWSYKI  581


 Score =   161 bits (407),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L  +TGSSS EW +G LLA  QPLTWYK TF+AP GNDPLALDMSSMGKG
Sbjct  580   KIGLKGEALNLQAITGSSSDEWVEGSLLAQKQPLTWYKTTFNAPGGNDPLALDMSSMGKG  639

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGE +GRHWP YTA G+C+  CNYAG +N KKCQ  CG PSQ
Sbjct  640   QIWINGESIGRHWPAYTAHGNCNG-CNYAGIFNDKKCQTGCGGPSQ  684



>ref|XP_002308268.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
 gb|EEE91791.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
Length=837

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/561 (76%), Positives = 484/561 (86%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING+RRILISGSIHYPRSTP+MWP L+QKAKDGG+DVIQTYVFWNGHEPS
Sbjct  26    SVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYVFWNGHEPS  85

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG Y FE RYDLVKFIKL Q+AGLY+HLRIGPYIC EWNFGGFP+WLKYVPGIEFRTDN 
Sbjct  86    PGNYYFEDRYDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGIEFRTDNG  145

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV MMKSEKLFE+QGGPII+SQIENEYGPVEWEIGAPGKAYTKWA  M
Sbjct  146   PFKAAMQKFTEKIVGMMKSEKLFENQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAADM  205

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV L TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPK++TE WTGWYT+FGG V
Sbjct  206   AVKLGTGVPWIMCKQEDAPDPMIDTCNGFYCENFKPNKDYKPKIWTEAWTGWYTEFGGAV  265

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQN GS++NYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL  
Sbjct  266   PHRPAEDMAFSVARFIQNGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLPR  325

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIKL EPALVS  P VT  G NQE HVF+S++  C AFL+NYD ++S 
Sbjct  326   EPKWGHLRDLHKAIKLCEPALVSVDPTVTSLGSNQEAHVFKSKS-VCAAFLANYDTKYSV  384

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KVTF N QY+LPPWS+SILPDCK  VYNTA + S S Q KM+P  + FSWQSY EE AS+
Sbjct  385   KVTFGNGQYELPPWSVSILPDCKTAVYNTARLGSQSSQMKMVPASSSFSWQSYNEETASA  444

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             DD DT   +G+WEQINVTRD++DYLWY+T+V I  DE FL++G++P++T+ SAGHA+HVF
Sbjct  445   DDDDTTTMNGLWEQINVTRDATDYLWYLTDVKIDADEGFLKSGQNPLLTIFSAGHALHVF  504

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +L+GT YGGL+ PKLT++ ++KL  GINKISLLSVAVGLPNVGLHFE WNAGVLGP+
Sbjct  505   INGQLAGTAYGGLSNPKLTFSQNIKLTEGINKISLLSVAVGLPNVGLHFETWNAGVLGPI  564

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEGTRDL+ Q W YK+
Sbjct  565   TLKGLNEGTRDLSGQKWSYKI  585


 Score =   165 bits (417),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T +GS SVEW +G LLA  Q LTWYK  FDAP+GNDPLALDMSSMGKG
Sbjct  584   KIGLKGESLSLHTASGSESVEWVEGSLLAQKQALTWYKTAFDAPQGNDPLALDMSSMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWPGY A GSC  +CNYAGT++ KKC+ NCG+PSQ
Sbjct  644   QMWINGQNIGRHWPGYIAHGSC-GDCNYAGTFDDKKCRTNCGEPSQ  688



>ref|XP_002282132.1| PREDICTED: beta-galactosidase [Vitis vinifera]
Length=836

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/561 (76%), Positives = 489/561 (87%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD RSFIING+R+ILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  25    SVTYDKRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FEGRYDLV+FIK+ Q AGLYVHLRIGPYIC EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  85    RGKYYFEGRYDLVRFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDNG  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFKVAMQGF  KIV+MMKSEKLF+ QGGPIIMSQIENEYGPVE+EIGAPGKAYTKWA +M
Sbjct  145   PFKVAMQGFTQKIVDMMKSEKLFQPQGGPIIMSQIENEYGPVEYEIGAPGKAYTKWAAEM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV L TGVPW+MCKQEDAPDP+ID CNG+YCENF PNK YKPKMFTE WTGWYT+FGG +
Sbjct  205   AVQLGTGVPWVMCKQEDAPDPVIDACNGFYCENFFPNKDYKPKMFTEAWTGWYTEFGGAI  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+A+SVARFIQN GSF+NYYMYHGGTNFGRTA   FI+TSYDYDAP+DEYGL +
Sbjct  265   PNRPAEDLAYSVARFIQNRGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEYGLPS  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIKL EPALVS+ P VT+ G N E HV+++++GAC AFL+NYDP+ SA
Sbjct  325   EPKWGHLRDLHKAIKLCEPALVSADPTVTYLGTNLEAHVYKAKSGACAAFLANYDPKSSA  384

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KVTF N QYDLPPWS+SILPDCKNVV+NTA + + S Q KM PV   FSWQSY EE AS+
Sbjct  385   KVTFGNTQYDLPPWSVSILPDCKNVVFNTARIGAQSSQMKMNPVST-FSWQSYNEETASA  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                DT   DG+ EQIN+TRD++DYLWYMTEV+I PDE FL+ G+ PV+TVMSAGHA+HVF
Sbjct  444   YTEDTTTMDGLLEQINITRDTTDYLWYMTEVHIKPDEGFLKTGQYPVLTVMSAGHALHVF  503

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L+ PK+T++++VKL  G NKISLLSVA+GLPNVGLHFE WNAGVLGPV
Sbjct  504   INGQLSGTVYGELSNPKVTFSDNVKLTVGTNKISLLSVAMGLPNVGLHFETWNAGVLGPV  563

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEGT D+++  W YK+
Sbjct  564   TLKGLNEGTVDMSSWKWSYKI  584


 Score =   161 bits (407),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L  +TGSSS EW +G LLA  QPLTWYK TF+AP GNDPLALDMSSMGKG
Sbjct  583   KIGLKGEALNLQAITGSSSDEWVEGSLLAQKQPLTWYKTTFNAPGGNDPLALDMSSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGE +GRHWP YTA G+C+  CNYAG +N KKCQ  CG PSQ
Sbjct  643   QIWINGESIGRHWPAYTAHGNCNG-CNYAGIFNDKKCQTGCGGPSQ  687



>gb|KDP33829.1| hypothetical protein JCGZ_07400 [Jatropha curcas]
Length=838

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/561 (76%), Positives = 486/561 (87%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  27    SVSYDHKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  86

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG Y FE RYDLVKFIKL Q+AGLYVHLRIGPYIC EWNFGGFP+WLKYVPGIEFRT+N 
Sbjct  87    PGNYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIEFRTNNG  146

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFKVAMQ F  KIV MMKSEKLFE+QGGPII+SQIENE+GPVEWEIGAPGKAYTKWA +M
Sbjct  147   PFKVAMQKFTEKIVGMMKSEKLFETQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAEM  206

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQEDAPDP+I+TCNG+YCENF PNK YKPKM+TE WTGWYT+FGG V
Sbjct  207   AVGLGTGVPWVMCKQEDAPDPVINTCNGFYCENFKPNKDYKPKMWTENWTGWYTEFGGSV  266

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQN GSF+NYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL  
Sbjct  267   PYRPAEDLAFSVARFIQNGGSFMNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLPR  326

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHLRDLH+AIKL EPALVS  P V   G NQE HVF+S++ AC AFL+NYD ++S 
Sbjct  327   DPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGDNQEAHVFQSKS-ACAAFLANYDTKYSV  385

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KVTF N QYDLPPWSISILPDCK  V+NTA + + S Q KM PVG+GFSWQSY EE AS 
Sbjct  386   KVTFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSTQMKMTPVGSGFSWQSYIEEAASG  445

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                DT   DG+WEQINVTRD++DYLWYMT V I PDE FL+NG+DP++T++SAGH++HVF
Sbjct  446   YTDDTTTLDGLWEQINVTRDATDYLWYMTNVKIDPDEGFLKNGQDPLLTILSAGHSLHVF  505

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +L+GTVYG L  PK+T++ +VKL +GINKISLLSVAVGLPNVG+HFE+WN+GVLGPV
Sbjct  506   INDQLAGTVYGSLDNPKVTFSKNVKLTSGINKISLLSVAVGLPNVGVHFERWNSGVLGPV  565

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEGT+DL+   W YK+
Sbjct  566   TLKGLNEGTKDLSGWKWSYKI  586


 Score =   176 bits (445),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+TVTGSSSVEW +G LLA+ QPLTWYK TFDAPEGNDPLALDMSSMGKG
Sbjct  585   KIGLKGEALNLHTVTGSSSVEWAEGSLLATKQPLTWYKTTFDAPEGNDPLALDMSSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNG+ +GRHWP YTA+GSC  +CNYAGT++ KKC+ NCG+PSQ
Sbjct  645   QIWVNGQSIGRHWPAYTARGSC-GDCNYAGTFDDKKCRRNCGEPSQ  689



>ref|XP_010262131.1| PREDICTED: beta-galactosidase isoform X1 [Nelumbo nucifera]
Length=847

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/561 (76%), Positives = 484/561 (86%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD ++ +INGKRRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  31    SVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  90

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEGRYDLV+FIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDNQ
Sbjct  91    PGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNQ  150

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQGF  KIV+MMK+E+LF+SQGGPII+SQIENEYGPVEWEIGAPG+AYTKWA QM
Sbjct  151   PFKAAMQGFTKKIVDMMKAERLFQSQGGPIILSQIENEYGPVEWEIGAPGRAYTKWAAQM  210

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDP+I+ CNG+YC+ F PNK YKPKM+TE WTGWYT+FGGPV
Sbjct  211   AVGLGTGVPWVMCKQDDAPDPVINACNGFYCDWFTPNKAYKPKMWTEAWTGWYTEFGGPV  270

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVA+FIQ  GSFVNYYMYHGGTNFGRTA   FI+TSYDYDAPLDEYGL+ 
Sbjct  271   PHRPAEDLAFSVAKFIQKGGSFVNYYMYHGGTNFGRTAGGPFISTSYDYDAPLDEYGLLR  330

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPKYGHLRDLH+AIKL EPALVS+ P V   G NQE HVF+S +GAC AFL+NYD +  A
Sbjct  331   EPKYGHLRDLHKAIKLCEPALVSTDPTVISLGNNQEAHVFKSRSGACAAFLANYDSRSYA  390

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              V F N+ Y+LPPWSISILPDCKN V+NTA V + S Q KM PV  GFSWQSY EE AS 
Sbjct  391   TVAFGNMHYNLPPWSISILPDCKNTVFNTARVGAQSSQMKMTPVYRGFSWQSYNEETASY  450

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             DD ++    G+ EQINVTRD+SDYLWYMT+V I P+E FLRNG+ PV+TV+SAGHA+HVF
Sbjct  451   DD-NSFTTVGLLEQINVTRDASDYLWYMTDVKIDPNEAFLRNGQYPVLTVLSAGHALHVF  509

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKLT+++ VKL AGINKISLLS+AVGLPNVG HFE WNAGVLGP+
Sbjct  510   INGQLSGTVYGSLENPKLTFSDKVKLIAGINKISLLSIAVGLPNVGPHFETWNAGVLGPI  569

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEG RDL+ Q W YK+
Sbjct  570   TLKGLNEGQRDLSWQKWSYKI  590


 Score =   127 bits (319),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE++ + +++GSSSVE  +   +A  QP+TWYK TF+AP GN+PLALDM SMGKG
Sbjct  589   KIGLKGETVGIQSLSGSSSVE-WEVSSVAQKQPMTWYKTTFNAPGGNEPLALDMGSMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGE +GR+WP Y A GSC   CNYAGTY++KKC+ NCG+ SQ
Sbjct  648   QIWINGESIGRYWPAYKAYGSCGG-CNYAGTYDEKKCRSNCGEASQ  692



>ref|XP_010262132.1| PREDICTED: beta-galactosidase isoform X2 [Nelumbo nucifera]
Length=842

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/561 (76%), Positives = 484/561 (86%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD ++ +INGKRRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  31    SVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  90

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEGRYDLV+FIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDNQ
Sbjct  91    PGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNQ  150

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQGF  KIV+MMK+E+LF+SQGGPII+SQIENEYGPVEWEIGAPG+AYTKWA QM
Sbjct  151   PFKAAMQGFTKKIVDMMKAERLFQSQGGPIILSQIENEYGPVEWEIGAPGRAYTKWAAQM  210

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDP+I+ CNG+YC+ F PNK YKPKM+TE WTGWYT+FGGPV
Sbjct  211   AVGLGTGVPWVMCKQDDAPDPVINACNGFYCDWFTPNKAYKPKMWTEAWTGWYTEFGGPV  270

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVA+FIQ  GSFVNYYMYHGGTNFGRTA   FI+TSYDYDAPLDEYGL+ 
Sbjct  271   PHRPAEDLAFSVAKFIQKGGSFVNYYMYHGGTNFGRTAGGPFISTSYDYDAPLDEYGLLR  330

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPKYGHLRDLH+AIKL EPALVS+ P V   G NQE HVF+S +GAC AFL+NYD +  A
Sbjct  331   EPKYGHLRDLHKAIKLCEPALVSTDPTVISLGNNQEAHVFKSRSGACAAFLANYDSRSYA  390

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              V F N+ Y+LPPWSISILPDCKN V+NTA V + S Q KM PV  GFSWQSY EE AS 
Sbjct  391   TVAFGNMHYNLPPWSISILPDCKNTVFNTARVGAQSSQMKMTPVYRGFSWQSYNEETASY  450

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             DD ++    G+ EQINVTRD+SDYLWYMT+V I P+E FLRNG+ PV+TV+SAGHA+HVF
Sbjct  451   DD-NSFTTVGLLEQINVTRDASDYLWYMTDVKIDPNEAFLRNGQYPVLTVLSAGHALHVF  509

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKLT+++ VKL AGINKISLLS+AVGLPNVG HFE WNAGVLGP+
Sbjct  510   INGQLSGTVYGSLENPKLTFSDKVKLIAGINKISLLSIAVGLPNVGPHFETWNAGVLGPI  569

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEG RDL+ Q W YK+
Sbjct  570   TLKGLNEGQRDLSWQKWSYKI  590


 Score =   127 bits (319),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE++ + +++GSSSVE  +   +A  QP+TWYK TF+AP GN+PLALDM SMGKG
Sbjct  589   KIGLKGETVGIQSLSGSSSVE-WEVSSVAQKQPMTWYKTTFNAPGGNEPLALDMGSMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGE +GR+WP Y A GSC   CNYAGTY++KKC+ NCG+ SQ
Sbjct  648   QIWINGESIGRYWPAYKAYGSCGG-CNYAGTYDEKKCRSNCGEASQ  692



>gb|KDO57765.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=710

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/675 (65%), Positives = 521/675 (77%), Gaps = 14/675 (2%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLT++ +VKLR G+NKISLLS +VGLPNVG HFEKWNAGVLG
Sbjct  515   VFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFEKWNAGVLG  574

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV*FAQISSQYCIHSF*NCSTISCLFTA---------WY  2166
             PV+L GLNEGTRD++ Q W YK+          +H+    S++     A         WY
Sbjct  575   PVTLKGLNEGTRDISKQKWTYKIGLK--GEALSLHTVSGSSSVEWAQGASLAQKQPMTWY  632

Query  2167  ERRIVK--S*HCNWKLLGRMGRRSTSGFQPTLNLVQGHV*CTRRKRSPSARHEQYGERRN  2340
             + RI+   S H     L  +  +S       + L   +  CT R+R  S RH   G+   
Sbjct  633   KVRIISILSQHILTIFLELIYEQSICINICHILLSADYFQCTARQRPISFRHGCNGKGDG  692

Query  2341  MGKWRRSGAPLAWIH  2385
             + +W    APLAWI+
Sbjct  693   LDQWSEYWAPLAWIY  707



>ref|XP_002514108.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48062.1| beta-galactosidase, putative [Ricinus communis]
Length=840

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/561 (76%), Positives = 479/561 (85%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +VSYD R+  ING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  29    TVSYDHRAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  88

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG Y FE RYDLVKFIK+ Q AGLYVHLRIGPYIC EWNFGGFP+WLKYVPGIEFRTDN 
Sbjct  89    PGNYYFEDRYDLVKFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIEFRTDNG  148

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV+MMKSEKLFESQGGPII+SQIENE+GPVEWEIGAPGKAYTKWA  M
Sbjct  149   PFKAAMQKFTEKIVSMMKSEKLFESQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAADM  208

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV L TGVPW+MCKQ+DAPDP+I+TCNG+YCENF PNK YKPK++TE WTGWYT+FGG V
Sbjct  209   AVKLGTGVPWVMCKQDDAPDPVINTCNGFYCENFKPNKDYKPKLWTENWTGWYTEFGGAV  268

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQN GSF+NYYMYHGGTNFGRT+A LFIATSYDYDAPLDEYGL  
Sbjct  269   PYRPAEDLAFSVARFIQNGGSFMNYYMYHGGTNFGRTSAGLFIATSYDYDAPLDEYGLTR  328

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHLRDLH+AIKL EPALVS  P V   G NQE HVF+S++ +C AFL+NYD ++S 
Sbjct  329   DPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGSNQEAHVFQSKS-SCAAFLANYDTKYSV  387

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KVTF N QYDLPPWSISILPDCK  V+NTA + + S Q KM PVG   SWQSY EE A+ 
Sbjct  388   KVTFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSSQMKMTPVGGALSWQSYIEEAATG  447

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                DT   +G+WEQINVTRD+SDYLWYMT VNI  DE FL+NG  PV+T+ SAGH++HVF
Sbjct  448   YTDDTTTLEGLWEQINVTRDASDYLWYMTNVNIDSDEGFLKNGDSPVLTIFSAGHSLHVF  507

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +L+GTVYG L  PKLT++ +VKL AGINKISLLSVAVGLPNVG+HFEKWNAG+LGPV
Sbjct  508   INGQLAGTVYGSLENPKLTFSQNVKLTAGINKISLLSVAVGLPNVGVHFEKWNAGILGPV  567

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEGTRDL+   W YK+
Sbjct  568   TLKGLNEGTRDLSGWKWSYKI  588


 Score =   176 bits (447),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TVTGSSSVEW +G L A  QPLTWYKATFDAPEGNDP+ALDMSSMGKG
Sbjct  587   KIGLKGEALSLHTVTGSSSVEWVEGSLSAKKQPLTWYKATFDAPEGNDPVALDMSSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNG+ +GRHWP YTA+GSCS+ CNYAGTY+ KKC+ NCG+PSQ
Sbjct  647   QIWVNGQSIGRHWPAYTARGSCSA-CNYAGTYDDKKCRSNCGEPSQ  691



>ref|XP_003550633.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=839

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/562 (76%), Positives = 483/562 (86%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ ++NG+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  29    ASVTYDHKAIVVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEP  88

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIKL Q+AGLYVHLRIGPYIC EWNFGGFP+WLKYVPGI FRTDN
Sbjct  89    SPGKYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDN  148

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV++MK EKLF++QGGPIIMSQIENEYGPVEWEIGAPGKAYTKW  Q
Sbjct  149   EPFKAAMQKFTEKIVSIMKEEKLFQTQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWFSQ  208

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQ+D PDP+IDTCNGYYCENF PNK YKPKM+TE WTGWYT+FGG 
Sbjct  209   MAVGLDTGVPWIMCKQQDTPDPLIDTCNGYYCENFTPNKKYKPKMWTENWTGWYTEFGGA  268

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V RRPAED+AFSVARF+QN GSFVNYYMYHGGTNF RT++ LFIATSYDYD P+DEYGL+
Sbjct  269   VPRRPAEDMAFSVARFVQNGGSFVNYYMYHGGTNFDRTSSGLFIATSYDYDGPIDEYGLL  328

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             NEPK+GHLRDLH+AIKL EPALVS  P VTW G N EVHVF++ +GAC AFL+NYD + S
Sbjct  329   NEPKWGHLRDLHKAIKLCEPALVSVDPTVTWPGNNLEVHVFKT-SGACAAFLANYDTKSS  387

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A V F N QYDLPPWSISILPDCK  V+NTA + + S   KM  V + F WQSY EE AS
Sbjct  388   ASVKFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSSLMKMTAVNSAFDWQSYNEEPAS  447

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S++ D++ A  +WEQINVTRDS+DYLWYMT+VNI  +E F++NG+ PV+TVMSAGH +HV
Sbjct  448   SNEDDSLTAYALWEQINVTRDSTDYLWYMTDVNIDANEGFIKNGQSPVLTVMSAGHVLHV  507

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
              IN +LSGTVYGGL   KLT+++SVKLR G NKISLLS+AVGLPNVG HFE WNAGVLGP
Sbjct  508   LINDQLSGTVYGGLDSHKLTFSDSVKLRVGNNKISLLSIAVGLPNVGPHFETWNAGVLGP  567

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL+ Q W YK+
Sbjct  568   VTLKGLNEGTRDLSKQKWSYKI  589


 Score =   157 bits (398),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+LNTV+GSSSVEW  G LLA  QPL WYK TF  P GNDPLALDM SMGKG
Sbjct  588   KIGLKGEALNLNTVSGSSSVEWVQGSLLAKQQPLAWYKTTFSTPAGNDPLALDMISMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             + W+NG  +GRHWPGY A+G+C  +C YAGTY  KKC+ NCG+PSQ
Sbjct  648   QAWINGRSIGRHWPGYIARGNC-GDCYYAGTYTDKKCRTNCGEPSQ  692



>ref|XP_007138730.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
 gb|ESW10724.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
Length=722

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/561 (76%), Positives = 484/561 (86%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD ++ +I+GKRRILISGSIHYPRSTPQMWP L+QKAKDGG+DVIQTYVFWNGHEPS
Sbjct  24    SVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIQTYVFWNGHEPS  83

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLV+F+K+ Q+AGLYVHLRIGPYIC EWNFGGFP+WLKYVPG+ FRTDN+
Sbjct  84    PGKYYFEDRYDLVRFVKVVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGMAFRTDNE  143

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV++MK E+LF+SQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA QM
Sbjct  144   PFKAAMQKFTAKIVSLMKEERLFQSQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAAQM  203

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQEDAPDP+IDTCNG+YCENF PNK  KPKM+TE WTGWYT FGG V
Sbjct  204   AVGLDTGVPWVMCKQEDAPDPVIDTCNGFYCENFKPNKNTKPKMWTENWTGWYTDFGGAV  263

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQN GSFVNYYMYHGGTNFGRT+  LFIATSYDYDAPLDEYGL N
Sbjct  264   PVRPAEDLAFSVARFIQNGGSFVNYYMYHGGTNFGRTSGGLFIATSYDYDAPLDEYGLQN  323

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIK +EPALVS+ P VT  G N E HVF S  GAC AF++NYD + SA
Sbjct  324   EPKWGHLRDLHKAIKQSEPALVSTDPKVTSLGYNLEAHVF-STPGACAAFIANYDTKSSA  382

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             K TF + QYDLPPWSISILPDCK  VYNTA V + +   KM PV + F+WQSY EE ASS
Sbjct  383   KATFGSGQYDLPPWSISILPDCKTAVYNTAKVGANNWLKKMTPVNSAFAWQSYNEEPASS  442

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +  D++AAD +WEQ+NVTRDSSDYLWYMT+V I  +E F++NG+ PV+TVMSAGH +HVF
Sbjct  443   NQDDSIAADALWEQVNVTRDSSDYLWYMTDVYINANEGFIKNGQSPVLTVMSAGHLLHVF  502

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYGGL  PKLT++++V LR G NK+SLLSV+VGLPNVGLHFE WNAGVLGPV
Sbjct  503   INGQLSGTVYGGLGNPKLTFSDNVNLRVGNNKLSLLSVSVGLPNVGLHFETWNAGVLGPV  562

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEGTRDL+ Q W YKV
Sbjct  563   TLKGLNEGTRDLSRQKWSYKV  583


 Score =   160 bits (405),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+ +L+T +GSSSVEW  G L+A  QPLTWYKATF AP GNDPLALDM SMGKG
Sbjct  582   KVGLKGEASNLHTESGSSSVEWTQGSLVAKKQPLTWYKATFSAPSGNDPLALDMGSMGKG  641

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             E+W+NG  +GRHWPGY A GSC++ CNYAG Y  KKC+ NCG+PSQ
Sbjct  642   EVWINGRSIGRHWPGYIAHGSCNA-CNYAGYYTDKKCRTNCGKPSQ  686



>ref|XP_009760187.1| PREDICTED: beta-galactosidase-like isoform X4 [Nicotiana sylvestris]
Length=807

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/563 (75%), Positives = 479/563 (85%), Gaps = 32/563 (6%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD R+ IINGKRRILISGSIHYPRSTP+MWPGL+QKAKDGGLD+I+TYVFWNGHE
Sbjct  25    RATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGK+ FEGRYDLVKFIKL Q+AGLYV+LRIGPYICGEWNFGGFP+WLKYVPG+EFR D
Sbjct  85    PSPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRAD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK+AMQGFV KIVNMMKSE LFE QGGPII++QIENEYGP+EWE+G+PGKAYTKWA 
Sbjct  145   NHPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL+ GVPWIMCKQEDAPD +IDTCNG+YCE+F PNKPYKPKM+TE+WT WYT+FGG
Sbjct  205   EMAVGLEIGVPWIMCKQEDAPDHVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AFSVARFIQNNGSF NYYMYHGGTNFGRT +ALFIATSYDYDAPLDEYGL
Sbjct  265   PVPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPKYGHLRDLH+AIKL+EPAL+SSYP V W GKNQE HVFRS++G C AFLSNYD ++
Sbjct  325   LNEPKYGHLRDLHKAIKLSEPALISSYPTVNWLGKNQEAHVFRSKSGDCAAFLSNYDTKY  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S                                + S   Q  M PV    SWQSY+EE  
Sbjct  385   S--------------------------------ISSQCSQMMMAPVVGSLSWQSYSEETP  412

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++ DT++A+G+ EQIN+TRDSSDYLWYMT+VN+ PDE FL+NGKDP +TVMSAGHAMH
Sbjct  413   SAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHAMH  472

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYGGL  PKLTY+ +VKLRAGINKISLLSVAVGLPNVGLHFE WN GVLG
Sbjct  473   VFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGVLG  532

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+LSGLN+GTRDLT Q W YKV
Sbjct  533   PVTLSGLNDGTRDLTIQRWSYKV  555


 Score =   171 bits (434),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLS +T +G SSVEW +G LLA  QPLTWYKATFDAPEGNDP+ALDM SMGKG
Sbjct  554   KVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKG  613

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNGEGVGR WPGY A+G C  ECNYAG Y +KKCQ NCGQPSQ
Sbjct  614   QIWVNGEGVGRQWPGYIAKGHC-GECNYAGEYTEKKCQTNCGQPSQ  658



>ref|XP_007012844.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY30463.1| Beta-galactosidase [Theobroma cacao]
Length=847

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/570 (74%), Positives = 486/570 (85%), Gaps = 8/570 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              +VSYD ++ IING+RRIL+SGSIHYPRSTPQMWP L+ KAK+GGLDVIQTYVFWNGHEP
Sbjct  28    ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQTYVFWNGHEP  87

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  88    SPGKYYFDDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIVFRTDN  147

Query  757   QPFKV--------AMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGK  912
              PFKV        AMQ F  KIV+MMK+EKLF++QGGPIIMSQIENE+GPVEWEIGAPGK
Sbjct  148   GPFKVENFDYLIAAMQKFTEKIVSMMKAEKLFQTQGGPIIMSQIENEFGPVEWEIGAPGK  207

Query  913   AYTKWAGQMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTG  1092
             AYTKWA QMAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YCENF PN  YKPKM+TE WTG
Sbjct  208   AYTKWAAQMAVGLGTGVPWIMCKQDDAPDPVINTCNGFYCENFTPNAKYKPKMWTENWTG  267

Query  1093  WYTQFGGPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDA  1272
             W+T+FGG V  RPAEDIAFSVARFIQN GSFVNYYMYHGGTNFGRTA   FIATSYDYDA
Sbjct  268   WFTEFGGAVPTRPAEDIAFSVARFIQNGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDA  327

Query  1273  PLDEYGLVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFL  1452
             P+DEYGL  EPK+GHLRDLH+AIKL+EPALVS+ P VT  G NQE HVF++++GAC AFL
Sbjct  328   PIDEYGLPREPKWGHLRDLHKAIKLSEPALVSADPTVTSLGSNQEAHVFKAKSGACAAFL  387

Query  1453  SNYDPQFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQ  1632
             +NYD ++S KVTF N+QYDLP WSISILPDCK  V+NTA + + S Q KM+PV + FSWQ
Sbjct  388   ANYDTKYSVKVTFGNVQYDLPAWSISILPDCKTAVFNTARLGAQSSQKKMVPVNSAFSWQ  447

Query  1633  SYTEEIASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVM  1812
             SY EE  S+DD D    DG+ EQI VTRD+SDYLWYMT+V I P+E FL +G+DP +T+ 
Sbjct  448   SYNEESPSADDQDATVKDGLLEQIYVTRDASDYLWYMTDVQIDPNEGFLTSGQDPSLTIW  507

Query  1813  SAGHAMHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEK  1992
             SAGHA+HVFIN +LSGT YG L  PKLT++ +VKLRAGINKISLLS+AVGLPNVG+HFE 
Sbjct  508   SAGHALHVFINGQLSGTAYGELDNPKLTFSKNVKLRAGINKISLLSIAVGLPNVGVHFET  567

Query  1993  WNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             WNAGVLGPV+L GLNEG+RDL+ Q W YK+
Sbjct  568   WNAGVLGPVTLKGLNEGSRDLSKQKWSYKI  597


 Score =   165 bits (417),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TVTGSSSVEW  G LL   QP+TWYK TF+AP GN+PLALDMSSMGKG
Sbjct  596   KIGLKGEALSLHTVTGSSSVEWVKGSLLVKKQPMTWYKTTFNAPGGNEPLALDMSSMGKG  655

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWPGY A+G+C + C+YAGTY+ KKC+ NCG+PSQ
Sbjct  656   QIWINGQSIGRHWPGYIARGACGA-CDYAGTYSDKKCRTNCGEPSQ  700



>gb|AAF67341.1| beta galactosidase [Vigna radiata]
Length=721

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/561 (76%), Positives = 485/561 (86%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD ++ +I+GKRRILISGSIHYPRSTPQMWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  24    SVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  83

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLV+F+KLAQ+AGLYVHLRIGPYIC EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  84    PGKYYFEDRYDLVRFVKLAQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDNE  143

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV++MK E+LF+SQGGPII+SQIENEYGPVEWEIGAPGK+YTKWA QM
Sbjct  144   PFKAAMQKFTAKIVSLMKEERLFQSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQM  203

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQEDAPDP+IDTCNG+YCENF PNK  KPKM+TE WTGWYT FGG  
Sbjct  204   AVGLDTGVPWVMCKQEDAPDPVIDTCNGFYCENFKPNKNTKPKMWTENWTGWYTDFGGAS  263

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQN GSFVNYYMYHGGTNFGRT+  LFIATSYDYDAPLDEYGL N
Sbjct  264   PIRPAEDLAFSVARFIQNGGSFVNYYMYHGGTNFGRTSGGLFIATSYDYDAPLDEYGLQN  323

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLR LH+AIK +EPALVS+ P VT  G N E HVF S  GAC AF++NYD + SA
Sbjct  324   EPKWGHLRALHKAIKQSEPALVSTDPKVTSLGYNLEAHVF-STPGACAAFIANYDTKSSA  382

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             K TF + QYDLPPWSISILPDCK VVYNTA V +  ++ KM PV +GF+WQSY EE ASS
Sbjct  383   KATFGSGQYDLPPWSISILPDCKTVVYNTARVGNGWVK-KMTPVNSGFAWQSYNEEPASS  441

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                D++AA+ +WEQ+NVTRDSSDYLWYMT+V I  +E FL+NG+ PV+TVMSAGH +HVF
Sbjct  442   SQDDSIAAEALWEQVNVTRDSSDYLWYMTDVYINGNEGFLKNGRSPVLTVMSAGHLLHVF  501

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYGGL  PKLT++++V LR G NK+SLLSVAVGLPNVG+HFE WNAGVLGPV
Sbjct  502   INGQLSGTVYGGLGNPKLTFSDNVNLRVGNNKLSLLSVAVGLPNVGVHFETWNAGVLGPV  561

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEGTRDL+ Q W YKV
Sbjct  562   TLKGLNEGTRDLSRQKWSYKV  582


 Score =   160 bits (404),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+T +GSSSVEW  G L+A  QPLTWYKATF AP GNDPLALD+ SMGKG
Sbjct  581   KVGLKGEALNLHTESGSSSVEWIQGSLVAKKQPLTWYKATFSAPAGNDPLALDLGSMGKG  640

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             E+WVNG  +GRHWPGY A GSC++ CNYAG Y  +KC+ NCG+PSQ
Sbjct  641   EVWVNGRSIGRHWPGYIAHGSCNA-CNYAGYYTDQKCRTNCGKPSQ  685



>gb|ACC78255.1| beta-galactosidase [Carica papaya]
Length=721

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/563 (75%), Positives = 476/563 (85%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
               +VSYD ++ IING+RRILISGSIHYPRSTPQMWP L+Q AK+GGLDVIQTYVFWNGHE
Sbjct  20    EATVSYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQNAKEGGLDVIQTYVFWNGHE  79

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG Y FE RYDLVKFIKL  +AGLYVHLRIGPYICGEWNFGGFP+WLKYVPGI+FRTD
Sbjct  80    PSPGNYYFEDRYDLVKFIKLVHQAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGIQFRTD  139

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  MQ F  KIVNMMK+EKLFE QGGPIIMSQIENEYGP+EWEIGAPGKAYTKWA 
Sbjct  140   NGPFKAQMQKFTEKIVNMMKAEKLFEPQGGPIIMSQIENEYGPIEWEIGAPGKAYTKWAA  199

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPWIMCKQEDAPDPIIDTCNG+YCENF PN  YKPKMFTE WTGWYT+FGG
Sbjct  200   QMAVGLGTGVPWIMCKQEDAPDPIIDTCNGFYCENFMPNANYKPKMFTEAWTGWYTEFGG  259

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+A+SVARFIQN GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  260   PVPYRPAEDMAYSVARFIQNRGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  319

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPK+GHLRDLH+ IKL EP+LVS  P VT  G NQE HVF ++T +C AFL+NYD ++
Sbjct  320   RREPKWGHLRDLHKTIKLCEPSLVSVDPKVTSLGSNQEAHVFWTKT-SCAAFLANYDLKY  378

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S +VTF NL YDLPPWS+SILPDCK VV+NTA V S     KMI V + FSWQSY EE  
Sbjct  379   SVRVTFQNLPYDLPPWSVSILPDCKTVVFNTAKVVSQGSLAKMIAVNSAFSWQSYNEETP  438

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S++       DG+WEQI+VTRD++DYLWYMT+V I PDE FL+NG+DP++TVMSAGHA+H
Sbjct  439   SANYDAVFTKDGLWEQISVTRDATDYLWYMTDVTIGPDEAFLKNGQDPILTVMSAGHALH  498

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGTVYG L  PKL ++  VKLRAG+NK+SLLS+AVGLPNVGLHFE WNAGVLG
Sbjct  499   VFVNGQLSGTVYGQLENPKLAFSGKVKLRAGVNKVSLLSIAVGLPNVGLHFETWNAGVLG  558

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YK+
Sbjct  559   PVTLKGVNSGTWDMSKWKWSYKI  581


 Score =   163 bits (413),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TV+GSSSVEW +G LLA  QPL WYK TF+AP GNDPLALDM+SMGKG
Sbjct  580   KIGLKGEALSLHTVSGSSSVEWVEGSLLAQRQPLIWYKTTFNAPVGNDPLALDMNSMGKG  639

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWPGY A+GSC + CNYAG Y++KKC  NCG+ SQ
Sbjct  640   QIWINGQSIGRHWPGYKARGSCGA-CNYAGIYDEKKCHSNCGKASQ  684



>gb|KHN24609.1| Beta-galactosidase [Glycine soja]
Length=710

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/562 (76%), Positives = 482/562 (86%), Gaps = 2/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +++GKRRILISGSIHYPRSTPQMWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  12    ASVTYDHKAIVVDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVFWNGHEP  71

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+Y FE R+DLVKF+KL Q+AGLYVHLRIGPYIC EWNFGGFP+WLKYVPGI FRTDN
Sbjct  72    SPGQYYFEDRFDLVKFVKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDN  131

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV++MK  +LF+SQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA Q
Sbjct  132   EPFKAAMQKFTAKIVSLMKENRLFQSQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAAQ  191

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDP+IDTCNGYYCENF PNK  KPKM+TE WTGWYT FGG 
Sbjct  192   MAVGLDTGVPWVMCKQEDAPDPVIDTCNGYYCENFKPNKNTKPKMWTENWTGWYTDFGGA  251

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V RRPAED+AFSVARFIQN GSFVNYYMYHGGTNFGRT+  LFIATSYDYDAPLDEYGL 
Sbjct  252   VPRRPAEDLAFSVARFIQNGGSFVNYYMYHGGTNFGRTSGGLFIATSYDYDAPLDEYGLQ  311

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             NEPKY HLR+LH+AIK  EPALV++ P V   G N E HVF S  GAC AF++NYD +  
Sbjct  312   NEPKYEHLRNLHKAIKQCEPALVATDPKVQSLGYNLEAHVF-STPGACAAFIANYDTKSY  370

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AK TF N QYDLPPWSISILPDCK VVYNTA V +  L+ KM PV + F+WQSY EE AS
Sbjct  371   AKATFGNGQYDLPPWSISILPDCKTVVYNTAKVGNSWLK-KMTPVNSAFAWQSYNEEPAS  429

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S   D++AA  +WEQ+NVTRDSSDYLWYMT+V I  +E FL+NG+ PV+T MSAGH +HV
Sbjct  430   SSQADSIAAYALWEQVNVTRDSSDYLWYMTDVYINANEGFLKNGQSPVLTAMSAGHVLHV  489

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +L+GTV+GGLA PKLT++++VKLR G NK+SLLSVAVGLPNVG+HFE WNAGVLGP
Sbjct  490   FINDQLAGTVWGGLANPKLTFSDNVKLRVGNNKLSLLSVAVGLPNVGVHFETWNAGVLGP  549

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL++Q W YKV
Sbjct  550   VTLKGLNEGTRDLSSQKWSYKV  571


 Score =   160 bits (406),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T +GSSSVEW  G L+A  QPLTWYK TF AP GNDPLALD+ SMGKG
Sbjct  570   KVGLKGESLSLHTESGSSSVEWIRGSLVAKKQPLTWYKTTFSAPAGNDPLALDLGSMGKG  629

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             E+WVNG  +GRHWPGY A GSC++ CNYAG Y   KC+ NCGQPSQ
Sbjct  630   EVWVNGRSIGRHWPGYIAHGSCNA-CNYAGFYTDTKCRTNCGQPSQ  674



>ref|XP_003546457.1| PREDICTED: beta-galactosidase-like isoform X1 [Glycine max]
 ref|XP_006597816.1| PREDICTED: beta-galactosidase-like isoform X2 [Glycine max]
Length=721

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/562 (76%), Positives = 482/562 (86%), Gaps = 2/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +++GKRRILISGSIHYPRSTPQMWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  23    ASVTYDHKAIVVDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVFWNGHEP  82

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+Y FE R+DLVKF+KL Q+AGLYVHLRIGPYIC EWNFGGFP+WLKYVPGI FRTDN
Sbjct  83    SPGQYYFEDRFDLVKFVKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDN  142

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV++MK  +LF+SQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA Q
Sbjct  143   EPFKAAMQKFTAKIVSLMKENRLFQSQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAAQ  202

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDP+IDTCNGYYCENF PNK  KPKM+TE WTGWYT FGG 
Sbjct  203   MAVGLDTGVPWVMCKQEDAPDPVIDTCNGYYCENFKPNKNTKPKMWTENWTGWYTDFGGA  262

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V RRPAED+AFSVARFIQN GSFVNYYMYHGGTNFGRT+  LFIATSYDYDAPLDEYGL 
Sbjct  263   VPRRPAEDLAFSVARFIQNGGSFVNYYMYHGGTNFGRTSGGLFIATSYDYDAPLDEYGLQ  322

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             NEPKY HLR+LH+AIK  EPALV++ P V   G N E HVF S  GAC AF++NYD +  
Sbjct  323   NEPKYEHLRNLHKAIKQCEPALVATDPKVQSLGYNLEAHVF-STPGACAAFIANYDTKSY  381

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AK TF N QYDLPPWSISILPDCK VVYNTA V +  L+ KM PV + F+WQSY EE AS
Sbjct  382   AKATFGNGQYDLPPWSISILPDCKTVVYNTAKVGNSWLK-KMTPVNSAFAWQSYNEEPAS  440

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S   D++AA  +WEQ+NVTRDSSDYLWYMT+V I  +E FL+NG+ PV+T MSAGH +HV
Sbjct  441   SSQADSIAAYALWEQVNVTRDSSDYLWYMTDVYINANEGFLKNGQSPVLTAMSAGHVLHV  500

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +L+GTV+GGLA PKLT++++VKLR G NK+SLLSVAVGLPNVG+HFE WNAGVLGP
Sbjct  501   FINDQLAGTVWGGLANPKLTFSDNVKLRVGNNKLSLLSVAVGLPNVGVHFETWNAGVLGP  560

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL++Q W YKV
Sbjct  561   VTLKGLNEGTRDLSSQKWSYKV  582


 Score =   161 bits (407),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T +GSSSVEW  G L+A  QPLTWYK TF AP GNDPLALD+ SMGKG
Sbjct  581   KVGLKGESLSLHTESGSSSVEWIRGSLVAKKQPLTWYKTTFSAPAGNDPLALDLGSMGKG  640

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             E+WVNG  +GRHWPGY A GSC++ CNYAG Y   KC+ NCGQPSQ
Sbjct  641   EVWVNGRSIGRHWPGYIAHGSCNA-CNYAGFYTDTKCRTNCGQPSQ  685



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/564 (75%), Positives = 484/564 (86%), Gaps = 2/564 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING+RRIL SGSIHYPRSTP+MWP L+QKAKDGGLD IQTYVFWNGHE
Sbjct  38    KASVSYDQKAIIINGQRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDAIQTYVFWNGHE  97

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FEGRYDLV+FIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGIEFRTD
Sbjct  98    PSPGQYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIEFRTD  157

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFKV MQGF  KIV+MMK+E LFE QGGPIIMSQIENEYGPVEWEIGAPG+AYTKWA 
Sbjct  158   NEPFKVTMQGFTKKIVDMMKAENLFEPQGGPIIMSQIENEYGPVEWEIGAPGQAYTKWAA  217

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAV L TGVPW+MCKQ+DAPDP+I++CNG+YC+ F PNKPYKPKM+TE+WTGWYT+FGG
Sbjct  218   QMAVDLGTGVPWVMCKQDDAPDPMINSCNGFYCDWFSPNKPYKPKMWTEVWTGWYTEFGG  277

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RP EDIAFSVA+F+Q +GSF+NYYMYHGGTNFGRTA   FIATSYD+DAP+DEYGL
Sbjct  278   PVPHRPVEDIAFSVAKFVQKSGSFINYYMYHGGTNFGRTAGGPFIATSYDFDAPIDEYGL  337

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + EPK+GHLRDLHRAIKL EPALVS+ P V  FG  QE HVFRS +GAC AFL+NYD   
Sbjct  338   LREPKWGHLRDLHRAIKLCEPALVSADPTVISFGNYQEAHVFRSNSGACAAFLANYDSNA  397

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGN-GFSWQSYTEEI  1650
              AKV F N+ YDLPPWSISILPDCKN ++NTA + + S   KM  V + GF WQSYTEE 
Sbjct  398   YAKVAFENMHYDLPPWSISILPDCKNTIFNTARIGAQSSLMKMTAVSSEGFPWQSYTEET  457

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             AS DD ++    G+ EQIN+TRD+SDYLWYMT+V I P+EEFL++G+ PV+TV SAGHA+
Sbjct  458   ASYDD-NSFTMVGLLEQINLTRDASDYLWYMTDVQIDPNEEFLKSGQYPVLTVSSAGHAL  516

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVFIN +LSGTVYG L  PKLT++++VKL AGINKISLLS+AVGLPNVG HFE WNAGVL
Sbjct  517   HVFINGQLSGTVYGSLENPKLTFSDNVKLIAGINKISLLSIAVGLPNVGTHFETWNAGVL  576

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPV L GLNEGTRDL+ Q W YK+
Sbjct  577   GPVVLKGLNEGTRDLSWQKWSYKI  600


 Score =   146 bits (368),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE+L L+TV+GSSSVEWE G  +A  QPL+WYKA FDAP GN+PLALDMSSMGKG
Sbjct  599   KIGLQGEALGLHTVSGSSSVEWE-GSSIAKQQPLSWYKAIFDAPTGNEPLALDMSSMGKG  657

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A G+C + C+YAG Y+  KCQ NCG+ SQ
Sbjct  658   QIWINGQSIGRYWPAYKASGTCGN-CSYAGEYDDSKCQSNCGEASQ  702



>gb|AAC77377.1| beta-galactosidase precursor [Carica papaya]
Length=721

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/563 (75%), Positives = 475/563 (84%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
               +VSYD ++ IING+RRILISGSIHYPRSTPQMWP L+Q AK+GGLDVIQTYVFWNGHE
Sbjct  20    EATVSYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQNAKEGGLDVIQTYVFWNGHE  79

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG Y FE RYDLVKFIKL  +AGLYVHLRI PYICGEWNFGGFP+WLKYVPGI+FRTD
Sbjct  80    PSPGNYYFEDRYDLVKFIKLVHQAGLYVHLRISPYICGEWNFGGFPVWLKYVPGIQFRTD  139

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  MQ F  KIVNMMK+EKLFE QGGPIIMSQIENEYGP+EWEIGAPGKAYTKWA 
Sbjct  140   NGPFKAQMQKFTEKIVNMMKAEKLFEPQGGPIIMSQIENEYGPIEWEIGAPGKAYTKWAA  199

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPWIMCKQEDAPDPIIDTCNG+YCENF PN  YKPKMFTE WTGWYT+FGG
Sbjct  200   QMAVGLGTGVPWIMCKQEDAPDPIIDTCNGFYCENFMPNANYKPKMFTEAWTGWYTEFGG  259

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+A+SVARFIQN GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  260   PVPYRPAEDMAYSVARFIQNRGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  319

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPK+GHLRDLH+ IKL EP+LVS  P VT  G NQE HVF ++T +C AFL+NYD ++
Sbjct  320   RREPKWGHLRDLHKTIKLCEPSLVSVDPKVTSLGSNQEAHVFWTKT-SCAAFLANYDLKY  378

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             S +VTF NL YDLPPWS+SILPDCK VV+NTA V S     KMI V + FSWQSY EE  
Sbjct  379   SVRVTFQNLPYDLPPWSVSILPDCKTVVFNTAKVVSQGSLAKMIAVNSAFSWQSYNEETP  438

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S++       DG+WEQI+VTRD++DYLWYMT+V I PDE FL+NG+DP++TVMSAGHA+H
Sbjct  439   SANYDAVFTKDGLWEQISVTRDATDYLWYMTDVTIGPDEAFLKNGQDPILTVMSAGHALH  498

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGTVYG L  PKL ++  VKLRAG+NK+SLLS+AVGLPNVGLHFE WNAGVLG
Sbjct  499   VFVNGQLSGTVYGQLENPKLAFSGKVKLRAGVNKVSLLSIAVGLPNVGLHFETWNAGVLG  558

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YK+
Sbjct  559   PVTLKGVNSGTWDMSKWKWSYKI  581


 Score =   163 bits (413),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TV+GSSSVEW +G LLA  QPL WYK TF+AP GNDPLALDM+SMGKG
Sbjct  580   KIGLKGEALSLHTVSGSSSVEWVEGSLLAQRQPLIWYKTTFNAPVGNDPLALDMNSMGKG  639

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWPGY A+GSC + CNYAG Y++KKC  NCG+ SQ
Sbjct  640   QIWINGQSIGRHWPGYKARGSCGA-CNYAGIYDEKKCHSNCGKASQ  684



>ref|XP_009760186.1| PREDICTED: beta-galactosidase-like isoform X3 [Nicotiana sylvestris]
Length=809

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/565 (75%), Positives = 479/565 (85%), Gaps = 34/565 (6%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +VSYD R+ IINGKRRILISGSIHYPRSTP+MWPGL+QKAKDGGLD+I+TYVFWNGHE
Sbjct  25    RATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGK+ FEGRYDLVKFIKL Q+AGLYV+LRIGPYICGEWNFGGFP+WLKYVPG+EFR D
Sbjct  85    PSPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRAD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK+AMQGFV KIVNMMKSE LFE QGGPII++QIENEYGP+EWE+G+PGKAYTKWA 
Sbjct  145   NHPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL+ GVPWIMCKQEDAPD +IDTCNG+YCE+F PNKPYKPKM+TE+WT WYT+FGG
Sbjct  205   EMAVGLEIGVPWIMCKQEDAPDHVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV RRPAED+AFSVARFIQNNGSF NYYMYHGGTNFGRT +ALFIATSYDYDAPLDEYGL
Sbjct  265   PVPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQE--VHVFRSETGACVAFLSNYDP  1467
             +NEPKYGHLRDLH+AIKL+EPAL+SSYP V W GKNQE   HVFRS++G C AFLSNYD 
Sbjct  325   LNEPKYGHLRDLHKAIKLSEPALISSYPTVNWLGKNQEQQAHVFRSKSGDCAAFLSNYDT  384

Query  1468  QFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEE  1647
             ++S                                + S   Q  M PV    SWQSY+EE
Sbjct  385   KYS--------------------------------ISSQCSQMMMAPVVGSLSWQSYSEE  412

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               S+++ DT++A+G+ EQIN+TRDSSDYLWYMT+VN+ PDE FL+NGKDP +TVMSAGHA
Sbjct  413   TPSAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHA  472

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             MHVFIN +LSGTVYGGL  PKLTY+ +VKLRAGINKISLLSVAVGLPNVGLHFE WN GV
Sbjct  473   MHVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGV  532

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+LSGLN+GTRDLT Q W YKV
Sbjct  533   LGPVTLSGLNDGTRDLTIQRWSYKV  557


 Score =   172 bits (435),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLS +T +G SSVEW +G LLA  QPLTWYKATFDAPEGNDP+ALDM SMGKG
Sbjct  556   KVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKG  615

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IWVNGEGVGR WPGY A+G C  ECNYAG Y +KKCQ NCGQPSQ
Sbjct  616   QIWVNGEGVGRQWPGYIAKGHC-GECNYAGEYTEKKCQTNCGQPSQ  660



>gb|KCW79522.1| hypothetical protein EUGRSUZ_C00898 [Eucalyptus grandis]
Length=615

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/562 (74%), Positives = 475/562 (85%), Gaps = 0/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD R+ I+NGKRRILISGSIHYPRSTP MWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  42    ASVTYDHRALIVNGKRRILISGSIHYPRSTPGMWPDLIQKAKDGGLDVIQTYVFWNGHEP  101

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLV+FIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLK+VPGI FRTDN
Sbjct  102   SPGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGIVFRTDN  161

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIVNMMK+E LFESQGGPII+SQ+ENE+GPVEWEIGAPGKAY+KWA  
Sbjct  162   EPFKAAMQRFTEKIVNMMKAENLFESQGGPIILSQVENEFGPVEWEIGAPGKAYSKWAAD  221

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDP+IDTCNGYYCENF PN+ YKPKM+TE WTGWYT+FGG 
Sbjct  222   MAVGLGTGVPWVMCKQEDAPDPVIDTCNGYYCENFKPNRDYKPKMWTEAWTGWYTEFGGA  281

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             +  RP ED+A+SVARFIQN GSFVNYYMYHGGTNFGRT+   FIATSYDYDAP+DE+GL 
Sbjct  282   IPHRPVEDLAYSVARFIQNGGSFVNYYMYHGGTNFGRTSGGPFIATSYDYDAPIDEFGLP  341

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              E K+ HL+DLH AIKL E ALVSS   V   G  QE HVF +E+GAC AFL+NYDP +S
Sbjct  342   REKKWRHLKDLHEAIKLCESALVSSNATVLSLGNKQEAHVFTAESGACAAFLANYDPNYS  401

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              KVTF   QYDLPPWS+SILPDCK  V+NTA + + S   KM P+G  FSWQSY EE  S
Sbjct  402   VKVTFRGRQYDLPPWSVSILPDCKTAVFNTARIGAQSSLMKMTPLGKTFSWQSYNEETPS  461

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +DD DT   +G+ EQIN+TRD+SDYLWYMT++ I PDE FL+NG+ PV+TV SAGHA+HV
Sbjct  462   ADDSDTTEMEGLLEQINITRDASDYLWYMTDIVIEPDEAFLKNGQYPVLTVWSAGHALHV  521

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FINS+LSGTVYGGL  PKLT+ +++KL AGINK+SLLS+AVGLPNVGLHFE WNAGVLGP
Sbjct  522   FINSQLSGTVYGGLENPKLTFNDNLKLNAGINKLSLLSIAVGLPNVGLHFETWNAGVLGP  581

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLN GT +LTN  W YKV
Sbjct  582   VTLKGLNSGTWNLTNWKWSYKV  603



>ref|XP_006587007.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=615

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/562 (75%), Positives = 481/562 (86%), Gaps = 2/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +++GKRRILISGSIHYPRSTPQMWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  23    ASVTYDHKAIVVDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVFWNGHEP  82

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+Y FE R+DLVKF+KLAQ+AGLYVHLRIGPYIC EWN GGFP+WLKYVPGI FRTDN
Sbjct  83    SPGQYYFEDRFDLVKFVKLAQQAGLYVHLRIGPYICAEWNLGGFPVWLKYVPGIAFRTDN  142

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV++MK  +LF+SQGGPII+SQIENEYGPVEWEIGAPGKAYTKWA Q
Sbjct  143   EPFKAAMQKFTAKIVSLMKENRLFQSQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAAQ  202

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDP+IDTCNG+YCENF PNK  KPKM+TE WTGWYT FGG 
Sbjct  203   MAVGLDTGVPWVMCKQEDAPDPVIDTCNGFYCENFKPNKNTKPKMWTENWTGWYTDFGGA  262

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V RRPAED+AFSVARFIQN GSFVNYYMYHGGTNFGRT+  LFIATSYDYDAPLDEYGL 
Sbjct  263   VPRRPAEDLAFSVARFIQNGGSFVNYYMYHGGTNFGRTSGGLFIATSYDYDAPLDEYGLE  322

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             NEPKY HLR LH+AIK +EPALV++ P V   G N E HVF S  GAC AF++NYD +  
Sbjct  323   NEPKYEHLRALHKAIKQSEPALVATDPKVQSLGYNLEAHVF-SAPGACAAFIANYDTKSY  381

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AK  F N QYDLPPWSISILPDCK VVYNTA V    L+ KM PV + F+WQSY EE AS
Sbjct  382   AKAKFGNGQYDLPPWSISILPDCKTVVYNTAKVGYGWLK-KMTPVNSAFAWQSYNEEPAS  440

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S   D++AA  +WEQ+NVTRDSSDYLWYMT+VN+  +E FL+NG+ P++TVMSAGH +HV
Sbjct  441   SSQADSIAAYALWEQVNVTRDSSDYLWYMTDVNVNANEGFLKNGQSPLLTVMSAGHVLHV  500

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +L+GTV+GGL  PKLT++++VKLRAG NK+SLLSVAVGLPNVG+HFE WNAGVLGP
Sbjct  501   FINGQLAGTVWGGLGNPKLTFSDNVKLRAGNNKLSLLSVAVGLPNVGVHFETWNAGVLGP  560

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL+ Q W YKV
Sbjct  561   VTLKGLNEGTRDLSRQKWSYKV  582



>ref|XP_010047575.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW79521.1| hypothetical protein EUGRSUZ_C00898 [Eucalyptus grandis]
Length=874

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/562 (74%), Positives = 475/562 (85%), Gaps = 0/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD R+ I+NGKRRILISGSIHYPRSTP MWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  42    ASVTYDHRALIVNGKRRILISGSIHYPRSTPGMWPDLIQKAKDGGLDVIQTYVFWNGHEP  101

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLV+FIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLK+VPGI FRTDN
Sbjct  102   SPGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGIVFRTDN  161

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIVNMMK+E LFESQGGPII+SQ+ENE+GPVEWEIGAPGKAY+KWA  
Sbjct  162   EPFKAAMQRFTEKIVNMMKAENLFESQGGPIILSQVENEFGPVEWEIGAPGKAYSKWAAD  221

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDP+IDTCNGYYCENF PN+ YKPKM+TE WTGWYT+FGG 
Sbjct  222   MAVGLGTGVPWVMCKQEDAPDPVIDTCNGYYCENFKPNRDYKPKMWTEAWTGWYTEFGGA  281

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             +  RP ED+A+SVARFIQN GSFVNYYMYHGGTNFGRT+   FIATSYDYDAP+DE+GL 
Sbjct  282   IPHRPVEDLAYSVARFIQNGGSFVNYYMYHGGTNFGRTSGGPFIATSYDYDAPIDEFGLP  341

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              E K+ HL+DLH AIKL E ALVSS   V   G  QE HVF +E+GAC AFL+NYDP +S
Sbjct  342   REKKWRHLKDLHEAIKLCESALVSSNATVLSLGNKQEAHVFTAESGACAAFLANYDPNYS  401

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              KVTF   QYDLPPWS+SILPDCK  V+NTA + + S   KM P+G  FSWQSY EE  S
Sbjct  402   VKVTFRGRQYDLPPWSVSILPDCKTAVFNTARIGAQSSLMKMTPLGKTFSWQSYNEETPS  461

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +DD DT   +G+ EQIN+TRD+SDYLWYMT++ I PDE FL+NG+ PV+TV SAGHA+HV
Sbjct  462   ADDSDTTEMEGLLEQINITRDASDYLWYMTDIVIEPDEAFLKNGQYPVLTVWSAGHALHV  521

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FINS+LSGTVYGGL  PKLT+ +++KL AGINK+SLLS+AVGLPNVGLHFE WNAGVLGP
Sbjct  522   FINSQLSGTVYGGLENPKLTFNDNLKLNAGINKLSLLSIAVGLPNVGLHFETWNAGVLGP  581

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLN GT +LTN  W YK+
Sbjct  582   VTLKGLNSGTWNLTNWKWSYKL  603


 Score =   159 bits (402),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             +LG+KGE+L LNT++GSSSVEW  G  +    PLTWYK TFDAPEG+DPLALDMSSMGKG
Sbjct  602   KLGLKGETLGLNTISGSSSVEWMKGSSVVLKLPLTWYKTTFDAPEGDDPLALDMSSMGKG  661

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A GSC  ECNYAG + + KC+ NCGQPSQ
Sbjct  662   QIWINGQSIGRHWPSYVAGGSC-GECNYAGIFVENKCRTNCGQPSQ  706



>ref|XP_007204656.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
 gb|EMJ05855.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
Length=836

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/561 (74%), Positives = 483/561 (86%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QK+KDGGLDVIQTYVFWNGHEPS
Sbjct  27    SVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNGHEPS  86

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  87    PGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFRTDNE  146

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV+MMK+E+LF+SQGGPII+SQIENE+GPVEWEIGAPGKAYTKWA QM
Sbjct  147   PFKAAMQKFTEKIVSMMKAEQLFQSQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQM  206

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG V
Sbjct  207   AVGLNTGVPWIMCKQEDAPDPVIDTCNGFYCENFTPNKNYKPKMWTEVWTGWYTEFGGAV  266

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFS+ARFIQ  GSFVNYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL  
Sbjct  267   PTRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLPR  326

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIK +E ALVS+ P VT  G  QE HVF+S++G C AFL+NYD + SA
Sbjct  327   EPKWGHLRDLHKAIKSSESALVSAEPSVTSLGNGQEAHVFKSKSG-CAAFLANYDTKSSA  385

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F N QY+LPPWSISILPDCK  VYNTA + S S Q KM PV +   WQS+ EE ASS
Sbjct  386   KVSFGNGQYELPPWSISILPDCKTAVYNTARLGSQSSQMKMTPVKSALPWQSFVEESASS  445

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             D+ DT   DG+WEQINVTRD++DYLWYMT++ I+PDE F++ G+ P++T+ SAGHA+HVF
Sbjct  446   DESDTTTLDGLWEQINVTRDTTDYLWYMTDITISPDEGFIKRGESPLLTIYSAGHALHVF  505

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKLT++ +VKLR+GINK++LLS++VGLPNVGLHFE WNAGVLGPV
Sbjct  506   INGQLSGTVYGALENPKLTFSQNVKLRSGINKLALLSISVGLPNVGLHFETWNAGVLGPV  565

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN GT D++   W YK+
Sbjct  566   TLKGLNSGTWDMSRWKWTYKI  586


 Score =   162 bits (410),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L L+TV+GSSSVEW +GP +A  QPLTWYKATF+AP GN PLALDMSSMGKG
Sbjct  585   KIGLKGEALGLHTVSGSSSVEWAEGPSMAQKQPLTWYKATFNAPPGNGPLALDMSSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G+C + C YAGTY+ KKC+ +CG+PSQ
Sbjct  645   QIWINGQSIGRHWPAYTARGNCGN-CYYAGTYDDKKCRTHCGEPSQ  689



>ref|NP_001266133.1| beta-galactosidase-like [Cicer arietinum]
 emb|CAA06309.1| beta-galactosidase [Cicer arietinum]
Length=730

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/563 (75%), Positives = 478/563 (85%), Gaps = 1/563 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +ING+RRILISGSIHYPRSTPQMWP L+QKAKDGG+DVIQTYVFWNGHEP
Sbjct  29    ASVTYDHKAIVINGQRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIQTYVFWNGHEP  88

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG Y FE R+DLVKF+K+ Q+AGLYV+LRIGPY+C EWNFGGFP+WLKYVPG+ FRTDN
Sbjct  89    SPGNYYFEDRFDLVKFVKVVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGVAFRTDN  148

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMK+E LFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKW  Q
Sbjct  149   EPFKAAMQKFTAKIVSMMKAENLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWFSQ  208

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL TGVPWIMCKQEDAPDPIIDTCNGYYCENF PNK YKPKM+TE W+GWYT FG  
Sbjct  209   MAIGLDTGVPWIMCKQEDAPDPIIDTCNGYYCENFTPNKNYKPKMWTENWSGWYTDFGSA  268

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPA+D+AFSVARFIQN GS+VNYYMYHGGTNFGRT+A LFIATSYDYDAP+DEYGL+
Sbjct  269   VPYRPAQDVAFSVARFIQNRGSYVNYYMYHGGTNFGRTSAGLFIATSYDYDAPIDEYGLL  328

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             +EPK+GHLR+LH+AIK  EP LVS  P V+W GKN EVHV+++ TGAC AFL+NYD    
Sbjct  329   SEPKWGHLRNLHKAIKQCEPILVSVDPTVSWPGKNLEVHVYKTSTGACAAFLANYDTTSP  388

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRS-PSLQTKMIPVGNGFSWQSYTEEIA  1653
             AKVTF N QYDLPPWSISILPDCK  V+NTA V + PS   KM PV + F WQSY E  A
Sbjct  389   AKVTFGNGQYDLPPWSISILPDCKTAVFNTAKVGTVPSFHRKMTPVSSAFDWQSYNEAPA  448

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS   D+  A+ + EQI VTRDSSDYLWYMT+VNI+P+E F++NG+ PV+T MSAGH +H
Sbjct  449   SSGIDDSTTANALLEQIKVTRDSSDYLWYMTDVNISPNEGFIKNGQYPVLTAMSAGHVLH  508

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N + SGT YGGL  PKLT++NSVKLR G NKISLLSVAVGL NVGLH+E WN GVLG
Sbjct  509   VFVNGQFSGTAYGGLENPKLTFSNSVKLRVGNNKISLLSVAVGLSNVGLHYETWNVGVLG  568

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRDL+ Q W YK+
Sbjct  569   PVTLKGLNEGTRDLSGQKWSYKI  591


 Score =   164 bits (415),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+T+ GSSSV+W  G  L   QPLTWYKATFDAP GNDPLALDMSSMGKG
Sbjct  590   KIGLKGETLNLHTLIGSSSVQWTKGSSLVKKQPLTWYKATFDAPAGNDPLALDMSSMGKG  649

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIWVNGE +GRHWP Y A+GSC   CNYAGT+  KKC+ +CGQP+Q
Sbjct  650   EIWVNGESIGRHWPAYIARGSCGG-CNYAGTFTDKKCRTSCGQPTQ  694



>ref|XP_011045964.1| PREDICTED: beta-galactosidase-like isoform X1 [Populus euphratica]
Length=880

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/603 (71%), Positives = 487/603 (81%), Gaps = 43/603 (7%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING+RRILISGSIHYPRSTP+MWP L+QKAKDGG+DVIQTYVFWNGHEPS
Sbjct  27    SVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYVFWNGHEPS  86

Query  580   PG------------------------------------------KYNFEGRYDLVKFIKL  633
             PG                                          +Y FE RYDLVKFIKL
Sbjct  87    PGNVMQIPFYSGFCVCCAFFLFFLFCFHFKFLTRLIFTLWGKKNQYYFEDRYDLVKFIKL  146

Query  634   AQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFKVAMQGFVGKIVNMMK  813
              Q+AGLY+HLRIGPYIC EWNFGGFP+WLKYVPGIEFRTDN PFK AMQ F  KIV MMK
Sbjct  147   VQQAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGIEFRTDNGPFKAAMQKFTEKIVGMMK  206

Query  814   SEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVGLKTGVPWIMCKQEDA  993
             SEKLFE+QGGPII+SQIENEYGPVEWEIGAPGKAYTKWA  MAV L TGVPWIMCKQEDA
Sbjct  207   SEKLFENQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAADMAVKLGTGVPWIMCKQEDA  266

Query  994   PDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHRRPAEDIAFSVARFIQN  1173
             PDP+IDTCNG+YCENF PNK YKPK++TE WTGWYT+FGG V  RPAED+AFSVARFIQN
Sbjct  267   PDPMIDTCNGFYCENFKPNKDYKPKIWTEAWTGWYTEFGGAVPHRPAEDMAFSVARFIQN  326

Query  1174  NGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEPKYGHLRDLHRAIKLAE  1353
              GS++NYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL  EPK+GHLRDLH+AIKL E
Sbjct  327   GGSYINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLPREPKWGHLRDLHKAIKLCE  386

Query  1354  PALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKVTFSNLQYDLPPWSISI  1533
             PALVS  P VT  G NQEVHVF+S++  C AFL+NYD ++S KVTF N QY+LPPWSISI
Sbjct  387   PALVSVDPTVTSLGSNQEVHVFKSKS-VCAAFLANYDTKYSVKVTFGNGQYELPPWSISI  445

Query  1534  LPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASSDDGDTVAADGMWEQINVT  1713
             LPDCK VVYNTA + S S Q KM+P  + FSWQSY EE AS+DD DT   +G+WEQINVT
Sbjct  446   LPDCKTVVYNTARLGSQSSQMKMVPASSSFSWQSYNEETASADDDDTTTMNGLWEQINVT  505

Query  1714  RDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFINSELSGTVYGGLAFPKL  1893
             RD++DYLWY+T+V I  DE FL++G++P++T+ SAGHA+HVFIN +L+GT YGGL+ PKL
Sbjct  506   RDATDYLWYLTDVKIDADEGFLKSGQNPLLTIFSAGHALHVFINGQLAGTAYGGLSNPKL  565

Query  1894  TYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVSLSGLNEGTRDLTNQTWF  2073
             T++ ++KL  GINKISLLSVAVGLPNVGLHFE WNAGVLGPV+L GLNEGTRDL+ Q W 
Sbjct  566   TFSQNIKLTEGINKISLLSVAVGLPNVGLHFETWNAGVLGPVTLKGLNEGTRDLSGQKWS  625

Query  2074  YKV  2082
             YK+
Sbjct  626   YKI  628


 Score =   162 bits (409),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESL L+T +GS SVEW +G LLA  Q LTWYK  FDAP GNDPLALDMSSMGKG
Sbjct  627   KIGLKGESLGLHTASGSESVEWVEGSLLAQKQALTWYKTAFDAPPGNDPLALDMSSMGKG  686

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWPGY A GSC  +CNYAGT++ KKC+ NCG+PSQ
Sbjct  687   QMWINGQNIGRHWPGYIAHGSC-GDCNYAGTFDDKKCRTNCGEPSQ  731



>ref|XP_007154660.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
 gb|ESW26654.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
Length=833

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/562 (74%), Positives = 483/562 (86%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ ++NG+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVI+TYVFWNGHEP
Sbjct  23    ASVTYDHKAILVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVFWNGHEP  82

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIK+ Q+AGLY+HLRIGP++C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  83    SPGKYYFEDRYDLVKFIKVVQQAGLYLHLRIGPFVCAEWNFGGFPVWLKYVPGIAFRTDN  142

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMK EKLF+++GGPIIMSQIENE+GPVEWEIGAPGKAY +WA +
Sbjct  143   EPFKAAMQNFTEKIVSMMKEEKLFQTEGGPIIMSQIENEFGPVEWEIGAPGKAYAQWAAK  202

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQEDAPDP+I+TCNGYYCENF PNK YKPKM+TE W+GWYT+FGG 
Sbjct  203   MAVGLDTGVPWIMCKQEDAPDPVINTCNGYYCENFTPNKEYKPKMWTENWSGWYTEFGGA  262

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V RRPAED+AFSVARF+QN GSFVNYYM+HGGTNF RT+   FIATSYDYD  LDEYGL+
Sbjct  263   VPRRPAEDMAFSVARFVQNGGSFVNYYMFHGGTNFDRTSGGPFIATSYDYDGLLDEYGLL  322

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             NEPK+GHLRDLH+AIKL E ALVS  P VTW GKN EVHVF++ +GAC AFL+NYD + S
Sbjct  323   NEPKWGHLRDLHKAIKLCEAALVSVDPTVTWPGKNLEVHVFKT-SGACAAFLANYDTKSS  381

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A VTF N QYDLPPWSISILPDCK  V+NTA V + S   KM  V   F WQSY EE AS
Sbjct  382   ATVTFENGQYDLPPWSISILPDCKTEVFNTARVGAQSSLMKMTAVNTAFDWQSYNEEPAS  441

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S + D + A  +WEQIN+TRDS+DYLWYMT+VNI  +E F+++G+ PV+TVMSAGHA+HV
Sbjct  442   SSEDDPLTAYALWEQINITRDSTDYLWYMTDVNIDANEGFIKSGQSPVLTVMSAGHALHV  501

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYGGL FPKLT+++ VKLR G NKISLLS+AVGLPNVG HFE WNAGVLGP
Sbjct  502   FINGQLSGTVYGGLEFPKLTFSDGVKLRVGNNKISLLSIAVGLPNVGTHFETWNAGVLGP  561

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L+GLNEGTRDL+ Q W YK+
Sbjct  562   VTLNGLNEGTRDLSKQKWSYKI  583


 Score =   164 bits (415),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+LNTV+GSSSVEW  G LLA  QPLTWYK TF  P GNDPLALDM SMGKG
Sbjct  582   KIGLKGEALNLNTVSGSSSVEWVQGSLLAKKQPLTWYKTTFSTPVGNDPLALDMISMGKG  641

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GRHWPGY A+G C  EC YAGTYN KKC+ NCG+PSQ
Sbjct  642   QVWINGRSIGRHWPGYIARGHC-GECYYAGTYNDKKCRTNCGEPSQ  686



>gb|ACF22882.1| beta-galactosidase [Glycine max]
 gb|KHN35842.1| Beta-galactosidase [Glycine soja]
Length=721

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/561 (76%), Positives = 481/561 (86%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD ++ +++GKRRILISGSIHYPRSTPQMWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  24    SVTYDHKAIVVDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  83

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y FE R+DLVKF+KLAQ+AGLYVHLRIGPYIC EWN GGFP+WLKYVPGI FRTDN+
Sbjct  84    PGQYYFEDRFDLVKFVKLAQQAGLYVHLRIGPYICAEWNLGGFPVWLKYVPGIAFRTDNE  143

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV++MK  +LF+SQGGPII+SQIENEYGPVEWEIGAPGKAYTKWA QM
Sbjct  144   PFKAAMQKFTAKIVSLMKENRLFQSQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAAQM  203

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQEDAPDP+IDTCNG+YCENF PNK  KPKM+TE WTGWYT FGG V
Sbjct  204   AVGLDTGVPWVMCKQEDAPDPVIDTCNGFYCENFKPNKNTKPKMWTENWTGWYTDFGGAV  263

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
              RRPAED+AFSVARFIQN GSFVNYYMYHGGTNFGRT+  LFIATSYDYDAPLDEYGL N
Sbjct  264   PRRPAEDLAFSVARFIQNGGSFVNYYMYHGGTNFGRTSGGLFIATSYDYDAPLDEYGLEN  323

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPKY HLR LH+AIK +EPALV++ P V   G N E HVF S  GAC AF++NYD +  A
Sbjct  324   EPKYEHLRALHKAIKQSEPALVATDPKVQSLGYNLEAHVF-SAPGACAAFIANYDTKSYA  382

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             K  F N QYDLPPWSISILPDCK VVYNTA V    L+ KM PV + F+WQSY EE ASS
Sbjct  383   KAKFGNGQYDLPPWSISILPDCKTVVYNTAKVGYGWLK-KMTPVNSAFAWQSYNEEPASS  441

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                D++AA  +WEQ+NVTRDSSDYLWYMT+VN+  +E FL+NG+ P++TVMSAGH +HVF
Sbjct  442   SQADSIAAYALWEQVNVTRDSSDYLWYMTDVNVNANEGFLKNGQSPLLTVMSAGHVLHVF  501

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +L+GTV+GGL  PKLT++++VKLRAG NK+SLLSVAVGLPNVG+HFE WNAGVLGPV
Sbjct  502   INGQLAGTVWGGLGNPKLTFSDNVKLRAGNNKLSLLSVAVGLPNVGVHFETWNAGVLGPV  561

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEGTRDL+ Q W YKV
Sbjct  562   TLKGLNEGTRDLSRQKWSYKV  582


 Score =   161 bits (407),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T +GSSSVEW  G L+A  QPLTWYK TF AP GNDPLALD+ SMGKG
Sbjct  581   KVGLKGESLSLHTESGSSSVEWIQGSLVAKKQPLTWYKTTFSAPAGNDPLALDLGSMGKG  640

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             E+WVNG  +GRHWPGY A GSC++ CNYAG Y   KC+ NCGQPSQ
Sbjct  641   EVWVNGRSIGRHWPGYIAHGSCNA-CNYAGYYTDTKCRTNCGQPSQ  685



>gb|AAB61470.1| beta-D-galactosidase [Mangifera indica]
Length=663

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/563 (74%), Positives = 482/563 (86%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
               +VSYD ++ II+G+RRILISGSIHYPRSTPQMWP L+QKAKDG +DVIQTYVFWNGHE
Sbjct  31    EATVSYDHKAIIIDGQRRILISGSIHYPRSTPQMWPDLIQKAKDG-VDVIQTYVFWNGHE  89

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FE RYDLV+FIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGIEFRTD
Sbjct  90    PSPGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIEFRTD  149

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV+MMK+EKLFE+QGGPII+SQIENE+GPVEWEIGAPGKAYTKWA 
Sbjct  150   NEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAA  209

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCENF PN+  KPKM+TE WTGW+T FGG
Sbjct  210   QMAVGLDTGVPWVMCKQDDAPDPVINTCNGFYCENFVPNQKNKPKMWTENWTGWFTAFGG  269

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             P  +RPAED+AFSVARFIQN GSFVNYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  270   PTPQRPAEDVAFSVARFIQNGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + EPK+GHLRDLH+AIKL E ALVS+ P VT  G NQEVHVF  ++G+C AFL+NYD   
Sbjct  330   LREPKWGHLRDLHKAIKLCESALVSTDPTVTSLGNNQEVHVFNPKSGSCAAFLANYDTTS  389

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV F  +QY+LPPWSISILPDCK  V+NTA + + S   +M PV   FSWQSY EE A
Sbjct  390   SAKVNFKIMQYELPPWSISILPDCKTAVFNTARLGAQSSLKQMTPVST-FSWQSYIEESA  448

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D  T   DG+WEQ+NVTRD+SDYLWYMT +NI  +E FL+NG+DP++T+ SAGHA+H
Sbjct  449   SSSDDKTFTTDGLWEQLNVTRDASDYLWYMTNINIDSNEGFLKNGQDPLLTIWSAGHALH  508

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYGG+  PKLT++ +VK+R G+N++SLLS++VGL NVG HFE+WN GVLG
Sbjct  509   VFINGQLSGTVYGGVDNPKLTFSQNVKMRVGVNQLSLLSISVGLQNVGTHFEQWNTGVLG  568

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRDL+ Q W YK+
Sbjct  569   PVTLRGLNEGTRDLSKQQWSYKI  591


 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE LSL+TV+GSSSVEW +G  LA  QPLTWYK TF+AP GN+PLALDMS+MGKG
Sbjct  590   KIGLKGEDLSLHTVSGSSSVEWVEGSSLAQKQPLTWYKTTFNAPAGNEPLALDMSTMGKG  649

Query  2336  EIWVNGEGVGR  2368
              IW+N + +GR
Sbjct  650   LIWINSQSIGR  660



>gb|ABY71826.1| beta-galactosidase [Prunus salicina]
Length=836

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/562 (74%), Positives = 483/562 (86%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QK+KDGGLDVIQTYVFWNGHEP
Sbjct  26    ASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNGHEP  85

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  86    SPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFRTDN  145

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMK+E+LF+SQGGPII+SQIENE+GPVEWEIGAPGKAYTKWA Q
Sbjct  146   EPFKAAMQKFTEKIVSMMKAEQLFQSQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQ  205

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG 
Sbjct  206   MAVGLNTGVPWIMCKQEDAPDPVIDTCNGFYCENFTPNKNYKPKMWTEVWTGWYTEFGGA  265

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFS+ARFIQ  GSFVNYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL 
Sbjct  266   VPTRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLP  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHLRDLH+AIK +E ALVS+ P VT  G +QE HVF+S++G C AFL+NYD + S
Sbjct  326   REPKWGHLRDLHKAIKSSESALVSAEPSVTSLGNSQEAHVFKSKSG-CAAFLANYDTKSS  384

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV+F N QY+LPPWSISILPDC+  VYNTA + S S Q KM PV +   WQS+ EE AS
Sbjct  385   AKVSFGNGQYELPPWSISILPDCRTAVYNTARLGSQSSQMKMTPVKSALPWQSFIEESAS  444

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             SD+ DT   DG+WEQINVTRD++DY WYMT++ I+PDE F++ G+ P++T+ SAGHA+HV
Sbjct  445   SDESDTTTLDGLWEQINVTRDTTDYSWYMTDITISPDEGFIKRGESPLLTIYSAGHALHV  504

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYG L  PKLT++ +VKLR+GINK++LLS++VGLPNVGLHFE WNAGVLGP
Sbjct  505   FINGQLSGTVYGALENPKLTFSQNVKLRSGINKLALLSISVGLPNVGLHFETWNAGVLGP  564

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLN GT D++   W YKV
Sbjct  565   VTLKGLNSGTWDMSRWKWTYKV  586


 Score =   161 bits (407),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L L+TV+GSSSVEW +GP +A  QPLTWY+ATF+AP GN PLALDMSSMGKG
Sbjct  585   KVGLKGEALGLHTVSGSSSVEWAEGPSMAQKQPLTWYRATFNAPPGNGPLALDMSSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G+C + C YAGTY+ KKC+ +CG+PSQ
Sbjct  645   QIWINGQSIGRHWPAYTARGNCGN-CYYAGTYDDKKCRTHCGEPSQ  689



>ref|XP_008242341.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase [Prunus mume]
Length=836

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/562 (74%), Positives = 483/562 (86%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QK+KDGGLDVIQTYVFWNGHEP
Sbjct  26    ASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNGHEP  85

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  86    SPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFRTDN  145

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMK+E+LF+SQGGPII+SQIENE+GPVEWEIGAPGKAYTKWA +
Sbjct  146   EPFKAAMQKFTEKIVSMMKAEQLFQSQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAR  205

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG 
Sbjct  206   MAVGLNTGVPWIMCKQEDAPDPVIDTCNGFYCENFTPNKNYKPKMWTEVWTGWYTEFGGA  265

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFS+ARFIQ  GSFVNYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL 
Sbjct  266   VPTRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLP  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHLRDLH+AIK +E ALVS+ P VT  G +QE HVF+S++G C AFL+NYD + S
Sbjct  326   REPKWGHLRDLHKAIKSSESALVSAEPSVTSLGNSQEAHVFKSKSG-CAAFLANYDTKSS  384

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV+F N QY+LPPWSISILPDCK  VYNTA + S S Q KM PV +   WQS+ EE AS
Sbjct  385   AKVSFGNGQYELPPWSISILPDCKTAVYNTARLGSQSSQMKMTPVKSALPWQSFIEESAS  444

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              D+ DT   DG+WEQINVTRD++DYLWYMT++ I+PDE F++ G+ P++T+ SAGHA+HV
Sbjct  445   XDESDTTTLDGLWEQINVTRDTTDYLWYMTDITISPDEGFIKRGESPLLTIYSAGHALHV  504

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYG L  PKLT++ +VKLR+GINK++LLS++VGLPNVGLHFE WNAGVLGP
Sbjct  505   FINGQLSGTVYGALENPKLTFSQNVKLRSGINKLALLSISVGLPNVGLHFETWNAGVLGP  564

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLN GT D++   W YKV
Sbjct  565   VTLKGLNSGTWDMSRWKWTYKV  586


 Score =   162 bits (409),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L L+TV+GSSSVEW +GP +A  QPLTWYKATF+AP GN PLALDMSSMGKG
Sbjct  585   KVGLKGEALGLHTVSGSSSVEWAEGPSMAQKQPLTWYKATFNAPPGNGPLALDMSSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G+C + C YAGTY+ KKC+ +CG+PSQ
Sbjct  645   QIWINGQSIGRHWPAYTARGNCGN-CYYAGTYDDKKCRTHCGEPSQ  689



>gb|KDO57766.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=649

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/563 (73%), Positives = 479/563 (85%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLT++ +VKLR G+NKISLLS +VGLPNVG HFEKWNAGVLG
Sbjct  515   VFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFEKWNAGVLG  574

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRD++ Q W YK+
Sbjct  575   PVTLKGLNEGTRDISKQKWTYKI  597


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDM  2317
             ++G+KGE+LSL+TV+GSSSVEW  G  LA  QP+TWYK TF+ P       LD+
Sbjct  596   KIGLKGEALSLHTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPVLGATGLDI  649



>gb|KDO57768.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
 gb|KDO57769.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=605

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/563 (73%), Positives = 479/563 (85%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLT++ +VKLR G+NKISLLS +VGLPNVG HFEKWNAGVLG
Sbjct  515   VFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFEKWNAGVLG  574

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRD++ Q W YKV
Sbjct  575   PVTLKGLNEGTRDISKQKWTYKV  597



>gb|ABV32546.1| beta-galactosidase protein 1 [Prunus persica]
Length=836

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/561 (74%), Positives = 481/561 (86%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QK+KDGGLDVIQTYVFWNGHEPS
Sbjct  27    SVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNGHEPS  86

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  87    PGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFRTDNE  146

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV+MMK+E+LF+SQGGPII+SQIENE+GPVEWEIGAPGKAYTKWA QM
Sbjct  147   PFKAAMQKFTEKIVSMMKAEQLFQSQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQM  206

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG V
Sbjct  207   AVGLNTGVPWIMCKQEDAPDPVIDTCNGFYCENFTPNKNYKPKMWTEVWTGWYTEFGGAV  266

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFS+ARFIQ  GSFVNYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL  
Sbjct  267   PTRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLPR  326

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIK +E ALVS+ P VT  G  QE HVF+S++G C AFL+NYD + SA
Sbjct  327   EPKWGHLRDLHKAIKSSESALVSAEPSVTSLGNGQEAHVFKSKSG-CAAFLANYDTKSSA  385

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F N QY+LPPW ISILPDCK  VYNTA + S S Q KM PV +   WQS+ EE ASS
Sbjct  386   KVSFGNGQYELPPWPISILPDCKTAVYNTARLGSQSSQMKMTPVKSALPWQSFVEESASS  445

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             D+ DT   DG+WEQINVTRD++DYLWYMT++ I+PDE F++ G+ P++T+ SAGHA+HVF
Sbjct  446   DESDTTTLDGLWEQINVTRDTTDYLWYMTDITISPDEGFIKRGESPLLTIYSAGHALHVF  505

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKLT++ +VK R+GINK++LLS++VGLPNVGLHFE WNAGVLGPV
Sbjct  506   INGQLSGTVYGALENPKLTFSQNVKPRSGINKLALLSISVGLPNVGLHFETWNAGVLGPV  565

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN GT D++   W YK+
Sbjct  566   TLKGLNSGTWDMSRWKWTYKI  586


 Score =   162 bits (409),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L L+TV+GSSSVEW +GP +A  QPLTWYKATF+AP GN PLALDMSSMGKG
Sbjct  585   KIGLKGEALGLHTVSGSSSVEWAEGPSMAQKQPLTWYKATFNAPPGNGPLALDMSSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G+C + C YAGTY+ KKC+ +CG+PSQ
Sbjct  645   QIWINGQSIGRHWPAYTARGNCGN-CYYAGTYDDKKCRTHCGEPSQ  689



>gb|KHN06610.1| Beta-galactosidase [Glycine soja]
Length=831

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/562 (75%), Positives = 479/562 (85%), Gaps = 3/562 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ ++NG+RRILISGSIHYPRSTP+    L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  23    ASVTYDHKAIVVNGQRRILISGSIHYPRSTPEA--NLIQKAKDGGLDVIQTYVFWNGHEP  80

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIKL Q+AGL VHLRIGPYIC EWNFGGFP+WLKYVP I FRTDN
Sbjct  81    SPGKYYFEDRYDLVKFIKLVQQAGLSVHLRIGPYICAEWNFGGFPVWLKYVPDIAFRTDN  140

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMK+EKLF++QGGPIIMSQIENEYG VEWEIGAPGKAYTKW  Q
Sbjct  141   EPFKAAMQKFTEKIVSMMKAEKLFQTQGGPIIMSQIENEYGTVEWEIGAPGKAYTKWFSQ  200

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQ+D PDPIIDTCNGYYCENF PNK YKPKM+TE WTGWYT+FGG 
Sbjct  201   MAVGLDTGVPWIMCKQQDTPDPIIDTCNGYYCENFTPNKKYKPKMWTENWTGWYTEFGGA  260

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V RRPAED+AFSVARF+QN GSFVNYYMYHGGTNF RT++ LFIATSYDYD P+DEYGL+
Sbjct  261   VPRRPAEDMAFSVARFVQNGGSFVNYYMYHGGTNFDRTSSGLFIATSYDYDGPIDEYGLL  320

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             NEPK+GHLRDLH+AIKL EPALVS  P VTW G N EVHVF++ +GAC AFL+NYD + S
Sbjct  321   NEPKWGHLRDLHKAIKLCEPALVSVDPTVTWPGNNLEVHVFKT-SGACAAFLANYDTKSS  379

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A V F N QYDLPPWSISILPDCK  V+NTA + + S   KM  V + F WQSY EE AS
Sbjct  380   AAVKFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSSLMKMTAVNSAFDWQSYNEEAAS  439

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S++ D++ A  +WEQINVTRDS+DYLWYMT+VNI  +E F++NG+ PV+TVMSAGHA+HV
Sbjct  440   SNEDDSLTAYALWEQINVTRDSTDYLWYMTDVNIDANEGFIKNGQSPVLTVMSAGHALHV  499

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYGGL   KLT+++SVKLR G NKISLLS+ VGLPNVG HFE WNAGVLGP
Sbjct  500   FINGQLSGTVYGGLDSHKLTFSDSVKLRVGNNKISLLSITVGLPNVGPHFETWNAGVLGP  559

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL+ Q W YK+
Sbjct  560   VTLKGLNEGTRDLSKQKWSYKI  581


 Score =   162 bits (409),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+LNTV+GSSSVEW  G LL   QPLTWYK TF  P GNDPLALDM SMGKG
Sbjct  580   KIGLKGEALNLNTVSGSSSVEWVQGSLLTKKQPLTWYKTTFSTPAGNDPLALDMISMGKG  639

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GRHWPGY A+GSC  +C YAGTY  KKC+ NCG+PSQ
Sbjct  640   QVWINGRSIGRHWPGYIARGSC-GDCYYAGTYTDKKCRTNCGEPSQ  684



>gb|KDO57764.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=702

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/563 (73%), Positives = 479/563 (85%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLT++ +VKLR G+NKISLLS +VGLPNVG HFEKWNAGVLG
Sbjct  515   VFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFEKWNAGVLG  574

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRD++ Q W YK+
Sbjct  575   PVTLKGLNEGTRDISKQKWTYKI  597


 Score =   155 bits (391),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TV+GSSSVEW  G  LA  QP+TWYK TF+ P GNDPLALDM +MGKG
Sbjct  596   KIGLKGEALSLHTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKG  655

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GRHWPGY   G+C   CNYAGTY +KKC+  CG+PSQ
Sbjct  656   MVWINGQSIGRHWPGYIGNGNCGG-CNYAGTYTEKKCRTYCGKPSQ  700



>ref|XP_006451459.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64699.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=702

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/563 (73%), Positives = 479/563 (85%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLT++ +VKLR G+NKISLLS +VGLPNVG HFEKWNAGVLG
Sbjct  515   VFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFEKWNAGVLG  574

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRD++ Q W YK+
Sbjct  575   PVTLKGLNEGTRDISKQKWTYKI  597


 Score =   154 bits (390),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+T++GSSSVEW  G  LA  QP+TWYK TF+ P GNDPLALDM +MGKG
Sbjct  596   KIGLKGEALSLHTISGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKG  655

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GRHWPGY   G+C   CNYAGTY +KKC+  CG+PSQ
Sbjct  656   MVWINGQSIGRHWPGYIGNGNCGG-CNYAGTYTEKKCRTYCGKPSQ  700



>gb|AES59331.2| beta-like galactosidase [Medicago truncatula]
Length=730

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/563 (73%), Positives = 474/563 (84%), Gaps = 1/563 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ +I+G+RRILISGSIHYPRSTP+MWP L QKAKDGGLDVIQTYVFWNGHEP
Sbjct  29    ASVSYDHKALVIDGQRRILISGSIHYPRSTPEMWPDLFQKAKDGGLDVIQTYVFWNGHEP  88

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG Y FE R+DLVKF+KLAQ+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPG+ FRTDN
Sbjct  89    SPGNYYFEDRFDLVKFVKLAQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGMAFRTDN  148

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV MMK+E LF++QGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA Q
Sbjct  149   EPFKAAMQKFTTKIVTMMKAESLFQTQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAAQ  208

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW MCKQEDAPDP+IDTCNGYYCENF PN+ +KPKM+TE W+GWYT FGG 
Sbjct  209   MAVGLDTGVPWDMCKQEDAPDPVIDTCNGYYCENFTPNENFKPKMWTENWSGWYTDFGGA  268

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             +  RP ED+A+SVARFIQN GSFVNYYMYHGGTNFGRT++ LFIATSYDYDAP+DEYGL 
Sbjct  269   ISHRPTEDLAYSVARFIQNRGSFVNYYMYHGGTNFGRTSSGLFIATSYDYDAPIDEYGLP  328

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFG-KNQEVHVFRSETGACVAFLSNYDPQF  1473
             NEPK+ HL++LH+AIK  EPAL+S  P VTW G KN E HV+   T  C AFL+NYD + 
Sbjct  329   NEPKWSHLKNLHKAIKQCEPALISVDPTVTWLGNKNLEAHVYYVNTSICAAFLANYDTKS  388

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A VTF N QYDLPPWS+SILPDCK VV+NTATV   S   +M PV   F WQSY+EE A
Sbjct  389   AATVTFGNGQYDLPPWSVSILPDCKTVVFNTATVNGHSFHKRMTPVETTFDWQSYSEEPA  448

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
              S D D++ A+ +WEQINVTRDSSDYLWY+T+VNI+P E F++NG+ P +T+ SAGH +H
Sbjct  449   YSSDDDSIIANALWEQINVTRDSSDYLWYLTDVNISPSESFIKNGQFPTLTINSAGHVLH  508

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGTVYGGL  PK+T++ SV L+ G NKISLLSVAVGLPNVGLHFE WN GVLG
Sbjct  509   VFVNGQLSGTVYGGLDNPKVTFSESVNLKVGNNKISLLSVAVGLPNVGLHFETWNVGVLG  568

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV L GL+EGTRDL+ Q W YKV
Sbjct  569   PVRLKGLDEGTRDLSWQKWSYKV  591


 Score =   162 bits (410),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T+TGSSS++W  G  LA  QPLTWYK TFDAP GNDP+ALDMSSMGKG
Sbjct  590   KVGLKGESLSLHTITGSSSIDWTQGSSLAKKQPLTWYKTTFDAPSGNDPVALDMSSMGKG  649

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIW+N + +GRHWP Y A G+C  ECNYAGT+   KC+ NCG+P+Q
Sbjct  650   EIWINDQSIGRHWPAYIAHGNC-DECNYAGTFTNPKCRTNCGEPTQ  694



>gb|KDO57763.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=737

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/563 (73%), Positives = 479/563 (85%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLT++ +VKLR G+NKISLLS +VGLPNVG HFEKWNAGVLG
Sbjct  515   VFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFEKWNAGVLG  574

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRD++ Q W YK+
Sbjct  575   PVTLKGLNEGTRDISKQKWTYKI  597


 Score =   155 bits (391),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TV+GSSSVEW  G  LA  QP+TWYK TF+ P GNDPLALDM +MGKG
Sbjct  596   KIGLKGEALSLHTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKG  655

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GRHWPGY   G+C   CNYAGTY +KKC+  CG+PSQ
Sbjct  656   MVWINGQSIGRHWPGYIGNGNCGG-CNYAGTYTEKKCRTYCGKPSQ  700



>ref|XP_006451461.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64701.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=737

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/563 (73%), Positives = 479/563 (85%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLT++ +VKLR G+NKISLLS +VGLPNVG HFEKWNAGVLG
Sbjct  515   VFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFEKWNAGVLG  574

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRD++ Q W YK+
Sbjct  575   PVTLKGLNEGTRDISKQKWTYKI  597


 Score =   154 bits (389),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+T++GSSSVEW  G  LA  QP+TWYK TF+ P GNDPLALDM +MGKG
Sbjct  596   KIGLKGEALSLHTISGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKG  655

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GRHWPGY   G+C   CNYAGTY +KKC+  CG+PSQ
Sbjct  656   MVWINGQSIGRHWPGYIGNGNCGG-CNYAGTYTEKKCRTYCGKPSQ  700



>ref|XP_010090040.1| hypothetical protein L484_027271 [Morus notabilis]
 gb|EXB38837.1| hypothetical protein L484_027271 [Morus notabilis]
Length=838

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/561 (74%), Positives = 475/561 (85%), Gaps = 0/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD R+ +INGKRRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  28    SVTYDHRAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  87

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FE RYDLVKFIKL  +AGLYVHLRIGPYICGEWNFGGFP+WLKYVPGI FRTDN 
Sbjct  88    EGKYYFENRYDLVKFIKLVHQAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGIAFRTDNG  147

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIVN+MK+E LFE+QGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA QM
Sbjct  148   PFKWHMQRFTEKIVNIMKAEGLFETQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAAQM  207

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDP+ID CNG+YCEN+ PN+ YKPK++TE WTGWYT+FGGPV
Sbjct  208   AVGLNTGVPWVMCKQDDAPDPVIDACNGFYCENYKPNQVYKPKLWTEAWTGWYTEFGGPV  267

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AF+VARFIQN G+F NYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL  
Sbjct  268   PHRPAEDLAFAVARFIQNGGAFFNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLPR  327

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHLRDLHRAIKLAE ALVSS P VT  G NQE HVFRS TGAC AFL+NYD  +  
Sbjct  328   DPKWGHLRDLHRAIKLAESALVSSDPTVTKLGNNQEAHVFRSNTGACAAFLANYDTNYDV  387

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F N +Y+LPPWSISILPDCK  VYNTA + + S    M PV  GFSW+SY EE AS+
Sbjct  388   KVSFGNGRYNLPPWSISILPDCKTAVYNTARLGAQSTVMWMTPVYKGFSWESYNEETASA  447

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             + GDT A DG+WEQ+ VTRD++DYLWY+T++ I  DE FL+ G  P++ + SAGHA+HVF
Sbjct  448   NSGDTTALDGLWEQVYVTRDNTDYLWYLTDITIGSDEGFLKTGNYPLLNIFSAGHALHVF  507

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +L+G+ YG L  PKLT+T ++KLRAG+NK++LLSVAVGLPNVGLHFE WNAGVLGPV
Sbjct  508   VNGQLTGSAYGSLDKPKLTFTQNIKLRAGVNKLALLSVAVGLPNVGLHFETWNAGVLGPV  567

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L+GLN GT D++   W YK+
Sbjct  568   TLNGLNTGTWDMSKWKWSYKI  588


 Score =   154 bits (389),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE L L+TV+GSSSVEW  G  LA +QPLTWYK TF+AP GN PLALDM+SMGKG
Sbjct  587   KIGLKGEKLGLHTVSGSSSVEWGQGSFLAKHQPLTWYKTTFNAPGGNGPLALDMNSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG  +GRHWP Y A G C   CNYAGT+  KKC+ +CGQPSQ
Sbjct  647   QIWINGRSIGRHWPAYKASGGCGP-CNYAGTFTDKKCRTDCGQPSQ  691



>ref|NP_001275845.1| beta-galactosidase [Citrus sinensis]
 gb|AAK31801.1| beta-galactosidase [Citrus sinensis]
Length=737

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/563 (73%), Positives = 478/563 (85%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLR LH+AIKL EPALVS  P V   G+NQE HVF S +G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRGLHKAIKLCEPALVSVDPTVKSLGENQEAHVFNSISGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIGSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVYG L  PKLT++ +VKLRAG+NKISLLS +VGLPNVG HFEKWNAGVLG
Sbjct  515   VFINGQLSGTVYGSLENPKLTFSKNVKLRAGVNKISLLSTSVGLPNVGTHFEKWNAGVLG  574

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRD++ Q W YK+
Sbjct  575   PVTLKGLNEGTRDISKQKWTYKI  597


 Score =   155 bits (391),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TV+GSSSVEW  G  LA  QP+TWYK TF+ P GNDPLALDM +MGKG
Sbjct  596   KIGLKGEALSLHTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKG  655

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GRHWPGY   G+C   CNYAGTY +KKC+  CG+PSQ
Sbjct  656   MVWINGQSIGRHWPGYIGNGNCGG-CNYAGTYTEKKCRTYCGKPSQ  700



>ref|NP_001265889.1| beta-galactosidase-like precursor [Cicer arietinum]
 emb|CAA09457.1| beta-galactosidase [Cicer arietinum]
Length=723

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/562 (73%), Positives = 472/562 (84%), Gaps = 0/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +I+G+RRILISGSIHYPRSTP+MWP L QKAK+GGLDVIQTYVFWNGHEP
Sbjct  23    ASVTYDHKTIVIDGQRRILISGSIHYPRSTPEMWPALFQKAKEGGLDVIQTYVFWNGHEP  82

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE R+DLVKFIKLAQ+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  83    SPGKYYFEDRFDLVKFIKLAQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  142

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMK+E LF++QGGPIIMSQIENEYGPVEW IGAPGKAYT WA Q
Sbjct  143   EPFKAAMQKFTTKIVSMMKAENLFQNQGGPIIMSQIENEYGPVEWNIGAPGKAYTNWAAQ  202

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW MCKQEDAPDP+IDTCNGYYCENF PNK YKPKM+TE W+GWYT FG  
Sbjct  203   MAVGLDTGVPWDMCKQEDAPDPVIDTCNGYYCENFTPNKNYKPKMWTENWSGWYTDFGNA  262

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             +  RP ED+A+SVARFIQN GSFVNYYMYHGGTNFGRT++ LFIATSYDYDAP+DEYGL 
Sbjct  263   ICYRPVEDLAYSVARFIQNRGSFVNYYMYHGGTNFGRTSSGLFIATSYDYDAPIDEYGLT  322

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             NEPK+ HLRDLH+AIK  EPALVS  P +T  G   E HV+ + T  C AFL+NYD + +
Sbjct  323   NEPKWSHLRDLHKAIKQCEPALVSVDPTITSLGNKLEAHVYSTGTSVCAAFLANYDTKSA  382

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A VTF N +YDLPPWS+SILPDCK  V+NTA V + S Q  MI   + F WQSY EE A 
Sbjct  383   ATVTFGNGKYDLPPWSVSILPDCKTDVFNTAKVGAQSSQKTMISTNSTFDWQSYIEEPAF  442

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S + D++ A+ +WEQINVTRDSSDYLWY+T+VNI+P+E+F++NG+ P++ VMSAGH +HV
Sbjct  443   SSEDDSITAEALWEQINVTRDSSDYLWYLTDVNISPNEDFIKNGQYPILNVMSAGHVLHV  502

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +LSGTVYG L  PKLT++NSV L  G NKISLLSVAVGLPNVGLHFE WN GVLGP
Sbjct  503   FVNGQLSGTVYGVLDNPKLTFSNSVNLTVGNNKISLLSVAVGLPNVGLHFETWNVGVLGP  562

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL+ Q W YKV
Sbjct  563   VTLKGLNEGTRDLSWQKWSYKV  584


 Score =   162 bits (410),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T+TG SSV+W  G LLA  QPLTWYKATF+AP GNDPL LDMSSMGKG
Sbjct  583   KVGLKGESLSLHTITGGSSVDWTQGSLLAKKQPLTWYKATFNAPAGNDPLGLDMSSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIWVN + +GRHWPGY A GSC  +C+YAGT+   KC+ NCG P+Q
Sbjct  643   EIWVNDQSIGRHWPGYIAHGSC-GDCDYAGTFTNTKCRTNCGNPTQ  687



>gb|EPS64494.1| beta-galactosidase, partial [Genlisea aurea]
Length=736

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/576 (72%), Positives = 474/576 (82%), Gaps = 14/576 (2%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              +VSYD ++ I+ GK RILISGSIHYPRSTP+MWP L+ KAK GGLDVIQTYVFW+GHEP
Sbjct  23    ATVSYDDKAIIVGGKPRILISGSIHYPRSTPEMWPDLIAKAKAGGLDVIQTYVFWSGHEP  82

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+YNFEGR++LV+FIKL  +AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGIEFRTDN
Sbjct  83    SPGRYNFEGRFNLVEFIKLVHRAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIEFRTDN  142

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQGFV KIV++MKSE LFE QGGPIIMSQIENEYGP+EW+IGAPGKAYT WA +
Sbjct  143   EPFKQAMQGFVTKIVSLMKSENLFEPQGGPIIMSQIENEYGPIEWQIGAPGKAYTAWAAK  202

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVG  TGVPWIMCKQE APDPIIDTCNG+YCE F PN+P KPKM+TE W+GWYTQFGGP
Sbjct  203   MAVGQDTGVPWIMCKQETAPDPIIDTCNGFYCEGFRPNRPNKPKMWTEAWSGWYTQFGGP  262

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYM-------------YHGGTNFGRTAAALFIATS  1257
               +RPAEDIAF+VARFI NNGSF+NYYM             YHGGTNFGR++A LFIATS
Sbjct  263   TPQRPAEDIAFAVARFIHNNGSFINYYMAKIISTFAVSMIQYHGGTNFGRSSAGLFIATS  322

Query  1258  YDYDAPLDEYGLVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGA  1437
             YDYDAPLDEYGL NEPKY HL +LH+AIK +E ALVSSYP V+W G NQE+HVFRS  GA
Sbjct  323   YDYDAPLDEYGLPNEPKYSHLTNLHKAIKQSESALVSSYPEVSWPGTNQEIHVFRSANGA  382

Query  1438  CVAFLSNYDPQFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTA-TVRSPSLQTKMIPVG  1614
             C AFLSNYD   S + TF N +Y LPPWSISILPDC    +NTA  + S   + KM  + 
Sbjct  383   CAAFLSNYDTTLSKEFTFQNKKYVLPPWSISILPDCSTEAFNTAKQITSAGSKAKMTSLN  442

Query  1615  NGFSWQSYTEEIASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKD  1794
                SWQSY EE AS+DD D ++  G+WEQ+NVTRDSSDYLWY+T+V+IA DE FLR G  
Sbjct  443   RALSWQSYNEETASADDKDALSMLGLWEQVNVTRDSSDYLWYLTQVDIASDEGFLRTGTG  502

Query  1795  PVVTVMSAGHAMHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNV  1974
             P++TVMSAGHA+HVFIN +LSG VYG L  PKLTY+ +V +RAG NKIS+LSV+VGLPNV
Sbjct  503   PILTVMSAGHALHVFINGQLSGYVYGSLDNPKLTYSKNVNMRAGTNKISILSVSVGLPNV  562

Query  1975  GLHFEKWNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             G  +E+WN GVLGPV+L GLNEGTRDLT Q+W YKV
Sbjct  563   GFQYERWNTGVLGPVTLKGLNEGTRDLTKQSWSYKV  598


 Score =   168 bits (425),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KG+ L L+ VTGSSSVEW  G L A+NQPLTWYKA+F+APEG++P+ALDMSSMGKG
Sbjct  597   KVGLKGQILGLDRVTGSSSVEWVQGSLFAANQPLTWYKASFNAPEGSNPVALDMSSMGKG  656

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIWVNGE +GRHWP YTA+GSC  ECNYAGT+   KCQ NCGQPSQ
Sbjct  657   EIWVNGESLGRHWPAYTAKGSC-GECNYAGTFTDTKCQTNCGQPSQ  701



>gb|KEH39519.1| beta-galactosidase [Medicago truncatula]
Length=590

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/564 (73%), Positives = 480/564 (85%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++  ING+ RILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEP
Sbjct  26    ASVSYDSKAITINGQSRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  85

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FEG YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  86    SPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  145

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK  MQ F  KIV+MMK+++LFESQGGPIIMSQIENEYGP+E+EIGAPGK+YTKWA  
Sbjct  146   EPFKFQMQKFTEKIVDMMKADRLFESQGGPIIMSQIENEYGPMEYEIGAPGKSYTKWAAD  205

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  206   MAVGLGTGVPWIMCKQDDAPDPVINTCNGFYCDYFSPNKDYKPKMWTEAWTGWFTEFGGP  265

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+
Sbjct  266   VPHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLL  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL+EPAL+S  P VT  G  QE HVF+S++GAC AFL NY+P+  
Sbjct  326   QQPKWGHLKDLHRAIKLSEPALISGDPTVTRIGNYQEAHVFKSKSGACAAFLGNYNPKAF  385

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             A V F N+ Y+LPPWSISILPDCKN VYNTA V S S Q KM  +P+  G SWQ +TE+ 
Sbjct  386   ATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSAQMKMTRVPIHGGLSWQVFTEQT  445

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             AS+DD  +    G+ EQ+N TRD +DYLWY T+V I P+E FLR+GKDPV+TV+SAGHA+
Sbjct  446   ASTDD-SSFTMTGLLEQLNTTRDLTDYLWYSTDVVIDPNEGFLRSGKDPVLTVLSAGHAL  504

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVFINS+LSGT+YG L FPKLT++ +VKL  G+NKISLLSVAVGLPNVG HFE WNAGVL
Sbjct  505   HVFINSQLSGTIYGSLEFPKLTFSQNVKLIPGVNKISLLSVAVGLPNVGPHFETWNAGVL  564

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GP++L+GL+EG RDL+ Q W YKV
Sbjct  565   GPITLNGLDEGRRDLSWQKWSYKV  588



>ref|XP_004486826.1| PREDICTED: beta-galactosidase 1-like [Cicer arietinum]
Length=847

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/564 (73%), Positives = 477/564 (85%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEP
Sbjct  32    ASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  91

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SP KY FEG YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  92    SPDKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  151

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK  MQ F  KIV MMK E+L+ESQGGPII+SQIENEYGPVE+EIGAPGK+YTKWA  
Sbjct  152   EPFKFQMQKFTEKIVGMMKEERLYESQGGPIILSQIENEYGPVEYEIGAPGKSYTKWAAD  211

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  212   MAIGLGTGVPWIMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGP  271

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+
Sbjct  272   VPHRPAEDLAFSVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLL  331

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL+EPALVS  P VT  G  QE HVF+S++GAC AFL+NY+P+  
Sbjct  332   RQPKWGHLKDLHRAIKLSEPALVSGDPTVTRIGNYQEAHVFKSKSGACAAFLANYNPKSY  391

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             A V F N+ Y+LPPWSISILPDCKN VYNTA V S S Q KM  +P+  G SWQ +TE+ 
Sbjct  392   ATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSAQMKMTRVPIHGGLSWQVFTEQT  451

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             AS+DD  +    G+ EQ+N TRD +DYLWY T+V I  DE FL +GKDPV+TV+SAGHA+
Sbjct  452   ASTDD-SSFTMTGLLEQLNTTRDLTDYLWYSTDVVIDTDEGFLSSGKDPVLTVLSAGHAL  510

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVF+N +LSGT+YG L FPKLT++ +VKLR G+NKISLLSVAVGLPNVG HFE WNAGVL
Sbjct  511   HVFVNDQLSGTIYGSLEFPKLTFSQNVKLRPGVNKISLLSVAVGLPNVGPHFETWNAGVL  570

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GP++L+GLNEG RDLT Q W YKV
Sbjct  571   GPITLNGLNEGRRDLTWQKWSYKV  594


 Score =   128 bits (321),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GESLSL++++GSSSV+W  G L++  QPLTWYK TFDAP+G  P ALDM SMGKG
Sbjct  593   KVGLNGESLSLHSLSGSSSVDWIQGSLVSQRQPLTWYKTTFDAPDGIAPFALDMGSMGKG  652

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A G+C  +C+YAGTYN+ KC+ NCG+ SQ
Sbjct  653   QVWLNGQNIGRYWPAYKASGTC-DDCDYAGTYNENKCRSNCGEASQ  697



>ref|XP_003597608.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08398.1| D-galactoside/L-rhamnose binding SUEL lectin; Galactose-binding 
like [Medicago truncatula]
 gb|AES67859.1| beta-galactosidase [Medicago truncatula]
Length=841

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/564 (73%), Positives = 480/564 (85%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++  ING+ RILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEP
Sbjct  26    ASVSYDSKAITINGQSRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  85

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FEG YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  86    SPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  145

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK  MQ F  KIV+MMK+++LFESQGGPIIMSQIENEYGP+E+EIGAPGK+YTKWA  
Sbjct  146   EPFKFQMQKFTEKIVDMMKADRLFESQGGPIIMSQIENEYGPMEYEIGAPGKSYTKWAAD  205

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  206   MAVGLGTGVPWIMCKQDDAPDPVINTCNGFYCDYFSPNKDYKPKMWTEAWTGWFTEFGGP  265

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+
Sbjct  266   VPHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLL  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL+EPAL+S  P VT  G  QE HVF+S++GAC AFL NY+P+  
Sbjct  326   QQPKWGHLKDLHRAIKLSEPALISGDPTVTRIGNYQEAHVFKSKSGACAAFLGNYNPKAF  385

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             A V F N+ Y+LPPWSISILPDCKN VYNTA V S S Q KM  +P+  G SWQ +TE+ 
Sbjct  386   ATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSAQMKMTRVPIHGGLSWQVFTEQT  445

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             AS+DD  +    G+ EQ+N TRD +DYLWY T+V I P+E FLR+GKDPV+TV+SAGHA+
Sbjct  446   ASTDD-SSFTMTGLLEQLNTTRDLTDYLWYSTDVVIDPNEGFLRSGKDPVLTVLSAGHAL  504

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVFINS+LSGT+YG L FPKLT++ +VKL  G+NKISLLSVAVGLPNVG HFE WNAGVL
Sbjct  505   HVFINSQLSGTIYGSLEFPKLTFSQNVKLIPGVNKISLLSVAVGLPNVGPHFETWNAGVL  564

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GP++L+GL+EG RDL+ Q W YKV
Sbjct  565   GPITLNGLDEGRRDLSWQKWSYKV  588


 Score =   127 bits (320),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE+LSL+++ GSSSVEW  G L++  QPLTWYK TFDAP+G  P ALDM SMGKG
Sbjct  587   KVGLHGEALSLHSLGGSSSVEWVQGSLVSRMQPLTWYKTTFDAPDGIAPFALDMGSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A G+C + C+YAGTYN+ KC+ NCG+ SQ
Sbjct  647   QVWLNGQNLGRYWPAYKASGTCDN-CDYAGTYNENKCRSNCGEASQ  691



>gb|KEH37473.1| beta-like galactosidase [Medicago truncatula]
Length=667

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/562 (73%), Positives = 474/562 (84%), Gaps = 0/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +INGKRRILISGSIHYPRSTPQMWP L+QKAKDGG+DVI+TYVFWNGHEP
Sbjct  26    ASVTYDHKAIVINGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIETYVFWNGHEP  85

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             S GKY FE R+DLVKFIK+ Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTDN
Sbjct  86    SQGKYYFEDRFDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVAFRTDN  145

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV++MKSE LF+SQGGPII+SQIENEYGPVEWEIGAPGK+YTKW  Q
Sbjct  146   EPFKAAMQKFTTKIVSIMKSENLFQSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWFSQ  205

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDPIIDTCNGYYCENF PNK YKPKM+TE WTGWYT FG  
Sbjct  206   MAVGLNTGVPWVMCKQEDAPDPIIDTCNGYYCENFSPNKNYKPKMWTENWTGWYTDFGTA  265

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARF+QN GS+VNYYMYHGGTNFGRT++ LFIATSYDYDAP+DEYGL+
Sbjct  266   VPYRPAEDLAFSVARFVQNRGSYVNYYMYHGGTNFGRTSSGLFIATSYDYDAPIDEYGLI  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             +EPK+GHLRDLH+AIK  E ALVS  P V+W GKN EVH++++  GAC AFL+NYD    
Sbjct  326   SEPKWGHLRDLHKAIKQCESALVSVDPTVSWPGKNLEVHLYKTSFGACAAFLANYDTGSW  385

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV F N  YDLPPWSISILPDCK  V+NTA VR+P +   M P  + F+WQSY E+ A 
Sbjct  386   AKVAFGNGHYDLPPWSISILPDCKTEVFNTAKVRAPRVHRSMTPANSAFNWQSYNEQPAF  445

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S +  +  A+G+ EQ++ T D SDYLWYMT+VNI+P+E F++NG++PV+T MSAGH +HV
Sbjct  446   SGESGSWTANGLLEQLSQTWDKSDYLWYMTDVNISPNEGFIKNGQNPVLTAMSAGHVLHV  505

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +  GT YG L  PKLT++NSVKLR G NKISLLSVAVGL NVG+H+EKWN GVLGP
Sbjct  506   FINGQFWGTAYGSLDNPKLTFSNSVKLRVGNNKISLLSVAVGLSNVGVHYEKWNVGVLGP  565

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL+ Q W YK+
Sbjct  566   VTLKGLNEGTRDLSKQKWSYKI  587


 Score = 54.3 bits (129),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKA  2272
             ++G+KGESL+L+T +GSSSV+W  G  L+  QPLTWYK 
Sbjct  586   KIGLKGESLNLHTTSGSSSVKWTQGSFLSKKQPLTWYKV  624



>ref|XP_011072510.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/563 (73%), Positives = 475/563 (84%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
              GSVSYD +S  ING+R+ILISGSIHYPRSTP+MWP L+QKAK+GG+DVIQTYVFWNGHE
Sbjct  28    EGSVSYDSKSISINGRRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHE  87

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P PGKY FEGRYDLVKFIKL Q+AGLYVHLRIGPY C EWNFGGFP+WLKYVPGI FRTD
Sbjct  88    PEPGKYYFEGRYDLVKFIKLVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFRTD  147

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AMQ F  KIVNMMKSEKL+E+QGGPII+SQIENEYGP+E+E+G PG+AYT+WA 
Sbjct  148   NGPFKAAMQKFTTKIVNMMKSEKLYETQGGPIILSQIENEYGPMEYELGEPGRAYTEWAA  207

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAV L TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG
Sbjct  208   KMAVDLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGG  267

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RP ED+AFSVA+FIQ  GS++NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  268   PVPYRPVEDLAFSVAKFIQKGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  327

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS+ P VT  G NQE HVF+S++GAC AFL+NYD   
Sbjct  328   LRQPKWGHLKDLHRAIKLCEPALVSADPTVTSLGNNQEAHVFKSKSGACAAFLANYDQHS  387

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
              AKV+F N+ Y+LPPWSISILPDCKN VYNTA + + S Q KM PV  GFSW+SY EE A
Sbjct  388   FAKVSFGNMHYNLPPWSISILPDCKNTVYNTARIGAQSAQMKMTPVSKGFSWESYNEETA  447

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S DD ++    G+ EQIN TRD++DYLWY T+V I P E F+R GK PV+TV+SAGHA+H
Sbjct  448   SHDD-NSFTMVGLVEQINTTRDNTDYLWYTTDVKIDPSEGFMRGGKWPVLTVLSAGHALH  506

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGT YG L  P+LT++  V L+AG+N+I+LLS+AVGLPNVG HFE W AGVLG
Sbjct  507   VFINGQLSGTAYGSLEDPRLTFSEGVNLKAGVNQIALLSIAVGLPNVGPHFETWKAGVLG  566

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSLSGLNEG RDLT Q W YKV
Sbjct  567   PVSLSGLNEGKRDLTWQKWSYKV  589


 Score =   122 bits (307),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GESLSL++++GSSSVEW +G  ++  QPLTWYK TF+APEG++PLALDM+SM KG
Sbjct  588   KVGLRGESLSLHSLSGSSSVEWVEGTYVSERQPLTWYKTTFNAPEGDEPLALDMNSMSKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+W  Y A G C   CNYAG +N+KKC  NCG+ SQ
Sbjct  648   QVWINGQSIGRYWNQYKASGDCVP-CNYAGWFNEKKCLGNCGEASQ  692



>ref|XP_008450854.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=723

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/562 (72%), Positives = 472/562 (84%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +I+GKRRILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWNGHEP
Sbjct  24    ASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+Y FE RYDLV+F+KL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  84    SPGQYYFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  143

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIV+MMK EKL+ SQGGPII+SQIENEYGPVEWEIGAPGK+YTKWA Q
Sbjct  144   GPFKAAMQKFTAKIVSMMKGEKLYHSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  203

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL TGVPW+MCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE WTGW+T+FGGP
Sbjct  204   MALGLDTGVPWVMCKQEDAPDPVIDTCNGFYCENFEPNKAYKPKMWTEAWTGWFTEFGGP  263

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED+A++VARFIQN GS +NYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL+
Sbjct  264   VPYRPVEDLAYAVARFIQNRGSLINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLI  323

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHLRDLH+AIKL EPALVS  P V+  G  QE HVF + +G C AFL+NYDP  S
Sbjct  324   RQPKWGHLRDLHKAIKLCEPALVSVDPTVSSLGSKQEAHVFDTRSGQCAAFLANYDPSTS  383

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              +V F N  YDLPPWS+SILPDCK VV+NTA V +PS   KM P+ + FSW SY EE AS
Sbjct  384   VRVIFGNHPYDLPPWSVSILPDCKTVVFNTAKVNAPSYWPKMTPI-SSFSWHSYNEETAS  442

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +   DT    G+ EQI+VTRD +DYLWYMT++ I  +E FL++G+ P++T+ SAGHA+HV
Sbjct  443   AYADDTTTMAGLVEQISVTRDGTDYLWYMTDIRIDSNEGFLKSGQWPLLTIFSAGHALHV  502

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYGGL  PKLT++  V LR G+NK+S+LSVAVGLPNVGLHFE WNAG+LGP
Sbjct  503   FINGQLSGTVYGGLDNPKLTFSKYVNLRPGVNKLSMLSVAVGLPNVGLHFETWNAGILGP  562

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRD++   W YKV
Sbjct  563   VTLKGLNEGTRDMSGYKWSYKV  584


 Score =   152 bits (383),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGES++L+T++GSSSVEW  G L++  QPLTWYK TF+AP GN+PLALDM SMGKG
Sbjct  583   KVGLKGESMNLHTISGSSSVEWMTGSLVSQKQPLTWYKTTFNAPGGNEPLALDMGSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GRHWP YTA+GSC  +C Y G + +KKC  +CG+PSQ
Sbjct  643   QVWINGRSIGRHWPAYTARGSC-GKCYYGGIFTEKKCHYSCGEPSQ  687



>gb|AES65414.2| beta-like galactosidase [Medicago truncatula]
Length=692

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/562 (73%), Positives = 474/562 (84%), Gaps = 0/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +INGKRRILISGSIHYPRSTPQMWP L+QKAKDGG+DVI+TYVFWNGHEP
Sbjct  26    ASVTYDHKAIVINGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIETYVFWNGHEP  85

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             S GKY FE R+DLVKFIK+ Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTDN
Sbjct  86    SQGKYYFEDRFDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVAFRTDN  145

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV++MKSE LF+SQGGPII+SQIENEYGPVEWEIGAPGK+YTKW  Q
Sbjct  146   EPFKAAMQKFTTKIVSIMKSENLFQSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWFSQ  205

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDPIIDTCNGYYCENF PNK YKPKM+TE WTGWYT FG  
Sbjct  206   MAVGLNTGVPWVMCKQEDAPDPIIDTCNGYYCENFSPNKNYKPKMWTENWTGWYTDFGTA  265

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARF+QN GS+VNYYMYHGGTNFGRT++ LFIATSYDYDAP+DEYGL+
Sbjct  266   VPYRPAEDLAFSVARFVQNRGSYVNYYMYHGGTNFGRTSSGLFIATSYDYDAPIDEYGLI  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             +EPK+GHLRDLH+AIK  E ALVS  P V+W GKN EVH++++  GAC AFL+NYD    
Sbjct  326   SEPKWGHLRDLHKAIKQCESALVSVDPTVSWPGKNLEVHLYKTSFGACAAFLANYDTGSW  385

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV F N  YDLPPWSISILPDCK  V+NTA VR+P +   M P  + F+WQSY E+ A 
Sbjct  386   AKVAFGNGHYDLPPWSISILPDCKTEVFNTAKVRAPRVHRSMTPANSAFNWQSYNEQPAF  445

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S +  +  A+G+ EQ++ T D SDYLWYMT+VNI+P+E F++NG++PV+T MSAGH +HV
Sbjct  446   SGESGSWTANGLLEQLSQTWDKSDYLWYMTDVNISPNEGFIKNGQNPVLTAMSAGHVLHV  505

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +  GT YG L  PKLT++NSVKLR G NKISLLSVAVGL NVG+H+EKWN GVLGP
Sbjct  506   FINGQFWGTAYGSLDNPKLTFSNSVKLRVGNNKISLLSVAVGLSNVGVHYEKWNVGVLGP  565

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL+ Q W YK+
Sbjct  566   VTLKGLNEGTRDLSKQKWSYKI  587


 Score =   164 bits (414),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESL+L+T +GSSSV+W  G  L+  QPLTWYK TF+AP GNDPLALDMSSMGKG
Sbjct  586   KIGLKGESLNLHTTSGSSSVKWTQGSFLSKKQPLTWYKTTFNAPAGNDPLALDMSSMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIWVNG+ +GRHWP Y A+G+C S CNYAGT+  KKC+ NCGQP+Q
Sbjct  646   EIWVNGQSIGRHWPAYIARGNCGS-CNYAGTFTDKKCRTNCGQPTQ  690



>gb|KDO57767.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=635

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/593 (69%), Positives = 479/593 (81%), Gaps = 31/593 (5%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELS------------------------------GTVYGGLAFPKLTYTNSVKLRA  1923
             VFIN +LS                              GTVYG L  PKLT++ +VKLR 
Sbjct  515   VFINGQLSGKRSIMTDMIMFLGANIACQQLTFSFYPYAGTVYGSLENPKLTFSKNVKLRP  574

Query  1924  GINKISLLSVAVGLPNVGLHFEKWNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             G+NKISLLS +VGLPNVG HFEKWNAGVLGPV+L GLNEGTRD++ Q W YKV
Sbjct  575   GVNKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKV  627



>ref|XP_003595163.1| Beta-galactosidase [Medicago truncatula]
 gb|KEH37472.1| beta-like galactosidase [Medicago truncatula]
Length=607

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/562 (73%), Positives = 474/562 (84%), Gaps = 0/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +INGKRRILISGSIHYPRSTPQMWP L+QKAKDGG+DVI+TYVFWNGHEP
Sbjct  26    ASVTYDHKAIVINGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIETYVFWNGHEP  85

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             S GKY FE R+DLVKFIK+ Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTDN
Sbjct  86    SQGKYYFEDRFDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVAFRTDN  145

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV++MKSE LF+SQGGPII+SQIENEYGPVEWEIGAPGK+YTKW  Q
Sbjct  146   EPFKAAMQKFTTKIVSIMKSENLFQSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWFSQ  205

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDPIIDTCNGYYCENF PNK YKPKM+TE WTGWYT FG  
Sbjct  206   MAVGLNTGVPWVMCKQEDAPDPIIDTCNGYYCENFSPNKNYKPKMWTENWTGWYTDFGTA  265

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARF+QN GS+VNYYMYHGGTNFGRT++ LFIATSYDYDAP+DEYGL+
Sbjct  266   VPYRPAEDLAFSVARFVQNRGSYVNYYMYHGGTNFGRTSSGLFIATSYDYDAPIDEYGLI  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             +EPK+GHLRDLH+AIK  E ALVS  P V+W GKN EVH++++  GAC AFL+NYD    
Sbjct  326   SEPKWGHLRDLHKAIKQCESALVSVDPTVSWPGKNLEVHLYKTSFGACAAFLANYDTGSW  385

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV F N  YDLPPWSISILPDCK  V+NTA VR+P +   M P  + F+WQSY E+ A 
Sbjct  386   AKVAFGNGHYDLPPWSISILPDCKTEVFNTAKVRAPRVHRSMTPANSAFNWQSYNEQPAF  445

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S +  +  A+G+ EQ++ T D SDYLWYMT+VNI+P+E F++NG++PV+T MSAGH +HV
Sbjct  446   SGESGSWTANGLLEQLSQTWDKSDYLWYMTDVNISPNEGFIKNGQNPVLTAMSAGHVLHV  505

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +  GT YG L  PKLT++NSVKLR G NKISLLSVAVGL NVG+H+EKWN GVLGP
Sbjct  506   FINGQFWGTAYGSLDNPKLTFSNSVKLRVGNNKISLLSVAVGLSNVGVHYEKWNVGVLGP  565

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL+ Q W YKV
Sbjct  566   VTLKGLNEGTRDLSKQKWSYKV  587



>ref|XP_003546676.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=840

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/565 (74%), Positives = 477/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTD
Sbjct  86    PSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK  MQ F  KIV++MK+E+L+ESQGGPIIMSQIENEYGP+E+EIGA GKAYTKWA 
Sbjct  146   NEPFKHQMQKFTTKIVDLMKAERLYESQGGPIIMSQIENEYGPMEYEIGAAGKAYTKWAA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA+GL TGVPW+MCKQ+D PDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG
Sbjct  206   EMAMGLGTGVPWVMCKQDDTPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  266   PVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  325

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVF+S++GAC AFL+NY+P+ 
Sbjct  326   LRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEAHVFKSKSGACAAFLANYNPKS  385

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              A V F N+ Y+LPPWSISILPDCKN VYNTA V S S Q KM  +P+  GFSW S+ EE
Sbjct  386   YATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSAQMKMTRVPIHGGFSWLSFNEE  445

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               ++DD  +    G+ EQ+N TRD SDYLWY T+V + P+E FLRNGKDPV+TV SAGHA
Sbjct  446   TTTTDD-SSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPNEGFLRNGKDPVLTVFSAGHA  504

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVFIN +LSGT YG L FPKLT+   VKLRAG+NKISLLSVAVGLPNVG HFE WNAGV
Sbjct  505   LHVFINGQLSGTAYGSLEFPKLTFNEGVKLRAGVNKISLLSVAVGLPNVGPHFETWNAGV  564

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGP+SLSGLNEG RDL+ Q W YKV
Sbjct  565   LGPISLSGLNEGRRDLSWQKWSYKV  589


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE LSL++++GSSSVEW  G L++  QPLTWYK TFDAP G  PLALDM SMGKG
Sbjct  588   KVGLKGEILSLHSLSGSSSVEWIQGSLVSQRQPLTWYKTTFDAPAGTAPLALDMDSMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A G+C   C+YAGTYN+ KC+ NCG+ SQ
Sbjct  648   QVWLNGQNLGRYWPAYKASGTCDY-CDYAGTYNENKCRSNCGEASQ  692



>ref|XP_003595162.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08770.1| Galactose-binding like [Medicago truncatula]
 gb|AES65413.1| beta-like galactosidase [Medicago truncatula]
Length=726

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/562 (73%), Positives = 474/562 (84%), Gaps = 0/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +INGKRRILISGSIHYPRSTPQMWP L+QKAKDGG+DVI+TYVFWNGHEP
Sbjct  26    ASVTYDHKAIVINGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIETYVFWNGHEP  85

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             S GKY FE R+DLVKFIK+ Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTDN
Sbjct  86    SQGKYYFEDRFDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVAFRTDN  145

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV++MKSE LF+SQGGPII+SQIENEYGPVEWEIGAPGK+YTKW  Q
Sbjct  146   EPFKAAMQKFTTKIVSIMKSENLFQSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWFSQ  205

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDPIIDTCNGYYCENF PNK YKPKM+TE WTGWYT FG  
Sbjct  206   MAVGLNTGVPWVMCKQEDAPDPIIDTCNGYYCENFSPNKNYKPKMWTENWTGWYTDFGTA  265

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARF+QN GS+VNYYMYHGGTNFGRT++ LFIATSYDYDAP+DEYGL+
Sbjct  266   VPYRPAEDLAFSVARFVQNRGSYVNYYMYHGGTNFGRTSSGLFIATSYDYDAPIDEYGLI  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             +EPK+GHLRDLH+AIK  E ALVS  P V+W GKN EVH++++  GAC AFL+NYD    
Sbjct  326   SEPKWGHLRDLHKAIKQCESALVSVDPTVSWPGKNLEVHLYKTSFGACAAFLANYDTGSW  385

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV F N  YDLPPWSISILPDCK  V+NTA VR+P +   M P  + F+WQSY E+ A 
Sbjct  386   AKVAFGNGHYDLPPWSISILPDCKTEVFNTAKVRAPRVHRSMTPANSAFNWQSYNEQPAF  445

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S +  +  A+G+ EQ++ T D SDYLWYMT+VNI+P+E F++NG++PV+T MSAGH +HV
Sbjct  446   SGESGSWTANGLLEQLSQTWDKSDYLWYMTDVNISPNEGFIKNGQNPVLTAMSAGHVLHV  505

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +  GT YG L  PKLT++NSVKLR G NKISLLSVAVGL NVG+H+EKWN GVLGP
Sbjct  506   FINGQFWGTAYGSLDNPKLTFSNSVKLRVGNNKISLLSVAVGLSNVGVHYEKWNVGVLGP  565

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRDL+ Q W YK+
Sbjct  566   VTLKGLNEGTRDLSKQKWSYKI  587


 Score =   164 bits (414),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESL+L+T +GSSSV+W  G  L+  QPLTWYK TF+AP GNDPLALDMSSMGKG
Sbjct  586   KIGLKGESLNLHTTSGSSSVKWTQGSFLSKKQPLTWYKTTFNAPAGNDPLALDMSSMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIWVNG+ +GRHWP Y A+G+C S CNYAGT+  KKC+ NCGQP+Q
Sbjct  646   EIWVNGQSIGRHWPAYIARGNCGS-CNYAGTFTDKKCRTNCGQPTQ  690



>gb|KHN32687.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/565 (74%), Positives = 477/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  17    KASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  76

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTD
Sbjct  77    PSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  136

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK  MQ F  KIV++MK+E+L+ESQGGPIIMSQIENEYGP+E+EIGA GKAYTKWA 
Sbjct  137   NEPFKHQMQKFTTKIVDLMKAERLYESQGGPIIMSQIENEYGPMEYEIGAAGKAYTKWAA  196

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA+GL TGVPW+MCKQ+D PDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG
Sbjct  197   EMAMGLGTGVPWVMCKQDDTPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGG  256

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  257   PVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  316

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVF+S++GAC AFL+NY+P+ 
Sbjct  317   LRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEAHVFKSKSGACAAFLANYNPKS  376

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              A V F N+ Y+LPPWSISILPDCKN VYNTA V S S Q KM  +P+  GFSW S+ EE
Sbjct  377   YATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSAQMKMTRVPIHGGFSWLSFNEE  436

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               ++DD  +    G+ EQ+N TRD SDYLWY T+V + P+E FLRNGKDPV+TV SAGHA
Sbjct  437   TTTTDD-SSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPNEGFLRNGKDPVLTVFSAGHA  495

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVFIN +LSGT YG L FPKLT+   VKLRAG+NKISLLSVAVGLPNVG HFE WNAGV
Sbjct  496   LHVFINGQLSGTAYGSLEFPKLTFNEGVKLRAGVNKISLLSVAVGLPNVGPHFETWNAGV  555

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGP+SLSGLNEG RDL+ Q W YKV
Sbjct  556   LGPISLSGLNEGRRDLSWQKWSYKV  580


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE LSL++++GSSSVEW  G L++  QPLTWYK TFDAP G  PLALDM SMGKG
Sbjct  579   KVGLKGEILSLHSLSGSSSVEWIQGSLVSQRQPLTWYKTTFDAPAGTAPLALDMDSMGKG  638

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A G+C   C+YAGTYN+ KC+ NCG+ SQ
Sbjct  639   QVWLNGQNLGRYWPAYKASGTCDY-CDYAGTYNENKCRSNCGEASQ  683



>ref|XP_004158444.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase-like [Cucumis 
sativus]
Length=725

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/562 (72%), Positives = 474/562 (84%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ IING+RRILISGSIHYPRS PQMWP L+QKAKDGGLDVI+TYVFWNGHEP
Sbjct  24    ASVTYDHKAIIINGRRRILISGSIHYPRSIPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+YNFE RYDLV+F+KL  +AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  84    SPGQYNFEDRYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  143

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIV +MK EKL+ESQGGPII+SQIENEYGPVEWEIGAPGK+YTKWA Q
Sbjct  144   GPFKAAMQKFTEKIVGLMKGEKLYESQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  203

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL TGVPW+MCKQ+DAPDP+IDTCNG+YCENF PNK YKPKM+TE WTGW+T+FGGP
Sbjct  204   MALGLNTGVPWVMCKQDDAPDPVIDTCNGFYCENFKPNKVYKPKMWTEAWTGWFTEFGGP  263

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
                RP ED+A+SVARFIQN GSF+NYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL+
Sbjct  264   APYRPVEDMAYSVARFIQNGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLL  323

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+ HLRDLH+AIKL EPALVS  P V++ G NQE HVF++ +G+C AFL+NYD   S
Sbjct  324   REPKWSHLRDLHKAIKLCEPALVSVDPTVSYLGSNQEAHVFKTRSGSCAAFLANYDASSS  383

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A VTF N QYDLPPWS+SILPDCK+V++NTA V +P+ Q KM PV + FSW SY EE AS
Sbjct  384   ATVTFGNNQYDLPPWSVSILPDCKSVIFNTAKVGAPTSQPKMTPV-SSFSWLSYNEETAS  442

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +   DT    G+ EQI+VTRDS+DYLWYMT++ I P+E FL++G+ P++TV SAGHA+HV
Sbjct  443   AYTEDTTTMAGLVEQISVTRDSTDYLWYMTDIRIDPNEGFLKSGQWPLLTVFSAGHALHV  502

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGT YGG    KLT++  V LRAGINK+S+LSVAVGLPN GLH+E WN GVLGP
Sbjct  503   FINGQLSGTTYGGSENYKLTFSKYVNLRAGINKLSILSVAVGLPNGGLHYETWNTGVLGP  562

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNE TRD++   W YK+
Sbjct  563   VTLKGLNEDTRDMSGYKWSYKI  584


 Score =   161 bits (408),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++V+GSSSVEW  G L+A  QPLTWYK TFD+P+GN+PLALDMSSMGKG
Sbjct  583   KIGLKGEALNLHSVSGSSSVEWVTGSLVAQKQPLTWYKTTFDSPKGNEPLALDMSSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+GSC  +CNY G +N+KKC   CG+PSQ
Sbjct  643   QIWINGQSIGRHWPAYTAKGSC-GKCNYGGIFNEKKCHSXCGEPSQ  687



>ref|XP_004158465.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=1225

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/562 (72%), Positives = 474/562 (84%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +I+GKRRILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWNGHEP
Sbjct  24    ASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+Y FE RY+LV+F+KL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  84    SPGQYYFEDRYELVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  143

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIV+MMK EKL+ SQGGPII+SQIENEYGPVEWEIGAPGK+YTKWA Q
Sbjct  144   GPFKAAMQKFTAKIVSMMKGEKLYHSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  203

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL TGVPW+MCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE WTGW+T+FGGP
Sbjct  204   MALGLDTGVPWVMCKQEDAPDPMIDTCNGFYCENFEPNKAYKPKMWTEAWTGWFTEFGGP  263

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED+A++VARFIQN GS +NYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL+
Sbjct  264   VPYRPVEDLAYAVARFIQNRGSLINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLI  323

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHLRDLH+AIKL EPALVS  P V+  G  QE HV+ + +G C AFL+NYDP  S
Sbjct  324   RQPKWGHLRDLHKAIKLCEPALVSVDPTVSSLGSKQEAHVYNTRSGECAAFLANYDPSTS  383

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              +VTF N  YDLPPWS+SILPDCK VV+NTA V +PS   KM P+ + FSW SY EE AS
Sbjct  384   VRVTFGNHPYDLPPWSVSILPDCKTVVFNTAKVNAPSYWPKMTPI-SSFSWHSYNEETAS  442

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +   DT    G+ EQI++TRD++DYLWYMT++ I  +E FL++G+ P++T+ SAGHA+HV
Sbjct  443   AYADDTTTMAGLVEQISITRDATDYLWYMTDIRIDSNEGFLKSGQWPLLTIFSAGHALHV  502

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYGGL  PKLT++  V LR G+NK+S+LSVAVGLPNVG+HFE WNAG+LGP
Sbjct  503   FINGQLSGTVYGGLDNPKLTFSKYVNLRPGVNKLSMLSVAVGLPNVGVHFETWNAGILGP  562

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRD++   W YKV
Sbjct  563   VTLKGLNEGTRDMSGYKWSYKV  584


 Score =   483 bits (1242),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 231/366 (63%), Positives = 281/366 (77%), Gaps = 9/366 (2%)
 Frame = +1

Query  1006  IDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHRRPAEDIAFSVARFIQNNGSF  1185
             IDTCNG+YCENF PN+ YKPK++TE W+GWYT FGGP   RP ED+AFSVARFIQN GS 
Sbjct  723   IDTCNGFYCENFKPNQIYKPKIWTENWSGWYTAFGGPTPYRPPEDVAFSVARFIQNGGSL  782

Query  1186  VNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEPKYGHLRDLHRAIKLAEPALV  1365
             VNYYMYHGGTNFGRT+  LF+ TSYD+DAP+DEYGL+ EPK+GHLRDLH+AIKL EPALV
Sbjct  783   VNYYMYHGGTNFGRTSG-LFVTTSYDFDAPIDEYGLLREPKWGHLRDLHKAIKLCEPALV  841

Query  1366  SSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKVTFSNLQYDLPPWSISILPDC  1545
             S+ P  TW GK+QE  VF+S +GAC AFL+NYD     +V F N  YDLPPWSISILPDC
Sbjct  842   SADPTSTWLGKDQEARVFKSSSGACAAFLANYDTSAFVRVNFWNHPYDLPPWSISILPDC  901

Query  1546  KNVVYNTATVRSPS-------LQTKMIPVGNGFSWQSYTEEIASSDDGDTVAADGMWEQI  1704
             K V +NTA VR          L  KM P+ + F W SY EE AS+   DT   DG+ EQ+
Sbjct  902   KTVTFNTARVRRDPKLFIPNLLMAKMTPISS-FWWLSYKEEPASAYAKDTTTKDGLVEQV  960

Query  1705  NVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFINSELSGTVYGGLAF  1884
             +VT D++DYLWYMT++ I   E FL++G+ P++TV SAGH +HVFIN +LSG+VYG L  
Sbjct  961   SVTWDTTDYLWYMTDIRIDSTEGFLKSGQWPLLTVNSAGHILHVFINGQLSGSVYGSLED  1020

Query  1885  PKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVSLSGLNEGTRDLTNQ  2064
             P++T++  V L+ G+NK+S+LSV VGLPNVGLHF+ WNAGVLGPV+L GLNEGTRD++  
Sbjct  1021  PRITFSKYVNLKQGVNKLSMLSVTVGLPNVGLHFDTWNAGVLGPVTLKGLNEGTRDMSKY  1080

Query  2065  TWFYKV  2082
              W YKV
Sbjct  1081  KWSYKV  1086


 Score =   154 bits (390),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+TV+GSSSVEW  G L++  QPLTWYK TF+AP GN+PLALDM SMGKG
Sbjct  583   KVGLKGEALNLHTVSGSSSVEWMTGSLVSQKQPLTWYKTTFNAPGGNEPLALDMGSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NGE +GRHWP YTA+GSC  +C Y G + +KKC  +CG+PSQ
Sbjct  643   QVWINGESIGRHWPAYTARGSC-GKCYYGGIFTEKKCHFSCGEPSQ  687


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (71%), Gaps = 3/117 (3%)
 Frame = +2

Query  2123  SRIAPRFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDP  2302
             +R   ++    ++G++GE L+L +V GS+SV+W  G      QPLTWYK TF+ P GN+P
Sbjct  1074  TRDMSKYKWSYKVGLRGEILNLYSVKGSNSVQWMKGSF--QKQPLTWYKTTFNTPAGNEP  1131

Query  2303  LALDMSSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             LALDMSSM KG+IWVNG  +GR++PGY A G C ++C+Y G + +KKC  NCG PSQ
Sbjct  1132  LALDMSSMSKGQIWVNGRSIGRYFPGYIASGKC-NKCSYTGFFTEKKCLWNCGGPSQ  1187



>ref|XP_010536861.1| PREDICTED: beta-galactosidase 12 [Tarenaya hassleriana]
Length=726

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/563 (72%), Positives = 473/563 (84%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  25    KAAVSYDHKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FE RYDLV+F+KL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTD
Sbjct  85    PSPGKYYFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIAFRTD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AMQ F  KIV MMK+EKLFE+QGGPII+SQIENEYGPVEWEIGAPGKAYTKWA 
Sbjct  145   NGPFKAAMQKFTEKIVGMMKAEKLFETQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+DAPDPII+TCNG+YCE F PN   KPKM+TE WTGW+T+FGG
Sbjct  205   EMAVGLSTGVPWIMCKQDDAPDPIINTCNGFYCEGFKPNSDRKPKMWTENWTGWFTEFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIAFSVARFIQN GSFVNYYMYHGGTNF RTA   FIATSYDYDAPLDEYGL
Sbjct  265   AVPYRPAEDIAFSVARFIQNGGSFVNYYMYHGGTNFDRTAGG-FIATSYDYDAPLDEYGL  323

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPK+ HL++LH+ IKL EPALV+  P VT  G NQE HVFRS++ +C AFLSNYDP  
Sbjct  324   PREPKWSHLKELHKVIKLCEPALVTVDPTVTSLGDNQEAHVFRSKS-SCAAFLSNYDPSS  382

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             + KVTF    YDLPPWS+SILPDCK V YNTA VR+PS+  KM+P G  FSW+SY EE  
Sbjct  383   AVKVTFGGFPYDLPPWSVSILPDCKTVYYNTAQVRAPSVTMKMVPTGGPFSWESYNEESP  442

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S +D  T A DG  EQIN+TRDS+DYLWY+T++ I+PDE+FL+ G DP++T+ SAGHA+H
Sbjct  443   SWNDDGTFALDGFVEQINMTRDSTDYLWYLTDITISPDEKFLKTGDDPLLTIWSAGHALH  502

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS+AVGLPNVGLH+E WNAGVLG
Sbjct  503   VFVNGQLAGTAYGSLNNPKLTFSQKIKLHAGVNKLALLSIAVGLPNVGLHYETWNAGVLG  562

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSL G+N GT D++   W YKV
Sbjct  563   PVSLKGVNSGTWDMSKWKWSYKV  585


 Score =   156 bits (395),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TVTGSSSVEW +G L+A  QPLTWYKA+FD P GN+PLALDM +MGKG
Sbjct  584   KVGLKGEALSLHTVTGSSSVEWVEGSLVAKKQPLTWYKASFDTPAGNEPLALDMDTMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG  +GRHWPG TA G+C   C+YAGTY  KKC  NCG+ SQ
Sbjct  644   QIWINGRNIGRHWPGNTAHGNC-GRCSYAGTYTDKKCLSNCGEASQ  688



>ref|XP_004135712.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=723

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/562 (72%), Positives = 474/562 (84%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +I+GKRRILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWNGHEP
Sbjct  24    ASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+Y FE RY+LV+F+KL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  84    SPGQYYFEDRYELVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  143

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIV+MMK EKL+ SQGGPII+SQIENEYGPVEWEIGAPGK+YTKWA Q
Sbjct  144   GPFKAAMQKFTAKIVSMMKGEKLYHSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  203

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL TGVPW+MCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE WTGW+T+FGGP
Sbjct  204   MALGLDTGVPWVMCKQEDAPDPMIDTCNGFYCENFEPNKAYKPKMWTEAWTGWFTEFGGP  263

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED+A++VARFIQN GS +NYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL+
Sbjct  264   VPYRPVEDLAYAVARFIQNRGSLINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLI  323

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHLRDLH+AIKL EPALVS  P V+  G  QE HV+ + +G C AFL+NYDP  S
Sbjct  324   RQPKWGHLRDLHKAIKLCEPALVSVDPTVSSLGSKQEAHVYNTRSGECAAFLANYDPSTS  383

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              +VTF N  YDLPPWS+SILPDCK VV+NTA V +PS   KM P+ + FSW SY EE AS
Sbjct  384   VRVTFGNHPYDLPPWSVSILPDCKTVVFNTAKVNAPSYWPKMTPI-SSFSWHSYNEETAS  442

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +   DT    G+ EQI++TRD++DYLWYMT++ I  +E FL++G+ P++T+ SAGHA+HV
Sbjct  443   AYADDTTTMAGLVEQISITRDATDYLWYMTDIRIDSNEGFLKSGQWPLLTIFSAGHALHV  502

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYGGL  PKLT++  V LR G+NK+S+LSVAVGLPNVG+HFE WNAG+LGP
Sbjct  503   FINGQLSGTVYGGLDNPKLTFSKYVNLRPGVNKLSMLSVAVGLPNVGVHFETWNAGILGP  562

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRD++   W YKV
Sbjct  563   VTLKGLNEGTRDMSGYKWSYKV  584


 Score =   155 bits (391),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+TV+GSSSVEW  G L++  QPLTWYK TF+AP GN+PLALDM SMGKG
Sbjct  583   KVGLKGEALNLHTVSGSSSVEWMTGSLVSQKQPLTWYKTTFNAPGGNEPLALDMGSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NGE +GRHWP YTA+GSC  +C Y G + +KKC  +CG+PSQ
Sbjct  643   QVWINGESIGRHWPAYTARGSC-GKCYYGGIFTEKKCHFSCGEPSQ  687



>gb|ABK96254.1| unknown [Populus trichocarpa x Populus deltoides]
Length=846

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/563 (73%), Positives = 475/563 (84%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  32    SVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  91

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEG YDLVKF+KLA++AGLYVHLRIGPYIC EWNFGGFP+WLKY+PGI FRTDN 
Sbjct  92    PGKYYFEGNYDLVKFVKLAKEAGLYVHLRIGPYICAEWNFGGFPVWLKYIPGINFRTDNG  151

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIVNMMK+E+LFE+QGGPII+SQIENEYGP+E+EIG+PGKAYTKWA +M
Sbjct  152   PFKAQMQKFTTKIVNMMKAERLFETQGGPIILSQIENEYGPMEYEIGSPGKAYTKWAAEM  211

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL+TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+TQFGGPV
Sbjct  212   AVGLRTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGGPV  271

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  272   PHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS    V   G  QE HVF  + G C AFL+NY  +  A
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGDATVIPLGNYQEAHVFNYKAGGCAAFLANYHQRSFA  391

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KV+F N+ Y+LPPWSISILPDCKN VYNTA V + S + KM  +P+  GFSWQ+Y EE +
Sbjct  392   KVSFRNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPMHGGFSWQAYNEEPS  451

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             +S D  T    G+ EQIN TRD SDYLWYMT+V+I P E FLR+GK PV+ V+SAGHA+H
Sbjct  452   ASGD-STFTMVGLLEQINTTRDVSDYLWYMTDVHIDPSEGFLRSGKYPVLGVLSAGHALH  510

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGT YG L FPKLT+T  VKLRAG+NKISLLS+AVGLPNVG HFE WNAG+LG
Sbjct  511   VFINGQLSGTAYGSLDFPKLTFTQGVKLRAGVNKISLLSIAVGLPNVGPHFETWNAGILG  570

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L+GLNEG RDL+ Q W YK+
Sbjct  571   PVTLNGLNEGRRDLSWQKWSYKI  593


 Score =   151 bits (381),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE+L L++++GSSSVEW +G L+A  QPL+WYK TF+AP GN PLALDM SMGKG
Sbjct  592   KIGLHGEALGLHSISGSSSVEWAEGSLVAQRQPLSWYKTTFNAPAGNSPLALDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A G+C  +C+Y GTYN+KKC  NCG+ SQ
Sbjct  652   QIWINGQHVGRHWPAYKASGTC-GDCSYIGTYNEKKCSTNCGEASQ  696



>ref|XP_006385360.1| beta-galactosidase 1 family protein [Populus trichocarpa]
 gb|ERP63157.1| beta-galactosidase 1 family protein [Populus trichocarpa]
Length=846

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/563 (73%), Positives = 475/563 (84%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  32    SVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  91

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEG YDLVKF+KLA++AGLYVHLRIGPYIC EWNFGGFP+WLKY+PGI FRTDN 
Sbjct  92    PGKYYFEGNYDLVKFVKLAKEAGLYVHLRIGPYICAEWNFGGFPVWLKYIPGINFRTDNG  151

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  K+VNMMK+E+LFE+QGGPII+SQIENEYGP+E+EIG+PGKAYTKWA +M
Sbjct  152   PFKAQMQKFTTKVVNMMKAERLFETQGGPIILSQIENEYGPMEYEIGSPGKAYTKWAAEM  211

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL+TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+TQFGGPV
Sbjct  212   AVGLRTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGGPV  271

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  272   PHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS    V   G  QE HVF  + G C AFL+NY  +  A
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGDATVIPLGNYQEAHVFNYKAGGCAAFLANYHQRSFA  391

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KV+F N+ Y+LPPWSISILPDCKN VYNTA V + S + KM  +P+  GFSWQ+Y EE +
Sbjct  392   KVSFRNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPMHGGFSWQAYNEEPS  451

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             +S D  T    G+ EQIN TRD SDYLWYMT+V+I P E FLR+GK PV+ V+SAGHA+H
Sbjct  452   ASGD-STFTMVGLLEQINTTRDVSDYLWYMTDVHIDPSEGFLRSGKYPVLGVLSAGHALH  510

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGT YG L FPKLT+T  VKLRAG+NKISLLS+AVGLPNVG HFE WNAG+LG
Sbjct  511   VFINGQLSGTAYGSLDFPKLTFTQGVKLRAGVNKISLLSIAVGLPNVGPHFETWNAGILG  570

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L+GLNEG RDL+ Q W YK+
Sbjct  571   PVTLNGLNEGRRDLSWQKWSYKI  593


 Score =   151 bits (381),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE+L L++++GSSSVEW +G L+A  QPL+WYK TF+AP GN PLALDM SMGKG
Sbjct  592   KIGLHGEALGLHSISGSSSVEWAEGSLVAQRQPLSWYKTTFNAPAGNSPLALDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A G+C  +C+Y GTYN+KKC  NCG+ SQ
Sbjct  652   QIWINGQHVGRHWPAYKASGTC-GDCSYIGTYNEKKCSTNCGEASQ  696



>gb|KDO57762.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=767

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/593 (69%), Positives = 479/593 (81%), Gaps = 31/593 (5%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELS------------------------------GTVYGGLAFPKLTYTNSVKLRA  1923
             VFIN +LS                              GTVYG L  PKLT++ +VKLR 
Sbjct  515   VFINGQLSGKRSIMTDMIMFLGANIACQQLTFSFYPYAGTVYGSLENPKLTFSKNVKLRP  574

Query  1924  GINKISLLSVAVGLPNVGLHFEKWNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             G+NKISLLS +VGLPNVG HFEKWNAGVLGPV+L GLNEGTRD++ Q W YK+
Sbjct  575   GVNKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKI  627


 Score =   155 bits (391),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TV+GSSSVEW  G  LA  QP+TWYK TF+ P GNDPLALDM +MGKG
Sbjct  626   KIGLKGEALSLHTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKG  685

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GRHWPGY   G+C   CNYAGTY +KKC+  CG+PSQ
Sbjct  686   MVWINGQSIGRHWPGYIGNGNCGG-CNYAGTYTEKKCRTYCGKPSQ  730



>ref|XP_006451460.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64700.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=767

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/593 (69%), Positives = 479/593 (81%), Gaps = 31/593 (5%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  36    KASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  95

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P+ G Y F+ RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLKYVPGIEFRTD
Sbjct  96    PTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTD  155

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AM  F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEW+IGAPGKAY KWA 
Sbjct  156   NGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWDIGAPGKAYAKWAA  215

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YCE F PN+ YKPKM+TE WTGW+T+FG 
Sbjct  216   QMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGS  275

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+ FSVARFIQ+ GSF+NYYMYHGGTNFGRT+   F+ATSYDYDAP+DEYGL
Sbjct  276   AVPTRPAEDLVFSVARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGL  334

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             +NEPK+GHLRDLH+AIKL EPALVS  P V   GKNQE HVF S++G C AFL+NYD  F
Sbjct  335   LNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFNSKSGKCAAFLANYDTTF  394

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             SAKV+F N QYDLPPWSIS+LPDCK  V+NTA V   S Q K +PV N FSWQSY EE A
Sbjct  395   SAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAFSWQSYIEETA  454

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T   DG+WEQ+ +T D+SDYLWYMT+VNI  +E FL+NG+DP++T+ SAGHA+ 
Sbjct  455   SSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDPLLTIWSAGHALQ  514

Query  1834  VFINSELS------------------------------GTVYGGLAFPKLTYTNSVKLRA  1923
             VFIN +LS                              GTVYG L  PKLT++ +VKLR 
Sbjct  515   VFINGQLSGKRSIMTDMIMFLGANIACQQLTFSFYPYAGTVYGSLENPKLTFSKNVKLRP  574

Query  1924  GINKISLLSVAVGLPNVGLHFEKWNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             G+NKISLLS +VGLPNVG HFEKWNAGVLGPV+L GLNEGTRD++ Q W YK+
Sbjct  575   GVNKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKI  627


 Score =   154 bits (390),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+T++GSSSVEW  G  LA  QP+TWYK TF+ P GNDPLALDM +MGKG
Sbjct  626   KIGLKGEALSLHTISGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKG  685

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GRHWPGY   G+C   CNYAGTY +KKC+  CG+PSQ
Sbjct  686   MVWINGQSIGRHWPGYIGNGNCGG-CNYAGTYTEKKCRTYCGKPSQ  730



>ref|XP_003543598.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=841

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/565 (73%), Positives = 474/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  27    KASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  86

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTD
Sbjct  87    PSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  146

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFKV MQ F  KIV++MK+E+L+ESQGGPIIMSQIENEYGP+E+EIGA GKAYTKWA 
Sbjct  147   NEPFKVQMQKFTTKIVDLMKAERLYESQGGPIIMSQIENEYGPMEYEIGAAGKAYTKWAA  206

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA+ L TGVPWIMCKQ+D PDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG
Sbjct  207   EMAMELGTGVPWIMCKQDDTPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGG  266

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  267   PVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  326

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVF+S +GAC AFL+NY+P+ 
Sbjct  327   LRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEAHVFKSMSGACAAFLANYNPKS  386

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              A V F N+ Y+LPPWSISILP+CKN VYNTA V S S Q KM  +P+  G SW S+ EE
Sbjct  387   YATVAFGNMHYNLPPWSISILPNCKNTVYNTARVGSQSAQMKMTRVPIHGGLSWLSFNEE  446

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               ++DD  +    G+ EQ+N TRD SDYLWY T+V + P+E FLRNGKDPV+TV SAGHA
Sbjct  447   TTTTDD-SSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPNEGFLRNGKDPVLTVFSAGHA  505

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVFIN +LSGT YG L FPKLT+   VKLR G+NKISLLSVAVGLPNVG HFE WNAGV
Sbjct  506   LHVFINGQLSGTAYGSLEFPKLTFNEGVKLRTGVNKISLLSVAVGLPNVGPHFETWNAGV  565

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGP+SLSGLNEG RDL+ Q W YKV
Sbjct  566   LGPISLSGLNEGRRDLSWQKWSYKV  590


 Score =   132 bits (332),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+++ GSSSVEW  G L++  QPLTWYK TFDAP+G  PLALDM+SMGKG
Sbjct  589   KVGLKGETLSLHSLGGSSSVEWIQGSLVSQRQPLTWYKTTFDAPDGTAPLALDMNSMGKG  648

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A G+C   C+YAGTYN+ KC+ NCG+ SQ
Sbjct  649   QVWLNGQNLGRYWPAYKASGTCDY-CDYAGTYNENKCRSNCGEASQ  693



>gb|ABV32545.1| beta-galactosidase protein 2 [Prunus persica]
Length=841

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/565 (72%), Positives = 476/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ +ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  25    KASVSYDSKAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FE  YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI+FRTD
Sbjct  85    PSPGKYYFEDNYDLVKFIKLIQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIQFRTD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  MQ F  KIVNMMK+E+LF+SQGGPII+SQIENEYGP+E+E+GAPGK YT WA 
Sbjct  145   NGPFKAQMQRFTTKIVNMMKAERLFQSQGGPIILSQIENEYGPMEYELGAPGKVYTDWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
              MA+GL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  205   HMALGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  265   AVPSRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS+ P VT  G  QE HVF+S++GAC AFL+NY+P+ 
Sbjct  325   LRQPKWGHLKDLHRAIKLCEPALVSADPTVTPLGTYQEAHVFKSKSGACAAFLANYNPRS  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N+ Y+LPPWSISILPDCKN VYNTA V + S Q KM  +P+   FSWQ+Y +E
Sbjct  385   FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMPRVPLHGAFSWQAYNDE  444

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
              A+  D     A G+ EQIN TRDSSDYLWY+T+V I P+EEFLR+GK PV+T++SAGHA
Sbjct  445   TATYADTSFTTA-GLLEQINTTRDSSDYLWYLTDVKIDPNEEFLRSGKYPVLTILSAGHA  503

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             + VFIN +L+GT YG L FPKLT++  V LRAGIN+I+LLS+AVGLPNVG HFE WNAGV
Sbjct  504   LRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGINQIALLSIAVGLPNVGPHFETWNAGV  563

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV L+GLNEG RDL+ Q W YKV
Sbjct  564   LGPVILNGLNEGRRDLSWQKWSYKV  588


 Score =   132 bits (333),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW  G L+   QPLTWYK TF+AP GN PLALDM SMGKG
Sbjct  587   KVGLKGEALSLHSLSGSSSVEWIQGSLVTRRQPLTWYKTTFNAPAGNSPLALDMGSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GR+WP Y A GSC + CNYAG+Y++KKC  NCG+ SQ
Sbjct  647   QVWINGRSIGRYWPAYKASGSCGA-CNYAGSYHEKKCLSNCGEASQ  691



>ref|XP_009367552.1| PREDICTED: beta-galactosidase 1 [Pyrus x bretschneideri]
Length=843

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/565 (73%), Positives = 476/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R SVSYD ++ +ING+R+ILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  27    RASVSYDSKAIVINGQRKILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  86

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FE  YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI+FRTD
Sbjct  87    PSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIQFRTD  146

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  MQ F  KIVNMMK+E+LF++QGGPIIMSQIENEYGP+E+E+GAPGK YT WA 
Sbjct  147   NGPFKNQMQRFTTKIVNMMKAERLFQTQGGPIIMSQIENEYGPMEYELGAPGKQYTDWAA  206

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  207   QMALGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  266

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  267   AVPYRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  326

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS+ P V   G+ QE HVF+S +GAC AFL+NY+P+ 
Sbjct  327   LRQPKWGHLKDLHRAIKLCEPALVSADPTVQSLGRFQEAHVFKSNSGACSAFLANYNPRS  386

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N+ Y+LPPWSISILPDCKN VYNTA V + S   KM  +P+  GFSWQSY +E
Sbjct  387   FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMPRVPLHGGFSWQSYPDE  446

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
              AS  D  T    G+ EQIN TRDSSDYLWY+T+VNI P+EEFLR+GK P +TV+SAGHA
Sbjct  447   AASYGD-TTFTTAGLLEQINTTRDSSDYLWYITDVNIDPNEEFLRSGKYPELTVLSAGHA  505

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             + VFIN +L+GT YG L FPKLT++  V LRAGIN+I+LLS+AVGLPNVG HFE WNAGV
Sbjct  506   LRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGINQIALLSIAVGLPNVGPHFETWNAGV  565

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV L+GLNEG RDL+ Q W YKV
Sbjct  566   LGPVILNGLNEGRRDLSWQKWSYKV  590


 Score =   132 bits (332),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW  G  +   QPLTW+K TF+ P GN PLALDM SMGKG
Sbjct  589   KVGLKGEALSLHSLSGSSSVEWIQGSYVTRKQPLTWFKTTFNEPAGNSPLALDMISMGKG  648

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GR+WP YTA G+C + CNYAGTYN+KKC  NCGQ SQ
Sbjct  649   QVWINGRSIGRYWPAYTASGNCGA-CNYAGTYNEKKCLSNCGQASQ  693



>ref|XP_007217046.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
 gb|EMJ18245.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
Length=835

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/562 (73%), Positives = 472/562 (84%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD RS IING++RILISGSIHYPRSTP+MWP L+QKAK+GG+DVIQTYVFWNGHEP
Sbjct  25    ASVSYDHRSIIINGRKRILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEP  84

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  85    SPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  144

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F+ KIV MMK+E LF+SQGGPII+SQIENEYGPVEWEIGAPGKAYT WA Q
Sbjct  145   EPFKAAMQTFMEKIVGMMKAESLFQSQGGPIILSQIENEYGPVEWEIGAPGKAYTNWAAQ  204

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAV L  GVPWIMCKQEDAPDPIIDTCNG+YC+NF P K YKPKM+TE+WTGWYT+FGG 
Sbjct  205   MAVNLNIGVPWIMCKQEDAPDPIIDTCNGFYCQNFTPTKKYKPKMWTEVWTGWYTEFGGA  264

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQN GSFVNYYMYHGGTNFGRTA   FIATSYDYD+PLDE+GL 
Sbjct  265   VPTRPAEDLAFSVARFIQNGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDSPLDEFGLP  324

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHLRDLHRAIKL+E ALVS+ P V   G++QE HVF+S    C AFL+NYD  +S
Sbjct  325   REPKWGHLRDLHRAIKLSESALVSADPSVISLGRHQEAHVFKSSY-QCAAFLANYDTNYS  383

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              +V F + QYDLPPWSISILPDCK  VYNTA + + S Q KM PV N  SWQS+ EE AS
Sbjct  384   VEVRFGDGQYDLPPWSISILPDCKTAVYNTARLGAQSSQMKMTPVNNALSWQSFAEETAS  443

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             SDD DT   DG+ +QIN+T DS+DYLWYMT++ I+PDE FL +G+ P++T+ SAGHA+HV
Sbjct  444   SDDPDTFTLDGLRDQINMTWDSTDYLWYMTDITISPDEGFLESGQSPLLTIGSAGHALHV  503

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGT YG L   +L ++++VKLR+GINK++LLSV++GLPN+GLHFE WN GVLG 
Sbjct  504   FINGKLSGTAYGSLEKRRLRFSDNVKLRSGINKLALLSVSLGLPNIGLHFETWNVGVLGS  563

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLN GT DL+ + W YKV
Sbjct  564   VTLKGLNSGTWDLSQRKWTYKV  585


 Score =   163 bits (412),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TV GSSSVEW   P LA   PLTWYKATFDAP GNDPLALDM SMGKG
Sbjct  584   KVGLKGEALSLHTVNGSSSVEWVQKPYLAKKPPLTWYKATFDAPSGNDPLALDMVSMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG  +GRHWP YTA G+C  +C YAGTYN+ KC+  CG+PSQ
Sbjct  644   QIWINGRSIGRHWPAYTAHGAC-RDCYYAGTYNENKCRTKCGEPSQ  688



>gb|KHN30042.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/565 (73%), Positives = 473/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L+QKAKDG LDVIQTYVFWNGHE
Sbjct  17    KASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGSLDVIQTYVFWNGHE  76

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTD
Sbjct  77    PSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  136

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFKV MQ F  KIV++MK+E+L+ESQGGPIIMSQIENEYGP+++EIGA GKAYTKWA 
Sbjct  137   NEPFKVQMQKFTTKIVDLMKAERLYESQGGPIIMSQIENEYGPMQYEIGAAGKAYTKWAA  196

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA+ L TGVPWIMCKQ+D PDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG
Sbjct  197   EMAMELGTGVPWIMCKQDDTPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGG  256

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  257   PVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  316

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVF+S +GAC AFL+NY+P+ 
Sbjct  317   LRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEAHVFKSMSGACAAFLANYNPKS  376

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              A V F N+ Y+LPPWSISILPDCKN VYNTA V S S Q KM  +P+  G SW S+ EE
Sbjct  377   YATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSAQMKMTRVPIHGGLSWLSFNEE  436

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               ++DD  +    G+ EQ+N TRD SDYLWY T+V + P+E FLRNGKDPV+TV SAGHA
Sbjct  437   TTTTDD-SSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPNEGFLRNGKDPVLTVFSAGHA  495

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVFIN +LSGT YG L FPKLT+   VKLR G+NKISLLSVAVGLPNVG HFE WNAGV
Sbjct  496   LHVFINGQLSGTAYGSLEFPKLTFNEGVKLRTGVNKISLLSVAVGLPNVGPHFETWNAGV  555

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGP+SLSGLNEG RDL+ Q W YKV
Sbjct  556   LGPISLSGLNEGRRDLSWQKWSYKV  580


 Score =   132 bits (332),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW  G L++  QPLTWYK TFDAP+G  PLALDM+SMGKG
Sbjct  579   KVGLKGETLSLHSLSGSSSVEWIQGSLVSQRQPLTWYKTTFDAPDGTAPLALDMNSMGKG  638

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A G+C   C+YAGTYN+ KC+ NCG+ SQ
Sbjct  639   QVWLNGQNLGRYWPAYKASGTCDY-CDYAGTYNENKCRSNCGEASQ  683



>gb|KGN66238.1| hypothetical protein Csa_1G587980 [Cucumis sativus]
Length=661

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/571 (71%), Positives = 474/571 (83%), Gaps = 10/571 (2%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ IING+RRILISGSIHYPRS PQMWP L+QKAKDGGLDVI+TYVFWNGHEP
Sbjct  24    ASVTYDHKAIIINGRRRILISGSIHYPRSIPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+YNFE RYDLV+F+KL  +AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  84    SPGQYNFEDRYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  143

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQ---------IENEYGPVEWEIGAPG  909
              PFK AMQ F  KIV +MK EKL+ESQGGPII+SQ         IENEYGPVEWEIGAPG
Sbjct  144   GPFKAAMQKFTEKIVGLMKGEKLYESQGGPIILSQLFGNVLRCQIENEYGPVEWEIGAPG  203

Query  910   KAYTKWAGQMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWT  1089
             K+YTKWA QMA+GL TGVPW+MCKQ+DAPDP+IDTCNG+YCENF PNK YKPKM+TE WT
Sbjct  204   KSYTKWAAQMALGLNTGVPWVMCKQDDAPDPVIDTCNGFYCENFKPNKVYKPKMWTEAWT  263

Query  1090  GWYTQFGGPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYD  1269
             GW+T+FGGP   RP ED+A+SVARFIQN GSF+NYYMYHGGTNFGRTA   FIATSYDYD
Sbjct  264   GWFTEFGGPAPYRPVEDMAYSVARFIQNGGSFINYYMYHGGTNFGRTAGGPFIATSYDYD  323

Query  1270  APLDEYGLVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAF  1449
             AP+DEYGL+ EPK+ HLRDLH+AIKL EPALVS  P V++ G NQE HVF++ +G+C AF
Sbjct  324   APIDEYGLLREPKWSHLRDLHKAIKLCEPALVSVDPTVSYLGSNQEAHVFKTRSGSCAAF  383

Query  1450  LSNYDPQFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSW  1629
             L+NYD   SA VTF N QYDLPPWS+SILPDCK+V++NTA V +P+ Q KM PV + FSW
Sbjct  384   LANYDASSSATVTFGNNQYDLPPWSVSILPDCKSVIFNTAKVGAPTSQPKMTPV-SSFSW  442

Query  1630  QSYTEEIASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTV  1809
              SY EE AS+   DT    G+ EQI+VTRDS+DYLWYMT++ I P+E FL++G+ P++TV
Sbjct  443   LSYNEETASAYTEDTTTMAGLVEQISVTRDSTDYLWYMTDIRIDPNEGFLKSGQWPLLTV  502

Query  1810  MSAGHAMHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFE  1989
              SAGHA+HVFIN +LSGT YGG    KLT++  V LRAGINK+S+LSVAVGLPN GLH+E
Sbjct  503   FSAGHALHVFINGQLSGTTYGGSENYKLTFSKYVNLRAGINKLSILSVAVGLPNGGLHYE  562

Query  1990  KWNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
              WN GVLGPV+L GLNE TRD++   W YK+
Sbjct  563   TWNTGVLGPVTLKGLNEDTRDMSGYKWSYKI  593


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 8/56 (14%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSS  2323
             ++G+KGE+L+L++V+GSSSVEW  G L+A  QPLTWYK+         PL +D +S
Sbjct  592   KIGLKGEALNLHSVSGSSSVEWVTGSLVAQKQPLTWYKSC--------PLYIDFTS  639



>ref|XP_008450853.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=721

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/562 (72%), Positives = 471/562 (84%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ IING+RRILISGSIHYPRSTPQMWP L+QKAKDGGLDVI TYVFWNGHEP
Sbjct  20    ASVTYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIDTYVFWNGHEP  79

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG YNFE RYDLV+F+KL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  80    SPGHYNFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  139

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIV +MK EKL+ESQGGPII+SQIENEYGPVEWEIGAPGK+Y+KWA Q
Sbjct  140   GPFKAAMQKFTEKIVGVMKGEKLYESQGGPIILSQIENEYGPVEWEIGAPGKSYSKWAAQ  199

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+ L TGVPW+MCKQ+DAPDP+IDTCNG+YCENF PN+ YKPKM+TE WTGW+T+FGGP
Sbjct  200   MALDLDTGVPWVMCKQDDAPDPVIDTCNGFYCENFKPNQVYKPKMWTEAWTGWFTEFGGP  259

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
                RP ED+A+SVARFIQN GSF+NYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL+
Sbjct  260   APYRPVEDMAYSVARFIQNGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLL  319

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+ HLRDLH+AIKL EPALVS  P V+  G NQE HVF++ +G+C AFL+NYD   S
Sbjct  320   REPKWSHLRDLHKAIKLCEPALVSVDPTVSSLGSNQEAHVFKTRSGSCAAFLANYDASSS  379

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A VTF N QYDLPPWS+SILPDCK+ V+NTA V +P+ Q KM PV + FSW SY EE AS
Sbjct  380   ATVTFGNNQYDLPPWSVSILPDCKSAVFNTAKVGAPTSQPKMTPV-SSFSWLSYNEETAS  438

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +   DT    G+ EQI+VTRDS+DYLWYMT++ I P+E FL++G+ P++TV SAGHA+HV
Sbjct  439   AYTEDTTTMAGLVEQISVTRDSTDYLWYMTDIRIDPNEGFLKSGQWPLLTVFSAGHALHV  498

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGT YGG    KLT++  V LRAGINK+S+LSVAVGLPN GLH+E WN G+LGP
Sbjct  499   FINGQLSGTTYGGAENYKLTFSKYVNLRAGINKLSILSVAVGLPNGGLHYETWNTGILGP  558

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNE TRD++   W YK+
Sbjct  559   VTLKGLNEDTRDMSGYKWSYKI  580


 Score =   164 bits (416),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+T +GSSSVEW  G L+A  QPLTWYK TFD+PEGN+PLALDMSSMGKG
Sbjct  579   KIGLKGEALNLHTASGSSSVEWVAGSLVAQKQPLTWYKTTFDSPEGNEPLALDMSSMGKG  638

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+GSC  +CNY G +N+KKC  NCG+PSQ
Sbjct  639   QIWINGQSIGRHWPAYTARGSC-GKCNYGGIFNEKKCHSNCGEPSQ  683



>ref|XP_009352652.1| PREDICTED: beta-galactosidase [Pyrus x bretschneideri]
Length=731

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/561 (73%), Positives = 480/561 (86%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  25    SVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLVKFIKL Q+AGL+V+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  85    PGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDNE  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEWEIGAPGKAYTKWA QM
Sbjct  145   PFKAAMQKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG V
Sbjct  205   AVGLDTGVPWIMCKQEDAPDPVIDTCNGFYCENFKPNKDYKPKMWTEVWTGWYTEFGGAV  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ+ GSF+NYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL+ 
Sbjct  265   PTRPAEDVAFSVARFIQSGGSFLNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLLR  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIK  E ALVS  P VT  G NQE HVF+SE+  C AFL+NYD ++S 
Sbjct  325   EPKWGHLRDLHKAIKSCESALVSVDPSVTKLGSNQEAHVFKSESD-CAAFLANYDAKYSV  383

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F   QYDLPPWSISILPDCK  VY+TA V S S Q +M PV +GF WQS+ EE  SS
Sbjct  384   KVSFGGGQYDLPPWSISILPDCKTEVYSTAKVGSQSSQVQMTPVHSGFPWQSFIEETTSS  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             D+ DT   DG++EQIN+TRD++DYLWYMT++ I  DE FL+NGK P++T+ SAGHA++VF
Sbjct  444   DETDTTTLDGLYEQINITRDTTDYLWYMTDITIGSDEAFLKNGKSPLLTIFSAGHALNVF  503

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKL+++ +V LR+GINK++LLS++VGLPNVG HFE WNAGVLGP+
Sbjct  504   INGQLSGTVYGSLENPKLSFSQNVNLRSGINKLALLSISVGLPNVGTHFETWNAGVLGPI  563

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN GT D++   W YK 
Sbjct  564   TLKGLNSGTWDMSGWKWTYKT  584


 Score =   162 bits (409),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             + G+KGE+L L+TVTGSSSVEW +GP +A  QPLTWYKATF+AP G+ PLALDM SMGKG
Sbjct  583   KTGLKGEALGLHTVTGSSSVEWVEGPSMAKKQPLTWYKATFNAPPGDAPLALDMGSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWPGY A+GSC  +C+YAGTY+ KKC+ +CG+PSQ
Sbjct  643   QIWINGQSVGRHWPGYIARGSC-GDCSYAGTYDDKKCRTHCGEPSQ  687



>dbj|BAE72073.1| pear beta-galactosidase1 [Pyrus communis]
Length=731

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/561 (74%), Positives = 479/561 (85%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  25    SVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLVKFIKL Q+AGL+V+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  85    PGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDNE  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV+MMK+EKLF+SQGGPII+SQIENE+GPVEWEIGAPGKAYTKWA QM
Sbjct  145   PFKAAMQKFTEKIVSMMKAEKLFQSQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG V
Sbjct  205   AVGLDTGVPWIMCKQEDAPDPVIDTCNGFYCENFKPNKDYKPKMWTEVWTGWYTEFGGAV  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ+ GSF+NYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL  
Sbjct  265   PTRPAEDVAFSVARFIQSGGSFLNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLPR  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIK  E ALVS  P VT  G NQE HVF+SE+  C AFL+NYD ++S 
Sbjct  325   EPKWGHLRDLHKAIKPCESALVSVDPSVTKLGSNQEAHVFKSESD-CAAFLANYDAKYSV  383

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F   QYDLPPWSISILPDCK  VYNTA V S S Q +M PV +GF WQS+ EE  SS
Sbjct  384   KVSFGGGQYDLPPWSISILPDCKTEVYNTAKVGSQSSQVQMTPVHSGFPWQSFIEETTSS  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             D+ DT   DG++EQIN+TRD++DYLWYMT++ I  DE FL+NGK P++T+ SAGHA++VF
Sbjct  444   DETDTTTLDGLYEQINITRDTTDYLWYMTDITIGSDEAFLKNGKSPLLTISSAGHALNVF  503

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKL+++ +V LR+GINK++LLS++VGLPNVG HFE WNAGVLGP+
Sbjct  504   INGQLSGTVYGSLENPKLSFSQNVNLRSGINKLALLSISVGLPNVGTHFETWNAGVLGPI  563

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN GT D++   W YK 
Sbjct  564   TLKGLNSGTWDMSGWKWTYKT  584


 Score =   162 bits (409),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             + G+KGE+L L+TVTGSSSVEW +GP +A  QPLTWYKATF+AP G+ PLALDM SMGKG
Sbjct  583   KTGLKGEALGLHTVTGSSSVEWVEGPSMAKKQPLTWYKATFNAPPGDAPLALDMGSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWPGY A+GSC  +C+YAGTY+ KKC+ +CG+PSQ
Sbjct  643   QIWINGQSVGRHWPGYIARGSC-GDCSYAGTYDDKKCRTHCGEPSQ  687



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/593 (70%), Positives = 494/593 (83%), Gaps = 5/593 (1%)
 Frame = +1

Query  316   MGIKKV--RNHflvlfvlvlsslafcsvRGSVSYDGRSFIINGKRRILISGSIHYPRSTP  489
             MG+KK+  RN+ ++L V+VL SL  CSV  SVSYD ++ +ING+RRILISGSIHYPRSTP
Sbjct  1     MGLKKLAMRNNGVLLLVVVLFSLWGCSVSASVSYDSKAIVINGQRRILISGSIHYPRSTP  60

Query  490   QMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRI  669
             +MWP L+QKAKDGGLDVIQTYVFWNGHEPSPGKY FEG YDLVKF+KL Q+AGLY+HLRI
Sbjct  61    EMWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFVKLVQQAGLYMHLRI  120

Query  670   GPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFKVAMQGFVGKIVNMMKSEKLFESQGGPI  849
             GPY+C EWNFGGFP+WLKY+PGI FRTDN PFK  M+ F  KIVNMMK+E+LF S+GGPI
Sbjct  121   GPYVCAEWNFGGFPVWLKYIPGIRFRTDNGPFKAQMEKFTRKIVNMMKAERLFASEGGPI  180

Query  850   IMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYY  1029
             I+SQIENEYGP+E+E+GAPGKAY+ WA  MAVGL TGVPW+MCKQ+DAPDPII+ CNG+Y
Sbjct  181   ILSQIENEYGPMEYELGAPGKAYSNWAAHMAVGLGTGVPWVMCKQDDAPDPIINACNGFY  240

Query  1030  CENFHPNKPYKPKMFTELWTGWYTQFGGPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHG  1209
             C+ F PNK YKPKM+TE WT WYT+FGGPV +RPAED+AF+VARFIQ  G+F+NYYMYHG
Sbjct  241   CDYFSPNKAYKPKMWTEAWTAWYTEFGGPVPKRPAEDLAFAVARFIQKGGAFINYYMYHG  300

Query  1210  GTNFGRTAAALFIATSYDYDAPLDEYGLVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTW  1389
             GTNFGRTA   FIATSYDYDAPLDEYGL+ +PK+GHL+DLHRAIKL EPALVS  P VT 
Sbjct  301   GTNFGRTAGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTQ  360

Query  1390  FGKNQEVHVFRSETGACVAFLSNYDPQFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTA  1569
              G  ++ HVF+S++GAC AFL+NY+P   AKV+F N+ Y+LPPWSISILPDC+N VYNTA
Sbjct  361   LGNYEQAHVFKSKSGACAAFLANYNPNSFAKVSFGNMHYNLPPWSISILPDCENTVYNTA  420

Query  1570  TVRSPSLQTKM--IPVGNGFSWQSYTEEIASSDDGDTVAADGMWEQINVTRDSSDYLWYM  1743
              V + S   KM  +P+  G SWQ+Y E+ AS ++  +    G+ EQIN TRD+SDYLWYM
Sbjct  421   RVGAQSSTMKMTRVPIHGGLSWQAYNEQTASYEE-TSFTVSGLLEQINTTRDASDYLWYM  479

Query  1744  TEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFINSELSGTVYGGLAFPKLTYTNSVKLRA  1923
             T+V I P EEFLR+GK PV+TV SAGHA+HVF+N +L+GT YG L FPKLT +  V LRA
Sbjct  480   TDVKIDPSEEFLRSGKYPVLTVSSAGHALHVFVNGQLAGTSYGSLEFPKLTLSKGVNLRA  539

Query  1924  GINKISLLSVAVGLPNVGLHFEKWNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             GIN I+LLS+AVGLPNVG HFE WNAGVLGPV+L+GLNEG RDL+ Q W YKV
Sbjct  540   GINTIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKV  592


 Score =   148 bits (373),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE+LSL+++TGSSSV+W  G L+A  QPLTW+K +FDAP G  PLALDM SMGKG
Sbjct  591   KVGLRGEALSLHSLTGSSSVDWIQGSLVARKQPLTWFKTSFDAPAGYAPLALDMGSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y AQGSC   C+YAGTYN+KKC  NCG  SQ
Sbjct  651   QIWINGQSLGRYWPAYKAQGSCGG-CDYAGTYNEKKCLSNCGDASQ  695



>ref|XP_011080179.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/563 (73%), Positives = 472/563 (84%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
               SVSYD ++  +NG+RRILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  28    EASVSYDHKAISVNGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  87

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P PGKY FEGRYDLVKFIKL  +AGLYV+LRIGPY C EWNFGGFP+WLKYVPGI FRT+
Sbjct  88    PEPGKYYFEGRYDLVKFIKLVHQAGLYVNLRIGPYACAEWNFGGFPVWLKYVPGISFRTN  147

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AMQ F  KIVNMMK+E+L+E+QGGPII+SQIENEYGP+E+E+GAPG+AY++WA 
Sbjct  148   NGPFKAAMQKFTTKIVNMMKAERLYETQGGPIILSQIENEYGPMEYELGAPGRAYSEWAA  207

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAV L TGVPWIMCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+TQFGG
Sbjct  208   KMAVDLGTGVPWIMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGG  267

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  268   PVPYRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  327

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P V   G  QE HVF+S +G+C AFL+NY+   
Sbjct  328   LRQPKWGHLKDLHRAIKLCEPALVSGDPTVMSLGNYQEAHVFKSRSGSCAAFLANYNQHS  387

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
              AKV+F N+ Y+LPPWSISILPDCKN VYNTA + + S Q KM PV  GF+WQSY EE+ 
Sbjct  388   FAKVSFWNMHYNLPPWSISILPDCKNTVYNTARIGAQSAQMKMTPVSKGFAWQSYNEELM  447

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S +D ++    G+ EQIN TRD++DYLWY T+V I P E FLR GK PV+TV SAGHA+H
Sbjct  448   SYED-NSFTMVGLREQINTTRDNTDYLWYTTDVKIDPREGFLRGGKWPVLTVFSAGHALH  506

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGT YG L  PK+T++ SV LRAG+NKISLLS+AVGLPNVG HFE WNAGVLG
Sbjct  507   VFINGQLSGTAYGSLESPKVTFSKSVNLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  566

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSLSGLNEG RDLT Q W YKV
Sbjct  567   PVSLSGLNEGKRDLTWQKWTYKV  589


 Score =   124 bits (312),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW +G  +A  QPLTWYK TF+AP GN+PLALDM +M KG
Sbjct  588   KVGLKGESLSLHSLSGSSSVEWVEGSYIAQRQPLTWYKTTFNAPSGNEPLALDMDTMSKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+W  Y A G+C + CNYAG +N+KKC  NCG+ SQ
Sbjct  648   QVWINGQSIGRYWNEYKASGNCGA-CNYAGWFNEKKCLSNCGKASQ  692



>ref|XP_011000791.1| PREDICTED: beta-galactosidase 1-like [Populus euphratica]
Length=846

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/563 (72%), Positives = 474/563 (84%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLD IQTYVFWNGHEPS
Sbjct  32    SVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDGIQTYVFWNGHEPS  91

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY F G YDLVKF+KL ++AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN 
Sbjct  92    PGKYYFGGNYDLVKFVKLVKEAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGINFRTDNG  151

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIVNMMK+E+LFE+QGGPII+SQIENEYGP+E+EIG+PGKAYTKWA +M
Sbjct  152   PFKAQMQKFTTKIVNMMKAERLFETQGGPIILSQIENEYGPLEYEIGSPGKAYTKWAAEM  211

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL+TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+TQFGGPV
Sbjct  212   AVGLRTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGGPV  271

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  272   PHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS    V   G  QE HVF  + G C AFL+NY  +  A
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGDATVIPLGNYQEAHVFNYKAGGCAAFLANYHQRSFA  391

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KV+F N+ Y+LPPWSISILPDCKN VYNTA V + S + KM  +P+  GFSWQ+Y EE +
Sbjct  392   KVSFRNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPMHGGFSWQAYNEEPS  451

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             +S D +T    G+ EQIN TRD SDYLWYMT+V+I P E FLR+GK PV++V+SAGHA+H
Sbjct  452   ASGD-NTFTMVGLLEQINTTRDVSDYLWYMTDVHINPSEGFLRSGKYPVLSVLSAGHALH  510

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGT YG L FPKLT+T  VKLRAG+NKISLLSVAVGLPNVG HFE WNAG+LG
Sbjct  511   VFINGQLSGTAYGSLDFPKLTFTQGVKLRAGVNKISLLSVAVGLPNVGPHFETWNAGILG  570

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L+GLNEG RDL+ Q W YK+
Sbjct  571   PVTLNGLNEGRRDLSWQKWSYKI  593


 Score =   147 bits (372),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE+L L++++GSSSVEW +G L+A  QPL+WYK TF+AP GN PLALDM SMGKG
Sbjct  592   KIGLHGEALGLHSISGSSSVEWAEGSLVAQRQPLSWYKTTFNAPAGNSPLALDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ VGRHWP Y A G+C  +C+Y GTY++KKC  NCG+ SQ
Sbjct  652   QMWINGQHVGRHWPAYKASGTC-GDCSYIGTYSEKKCSTNCGEASQ  696



>emb|CAH18936.1| beta-galactosidase [Pyrus communis]
Length=724

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/561 (74%), Positives = 479/561 (85%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  18    SVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  77

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLVKFIKL Q+AGL+V+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  78    PGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDNE  137

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV+MMK+EKLF+SQGGPII+SQIENE+GPVEWEIGAPGKAYTKWA QM
Sbjct  138   PFKAAMQKFTEKIVSMMKAEKLFQSQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQM  197

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG V
Sbjct  198   AVGLDTGVPWIMCKQEDAPDPVIDTCNGFYCENFKPNKDYKPKMWTEVWTGWYTEFGGAV  257

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ+ GSF+NYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL  
Sbjct  258   PTRPAEDVAFSVARFIQSGGSFLNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLPR  317

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIK  E ALVS  P VT  G NQE HVF+SE+  C AFL+NYD ++S 
Sbjct  318   EPKWGHLRDLHKAIKPCESALVSVDPSVTKLGSNQEAHVFKSESD-CAAFLANYDAKYSV  376

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F   QYDLPPWSISILPDCK  VYNTA V S S Q +M PV +GF WQS+ EE  SS
Sbjct  377   KVSFGGGQYDLPPWSISILPDCKTEVYNTAKVGSQSSQVQMTPVHSGFPWQSFIEETTSS  436

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             D+ DT   DG++EQIN+TRD++DYLWYMT++ I  DE FL+NGK P++T+ SAGHA++VF
Sbjct  437   DETDTTYMDGLYEQINITRDTTDYLWYMTDITIGSDEAFLKNGKSPLLTISSAGHALNVF  496

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKL+++ +V LR+GINK++LLS++VGLPNVG HFE WNAGVLGP+
Sbjct  497   INGQLSGTVYGSLENPKLSFSQNVNLRSGINKLALLSISVGLPNVGTHFETWNAGVLGPI  556

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN GT D++   W YK 
Sbjct  557   TLKGLNSGTWDMSGWKWTYKT  577


 Score =   160 bits (404),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             + G+KGE+L L+TVTGSSSVEW +GP +A  QPLTW+KATF+AP G+ PLALDM SMGKG
Sbjct  576   KTGLKGEALGLHTVTGSSSVEWVEGPSMAKKQPLTWHKATFNAPPGDAPLALDMGSMGKG  635

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWPGY A+GSC  +C+YAGTY+ KKC+ +CG+PSQ
Sbjct  636   QIWINGQSVGRHWPGYIARGSC-GDCSYAGTYDDKKCRTHCGEPSQ  680



>dbj|BAB21492.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=731

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/561 (73%), Positives = 480/561 (86%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  25    SVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLVKFIKL Q+AGL+V+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  85    PGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDNE  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEWEIGAPGKAYTKWA QM
Sbjct  145   PFKAAMQKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG V
Sbjct  205   AVGLDTGVPWIMCKQEDAPDPVIDTCNGFYCENFKPNKDYKPKMWTEVWTGWYTEFGGAV  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ+ GSF+NYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL+ 
Sbjct  265   PTRPAEDVAFSVARFIQSGGSFLNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLLR  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIK  E ALVS  P VT  G NQE HVF+SE+  C AFL+NYD ++S 
Sbjct  325   EPKWGHLRDLHKAIKSCESALVSVDPSVTKLGSNQEAHVFKSESD-CAAFLANYDAKYSV  383

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F   QYDLPPWSISILPDCK  VY+TA V S S Q +M PV +GF WQS+ EE  SS
Sbjct  384   KVSFGGGQYDLPPWSISILPDCKTEVYSTAKVGSQSSQVQMTPVHSGFPWQSFIEETTSS  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             D+ DT   DG++EQIN+TRD++DYLWYMT++ I  DE FL+NGK P++T+ SAGHA++VF
Sbjct  444   DETDTTTLDGLYEQINITRDTTDYLWYMTDITIGSDEAFLKNGKSPLLTIFSAGHALNVF  503

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKL+++ +V LR+GINK++LLS++VGLPNVG HFE WNAGVLGP+
Sbjct  504   INGQLSGTVYGSLENPKLSFSQNVNLRSGINKLALLSISVGLPNVGTHFETWNAGVLGPI  563

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN GT D++   W YK 
Sbjct  564   TLKGLNSGTWDMSGWKWTYKT  584


 Score =   162 bits (409),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             + G+KGE+L L+TVTGSSSVEW +GP +A  QPLTWYKATF+AP G+ PLALDM SMGKG
Sbjct  583   KTGLKGEALGLHTVTGSSSVEWVEGPSMAKKQPLTWYKATFNAPPGDAPLALDMGSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWPGY A+GSC  +C+YAGTY+ KKC+ +CG+PSQ
Sbjct  643   QIWINGQSVGRHWPGYIARGSC-GDCSYAGTYDDKKCRTHCGEPSQ  687



>ref|XP_007217146.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
 gb|EMJ18345.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
Length=841

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/565 (72%), Positives = 475/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ +ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  25    KASVSYDSKAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FE  YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI+FRTD
Sbjct  85    PSPGKYYFEDNYDLVKFIKLIQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIQFRTD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  MQ F  KIVN MK+E+LF+SQGGPII+SQIENEYGP+E+E+GAPGK YT WA 
Sbjct  145   NGPFKAQMQRFTTKIVNTMKAERLFQSQGGPIILSQIENEYGPMEYELGAPGKVYTDWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
              MA+GL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  205   HMALGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  265   AVPSRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS+ P VT  G  QE HVF+S++GAC AFL+NY+P+ 
Sbjct  325   LRQPKWGHLKDLHRAIKLCEPALVSADPTVTPLGTYQEAHVFKSKSGACAAFLANYNPRS  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N+ Y+LPPWSISILPDCKN VYNTA V + S Q KM  +P+   FSWQ+Y +E
Sbjct  385   FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMPRVPLHGAFSWQAYNDE  444

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
              A+  D     A G+ EQIN TRDSSDYLWY+T+V I P+EEFLR+GK PV+T++SAGHA
Sbjct  445   TATYADTSFTTA-GLLEQINTTRDSSDYLWYLTDVKIDPNEEFLRSGKYPVLTILSAGHA  503

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             + VFIN +L+GT YG L FPKLT++  V LRAGIN+I+LLS+AVGLPNVG HFE WNAGV
Sbjct  504   LRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGINQIALLSIAVGLPNVGPHFETWNAGV  563

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV L+GLNEG RDL+ Q W YKV
Sbjct  564   LGPVILNGLNEGRRDLSWQKWSYKV  588


 Score =   134 bits (336),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW  G L+   QPLTWYK TF+AP GN PLALDM SMGKG
Sbjct  587   KVGLKGEALSLHSLSGSSSVEWIQGSLVTRRQPLTWYKTTFNAPAGNSPLALDMGSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GR+WP Y A GSC + CNYAGTY++KKC  NCG+ SQ
Sbjct  647   QVWINGRSIGRYWPAYKASGSCGA-CNYAGTYHEKKCLSNCGEASQ  691



>ref|XP_010049746.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82504.1| hypothetical protein EUGRSUZ_C03896 [Eucalyptus grandis]
Length=722

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/561 (73%), Positives = 472/561 (84%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ II+GKRRILISGSIHYPRSTP+MWP L+ KAK GGLDVIQTYVFWNGHEPS
Sbjct  22    SVSYDRKAIIIDGKRRILISGSIHYPRSTPEMWPDLIWKAKQGGLDVIQTYVFWNGHEPS  81

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG Y F+ RYDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRT+N+
Sbjct  82    PGNYYFQDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTNNK  141

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PF+ AMQ F  KIVNMMK+E+LF+SQGGPII+SQIENE+GPVEW IGAPGKAYTKWA  M
Sbjct  142   PFEDAMQKFTQKIVNMMKAERLFQSQGGPIILSQIENEFGPVEWNIGAPGKAYTKWAASM  201

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDP+I+ CNGYYCE F PN   KPKM+TE WTGWYT+FGG V
Sbjct  202   AVGLGTGVPWVMCKQDDAPDPVINACNGYYCEGFKPNSNNKPKMWTENWTGWYTEFGGAV  261

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQN+GSFVNYYMYHGGTNFGRTA    IATSYDYDAPLDEYGL+ 
Sbjct  262   PYRPAEDLAFSVARFIQNSGSFVNYYMYHGGTNFGRTAGGPMIATSYDYDAPLDEYGLLR  321

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+ HLRDLH+AIK +E ALVS+ P+V   G NQE HVF++ +G C AFL+NYD ++S 
Sbjct  322   EPKWSHLRDLHKAIKQSEWALVSADPVVQSLGSNQEAHVFKAGSG-CAAFLANYDTKYSV  380

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             +V F N +YDLPPWSISILPDCK  VYNTA V +PS Q KM+PVG GFSWQSY EE  S+
Sbjct  381   RVNFGNGKYDLPPWSISILPDCKTAVYNTARVNAPSSQIKMVPVG-GFSWQSYIEETVSA  439

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                DT   DG+ EQI+ TRD SDYLWY T++ I+P+E FLR+G+ PV+T+ SAGHAMHVF
Sbjct  440   FGSDTYTKDGLLEQISFTRDFSDYLWYTTDITISPNEAFLRSGQYPVLTIWSAGHAMHVF  499

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN EL+G+ YG L  PKL+Y+N+VKLRAGINK+S+LSVAVGLPNVGLHFE WN GVLGPV
Sbjct  500   INGELTGSAYGSLENPKLSYSNNVKLRAGINKLSILSVAVGLPNVGLHFETWNTGVLGPV  559

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN GT D++   W YKV
Sbjct  560   TLKGLNSGTWDMSKWKWSYKV  580


 Score =   158 bits (399),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L LNTV+GSSSVEW +G +LA  QPLTWYKATF+AP G+ PLALDM+SMGKG
Sbjct  579   KVGLKGENLGLNTVSGSSSVEWLEGSMLAQKQPLTWYKATFNAPPGHSPLALDMNSMGKG  638

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIW+NG+ +GRHWP YTA+GSC S C+YAGT+++ KC+  CGQ SQ
Sbjct  639   EIWINGQSIGRHWPAYTARGSCGS-CSYAGTFDENKCRSGCGQASQ  683



>emb|CAA09467.1| exo galactanase [Lupinus angustifolius]
Length=730

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/562 (73%), Positives = 472/562 (84%), Gaps = 3/562 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV+YD ++ +ING+RRILISGSIHYPRSTPQMWP L+QKAKDGGLDVI+TYVFWNGHEP
Sbjct  33    ASVTYDHKAIMINGQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  92

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE R+DLV FIKL Q+AGL+VHLRIGP+IC EWNFGGFP+WLKYVPGI FRTDN
Sbjct  93    SPGKYYFEDRFDLVGFIKLVQQAGLFVHLRIGPFICAEWNFGGFPVWLKYVPGIAFRTDN  152

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIVN+MK+EKLF+SQGGPII+SQIENEYGPVEWEIGAPGKAYTKWA Q
Sbjct  153   EPFKEAMQKFTEKIVNIMKAEKLFQSQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAAQ  212

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDPIIDTCNG+YCENF PNK YKPK++TE WTGWYT FGG 
Sbjct  213   MAVGLDTGVPWVMCKQEDAPDPIIDTCNGFYCENFTPNKNYKPKLWTENWTGWYTAFGGA  272

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
                RPAEDIAFSVARFIQN GS  NYYMYHGGTNFGRT+  LF+ATSYDYDAP+DEYGL+
Sbjct  273   TPYRPAEDIAFSVARFIQNRGSLFNYYMYHGGTNFGRTSNGLFVATSYDYDAPIDEYGLL  332

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             NEPK+GHLR+LHRAIK  E ALVS  P V+W GKN EVH++++E+ AC AFL+NY+  +S
Sbjct  333   NEPKWGHLRELHRAIKQCESALVSVDPTVSWPGKNLEVHLYKTES-ACAAFLANYNTDYS  391

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              +V F N QYDLPPWSISILPDCK  V+NTA V SP L  KM PV + F+WQSY EE AS
Sbjct  392   TQVKFGNGQYDLPPWSISILPDCKTEVFNTAKVNSPRLHRKMTPVNSAFAWQSYNEEPAS  451

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             S + D V    +WEQ+ VTRDSSDYLWY+T+VNI P++  +++GK PV+T MSAGH ++V
Sbjct  452   SSENDPVTGYALWEQVGVTRDSSDYLWYLTDVNIGPND--IKDGKWPVLTAMSAGHVLNV  509

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN + +GT YG L  P+LT++ SV LR G NKISLLSV+VGL NVG HFE WN GVLGP
Sbjct  510   FINGQYAGTAYGSLDDPRLTFSQSVNLRVGNNKISLLSVSVGLANVGTHFETWNTGVLGP  569

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L+GL+ GT DL+ Q W YK+
Sbjct  570   VTLTGLSSGTWDLSKQKWSYKI  591


 Score =   154 bits (388),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T  GS+SVEW  G L+A  QPL WYK TF AP GNDPLALD+ SMGKG
Sbjct  590   KIGLKGESLSLHTEAGSNSVEWVQGSLVAKKQPLAWYKTTFSAPAGNDPLALDLGSMGKG  649

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             E+WVNG+ +GRHWPG  A+G+C + CNYAGTY   KC  NCGQPSQ
Sbjct  650   EVWVNGQSIGRHWPGNKARGNCGN-CNYAGTYTDTKCLANCGQPSQ  694



>ref|XP_008391326.1| PREDICTED: beta-galactosidase 1 [Malus domestica]
Length=843

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/565 (73%), Positives = 474/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R SVSYD ++ +ING R+ILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  27    RASVSYDSKAIVINGHRKILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  86

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FE  YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI+FRTD
Sbjct  87    PSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIQFRTD  146

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  MQ F  KIVNMMK+E+LF++ GGPIIMSQIENEYGP+E+E+GAPGK YT WA 
Sbjct  147   NGPFKNQMQRFTTKIVNMMKAERLFQTHGGPIIMSQIENEYGPMEYELGAPGKQYTDWAA  206

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  207   QMALGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  266

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  267   AVPYRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  326

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS+ P V   G+ QE HVF+S +GAC AFL+NY+P+ 
Sbjct  327   LRQPKWGHLKDLHRAIKLCEPALVSADPTVQPLGRFQEAHVFKSNSGACSAFLANYNPRS  386

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N+ Y+LPPWSISILPDCKN VYNTA V + S   KM  +P+  GFSWQSY +E
Sbjct  387   FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMPRVPLHGGFSWQSYPDE  446

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
              AS  D  T    G+ EQIN TRDSSDYLWY+T+VNI P+EEFLR+GK P +TV+SAGHA
Sbjct  447   AASYSD-TTFTTAGLLEQINTTRDSSDYLWYITDVNIDPNEEFLRSGKYPELTVLSAGHA  505

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             + VFIN +L+GT YG L FPKLT++  V LRAGIN+I+LLS+AVGLPNVG HFE WNAGV
Sbjct  506   LRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGINQIALLSIAVGLPNVGPHFETWNAGV  565

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV L+GLNEG RDL+ Q W YKV
Sbjct  566   LGPVILNGLNEGRRDLSWQKWSYKV  590


 Score =   134 bits (337),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW  G  +   QPLTW+K TF+AP GN PLALDM SMGKG
Sbjct  589   KVGLKGEALSLHSLSGSSSVEWIQGSYVTRKQPLTWFKTTFNAPAGNSPLALDMGSMGKG  648

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GR+WP YTA G+C + CNYAGTYN+KKC  NCGQ SQ
Sbjct  649   QVWINGRSIGRYWPAYTASGNCGA-CNYAGTYNEKKCLSNCGQASQ  693



>ref|XP_008228300.1| PREDICTED: beta-galactosidase 1 [Prunus mume]
Length=841

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/565 (72%), Positives = 475/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ +ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  25    KASVSYDSKAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FE  YDLVK+IKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI+FRTD
Sbjct  85    PSPGKYYFEDNYDLVKYIKLIQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIQFRTD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  MQ F  KIVNMMK+E+LF+SQGGPII+SQIENEYGP+E+E+GAPGK YT WA 
Sbjct  145   NGPFKAQMQRFTTKIVNMMKAERLFQSQGGPIILSQIENEYGPMEYELGAPGKVYTDWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
              MA+GL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  205   HMALGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  265   AVPSRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS+ P VT  G   E HVF+S++GAC AFL+NY+P+ 
Sbjct  325   LRQPKWGHLKDLHRAIKLCEPALVSADPTVTPLGTYGEAHVFKSKSGACAAFLANYNPRS  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N+ Y+LPPWSISILPDCKN VYNTA V + S + KM  +P+   FSWQ+Y +E
Sbjct  385   FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMPRVPLHGAFSWQAYNDE  444

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
              A+  D     A G+ EQIN TRDSSDYLWY+T+V I P+EEFLR+GK PV+T++SAGHA
Sbjct  445   TATYADTSFTTA-GLLEQINTTRDSSDYLWYLTDVKIDPNEEFLRSGKYPVLTILSAGHA  503

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             + VFIN +L+GT YG L FPKLT++  V LRAGIN+I+LLS+AVGLPNVG HFE WNAGV
Sbjct  504   LRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGINQIALLSIAVGLPNVGPHFETWNAGV  563

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV L+GLNEG RDL+ Q W YKV
Sbjct  564   LGPVILNGLNEGRRDLSWQKWSYKV  588


 Score =   134 bits (336),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW  G L+   QPLTWYK TF+AP GN PLALDM SMGKG
Sbjct  587   KVGLKGEALSLHSLSGSSSVEWIQGSLVTRRQPLTWYKTTFNAPAGNSPLALDMGSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GR+WP Y A GSC + CNYAGTY++KKC  NCG+ SQ
Sbjct  647   QVWINGRSIGRYWPAYKASGSCGA-CNYAGTYHEKKCLSNCGEASQ  691



>sp|P48981.1|BGAL_MALDO RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Malus domestica]
 gb|AAA62324.1| b-galactosidase-related protein; putative [Malus domestica]
Length=731

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/561 (73%), Positives = 477/561 (85%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING++RILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  25    SVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG Y FE RYDLVKFIKL Q+ GL+V+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  85    PGNYYFEERYDLVKFIKLVQQEGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDNE  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIV+MMK+EKLF++QGGPII+SQIENE+GPVEWEIGAPGKAYTKWA QM
Sbjct  145   PFKAAMQKFTEKIVSMMKAEKLFQTQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDP+IDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG V
Sbjct  205   AVGLDTGVPWIMCKQEDAPDPVIDTCNGFYCENFKPNKDYKPKMWTEVWTGWYTEFGGAV  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ+ GSF+NYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL  
Sbjct  265   PTRPAEDVAFSVARFIQSGGSFLNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLPR  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIK  E ALVS  P VT  G NQE HVF+SE+  C AFL+NYD ++S 
Sbjct  325   EPKWGHLRDLHKAIKSCESALVSVDPSVTKLGSNQEAHVFKSESD-CAAFLANYDAKYSV  383

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F   QYDLPPWSISILPDCK  VYNTA V S S Q +M PV +GF WQS+ EE  SS
Sbjct  384   KVSFGGGQYDLPPWSISILPDCKTEVYNTAKVGSQSSQVQMTPVHSGFPWQSFIEETTSS  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             D+ DT   DG++EQIN+TRD++DYLWYMT++ I  DE FL+NGK P++T+ SAGHA++VF
Sbjct  444   DETDTTTLDGLYEQINITRDTTDYLWYMTDITIGSDEAFLKNGKSPLLTIFSAGHALNVF  503

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKL+++ +V LR+GINK++LLS++VGLPNVG HFE WNAGVLGP+
Sbjct  504   INGQLSGTVYGSLENPKLSFSQNVNLRSGINKLALLSISVGLPNVGTHFETWNAGVLGPI  563

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN GT D++   W YK 
Sbjct  564   TLKGLNSGTWDMSGWKWTYKT  584


 Score =   162 bits (409),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             + G+KGE+L L+TVTGSSSVEW +GP +A  QPLTWYKATF+AP G+ PLALDM SMGKG
Sbjct  583   KTGLKGEALGLHTVTGSSSVEWVEGPSMAEKQPLTWYKATFNAPPGDAPLALDMGSMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWPGY A+GSC  +C+YAGTY+ KKC+ +CG+PSQ
Sbjct  643   QIWINGQSVGRHWPGYIARGSC-GDCSYAGTYDDKKCRTHCGEPSQ  687



>ref|XP_011010891.1| PREDICTED: beta-galactosidase 1-like [Populus euphratica]
Length=845

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/563 (72%), Positives = 473/563 (84%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  31    SVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  90

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEG YDLVKF+KL ++AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRTDN 
Sbjct  91    PGKYYFEGSYDLVKFVKLVKEAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTDNG  150

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  M+ F  KIV MMK+E+LFESQGGPII+SQIENEYGP+E+E+G+PG+AYTKWA QM
Sbjct  151   PFKAQMRKFTTKIVKMMKAERLFESQGGPIILSQIENEYGPMEYELGSPGQAYTKWAAQM  210

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL+TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+TQFGGPV
Sbjct  211   AVGLRTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGGPV  270

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  271   PHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  330

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS    V   G  QE HVF  + G C AFL+NY  +  A
Sbjct  331   QPKWGHLKDLHRAIKLCEPALVSGDATVIPLGNYQEAHVFNYKAGGCAAFLANYHQRSFA  390

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KV+F N+ Y+LPPWSISILPDCKN VYNTA V + S   KM  +P+  G SWQ+YTEE +
Sbjct  391   KVSFRNMHYNLPPWSISILPDCKNTVYNTARVGAQSATIKMTPVPMHGGLSWQTYTEEPS  450

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D +T    G+ EQIN TRD SDYLWYMT+V+I   E FL+NGK PV+TV+SAGHA+H
Sbjct  451   SSGD-NTFTMVGLLEQINTTRDVSDYLWYMTDVHIDHSEGFLKNGKYPVLTVLSAGHALH  509

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGT YG L FPKLT++  V+LRAG+NKISLLS+AVGLPNVG HFE WNAG+LG
Sbjct  510   VFINGQLSGTAYGSLDFPKLTFSQGVRLRAGVNKISLLSIAVGLPNVGPHFETWNAGILG  569

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L+GLNEG RDL+ Q W YK+
Sbjct  570   PVTLNGLNEGRRDLSWQKWSYKI  592


 Score =   139 bits (351),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE+LSL++++GSSSVEW +G L+A  QPL+WYK TF+AP GN PLALDM SMGKG
Sbjct  591   KIGLHGEALSLHSISGSSSVEWAEGSLVAQKQPLSWYKTTFNAPAGNSPLALDMGSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A G+C  EC Y GTYN+KKC  NCG+ SQ
Sbjct  651   QIWINGQHVGRHWPAYKASGTC-GECTYIGTYNEKKCSTNCGEASQ  695



>gb|AHG94611.1| beta-galactosidase [Camellia sinensis]
Length=843

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/563 (72%), Positives = 474/563 (84%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSY+ ++ +ING+RRILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEP 
Sbjct  29    SVSYNSKAIVINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPQ  88

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEGR+DLV FIKL ++AGLY HLRIGPY C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  89    PGKYYFEGRFDLVNFIKLVKQAGLYXHLRIGPYACAEWNFGGFPVWLKYVPGISFRTDNG  148

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIVNMMK+E+L+ESQGGP+I+SQIENEYGP+E+E+GAPG+AY KWA QM
Sbjct  149   PFKAAMQKFTMKIVNMMKAERLYESQGGPVILSQIENEYGPMEYELGAPGQAYAKWAAQM  208

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG V
Sbjct  209   AVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGAV  268

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRT+   FIATSYDYDAPLDEYGL+ 
Sbjct  269   PYRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTSGGPFIATSYDYDAPLDEYGLLR  328

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P V   G NQE +VF++++GAC AFL+N+D +  A
Sbjct  329   QPKWGHLKDLHRAIKLCEPALVSGDPTVFSLGNNQEAYVFKTKSGACAAFLTNHDSKSFA  388

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPV--GNGFSWQSYTEEIA  1653
             KV+F+NL Y+LPPWSISILPDCKN VYNTA V + S Q KMIP   G GFSWQS+ EE A
Sbjct  389   KVSFANLHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMIPAVYGIGFSWQSFNEEPA  448

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S +D     A G+ EQIN TRD SDYLWYMT+V I P E FL++G  PV+TV+SAGHA+H
Sbjct  449   SYNDNSFTTA-GLLEQINTTRDMSDYLWYMTDVKIDPYEGFLKSGNYPVLTVLSAGHALH  507

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGT YG L  P+LT+   V LRAG+N I+LLS+AVGLPNVG HFE WNAGVLG
Sbjct  508   VFINGQLSGTAYGSLEDPRLTFNQGVNLRAGVNTIALLSIAVGLPNVGPHFETWNAGVLG  567

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSL+GLNEG+RDL+ Q W YK+
Sbjct  568   PVSLNGLNEGSRDLSWQKWTYKI  590


 Score =   131 bits (330),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW  G  +A  QPLTWYK  F+AP GN+PLALDM++MGKG
Sbjct  589   KIGLKGEALSLHSLSGSSSVEWAQGSFVAQKQPLTWYKTAFNAPVGNEPLALDMNTMGKG  648

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GR+WPGY A GSCS+ CNYAG + +KKC  NCG+ SQ
Sbjct  649   NVWINGKSIGRYWPGYKATGSCSA-CNYAGWFYEKKCLSNCGEASQ  693



>ref|XP_004287560.1| PREDICTED: beta-galactosidase-like [Fragaria vesca subsp. vesca]
Length=746

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/563 (72%), Positives = 473/563 (84%), Gaps = 5/563 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD R+ II+G++RIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  28    ASVSYDHRAIIIDGQKRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEP  87

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIKL ++AGLYVHLRIGPY+C EWNFGGFP WLKYVPGIEFRTDN
Sbjct  88    SPGKYYFEDRYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPAWLKYVPGIEFRTDN  147

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AM+ F  KIV MMK+E LF+ QGGPIIMSQIENEYGPVEWEI APGKAYT W  Q
Sbjct  148   EPFKAAMKTFTEKIVGMMKAEGLFQPQGGPIIMSQIENEYGPVEWEIKAPGKAYTNWTAQ  207

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL TGVPWIMCKQEDAPDPIIDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG 
Sbjct  208   MALGLDTGVPWIMCKQEDAPDPIIDTCNGFYCENFTPNKKYKPKMWTEVWTGWYTEFGGA  267

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPA+D+AFSVARFIQN GSF NYYMYHGGTNF RT + LF+ATSYDYDAPLDEYGL 
Sbjct  268   VPTRPAQDLAFSVARFIQNGGSFANYYMYHGGTNFDRT-SGLFVATSYDYDAPLDEYGLP  326

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+ HL+ LH+AIKLAE ALV++ P V+  GK+QE HVF S +G C AFL+NYD ++S
Sbjct  327   REPKWSHLKYLHKAIKLAEAALVATDPAVSSLGKSQEAHVFNSTSG-CAAFLANYDTKYS  385

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATV-RSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             ++V+F N QY LPPWSISILPDC   V NT  V +SP +   M PV    SWQSY E+ A
Sbjct  386   SRVSFGNRQYKLPPWSISILPDCITDVLNTGRVGQSPPVD--MTPVNTTLSWQSYIEDAA  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D  T   DG++EQIN+TRD++DYLWYMT++ I P+EEFL+NG  P++T+ SAGHA+H
Sbjct  444   SSADDSTFTLDGLYEQINITRDATDYLWYMTDITIGPNEEFLKNGSYPLLTIDSAGHALH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSGTVY GLAFPKL + ++VKLRAGINK++LLS+AVGLPNVGLHFE WNAGVLG
Sbjct  504   VFINGQLSGTVYAGLAFPKLRFNDTVKLRAGINKLALLSIAVGLPNVGLHFETWNAGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLN GT +++   W YK+
Sbjct  564   PVTLKGLNSGTWNMSRWKWTYKI  586


 Score =   164 bits (414),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +2

Query  2138  RFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDM  2317
             R+    ++GM+GE+LSL+TV GSSSVEW +GPLLA  QPLTWYK+ F AP GN PLALDM
Sbjct  579   RWKWTYKIGMRGEALSLHTVKGSSSVEWVEGPLLAQKQPLTWYKSIFRAPPGNAPLALDM  638

Query  2318  SSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              SMGKG++W+NG  +GRHWPGY A GSC + C+YAGTY + KC+ NCGQPSQ
Sbjct  639   ISMGKGQVWINGRSIGRHWPGYIAHGSCGN-CSYAGTYTENKCRTNCGQPSQ  689



>emb|CAC44500.1| beta-galactosidase [Fragaria x ananassa]
Length=843

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/565 (71%), Positives = 473/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R SVSYD ++ +ING+RRILISGSIHYPRSTP+MWP L+Q+AKDGGLDVIQTYVFWNGHE
Sbjct  27    RASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIQRAKDGGLDVIQTYVFWNGHE  86

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FE  YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI+FRTD
Sbjct  87    PSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIQFRTD  146

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  MQ F  KIVNMMK+E+LFES GGPII+SQIENEYGP+E+EIGAPGKAYT WA 
Sbjct  147   NGPFKDQMQRFTTKIVNMMKAERLFESHGGPIILSQIENEYGPMEYEIGAPGKAYTDWAA  206

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMAVGL TGVPW+MCKQ+DAPDP+I+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGG
Sbjct  207   QMAVGLGTGVPWVMCKQDDAPDPVINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGG  266

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+AFSVA+F+Q  G+F+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  267   AVPYRPAEDLAFSVAKFLQKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  326

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVSS P VT  G  QE HVF+S +GAC AFL+NY+ + 
Sbjct  327   LRQPKWGHLKDLHRAIKLCEPALVSSDPTVTPLGTYQEAHVFKSNSGACAAFLANYNRKS  386

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N+ Y+LPPWSISILPDCKN VYNTA + + + + KM  +P+  GFSWQ+Y +E
Sbjct  387   FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARIGAQTARMKMPRVPIHGGFSWQAYNDE  446

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
              A+  D     A G+ EQIN+TRD++DYLWYMT+V I P E+FLR+G  PV+TV+SAGHA
Sbjct  447   TATYSDTSFTTA-GLLEQINITRDATDYLWYMTDVKIDPSEDFLRSGNYPVLTVLSAGHA  505

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             + VFIN +L+GT YG L  PKLT+   V LRAGIN+I+LLS+AVGLPNVG HFE WNAG+
Sbjct  506   LRVFINGQLAGTAYGSLETPKLTFKQGVNLRAGINQIALLSIAVGLPNVGPHFETWNAGI  565

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV L+GLNEG RDL+ Q W YK+
Sbjct  566   LGPVILNGLNEGRRDLSWQKWSYKI  590


 Score =   148 bits (373),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+++TGSSSVEW +G  +A  QPLTWYK TF+ P GN PLALDM SMGKG
Sbjct  589   KIGLKGEALSLHSLTGSSSVEWTEGSFVAQRQPLTWYKTTFNRPAGNSPLALDMGSMGKG  648

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+N   +GR+WP Y A G+C  ECNYAGT+++KKC  NCG+ SQ
Sbjct  649   QVWINDRSIGRYWPAYKASGTC-GECNYAGTFSEKKCLSNCGEASQ  693



>ref|XP_009627536.1| PREDICTED: beta-galactosidase [Nicotiana tomentosiformis]
Length=845

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/562 (73%), Positives = 470/562 (84%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ I+NG+R+ILISGSIHYPRSTP+MWP L+QKAK+GG+DVIQTYVFWNGHEP
Sbjct  32    ASVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEP  91

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FEGRYDLVKFIK+ Q+AGLYVHLRIGPY C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  92    EEGKYYFEGRYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFRTDN  151

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV M+KSE+L+ESQGGPII+SQIENEYGP+EWE+G PGKAY++WA +
Sbjct  152   EPFKAAMQKFTTKIVEMIKSERLYESQGGPIILSQIENEYGPMEWELGEPGKAYSEWAAK  211

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAV L TGVPWIMCKQ+D PDPII+TCNG+YC+ F PNK  KPKM+TE WT W+T+FGGP
Sbjct  212   MAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFSPNKANKPKMWTEAWTAWFTEFGGP  271

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL+
Sbjct  272   VPYRPAEDMAFAVARFIQTGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLL  331

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS+ PIVT  G  QE  VF+SE+GAC AFL+NY+    
Sbjct  332   RQPKWGHLKDLHRAIKLCEPALVSADPIVTPLGNYQEARVFKSESGACAAFLANYNQHSF  391

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV F N+ Y+LPPWSISILPDCKN VYNTA V + S Q KM PV  GFSWQSY E+ A 
Sbjct  392   AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMSPVIRGFSWQSYNEDAAL  451

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +D +T    G+ EQIN TRD SDYLWYMT+V I P E FL +G  P +TV SAGHA+HV
Sbjct  452   YED-NTYTVVGLLEQINTTRDVSDYLWYMTDVEIDPTEGFLNSGNWPWLTVFSAGHALHV  510

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GTVYG L  PKLT++N + LRAG+NKISLLS+AVGLPNVG HFE WNAGVLGP
Sbjct  511   FVNGQLAGTVYGSLENPKLTFSNGINLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  570

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSLSGLN+GTRDLT Q W YKV
Sbjct  571   VSLSGLNKGTRDLTWQKWCYKV  592


 Score =   144 bits (362),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +2

Query  2150  CSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMG  2329
             C ++G+KGE+LSL++++GS SVEW +G L+A  QPL+WYK+TF+AP GN+PLALDM++M 
Sbjct  589   CYKVGLKGEALSLHSLSGSPSVEWVEGSLVAQKQPLSWYKSTFNAPAGNEPLALDMNTMS  648

Query  2330  KGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             KG++W+NG+ +GRHWP Y + G+C++ CNY G +++KKC  NCG+ SQ
Sbjct  649   KGQVWINGQSLGRHWPAYKSSGNCTA-CNYKGWFDEKKCLSNCGEGSQ  695



>ref|XP_009622143.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=840

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/561 (72%), Positives = 466/561 (83%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ I+ G+RRILISGS+HYPRSTP+MWPG++QKAK+GG+DVIQTYVFWNGHEP 
Sbjct  28    SVSYDHKAIIVKGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGIDVIQTYVFWNGHEPQ  87

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FEGRYDLVKFIKL  +AGLYVHLRIGPY C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  88    QGKYYFEGRYDLVKFIKLVHQAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFRTDNG  147

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFKVAMQ F  KIVNMMK+E+L+E+QGGPIIMSQIENEYGP+EWE+GAPGKAYT+WA +M
Sbjct  148   PFKVAMQKFTTKIVNMMKAERLYETQGGPIIMSQIENEYGPMEWELGAPGKAYTQWAAKM  207

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQ+DAPDPII+ CNG+YC+ F PNK YKPK++TE WT W+T FG PV
Sbjct  208   AVGLNTGVPWIMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAWFTGFGDPV  267

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  268   PYRPAEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  327

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVFRS++G C AFL+NY+    A
Sbjct  328   QPKWGHLKDLHRAIKLCEPALVSGDPTVTPLGHQQEAHVFRSKSGGCAAFLANYNQHSFA  387

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              V F+N  Y+LPPWSISILPDCKN V+NTA + + S Q KM PV  GFSW S+ EE AS 
Sbjct  388   TVAFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTPVSRGFSWHSFNEETASY  447

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +D  +    G+ EQIN TRD SDYLWY T+V I   E FLR+GK P +T+MSAGHA+HVF
Sbjct  448   ED-SSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREGFLRSGKWPWLTIMSAGHALHVF  506

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +L+GT YG L  PKLT++ +V LRAG+NKISLLS+AVGLPN+G HFE WNAGVLGPV
Sbjct  507   VNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNAGVLGPV  566

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SLSGLNEG RDLT Q W YKV
Sbjct  567   SLSGLNEGKRDLTWQKWSYKV  587


 Score =   134 bits (336),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW +G  +A  QPLTWYK TF+AP GNDPLALD+++MGKG
Sbjct  586   KVGLKGEALSLHSLSGSSSVEWVEGSFVAQRQPLTWYKTTFNAPAGNDPLALDLNTMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY A G+C + CNYAG +++KKC  NCG+ SQ
Sbjct  646   QVWINGQSIGRYWPGYKASGNCGA-CNYAGWFDEKKCLSNCGEASQ  690



>ref|XP_010654522.1| PREDICTED: beta-galactosidase 1 [Vitis vinifera]
Length=850

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/561 (73%), Positives = 473/561 (84%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD R+ +ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  38    SVSYDRRAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  97

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FEGRYDLV+FIKL ++AGLYV+LRIGPY+C EWNFGGFP+WLKYV GI FRT+N+
Sbjct  98    QGKYYFEGRYDLVRFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVQGINFRTNNE  157

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIV+MMKSE LFESQGGPII+SQIENEYGP+E+EIGAPG+AYT+WA +M
Sbjct  158   PFKWHMQRFTKKIVDMMKSEGLFESQGGPIILSQIENEYGPMEYEIGAPGRAYTEWAAKM  217

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG V
Sbjct  218   AVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGAV  277

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL+ 
Sbjct  278   PHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLLR  337

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPAL+S  P VT  G  +E HVF S++GAC AFL+NY+P+  A
Sbjct  338   QPKWGHLKDLHRAIKLCEPALISGDPTVTSLGNYEEAHVFHSKSGACAAFLANYNPRSYA  397

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F N+ Y+LPPWSISILPDCKN VYNTA + + S   KM PV   F WQSY EE AS 
Sbjct  398   KVSFRNMHYNLPPWSISILPDCKNTVYNTARLGAQSATMKMTPVSGRFGWQSYNEETASY  457

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             DD  + AA G+ EQIN TRD SDYLWY T+V I  +E FL++G+ PV+TV+SAGHA+HVF
Sbjct  458   DD-SSFAAVGLLEQINTTRDVSDYLWYSTDVKIGYNEGFLKSGRYPVLTVLSAGHALHVF  516

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN  LSGT YG L  PKLT++  VKLRAG+N I+LLS+AVGLPNVG HFE WNAGVLGPV
Sbjct  517   INGRLSGTAYGSLENPKLTFSQGVKLRAGVNTIALLSIAVGLPNVGPHFETWNAGVLGPV  576

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SL+GLNEG RDL+ Q W YKV
Sbjct  577   SLNGLNEGRRDLSWQKWSYKV  597


 Score =   139 bits (349),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW +G L+A  QPLTWYK TF+AP GN PLALDM SMGKG
Sbjct  596   KVGLKGEALSLHSLSGSSSVEWVEGSLMARGQPLTWYKTTFNAPGGNTPLALDMGSMGKG  655

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGR+WP Y A G C  +CNYAGTY++KKC  NCG+PSQ
Sbjct  656   QIWINGQNVGRYWPAYKATGGC-GDCNYAGTYSEKKCLSNCGEPSQ  700



>gb|KCW53602.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=673

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/563 (72%), Positives = 469/563 (83%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPS
Sbjct  30    SVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPS  89

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKYNFEG YD+VKF+KLAQ+AGLYVHLR+GPY+C EWNFGGFP+WLKYV GI FRTDN 
Sbjct  90    PGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISFRTDNG  149

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIVNMMK+E LFESQGGPII+SQIENEYGP+E+EIGA G+AYTKWA +M
Sbjct  150   PFKYYMQKFTTKIVNMMKAEWLFESQGGPIILSQIENEYGPMEYEIGASGRAYTKWAAEM  209

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGGPV
Sbjct  210   AVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  269

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AFSVARFI+  G+F+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  270   PNRPVEDLAFSVARFIKKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  329

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P VT  G  +E HVFRS++GAC AFLSNY     A
Sbjct  330   QPKWGHLKDLHRAIKLCEPALVSGNPTVTKLGNYEEAHVFRSKSGACAAFLSNYHSNAFA  389

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KV++ N+ Y+LPPWSISILPDCKN VYNTA V + S + KM  +P+  GFSWQ+Y EE A
Sbjct  390   KVSWGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPIHGGFSWQAYNEEPA  449

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
               +D     A G+ EQIN TRD SDYLWY+T+V I   E FLR+GK P +TV SAGHA+H
Sbjct  450   GYEDNSFTMA-GLLEQINTTRDVSDYLWYITDVYINSKEGFLRSGKYPTLTVQSAGHALH  508

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N + SGT YG L FPKLT+   VKLRAG N+I+LLS+AVGLPNVG HFE+WNAGVLG
Sbjct  509   VFVNGQASGTAYGSLEFPKLTFNQGVKLRAGSNRIALLSIAVGLPNVGPHFERWNAGVLG  568

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GL+EG RDL+ Q W YKV
Sbjct  569   PVTLYGLDEGKRDLSRQKWSYKV  591


 Score = 83.6 bits (205),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMG  2329
             ++G+KGE+L+L+++TGSSSVEW +G L+A  QPLTW+K TF AP GN PLALDM+++G
Sbjct  590   KVGLKGEALNLHSLTGSSSVEWAEGSLVARKQPLTWFKTTFSAPAGNTPLALDMNTLG  647



>emb|CBI35944.3| unnamed protein product [Vitis vinifera]
Length=841

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/561 (73%), Positives = 473/561 (84%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD R+ +ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  29    SVSYDRRAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  88

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FEGRYDLV+FIKL ++AGLYV+LRIGPY+C EWNFGGFP+WLKYV GI FRT+N+
Sbjct  89    QGKYYFEGRYDLVRFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVQGINFRTNNE  148

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIV+MMKSE LFESQGGPII+SQIENEYGP+E+EIGAPG+AYT+WA +M
Sbjct  149   PFKWHMQRFTKKIVDMMKSEGLFESQGGPIILSQIENEYGPMEYEIGAPGRAYTEWAAKM  208

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG V
Sbjct  209   AVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGAV  268

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL+ 
Sbjct  269   PHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLLR  328

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPAL+S  P VT  G  +E HVF S++GAC AFL+NY+P+  A
Sbjct  329   QPKWGHLKDLHRAIKLCEPALISGDPTVTSLGNYEEAHVFHSKSGACAAFLANYNPRSYA  388

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV+F N+ Y+LPPWSISILPDCKN VYNTA + + S   KM PV   F WQSY EE AS 
Sbjct  389   KVSFRNMHYNLPPWSISILPDCKNTVYNTARLGAQSATMKMTPVSGRFGWQSYNEETASY  448

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             DD  + AA G+ EQIN TRD SDYLWY T+V I  +E FL++G+ PV+TV+SAGHA+HVF
Sbjct  449   DD-SSFAAVGLLEQINTTRDVSDYLWYSTDVKIGYNEGFLKSGRYPVLTVLSAGHALHVF  507

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN  LSGT YG L  PKLT++  VKLRAG+N I+LLS+AVGLPNVG HFE WNAGVLGPV
Sbjct  508   INGRLSGTAYGSLENPKLTFSQGVKLRAGVNTIALLSIAVGLPNVGPHFETWNAGVLGPV  567

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SL+GLNEG RDL+ Q W YKV
Sbjct  568   SLNGLNEGRRDLSWQKWSYKV  588


 Score =   138 bits (348),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW +G L+A  QPLTWYK TF+AP GN PLALDM SMGKG
Sbjct  587   KVGLKGEALSLHSLSGSSSVEWVEGSLMARGQPLTWYKTTFNAPGGNTPLALDMGSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGR+WP Y A G C  +CNYAGTY++KKC  NCG+PSQ
Sbjct  647   QIWINGQNVGRYWPAYKATGGC-GDCNYAGTYSEKKCLSNCGEPSQ  691



>ref|XP_006366152.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=839

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/562 (72%), Positives = 469/562 (83%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ IING+R+ILISGSIHYPRSTP+MWP L+QKAK+GG+DVIQTYVFWNGHEP
Sbjct  26    ASVSYDHKAIIINGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEP  85

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FE RYDLVKFIK+ Q+AGLYVHLRIGPY C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  86    EEGKYYFEERYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFRTDN  145

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMK+EKL+E+QGGPII+SQIENEYGP+EWE+G PGK Y++WA +
Sbjct  146   EPFKAAMQKFTTKIVDMMKAEKLYETQGGPIILSQIENEYGPMEWELGEPGKVYSEWAAK  205

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAV L TGVPWIMCKQ+D PDPII+TCNG+YC+ F PNK  KPKM+TE WT W+T+FGGP
Sbjct  206   MAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFTPNKANKPKMWTEAWTAWFTEFGGP  265

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRT+   FIATSYDYDAPLDE+G +
Sbjct  266   VPYRPAEDMAFSVARFIQTGGSFINYYMYHGGTNFGRTSGGPFIATSYDYDAPLDEFGSL  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS+ P VT  G  QE  VF+SE+GAC AFL+NY+    
Sbjct  326   RQPKWGHLKDLHRAIKLCEPALVSADPTVTSLGNYQEARVFKSESGACAAFLANYNQHSF  385

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV F N+ Y+LPPWSISILPDCKN VYNTA V + S Q KM PV  GFSW+SY E+ A 
Sbjct  386   AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMTPVSRGFSWESYNEDAAL  445

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +D DT    G+ EQIN+TRD SDYLWYMT++ I P E FL +G  P +TV SAGHA+HV
Sbjct  446   HED-DTFTVVGLLEQINITRDVSDYLWYMTDIQIDPTEGFLNSGNWPWLTVFSAGHALHV  504

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GTVYG L  PKLT++N + LRAG+NKISLLS+AVGLPNVG HFE WNAGVLGP
Sbjct  505   FVNGQLAGTVYGSLEDPKLTFSNGINLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  564

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSL+GLNEGTRDLT Q WFYKV
Sbjct  565   VSLNGLNEGTRDLTWQKWFYKV  586


 Score =   146 bits (369),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GS SVEW +G L+A  QPL+WYK TF+AP+GN+PLALDM++MGKG
Sbjct  585   KVGLKGEALSLHSLSGSPSVEWVEGSLVAQKQPLSWYKTTFNAPDGNEPLALDMNTMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP Y + GSCS  CNY G +++KKC  NCG+ SQ
Sbjct  645   QVWINGQSLGRHWPAYKSSGSCSV-CNYTGWFDEKKCLTNCGEGSQ  689



>ref|NP_001280755.1| beta-galactosidase precursor [Malus domestica]
 gb|AGE44111.1| beta-galactosidase 101 [Malus domestica]
Length=725

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/562 (72%), Positives = 469/562 (83%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV YD ++ IING+RRILISGSIHYPRSTP+MWP L+QKAK GGLDVIQTYVFWNGHEP
Sbjct  24    ASVGYDHKAIIINGQRRILISGSIHYPRSTPEMWPDLIQKAKAGGLDVIQTYVFWNGHEP  83

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIKL Q+AGL+V+LRIGPY+C EWNFGGFPIWLKYVPGI FRTDN
Sbjct  84    SPGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPIWLKYVPGIAFRTDN  143

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIVNMMK+EKLF+++GGPII+SQIENEYGPVEWEIGAPGKAYTKWA Q
Sbjct  144   EPFKAAMQKFTEKIVNMMKAEKLFQTEGGPIILSQIENEYGPVEWEIGAPGKAYTKWAAQ  203

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQEDAPDP+IDTCNGYYCENF PNK YKPKM+TE+WTGWYT+FGG 
Sbjct  204   MAVGLNTGVPWIMCKQEDAPDPVIDTCNGYYCENFKPNKVYKPKMWTEVWTGWYTEFGGA  263

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             +  RP ED+AFSVARFIQ+ GSF NYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL+
Sbjct  264   IPTRPVEDLAFSVARFIQSGGSFFNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLL  323

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLH+AIK  E ALV+  P VT  G NQE HVF +++G C AFL+NYD ++ 
Sbjct  324   QQPKWGHLKDLHKAIKSCEYALVAVDPSVTKLGNNQEAHVFNTKSG-CAAFLANYDTKYP  382

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              +V+F   QYDLPPWSISILPDCK  V+NTA V   + Q +M PV +   WQS+ EE  +
Sbjct  383   VRVSFGQGQYDLPPWSISILPDCKTAVFNTAKVTWKTSQVQMKPVYSRLPWQSFIEETTT  442

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             SD+  T   DG++EQI +TRD++DYLWYMT++ I  DE FL NGK P++T+ SA HA+HV
Sbjct  443   SDESGTTTLDGLYEQIYMTRDATDYLWYMTDITIGSDEAFLNNGKFPLLTIFSACHALHV  502

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYG L  PKLT++ +VKLR GINK++LLS++VGLPNVG HFE WNAGVLGP
Sbjct  503   FINGQLSGTVYGSLENPKLTFSQNVKLRPGINKLALLSISVGLPNVGTHFETWNAGVLGP  562

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             +SL GLN GT D++   W YK+
Sbjct  563   ISLKGLNTGTWDMSRWKWTYKI  584


 Score =   163 bits (413),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +2

Query  2138  RFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDM  2317
             R+    ++GMKGE+L L+TVTGSSSV+W +GP +A  QPLTWYKATF+AP G+ PLALDM
Sbjct  577   RWKWTYKIGMKGEALGLHTVTGSSSVDWAEGPSMAKKQPLTWYKATFNAPPGHAPLALDM  636

Query  2318  SSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              SMGKG+IW+NG+ VGRHWPGY AQGSC + CNYAGT+  KKC+  CG+PSQ
Sbjct  637   GSMGKGQIWINGQSVGRHWPGYIAQGSCGT-CNYAGTFYDKKCRTYCGKPSQ  687



>ref|XP_002527409.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF34975.1| beta-galactosidase, putative [Ricinus communis]
Length=845

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/560 (72%), Positives = 475/560 (85%), Gaps = 3/560 (1%)
 Frame = +1

Query  409   YDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGK  588
             YD ++  ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHEPSPGK
Sbjct  34    YDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPSPGK  93

Query  589   YNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFK  768
             Y FEG YDLVKFIKL ++AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN PFK
Sbjct  94    YYFEGNYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGINFRTDNGPFK  153

Query  769   VAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVG  948
               MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG+AY+KWA +MAVG
Sbjct  154   AQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGQAYSKWAAKMAVG  213

Query  949   LKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHRR  1128
             L TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNKPYKPKM+TE WTGW+T+FGG V  R
Sbjct  214   LGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKPYKPKMWTEAWTGWFTEFGGAVPYR  273

Query  1129  PAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEPK  1308
             PAED+AFSVARFIQ  G+F+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ +PK
Sbjct  274   PAEDLAFSVARFIQKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLRQPK  333

Query  1309  YGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKVT  1488
             +GHL+DLHRAIKL EPALVS  P V   G  QE HVF+S++GAC AFL+NY+ +  AKV+
Sbjct  334   WGHLKDLHRAIKLCEPALVSGAPSVMPLGNYQEAHVFKSKSGACAAFLANYNQRSFAKVS  393

Query  1489  FSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIASSD  1662
             F N+ Y+LPPWSISILPDCKN VYNTA + + S + KM  IP+  GFSWQ+Y+EE AS++
Sbjct  394   FGNMHYNLPPWSISILPDCKNTVYNTARIGAQSARMKMSPIPMRGGFSWQAYSEE-ASTE  452

Query  1663  DGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFI  1842
               +T    G+ EQIN TRD SDYLWY T+V I  +E FLR+GK PV+TV+SAGHA+HVF+
Sbjct  453   GDNTFMMVGLLEQINTTRDVSDYLWYSTDVRIDSNEGFLRSGKYPVLTVLSAGHALHVFV  512

Query  1843  NSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVS  2022
             N +LSGT YG L  PKLT++  VK+RAGIN+I LLS+AVGLPNVG HFE WNAGVLGPV+
Sbjct  513   NGQLSGTAYGSLESPKLTFSQGVKMRAGINRIYLLSIAVGLPNVGPHFETWNAGVLGPVT  572

Query  2023  LSGLNEGTRDLTNQTWFYKV  2082
             L+GLNEG RDL+ Q W YK+
Sbjct  573   LNGLNEGRRDLSWQKWTYKI  592


 Score =   130 bits (327),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE+LSL++++GSSSVEW  G  ++  QPL WYK TF+AP GN PLALDM SMGKG
Sbjct  591   KIGLHGEALSLHSLSGSSSVEWAQGSFVSRKQPLMWYKTTFNAPAGNSPLALDMGSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ VGR+WP Y A G+C   CNYAGT+N+KKC  NCG+ SQ
Sbjct  651   QVWINGQSVGRYWPAYKASGNCGV-CNYAGTFNEKKCLTNCGEASQ  695



>gb|KCW53601.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=696

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/563 (72%), Positives = 469/563 (83%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPS
Sbjct  30    SVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPS  89

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKYNFEG YD+VKF+KLAQ+AGLYVHLR+GPY+C EWNFGGFP+WLKYV GI FRTDN 
Sbjct  90    PGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISFRTDNG  149

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIVNMMK+E LFESQGGPII+SQIENEYGP+E+EIGA G+AYTKWA +M
Sbjct  150   PFKYYMQKFTTKIVNMMKAEWLFESQGGPIILSQIENEYGPMEYEIGASGRAYTKWAAEM  209

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGGPV
Sbjct  210   AVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  269

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AFSVARFI+  G+F+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  270   PNRPVEDLAFSVARFIKKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  329

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P VT  G  +E HVFRS++GAC AFLSNY     A
Sbjct  330   QPKWGHLKDLHRAIKLCEPALVSGNPTVTKLGNYEEAHVFRSKSGACAAFLSNYHSNAFA  389

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KV++ N+ Y+LPPWSISILPDCKN VYNTA V + S + KM  +P+  GFSWQ+Y EE A
Sbjct  390   KVSWGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPIHGGFSWQAYNEEPA  449

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
               +D     A G+ EQIN TRD SDYLWY+T+V I   E FLR+GK P +TV SAGHA+H
Sbjct  450   GYEDNSFTMA-GLLEQINTTRDVSDYLWYITDVYINSKEGFLRSGKYPTLTVQSAGHALH  508

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N + SGT YG L FPKLT+   VKLRAG N+I+LLS+AVGLPNVG HFE+WNAGVLG
Sbjct  509   VFVNGQASGTAYGSLEFPKLTFNQGVKLRAGSNRIALLSIAVGLPNVGPHFERWNAGVLG  568

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GL+EG RDL+ Q W YKV
Sbjct  569   PVTLYGLDEGKRDLSRQKWSYKV  591


 Score =   150 bits (380),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+++TGSSSVEW +G L+A  QPLTW+K TF AP GN PLALDM+SMGKG
Sbjct  590   KVGLKGEALNLHSLTGSSSVEWAEGSLVARKQPLTWFKTTFSAPAGNTPLALDMNSMGKG  649

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A G+C   CNYAGTY +KKC  NCG+ SQ
Sbjct  650   QIWINGQSIGRYWPAYKASGTCGG-CNYAGTYGEKKCLSNCGEASQ  694



>emb|CDO97918.1| unnamed protein product [Coffea canephora]
Length=835

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/561 (72%), Positives = 471/561 (84%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD  + I+NG+RRILISGSIHYPRSTP+MWP L+QKAK+GGLDVI+TYVFWNGHEP 
Sbjct  23    SVSYDNTAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIETYVFWNGHEPQ  82

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEGRYDLVKF+ L ++AGLYV+LRIGPY+C EWNFGGFP+WLKYVPGI FRT+N 
Sbjct  83    PGKYYFEGRYDLVKFVNLVKEAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGISFRTNNG  142

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIVNMMK+E+L+E QGGPII+SQ+ENEYGP+E+E+GAPG+AYT+WA +M
Sbjct  143   PFKAAMQKFTTKIVNMMKAERLYEPQGGPIILSQVENEYGPMEYELGAPGRAYTEWAAKM  202

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV L TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNK YKPK++TE WTGW+T+FGG  
Sbjct  203   AVDLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKIWTEAWTGWFTEFGGAQ  262

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  263   PYRPAEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  322

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRA+KL EPALVS  P VT  G  QE HVF+S++GAC AFL+NY+ Q  A
Sbjct  323   QPKWGHLKDLHRALKLCEPALVSGNPTVTPLGNYQEAHVFKSKSGACAAFLANYNSQSFA  382

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             +V F N+ Y+LPPWSISILPDCKN VYNTA V + S Q KM PV  GFSW+SY EE AS+
Sbjct  383   RVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMNPVIKGFSWESYNEETASN  442

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +D +     G+ EQINVTRD+SDYLWY TEV I   E FL+ GK PV+TVMSAGHA+HVF
Sbjct  443   ED-NAFTVSGLLEQINVTRDNSDYLWYSTEVRIYHTEGFLKGGKWPVLTVMSAGHALHVF  501

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGT YG L  PK+T++  V LRAG+NKISLLS+AVGLPNVG HFE WNAG+LGPV
Sbjct  502   INGQLSGTTYGSLENPKITFSQGVNLRAGVNKISLLSIAVGLPNVGPHFETWNAGILGPV  561

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SL GLNEG RDLT Q W YKV
Sbjct  562   SLYGLNEGRRDLTWQKWSYKV  582


 Score =   127 bits (320),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSS+VEW +G  +A  QPLTWYK TF AP GN+PLALDMS+M KG
Sbjct  581   KVGLKGEALSLHSLSGSSAVEWGEGSFVAERQPLTWYKTTFSAPSGNEPLALDMSAMSKG  640

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR++P Y A G+C + C+YAG++N+KKC  NCG+ SQ
Sbjct  641   QVWINGQSIGRYYPAYKASGNCGA-CSYAGSFNEKKCLSNCGEASQ  685



>ref|XP_009769408.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=840

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/563 (72%), Positives = 465/563 (83%), Gaps = 1/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ I+ G+RRILISGS+HYPRSTP+MWPG++QKAK+GG+DVIQTYVFWNGHE
Sbjct  26    KASVSYDHKAIIVKGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGIDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P  GKY FEGRYDLVKFIKL  +AGLYVHLRIGPY C EWNFGGFP+WLKYVPGI FRTD
Sbjct  86    PQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AMQ F  KIVNMMK+E+L+E+QGGPIIMSQIENEYGP+EWE+GAPGKAY +WA 
Sbjct  146   NGPFKAAMQRFTTKIVNMMKAERLYETQGGPIIMSQIENEYGPMEWELGAPGKAYAQWAA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+DAPDPII+ CNG+YC+ F PNK YKPK++TE WT W+T FG 
Sbjct  206   KMAVGLDTGVPWIMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAWFTGFGN  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  266   PVPYRPAEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  325

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVFRS++G C AFL+NY+   
Sbjct  326   LRQPKWGHLKDLHRAIKLCEPALVSGDPTVTPLGHQQEAHVFRSKSGTCAAFLANYNQHS  385

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
              A VTF+N  Y+LPPWSISILPDCKN V+NTA + + S Q KM  V  GFSW S+ EE A
Sbjct  386   FATVTFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTSVSRGFSWDSFNEETA  445

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S +D  +    G+ EQIN TRD SDYLWY T+V I   E FLR+GK P +T+MSAGHA+H
Sbjct  446   SYED-SSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREGFLRSGKWPWLTIMSAGHALH  504

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GT YG L  PKLT++ +V LRAG+NKISLLS+AVGLPN+G HFE WNAGVLG
Sbjct  505   VFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNAGVLG  564

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSLSGLNEG RDLT Q W YKV
Sbjct  565   PVSLSGLNEGKRDLTWQKWSYKV  587


 Score =   132 bits (331),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW +G  +A  QPLTWYK TF+AP GN+PLALD+++MGKG
Sbjct  586   KVGLKGEALSLHSLSGSSSVEWVEGSFVAQRQPLTWYKTTFNAPAGNEPLALDLNTMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY A G+C + CNYAG +++KKC  NCG+ SQ
Sbjct  646   QVWINGQSIGRYWPGYKASGNCGA-CNYAGWFDEKKCLSNCGEASQ  690



>gb|KDO65278.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=697

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/565 (72%), Positives = 472/565 (84%), Gaps = 4/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
              GSVSYD ++  INGKRRILISGSIHYPRS+P+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  30    EGSVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  89

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKLA++AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRT+
Sbjct  90    PSPGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTE  149

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  M  F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG++YT+WA 
Sbjct  150   NGPFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAA  209

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  210   KMAVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  269

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RP ED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  270   PVPHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P V   G  QE HVF+S++ AC AFL+NY+ + 
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRT  388

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N  Y+LPPWSISILPDCKN VYNTA V   S Q KM  +P+  GFSWQ++  E
Sbjct  389   FAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFN-E  447

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             + S+    +    G+ EQIN TRD++DYLWYMT+V I P E FLR+G  PV+TVMSAGHA
Sbjct  448   VPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHA  507

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L FPKLT+T  V +RAGINKI+LLS+AVGLPNVG HFE WNAGV
Sbjct  508   LHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGV  567

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+GLNEG RDL+ Q W YK+
Sbjct  568   LGPVTLNGLNEGRRDLSWQKWTYKI  592


 Score =   144 bits (364),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE L+L++++G SSVEW +G L+A  QPLTWY+ TF AP GN PLALDM SMGKG
Sbjct  591   KIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++WVNG+ +GRHWP Y A GSC   C+Y GTY +KKC  NCG+ SQ
Sbjct  651   QVWVNGQSIGRHWPAYKASGSCGY-CSYTGTYTEKKCLSNCGEASQ  695



>ref|XP_010033786.1| PREDICTED: beta-galactosidase 1-like [Eucalyptus grandis]
 gb|KCW53599.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
 gb|KCW53600.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=844

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/563 (72%), Positives = 469/563 (83%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPS
Sbjct  30    SVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPS  89

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKYNFEG YD+VKF+KLAQ+AGLYVHLR+GPY+C EWNFGGFP+WLKYV GI FRTDN 
Sbjct  90    PGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISFRTDNG  149

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIVNMMK+E LFESQGGPII+SQIENEYGP+E+EIGA G+AYTKWA +M
Sbjct  150   PFKYYMQKFTTKIVNMMKAEWLFESQGGPIILSQIENEYGPMEYEIGASGRAYTKWAAEM  209

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGGPV
Sbjct  210   AVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  269

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AFSVARFI+  G+F+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  270   PNRPVEDLAFSVARFIKKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  329

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P VT  G  +E HVFRS++GAC AFLSNY     A
Sbjct  330   QPKWGHLKDLHRAIKLCEPALVSGNPTVTKLGNYEEAHVFRSKSGACAAFLSNYHSNAFA  389

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KV++ N+ Y+LPPWSISILPDCKN VYNTA V + S + KM  +P+  GFSWQ+Y EE A
Sbjct  390   KVSWGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPIHGGFSWQAYNEEPA  449

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
               +D     A G+ EQIN TRD SDYLWY+T+V I   E FLR+GK P +TV SAGHA+H
Sbjct  450   GYEDNSFTMA-GLLEQINTTRDVSDYLWYITDVYINSKEGFLRSGKYPTLTVQSAGHALH  508

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N + SGT YG L FPKLT+   VKLRAG N+I+LLS+AVGLPNVG HFE+WNAGVLG
Sbjct  509   VFVNGQASGTAYGSLEFPKLTFNQGVKLRAGSNRIALLSIAVGLPNVGPHFERWNAGVLG  568

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GL+EG RDL+ Q W YKV
Sbjct  569   PVTLYGLDEGKRDLSRQKWSYKV  591


 Score =   150 bits (378),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+++TGSSSVEW +G L+A  QPLTW+K TF AP GN PLALDM+SMGKG
Sbjct  590   KVGLKGEALNLHSLTGSSSVEWAEGSLVARKQPLTWFKTTFSAPAGNTPLALDMNSMGKG  649

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A G+C   CNYAGTY +KKC  NCG+ SQ
Sbjct  650   QIWINGQSIGRYWPAYKASGTCGG-CNYAGTYGEKKCLSNCGEASQ  694



>gb|KEH18344.1| beta-galactosidase [Medicago truncatula]
Length=838

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/565 (72%), Positives = 474/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
               SVSYD ++  ING+RRIL+SGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  22    EASVSYDHKAITINGQRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  81

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKL  +AGLYVHLR+GPY C EWNFGGFP+WLKY+PGI FRTD
Sbjct  82    PSPGKYYFEGNYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYIPGISFRTD  141

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK+ MQ F  KIVN+MK+E+L+ESQGGPII+SQIENEYGP+E+E+GAP KAYT+WA 
Sbjct  142   NGPFKIQMQRFTTKIVNIMKAERLYESQGGPIILSQIENEYGPMEYELGAPAKAYTQWAA  201

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
              MAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T FG 
Sbjct  202   HMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTGFGT  261

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AFS+ARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  262   PVPHRPAEDLAFSIARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  321

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS+ P VT  G  QE HVF+S++GAC AFL+NY+P+ 
Sbjct  322   LRQPKWGHLKDLHRAIKLCEPALVSADPTVTRLGNYQEAHVFKSKSGACAAFLANYNPRS  381

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              A V+F N  Y+LPPWSISILP+CK+ VYNTA V S S Q KM  +P+  G SWQ++ EE
Sbjct  382   YATVSFGNQHYNLPPWSISILPNCKHTVYNTARVGSQSAQMKMSRVPIHGGLSWQAFNEE  441

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               ++DD  +    G+ EQ+N TRD SDYLWY T+V I  +E F RNGK+PV+TV+SAGHA
Sbjct  442   TTTTDD-SSFTVTGLLEQVNATRDLSDYLWYSTDVVINSNEGFFRNGKNPVLTVLSAGHA  500

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVFIN +LSGT YG + FPKLT++ SVKLRAG+NKISLLSVAVGLPN+G HFE WNAGV
Sbjct  501   LHVFINGQLSGTAYGSVDFPKLTFSESVKLRAGVNKISLLSVAVGLPNIGPHFETWNAGV  560

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGP+SL+GLNEG RDLT Q W YKV
Sbjct  561   LGPISLNGLNEGRRDLTWQKWSYKV  585


 Score =   148 bits (373),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+++TGSSSV+W  G L++  QPLTWYK TFDAP G  PLALDM+SMGKG
Sbjct  584   KVGLKGEALSLHSLTGSSSVDWLQGYLVSRKQPLTWYKTTFDAPAGVAPLALDMNSMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A GSC   CNYAGTYN+KKC  NCG+ SQ
Sbjct  644   QMWLNGQNLGRYWPAYKASGSC-DYCNYAGTYNEKKCGSNCGEASQ  688



>dbj|BAF31233.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/562 (72%), Positives = 471/562 (84%), Gaps = 2/562 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  38    SVSYDHKAIIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  97

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y FEGRYDLVKFIKL ++AGLYVHLRIGPY C EWNFGGFP+WLKY+PGI FRTDN+
Sbjct  98    PGEYYFEGRYDLVKFIKLVKEAGLYVHLRIGPYACAEWNFGGFPVWLKYIPGISFRTDNE  157

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM GF  KIV+MMK E+LFE+QGGPII+SQIENEYGPVEWEIGAPG+AYTKWA  M
Sbjct  158   PFKTAMAGFTKKIVDMMKEEELFETQGGPIILSQIENEYGPVEWEIGAPGQAYTKWAANM  217

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+TCN +YC+ F PNK YKP M+TE WT W+T FGGPV
Sbjct  218   AVGLGTGVPWVMCKQDDAPDPIINTCNDHYCDWFSPNKNYKPTMWTEAWTSWFTAFGGPV  277

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AF++A+FIQ  GSF+NYYMYHGGTNFGRTA   F+ATSYDYDAP+DEYGL+ 
Sbjct  278   PYRPAEDMAFAIAKFIQRGGSFINYYMYHGGTNFGRTAGGPFVATSYDYDAPIDEYGLIR  337

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLH+AIK+ E ALVS  PIVT  G +QE HVF+SE+G C AFL+NYD +  A
Sbjct  338   QPKWGHLKDLHKAIKMCEAALVSGDPIVTSLGSSQESHVFKSESGDCAAFLANYDEKSFA  397

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVG-NGFSWQSYTEEIAS  1656
             KV F  + Y+LPPWSISILPDC N V+NTA V + +    M  V  +GFSW++Y EE AS
Sbjct  398   KVAFQGMHYNLPPWSISILPDCVNTVFNTARVGAQTSSMTMTSVNPDGFSWETYNEETAS  457

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              DD  ++  +G+ EQINVTRD +DYLWY T++ I P+E FL+NG+ PV+TVMSAGHA+H+
Sbjct  458   YDDA-SITMEGLLEQINVTRDVTDYLWYTTDITIDPNEGFLKNGEYPVLTVMSAGHALHI  516

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN ELSGTVYG +  PKLTYT SVKL AG NKIS+LS+AVGLPN+G HFE WN GVLGP
Sbjct  517   FINGELSGTVYGSVDNPKLTYTGSVKLLAGNNKISVLSIAVGLPNIGAHFETWNTGVLGP  576

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V L+GLNEG RDL+ Q W YK+
Sbjct  577   VVLNGLNEGRRDLSWQNWSYKI  598


 Score =   144 bits (364),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L L+++TGSSSVEW    L+A  QPLTWYK TF+APEGN P ALDMS MGKG
Sbjct  597   KIGLKGEALQLHSLTGSSSVEWSS--LIAQKQPLTWYKTTFNAPEGNGPFALDMSMMGKG  654

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A G+C  EC+Y G YN+KKC  NCG+ SQ
Sbjct  655   QIWINGQSIGRYWPAYKAYGNC-GECSYTGRYNEKKCLANCGEASQ  699



>gb|KDO65277.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=815

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/565 (72%), Positives = 472/565 (84%), Gaps = 4/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
              GSVSYD ++  INGKRRILISGSIHYPRS+P+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  30    EGSVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  89

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKLA++AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRT+
Sbjct  90    PSPGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTE  149

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  M  F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG++YT+WA 
Sbjct  150   NGPFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAA  209

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  210   KMAVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  269

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RP ED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  270   PVPHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P V   G  QE HVF+S++ AC AFL+NY+ + 
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRT  388

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N  Y+LPPWSISILPDCKN VYNTA V   S Q KM  +P+  GFSWQ++  E
Sbjct  389   FAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFN-E  447

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             + S+    +    G+ EQIN TRD++DYLWYMT+V I P E FLR+G  PV+TVMSAGHA
Sbjct  448   VPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHA  507

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L FPKLT+T  V +RAGINKI+LLS+AVGLPNVG HFE WNAGV
Sbjct  508   LHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGV  567

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+GLNEG RDL+ Q W YK+
Sbjct  568   LGPVTLNGLNEGRRDLSWQKWTYKI  592


 Score =   144 bits (363),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE L+L++++G SSVEW +G L+A  QPLTWY+ TF AP GN PLALDM SMGKG
Sbjct  591   KIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++WVNG+ +GRHWP Y A GSC   C+Y GTY +KKC  NCG+ SQ
Sbjct  651   QVWVNGQSIGRHWPAYKASGSCGY-CSYTGTYTEKKCLSNCGEASQ  695



>ref|XP_008451151.1| PREDICTED: beta-galactosidase-like, partial [Cucumis melo]
Length=589

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/562 (71%), Positives = 468/562 (83%), Gaps = 2/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSV+YD ++ IING+RRILISGSIHYPRSTPQMWP L+QKAK+GGLD+I+TYVFWNGHEP
Sbjct  20    GSVTYDHKAIIINGQRRILISGSIHYPRSTPQMWPDLIQKAKNGGLDIIETYVFWNGHEP  79

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLV+FIKL  +AGLYVHLRIGPY+C EWN+GGFP+WLK+VPGI FRTDN
Sbjct  80    SPGKYYFEERYDLVRFIKLVHQAGLYVHLRIGPYVCAEWNYGGFPVWLKFVPGIAFRTDN  139

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ FV KIV++MK EKL+ +QGGPII+SQIENEYGPVEWEIGAPGK+YTKWA Q
Sbjct  140   KPFKAAMQKFVYKIVDLMKWEKLYHTQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  199

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GLKTGVPW+MCKQEDAPDP+IDTCNG+YCENF PNK YKPK++TE W+GWYT FGGP
Sbjct  200   MALGLKTGVPWVMCKQEDAPDPLIDTCNGFYCENFKPNKIYKPKIWTENWSGWYTAFGGP  259

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
                RP ED+AFSVARFIQN GS VNYYMYHGGTNFGRT + LFIATSYD+DAP+DEYGL+
Sbjct  260   TPYRPPEDVAFSVARFIQNGGSLVNYYMYHGGTNFGRT-SGLFIATSYDFDAPIDEYGLL  318

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHLRDLH+AIK  EPALVS+ P  TW GKNQE  VF+S +GAC AFL+NYD   S
Sbjct  319   REPKWGHLRDLHKAIKSCEPALVSADPTSTWLGKNQEARVFKSRSGACAAFLANYDTSAS  378

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              +V F N  YDLPPWSISILPDCK V +NTA +   S Q KM P+ + F W SY EE AS
Sbjct  379   VRVNFWNHPYDLPPWSISILPDCKTVTFNTAQIGVKSYQAKMTPI-SSFWWLSYKEEPAS  437

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
                 DT   DG+ EQ++VT D++DYLWYMT++ I   E FL+ G+ P++TV SAGH +HV
Sbjct  438   GYASDTTTKDGLVEQVSVTWDTTDYLWYMTDIRIDSTEGFLKTGRWPLLTVDSAGHVLHV  497

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSG+VYG L  P++T++  V L+ G+NK+S+LSV VGLPNVGLHF+ WNAGVLGP
Sbjct  498   FINGQLSGSVYGSLEDPRITFSKYVNLKEGVNKLSMLSVTVGLPNVGLHFDTWNAGVLGP  557

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRD++   W YKV
Sbjct  558   VTLKGLNEGTRDMSKYKWSYKV  579



>gb|KDO65275.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=872

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/565 (72%), Positives = 472/565 (84%), Gaps = 4/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
              GSVSYD ++  INGKRRILISGSIHYPRS+P+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  30    EGSVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  89

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKLA++AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRT+
Sbjct  90    PSPGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTE  149

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  M  F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG++YT+WA 
Sbjct  150   NGPFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAA  209

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  210   KMAVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  269

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RP ED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  270   PVPHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P V   G  QE HVF+S++ AC AFL+NY+ + 
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRT  388

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N  Y+LPPWSISILPDCKN VYNTA V   S Q KM  +P+  GFSWQ++  E
Sbjct  389   FAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFN-E  447

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             + S+    +    G+ EQIN TRD++DYLWYMT+V I P E FLR+G  PV+TVMSAGHA
Sbjct  448   VPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHA  507

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L FPKLT+T  V +RAGINKI+LLS+AVGLPNVG HFE WNAGV
Sbjct  508   LHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGV  567

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+GLNEG RDL+ Q W YKV
Sbjct  568   LGPVTLNGLNEGRRDLSWQKWTYKV  592


 Score =   145 bits (367),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  2153  SQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             +Q+G++GE L+L++++G SSVEW +G L+A  QPLTWY+ TF AP GN PLALDM SMGK
Sbjct  617   NQIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGK  676

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G++WVNG+ +GRHWP Y A GSC   C+Y GTY +KKC  NCG+ SQ
Sbjct  677   GQVWVNGQSIGRHWPAYKASGSCGY-CSYTGTYTEKKCLSNCGEASQ  722



>gb|KDO65274.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=845

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/565 (72%), Positives = 472/565 (84%), Gaps = 4/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
              GSVSYD ++  INGKRRILISGSIHYPRS+P+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  30    EGSVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  89

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKLA++AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRT+
Sbjct  90    PSPGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTE  149

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  M  F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG++YT+WA 
Sbjct  150   NGPFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAA  209

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  210   KMAVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  269

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RP ED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  270   PVPHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P V   G  QE HVF+S++ AC AFL+NY+ + 
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRT  388

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N  Y+LPPWSISILPDCKN VYNTA V   S Q KM  +P+  GFSWQ++  E
Sbjct  389   FAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFN-E  447

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             + S+    +    G+ EQIN TRD++DYLWYMT+V I P E FLR+G  PV+TVMSAGHA
Sbjct  448   VPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHA  507

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L FPKLT+T  V +RAGINKI+LLS+AVGLPNVG HFE WNAGV
Sbjct  508   LHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGV  567

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+GLNEG RDL+ Q W YK+
Sbjct  568   LGPVTLNGLNEGRRDLSWQKWTYKI  592


 Score =   144 bits (363),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE L+L++++G SSVEW +G L+A  QPLTWY+ TF AP GN PLALDM SMGKG
Sbjct  591   KIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++WVNG+ +GRHWP Y A GSC   C+Y GTY +KKC  NCG+ SQ
Sbjct  651   QVWVNGQSIGRHWPAYKASGSCGY-CSYTGTYTEKKCLSNCGEASQ  695



>ref|XP_006466038.1| PREDICTED: beta-galactosidase 1-like [Citrus sinensis]
Length=845

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/565 (72%), Positives = 472/565 (84%), Gaps = 4/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
              GSVSYD ++  INGKRRILISGSIHYPRS+P+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  30    EGSVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  89

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKLA++AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRT+
Sbjct  90    PSPGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTE  149

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  M  F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG++YT+WA 
Sbjct  150   NGPFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAA  209

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  210   KMAVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  269

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RP ED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  270   PVPHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P V   G  QE HVF+S++ AC AFL+NY+ + 
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRT  388

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N  Y+LPPWSISILPDCKN VYNTA V   S Q KM  +P+  GFSWQ++  E
Sbjct  389   FAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFN-E  447

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             + S+    +    G+ EQIN TRD++DYLWYMT+V I P E FLR+G  PV+TVMSAGHA
Sbjct  448   VPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHA  507

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L FPKLT+T  V +RAGINKI+LLS+AVGLPNVG HFE WNAGV
Sbjct  508   LHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGV  567

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+GLNEG RDL+ Q W YK+
Sbjct  568   LGPVTLNGLNEGRRDLSWQKWTYKI  592


 Score =   144 bits (363),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE L+L++++G SSVEW +G L+A  QPLTWY+ TF AP GN PLALDM SMGKG
Sbjct  591   KIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++WVNG+ +GRHWP Y A GSC   C+Y GTY +KKC  NCG+ SQ
Sbjct  651   QVWVNGQSIGRHWPAYKASGSCGY-CSYTGTYTEKKCLSNCGEASQ  695



>ref|XP_010686091.1| PREDICTED: beta-galactosidase 1 [Beta vulgaris subsp. vulgaris]
Length=841

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/562 (72%), Positives = 465/562 (83%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSV YD ++  ING+RRILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEP
Sbjct  28    GSVGYDHKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  87

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FE RYDLVKFIKL Q+AGLY HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  88    QQGKYYFEERYDLVKFIKLVQQAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  147

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIVNMMK+EKL+E+QGGPII+SQIENEYGP+E+E+GAPGK YT WA  
Sbjct  148   GPFKAAMQRFTEKIVNMMKAEKLYETQGGPIILSQIENEYGPMEYELGAPGKTYTHWAAN  207

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL+TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGGP
Sbjct  208   MALGLRTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGP  267

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AF +ARFIQ  GS+VNYYMYHGGTNF RTA   FIATSYDYDAPLDE+GL+
Sbjct  268   VPTRPAEDLAFGIARFIQKGGSYVNYYMYHGGTNFDRTAGGPFIATSYDYDAPLDEFGLL  327

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVSS P V   G +QE HVF+S +GAC AFL+NY+P   
Sbjct  328   KQPKWGHLKDLHRAIKLCEPALVSSDPTVVRLGSSQEAHVFKSGSGACAAFLANYNPSSY  387

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV + N  Y+LPPWSISILPDCKN VYNTA V + S Q K  PV N FSWQSY EE AS
Sbjct  388   AKVAYGNNHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKFTPVYNHFSWQSYNEETAS  447

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +DD       G+ EQ+N TRD +DYLWYMT+V I  +E FL+ GK+PV+ VMSAGHA+HV
Sbjct  448   TDD-SAFTVLGLLEQVNTTRDMTDYLWYMTDVKIDSNEGFLKGGKEPVLNVMSAGHALHV  506

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             +IN +L GT YG L  PK+++   V +RAG NKISLLS+AVGLPNVG +FE+WNAG+LGP
Sbjct  507   YINGQLVGTAYGSLENPKISFGEGVNMRAGTNKISLLSIAVGLPNVGPNFERWNAGILGP  566

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSLSGLNEG RDLT Q W YK+
Sbjct  567   VSLSGLNEGRRDLTWQKWSYKI  588


 Score =   147 bits (372),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++GMKGE+LSL++++G S+VEW +G  LA  QPLTWYK TF+AP GN+PLALDM +MGKG
Sbjct  587   KIGMKGETLSLHSLSGVSNVEWVEGKFLAQRQPLTWYKTTFNAPSGNEPLALDMGAMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP YTA+GSC S+C+YAG +++KKC   CG  SQ
Sbjct  647   QVWINGQNIGRYWPAYTAKGSC-SDCSYAGYFSEKKCLTYCGDASQ  691



>emb|CAC44502.1| beta-galactosidase [Fragaria x ananassa]
Length=722

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/563 (71%), Positives = 473/563 (84%), Gaps = 5/563 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV YD R+ I+NGKRRILISGSIHYPRSTP+MWP L+QKAKDGGLDV+QTYVFWNGHEP
Sbjct  25    ASVGYDHRAIIVNGKRRILISGSIHYPRSTPEMWPDLLQKAKDGGLDVLQTYVFWNGHEP  84

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIKLAQ+ GLYVHLRIGPYIC EWNFGGFP+WLKYVPGI FRTDN
Sbjct  85    SPGKYYFEDRYDLVKFIKLAQQHGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDN  144

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PF  AM+ F  KIV MMK+E+LF++QGGPII+SQIENEYGPVEWEIGAPGK+YT+WA +
Sbjct  145   RPFMAAMEKFTQKIVYMMKAERLFQTQGGPIILSQIENEYGPVEWEIGAPGKSYTQWAAK  204

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDPIIDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG 
Sbjct  205   MAVGLNTGVPWVMCKQEDAPDPIIDTCNGFYCENFTPNKNYKPKMWTEIWTGWYTEFGGA  264

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPA+D+AFSVARFIQN GSF NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  265   VPTRPAQDLAFSVARFIQNGGSFANYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLP  324

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPKY HL+ +H+AIK+AEPAL+++   V+  G NQE HV++S +G C AFL+NYD ++ 
Sbjct  325   REPKYSHLKYMHKAIKMAEPALLATDAAVSKLGNNQEAHVYQSRSG-CAAFLANYDTKYP  383

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATV-RSPSLQTKMIPVGNGFSWQSYTEEIA  1653
              +VTF N QY+LPPWSISILPDCK  V+NTA V +SP   TKM PV +  SWQ+Y E++A
Sbjct  384   VRVTFWNKQYNLPPWSISILPDCKTEVFNTARVGQSPP--TKMTPVAH-LSWQAYIEDVA  440

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             +S D +   + G+ EQI++T D++DYLWYMT++ I P+E+FLR GK P + V SAGHA+H
Sbjct  441   TSADDNAFTSVGLREQISLTWDNTDYLWYMTDITIGPNEQFLRTGKYPTLKVDSAGHALH  500

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSG+ YG LAFPKL +   VKLRAGINK++LLSV+VGL NVGLHFE WN GVLG
Sbjct  501   VFINGQLSGSAYGTLAFPKLEFNQGVKLRAGINKLALLSVSVGLANVGLHFETWNTGVLG  560

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L+G+N GT D+T   W YK+
Sbjct  561   PVTLAGVNSGTWDMTRWQWTYKI  583


 Score =   154 bits (389),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = +2

Query  2138  RFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDM  2317
             R+    ++GM+GE +SL+TV+GSSSVEW  G LLA  +PLTWYKA  +AP GN PLALDM
Sbjct  576   RWQWTYKIGMRGEDMSLHTVSGSSSVEWVQGSLLAQYRPLTWYKAILNAPPGNAPLALDM  635

Query  2318  SSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              SMGKG++W+NG+ +GRHWP Y A GSC + C YAGTY + KC+ NCGQPSQ
Sbjct  636   GSMGKGQMWINGQSIGRHWPAYKAHGSCGA-CYYAGTYTENKCRTNCGQPSQ  686



>ref|XP_009783993.1| PREDICTED: beta-galactosidase [Nicotiana sylvestris]
Length=844

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/562 (72%), Positives = 467/562 (83%), Gaps = 2/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ I+NG+R+ILISGSIHYPRS P+MWP L+QKAK+GG+DVIQTYVFWNGHE 
Sbjct  32    ASVSYDHKAIIVNGQRKILISGSIHYPRSIPEMWPDLIQKAKEGGVDVIQTYVFWNGHES  91

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FEGRYDLVKFIK+ Q+AGLYVHLRIGPY C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  92    EEGKYYFEGRYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFRTDN  151

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMKSE+L++SQGGPII+SQIENEYGP+EWE+G PGKAY++WA +
Sbjct  152   EPFKAAMQKFTTKIVDMMKSERLYQSQGGPIILSQIENEYGPMEWELGEPGKAYSEWAAK  211

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAV L TGVPWIMCKQ+D PDPII+TCNG+YC+ F PNK  KPKM+TE WT W+T+FGGP
Sbjct  212   MAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFLPNKANKPKMWTEAWTAWFTEFGGP  271

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL+
Sbjct  272   VPYRPAEDMAFAVARFIQTGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLL  331

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS+ P VT  G  QE  +F+SE+GAC AFL+NY+    
Sbjct  332   RQPKWGHLKDLHRAIKLCEPALVSADPTVTPLGNYQEARIFKSESGACAAFLANYNQHSF  391

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV F N+ Y+LPPWSISILPDCKN VYNTA V + S Q KM PV  GFSWQSY E+ A 
Sbjct  392   AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMSPVIRGFSWQSYNEDAAL  451

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +D       G+ EQIN TRD SDYLWYMT+V I P E FL +G  P +TV SAGHA+HV
Sbjct  452   HEDNTYTV--GLLEQINTTRDVSDYLWYMTDVEIDPTEGFLNSGNWPWLTVFSAGHALHV  509

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GTVYG L  PKLT++N + LRAG+NKISLLS+AVGLPNVG HFE WNAGVLGP
Sbjct  510   FVNGQLAGTVYGSLENPKLTFSNGINLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  569

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSLSGLNEGTRDLT Q WFYKV
Sbjct  570   VSLSGLNEGTRDLTWQKWFYKV  591


 Score =   142 bits (359),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GS SVEW +G L+A  QPL+WYK TF+AP GN+PLALDM++MGKG
Sbjct  590   KVGLKGEALSLHSLSGSPSVEWVEGSLVAQKQPLSWYKTTFNAPAGNEPLALDMNTMGKG  649

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWPGY + G+C++ C Y G +++KKC  NCG+ SQ
Sbjct  650   QVWINGQSLGRHWPGYKSSGNCTA-CYYTGWFDEKKCLSNCGEGSQ  694



>ref|NP_001234303.1| beta-galactosidase precursor [Solanum lycopersicum]
 gb|AAF70822.1|AF154421_1 beta-galactosidase [Solanum lycopersicum]
 emb|CAA10173.1| ss-galactosidase [Solanum lycopersicum]
Length=838

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/561 (71%), Positives = 465/561 (83%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD R+ I+NG+RRILISGS+HYPRSTP+MWPG++QKAK+GG+DVIQTYVFWNGHEP 
Sbjct  26    SVSYDHRAIIVNGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGVDVIQTYVFWNGHEPQ  85

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FEGRYDLVKFIKL  +AGLYVHLR+GPY C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  86    QGKYYFEGRYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGISFRTDNG  145

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIVNMMK+E+L+E+QGGPII+SQIENEYGP+EWE+GAPGK+Y +WA +M
Sbjct  146   PFKAAMQKFTAKIVNMMKAERLYETQGGPIILSQIENEYGPMEWELGAPGKSYAQWAAKM  205

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPK++TE WT W+T FG PV
Sbjct  206   AVGLDTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAWFTGFGNPV  265

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  266   PYRPAEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  325

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVFRS+ G+C AFL+NYD    A
Sbjct  326   QPKWGHLKDLHRAIKLCEPALVSGDPAVTALGHQQEAHVFRSKAGSCAAFLANYDQHSFA  385

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              V+F+N  Y+LPPWSISILPDCKN V+NTA + + S Q KM PV  G  WQS+ EE +S 
Sbjct  386   TVSFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTPVSRGLPWQSFNEETSSY  445

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +D  +    G+ EQIN TRD SDYLWY T+V I   E+FLR GK P +T+MSAGHA+HVF
Sbjct  446   ED-SSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREKFLRGGKWPWLTIMSAGHALHVF  504

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +L+GT YG L  PKLT++ +V LRAG+NKISLLS+AVGLPN+G HFE WNAGVLGPV
Sbjct  505   VNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNAGVLGPV  564

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SL+GL+EG RDLT Q W YKV
Sbjct  565   SLTGLDEGKRDLTWQKWSYKV  585


 Score =   135 bits (341),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW +G L+A  QPLTWYK+TF+AP GNDPLALD+++MGKG
Sbjct  584   KVGLKGEALSLHSLSGSSSVEWVEGSLVAQRQPLTWYKSTFNAPAGNDPLALDLNTMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY A G+C + CNYAG +N+KKC  NCG+ SQ
Sbjct  644   QVWINGQSLGRYWPGYKASGNCGA-CNYAGWFNEKKCLSNCGEASQ  688



>gb|KHG25378.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=843

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/563 (71%), Positives = 470/563 (83%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +VSYD ++  ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHEP+
Sbjct  29    TVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPA  88

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEG YDLVKFIKL ++AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRT+N 
Sbjct  89    PGKYYFEGNYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGINFRTNNG  148

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  M+ F   IVNMMK+E+LFESQGGPII+SQIENEYGPVE+EIG PGKAYT WA +M
Sbjct  149   PFKAQMRRFTKMIVNMMKAERLFESQGGPIILSQIENEYGPVEYEIGEPGKAYTDWAAKM  208

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV L TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG V
Sbjct  209   AVRLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGAV  268

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  269   PYRPAEDMAFSVARFIQTGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  328

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL E ALVS  P V   G +QE HVF  ++G C AFL+NYDP+  A
Sbjct  329   QPKWGHLKDLHRAIKLCESALVSGDPTVMQLGVHQEAHVFNYKSGGCAAFLANYDPKSFA  388

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPV--GNGFSWQSYTEEIA  1653
             KV F ++ Y+LPPWSISILPDCKN VYNTA V +   + KM+PV    GFSWQ+Y+EE A
Sbjct  389   KVAFRDMNYNLPPWSISILPDCKNTVYNTARVGAQIARKKMVPVPLHGGFSWQAYSEETA  448

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S  D  +    G+ EQIN TRD++DYLWY T++ I PDEEF RNGK P++T++SAGHA+H
Sbjct  449   SDAD-SSFTMVGLLEQINTTRDATDYLWYTTDIEIDPDEEFFRNGKSPILTILSAGHALH  507

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSG+ YG L FPKLT++  V +RAGINKI+LLS+AVGLPNVG HFE WNAGVLG
Sbjct  508   VFVNGQLSGSSYGSLEFPKLTFSQGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGVLG  567

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L+GLNEG RDL+ Q W YK+
Sbjct  568   PVTLNGLNEGRRDLSWQKWSYKI  590


 Score =   154 bits (390),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW +G L+A  QPLTWYK TF+AP GN PLALDM SMGKG
Sbjct  589   KIGLKGEALNLHSLSGSSSVEWAEGSLVAQRQPLTWYKTTFNAPTGNAPLALDMRSMGKG  648

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A G+CS  CNYAGTY++ KC+ NCG+ SQ
Sbjct  649   QIWINGQSIGRHWPAYKASGNCSV-CNYAGTYDEYKCRTNCGEASQ  693



>gb|ADO34788.1| beta-galactosidase STBG3 [Solanum lycopersicum]
Length=838

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/561 (71%), Positives = 465/561 (83%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD R+ I+NG+RRILISGS+HYPRSTP+MWPG++QKAK+GG+DVIQTYVFWNGHEP 
Sbjct  26    SVSYDHRAIIVNGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGVDVIQTYVFWNGHEPQ  85

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FEGRYDLVKFIKL  +AGLYVHLR+GPY C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  86    QGKYYFEGRYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGISFRTDNG  145

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIVNMMK+E+L+E+QGGPII+SQIENEYGP+EWE+GAPGK+Y +WA +M
Sbjct  146   PFKAAMQKFTAKIVNMMKAERLYETQGGPIILSQIENEYGPMEWELGAPGKSYAQWAAKM  205

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPK++TE WT W+T FG PV
Sbjct  206   AVGLDTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAWFTGFGNPV  265

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  266   PYRPAEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  325

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVFRS+ G+C AFL+NYD    A
Sbjct  326   QPKWGHLKDLHRAIKLCEPALVSGDPAVTALGHQQEAHVFRSKAGSCAAFLANYDQHSFA  385

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              V+F+N  Y+LPPWSISILPDCKN V+NTA + + S Q KM PV  G  WQS+ EE +S 
Sbjct  386   TVSFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTPVSRGLPWQSFNEETSSY  445

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +D  +    G+ EQIN TRD SDYLWY T+V I   E+FLR GK P +T+MSAGHA+HVF
Sbjct  446   ED-SSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREKFLRGGKWPWLTIMSAGHALHVF  504

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +L+GT YG L  PKLT++ +V LRAG+NKISLLS+AVGLPN+G HFE WNAGVLGPV
Sbjct  505   VNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNAGVLGPV  564

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SL+GL+EG RDLT Q W YKV
Sbjct  565   SLTGLDEGKRDLTWQKWSYKV  585


 Score =   135 bits (341),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW +G L+A  QPLTWYK+TF+AP GNDPLALD+++MGKG
Sbjct  584   KVGLKGEALSLHSLSGSSSVEWVEGSLVAQRQPLTWYKSTFNAPAGNDPLALDLNTMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY A G+C + CNYAG +N+KKC  NCG+ SQ
Sbjct  644   QVWINGQSLGRYWPGYKASGNCGA-CNYAGWFNEKKCLSNCGEASQ  688



>ref|XP_006426535.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39775.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=845

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/565 (72%), Positives = 471/565 (83%), Gaps = 4/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
              GSVSYD ++  INGKRRILISGSIHYPRS+P+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  30    EGSVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  89

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKL ++AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRT+
Sbjct  90    PSPGKYYFEGNYDLVKFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTN  149

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  M  F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG++YT+WA 
Sbjct  150   NGPFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAA  209

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  210   KMAVGLDTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  269

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RP ED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  270   PVPHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P V   G  QE HVF+S++ AC AFL+NY+ + 
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRT  388

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N  Y+LPPWSISILPDCKN VYNTA V   S Q KM  +P+  GFSWQ++  E
Sbjct  389   FAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFN-E  447

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             + S+    +    G+ EQIN TRD++DYLWYMT+V I P E FLR+G  PV+TVMSAGHA
Sbjct  448   VPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHA  507

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L FPKLT+T  V +RAGINKI+LLS+AVGLPNVG HFE WNAGV
Sbjct  508   LHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGV  567

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+GLNEG RDL+ Q W YKV
Sbjct  568   LGPVTLNGLNEGRRDLSWQKWTYKV  592


 Score =   144 bits (362),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE L+L++++G SSVEW +G L+A  QPLTWY+ TF AP GN PLALDM SMGKG
Sbjct  591   KVGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++WVNG+ +GRHWP Y A GSC   C+Y GTY +KKC  NCG+ SQ
Sbjct  651   QVWVNGQSIGRHWPAYKASGSCGY-CSYTGTYTEKKCLSNCGEASQ  695



>ref|NP_001234465.1| beta-galactosidase precursor [Solanum lycopersicum]
 sp|P48980.1|BGAL_SOLLC RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAF21626.1|AF023847_1 beta-galactosidase precursor [Solanum lycopersicum]
 emb|CAA58734.1| putative beta-galactosidase/galactanase [Solanum lycopersicum]
 emb|CAA10174.1| ss-galactosidase [Solanum lycopersicum]
Length=835

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/562 (72%), Positives = 469/562 (83%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ I+NG+R+ILISGSIHYPRSTP+MWP L+QKAK+GG+DVIQTYVFWNGHEP
Sbjct  22    ASVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEP  81

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FE RYDLVKFIK+ Q+AGLYVHLRIGPY C EWNFGGFP+WLKYVPGI FRT+N
Sbjct  82    EEGKYYFEERYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFRTNN  141

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMK+EKL+E+QGGPII+SQIENEYGP+EWE+G PGK Y++WA +
Sbjct  142   EPFKAAMQKFTTKIVDMMKAEKLYETQGGPIILSQIENEYGPMEWELGEPGKVYSEWAAK  201

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAV L TGVPWIMCKQ+D PDPII+TCNG+YC+ F PNK  KPKM+TE WT W+T+FGGP
Sbjct  202   MAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFTPNKANKPKMWTEAWTAWFTEFGGP  261

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AF+VARFIQ  GSF+NYYMYHGGTNFGRT+   FIATSYDYDAPLDE+G +
Sbjct  262   VPYRPAEDMAFAVARFIQTGGSFINYYMYHGGTNFGRTSGGPFIATSYDYDAPLDEFGSL  321

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE  VF+SE+GAC AFL+NY+    
Sbjct  322   RQPKWGHLKDLHRAIKLCEPALVSVDPTVTSLGNYQEARVFKSESGACAAFLANYNQHSF  381

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV F N+ Y+LPPWSISILPDCKN VYNTA V + S Q KM PV  GFSW+S+ E+ AS
Sbjct  382   AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMTPVSRGFSWESFNEDAAS  441

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +D DT    G+ EQIN+TRD SDYLWYMT++ I P E FL +G  P +TV SAGHA+HV
Sbjct  442   HED-DTFTVVGLLEQINITRDVSDYLWYMTDIEIDPTEGFLNSGNWPWLTVFSAGHALHV  500

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GTVYG L  PKLT++N + LRAG+NKISLLS+AVGLPNVG HFE WNAGVLGP
Sbjct  501   FVNGQLAGTVYGSLENPKLTFSNGINLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  560

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSL+GLNEGTRDLT Q WFYKV
Sbjct  561   VSLNGLNEGTRDLTWQKWFYKV  582


 Score =   146 bits (369),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GS SVEW +G L+A  QPL+WYK TF+AP+GN+PLALDM++MGKG
Sbjct  581   KVGLKGEALSLHSLSGSPSVEWVEGSLVAQKQPLSWYKTTFNAPDGNEPLALDMNTMGKG  640

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP Y + GSCS  CNY G +++KKC  NCG+ SQ
Sbjct  641   QVWINGQSLGRHWPAYKSSGSCSV-CNYTGWFDEKKCLTNCGEGSQ  685



>ref|XP_010545349.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Tarenaya hassleriana]
Length=588

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/563 (71%), Positives = 462/563 (82%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +G+VSYD ++ IING+RRIL+SGSIHYPRSTP+MW  L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  25    KGAVSYDHKAVIINGQRRILLSGSIHYPRSTPEMWSDLIQKAKDGGLDVIQTYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG Y FE RYDLV+FI++ QKAGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRT+
Sbjct  85    PSPGNYYFEDRYDLVRFIRVVQKAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTN  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AMQ F  KIV MMK+EKLFE+QGGPII+SQIENEYGPVEWEIGAPGKAYTKWA 
Sbjct  145   NGPFKAAMQKFTQKIVGMMKAEKLFETQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQEDAP PIIDTCNG+YCENF PN   KPKM+TE WTGW+T+FG 
Sbjct  205   EMAVGLSTGVPWIMCKQEDAPGPIIDTCNGFYCENFKPNSDNKPKMWTENWTGWFTEFGA  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP EDIAFSVARFIQN GSFVNYYMYHGGTNF RTA   F+ATSYDYDAPLDEYGL
Sbjct  265   AVPYRPVEDIAFSVARFIQNGGSFVNYYMYHGGTNFDRTAGE-FVATSYDYDAPLDEYGL  323

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPK+ HLR+LH+ IKL EPALVS  P VTW G  QE HVF+S++ +C AFLSNYDP  
Sbjct  324   PREPKWSHLRELHKVIKLCEPALVSVDPTVTWLGAKQEAHVFKSKS-SCAAFLSNYDPDS  382

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             + +VTF  L YDLPPWS+SILPDCK V +NTA V +  +   MIP G  FSW+SY EE  
Sbjct  383   AVRVTFWGLPYDLPPWSVSILPDCKTVYHNTAKVYAKGVHMNMIPTGVHFSWESYNEETL  442

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S +D  T   +G+ EQI++TRD +DYLWY T++ I  DE+FL+ G +P++T+ SAGHA+H
Sbjct  443   SGNDDGTFTLNGLVEQISMTRDKTDYLWYFTDITIGHDEKFLKTGDNPLLTIWSAGHALH  502

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GTVYG L  PKLT++  +KL AG+NK++LLSVAVGL NVG+HFE WN GVLG
Sbjct  503   VFVNGQLAGTVYGSLDNPKLTFSQKIKLYAGVNKLALLSVAVGLANVGVHFETWNVGVLG  562

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSL G+N GT D++   W YKV
Sbjct  563   PVSLKGMNSGTWDMSKWKWSYKV  585



>gb|KHG01120.1| Beta-galactosidase [Gossypium arboreum]
Length=837

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/573 (71%), Positives = 467/573 (82%), Gaps = 27/573 (5%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              +VSYD ++ IING+RRIL+SGSIHYPRSTPQMWP L+ KAK+GGLDVIQTYVFWNGHEP
Sbjct  31    ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQTYVFWNGHEP  90

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFG-----------GFPIWLK  723
             SPG Y FE RYDLV+FIKL Q+AGLYVHLRIGPYIC EWNFG           GFP+WLK
Sbjct  91    SPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGCLPICSVFWFRGFPVWLK  150

Query  724   YVPGIEFRTDNQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGA  903
             YVPGI FRTDN+PFK AMQ F  KIV+MMK+EKLFE+QGGPIIMSQIENE+GPVEWEIG 
Sbjct  151   YVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQIENEFGPVEWEIGD  210

Query  904   PGKAYTKWAGQMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTEL  1083
             PGKAYTKWA QMAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YCENF PN  YKPKM+TE 
Sbjct  211   PGKAYTKWAAQMAVGLDTGVPWIMCKQDDAPDPVINTCNGFYCENFTPNAKYKPKMWTEN  270

Query  1084  WTGWYTQFGGPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYD  1263
             WTGWYT+FGG V  RPAEDIAFSVARFIQN GSF     YHGGTNFGRTA+ LFIATSYD
Sbjct  271   WTGWYTEFGGAVPTRPAEDIAFSVARFIQNGGSF-----YHGGTNFGRTASGLFIATSYD  325

Query  1264  YDAPLDEYGLVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACV  1443
             YDAP+DEYGL  EPK+GHLRDLHRAIKL+EPALVS+ P VT  G NQE HVF+S++GAC 
Sbjct  326   YDAPIDEYGLPREPKWGHLRDLHRAIKLSEPALVSADPTVTSLGSNQEGHVFKSKSGACA  385

Query  1444  AFLSNYDPQFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGF  1623
             AFL+NYD ++S KVTF +  Y+LP WSI+ILPDCK  V+NTA + + S + KM+     F
Sbjct  386   AFLANYDTKYSVKVTFGSAHYELPSWSITILPDCKTAVFNTARLGAQSSEKKMVLANTAF  445

Query  1624  SWQSYTEEIASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVV  1803
             SWQSY EE  S+DD D    DG+WEQI +TRD++DYLWYMT+V I  DE FLR+G+DP++
Sbjct  446   SWQSYNEESPSADDQDVTVHDGLWEQIYITRDATDYLWYMTDVQIDSDEGFLRSGQDPLL  505

Query  1804  TVMSAGHAMHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLH  1983
             T+ SAGHA+HVFIN +LSGTVYGGL  PKLT++N+VKLRAGINK           NVG H
Sbjct  506   TIWSAGHALHVFINGQLSGTVYGGLENPKLTFSNNVKLRAGINK-----------NVGTH  554

Query  1984  FEKWNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             FE WN GVLGPV+L GLNEGTRD + Q W YK+
Sbjct  555   FETWNVGVLGPVTLKGLNEGTRDFSKQKWSYKI  587


 Score =   155 bits (391),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L L+T  GSSSVEW +G  L   QP+TWYK TFDAP GN+PL LDMSSMGKG
Sbjct  586   KIGLKGEALKLHTDAGSSSVEWVEGSQLVKKQPMTWYKTTFDAPGGNEPLGLDMSSMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWPGY A G+C + C+Y+GTY+ +KC+ NCGQPSQ
Sbjct  646   QVWINGQSIGRHWPGYIAHGNCDA-CDYSGTYSDQKCRTNCGQPSQ  690



>ref|XP_006342989.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=838

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/562 (71%), Positives = 466/562 (83%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD R+ I+NG+RRILISGS+HYPRSTP+MWPG++QKAK+GG+DVIQTYVFWNGHEP
Sbjct  25    ASVSYDHRAIIVNGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGVDVIQTYVFWNGHEP  84

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FEGRYDLVKFIKL  +AGLYVHLR+GPY C EWNFGGFP+WLKYVPGI FRT+N
Sbjct  85    QQGKYYFEGRYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGISFRTNN  144

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIVNMMK+E+L+E+QGGPII+SQIENEYGP+EWE+GAPGK+Y +WA +
Sbjct  145   GPFKAAMQKFTTKIVNMMKAERLYETQGGPIILSQIENEYGPMEWELGAPGKSYAQWAAK  204

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPK++TE WT W+T FG P
Sbjct  205   MAVGLDTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAWFTGFGNP  264

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AF+VA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+
Sbjct  265   VPYRPAEDLAFAVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLL  324

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVFRS++G+C AFL+NYD    
Sbjct  325   RQPKWGHLKDLHRAIKLCEPALVSGDPAVTALGHQQEAHVFRSKSGSCAAFLANYDQHSF  384

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A V+F+N  Y+LPPWSISILPDCKN V+NTA + + S Q KM PV  G  WQS+ EE +S
Sbjct  385   ATVSFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTPVSRGLPWQSFNEETSS  444

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +D  +    G+ EQIN TRD SDYLWY T+V I   EEFLR GK P +T+MSAGHA+HV
Sbjct  445   YED-SSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREEFLRGGKWPWLTIMSAGHALHV  503

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GT YG L  PKL+++ +V LRAG+NKISLLS+AVGLPN+G HFE WNAGVLGP
Sbjct  504   FVNGQLAGTAYGSLEKPKLSFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNAGVLGP  563

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSLSGL+EG RDLT Q W YKV
Sbjct  564   VSLSGLDEGKRDLTWQKWSYKV  585


 Score =   136 bits (342),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW +G L+A  QPLTWYK+TF+AP GNDPLALD+++MGKG
Sbjct  584   KVGLKGEALSLHSLSGSSSVEWVEGSLVAQRQPLTWYKSTFNAPAGNDPLALDLNTMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY A G+C + CNYAG +N+KKC  NCG+ SQ
Sbjct  644   QVWINGQSLGRYWPGYKASGNCGA-CNYAGWFNEKKCLSNCGEASQ  688



>ref|XP_007024475.1| Beta galactosidase 1 [Theobroma cacao]
 gb|EOY27097.1| Beta galactosidase 1 [Theobroma cacao]
Length=843

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/564 (70%), Positives = 471/564 (84%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++  ING+RRILISGSIHYPRS+P+MWP L+QKAK+GGLDVIQTYVFWNGHEP
Sbjct  28    ASVSYDRKAITINGQRRILISGSIHYPRSSPEMWPDLVQKAKEGGLDVIQTYVFWNGHEP  87

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             +PGKY F+G YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRT+N
Sbjct  88    APGKYYFQGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGINFRTNN  147

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPGKAYT WA +
Sbjct  148   GPFKAQMQRFTEKIVDMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGKAYTDWAAK  207

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPK++TE WTGWYT+FGG 
Sbjct  208   MAVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKIWTEAWTGWYTEFGGA  267

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  G+F+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+
Sbjct  268   VPYRPAEDLAFSVARFIQKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLL  327

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALV+  P V   G  QE HVF+ ++G C AFL+NY+P+  
Sbjct  328   RQPKWGHLKDLHRAIKLCEPALVNGDPTVMRLGNYQEAHVFKYQSGGCAAFLANYNPRSF  387

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPV--GNGFSWQSYTEEI  1650
             AKV F N+ Y+LPPWSISILPDCKN VYNTA V +   + KM+PV     FSWQ+Y+EE 
Sbjct  388   AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQIARKKMVPVPMHGAFSWQAYSEET  447

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             AS  D  +    G+ EQIN T+D++DYLWY T++ I P E FL+NG  PV+T++SAGHA+
Sbjct  448   ASDVD-SSFTMVGLLEQINTTKDATDYLWYTTDIKIDPSEGFLKNGNSPVLTILSAGHAL  506

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVF+N +LSG+ YG L FPKLT++  V LRAG+NKISLLS+AVGLPNVG HFE WNAG+L
Sbjct  507   HVFVNGQLSGSAYGSLEFPKLTFSQGVNLRAGVNKISLLSIAVGLPNVGPHFETWNAGIL  566

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPV+L+GLNEG RDL+ Q W YK+
Sbjct  567   GPVTLNGLNEGRRDLSWQKWSYKI  590


 Score =   150 bits (380),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE+L+L++++GSSSVEW  G  +A  QPL WYK TF+AP GN PLALDM SMGKG
Sbjct  589   KIGLEGEALNLHSLSGSSSVEWAQGSFVARRQPLMWYKTTFNAPAGNAPLALDMHSMGKG  648

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A G+C  +CNYAGTY++KKC+ NCG+ SQ
Sbjct  649   QIWINGQSIGRHWPAYKASGNC-GDCNYAGTYDEKKCRTNCGEASQ  693



>ref|XP_003529875.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=845

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/563 (72%), Positives = 474/563 (84%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRIL+SGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  31    SVSYDHKAITINGQRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  90

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY F G YDLV+FIKL Q+AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRTDN 
Sbjct  91    PGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDNG  150

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  M+ F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG+AYT+WA  M
Sbjct  151   PFKFQMEKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRAYTQWAAHM  210

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG V
Sbjct  211   AVGLGTGVPWIMCKQEDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGAV  270

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFS+ARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  
Sbjct  271   PHRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLPR  330

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P V   G  +E HVFRS++GAC AFL+NY+PQ  A
Sbjct  331   QPKWGHLKDLHRAIKLCEPALVSGDPTVQQLGNYEEAHVFRSKSGACAAFLANYNPQSYA  390

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
              V F N +Y+LPPWSISILP+CK+ VYNTA V S S   KM  +P+  G SW+++ EE  
Sbjct  391   TVAFGNQRYNLPPWSISILPNCKHTVYNTARVGSQSTTMKMTRVPIHGGLSWKAFNEETT  450

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD  +    G+ EQIN TRD SDYLWY T+V I  +E FLRNGK+PV+TV+SAGHA+H
Sbjct  451   TTDD-SSFTVTGLLEQINATRDLSDYLWYSTDVVINSNEGFLRNGKNPVLTVLSAGHALH  509

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN++LSGT YG L  PKLT++ SV+LRAG+NKISLLSVAVGLPNVG HFE+WNAGVLG
Sbjct  510   VFINNQLSGTAYGSLEAPKLTFSESVRLRAGVNKISLLSVAVGLPNVGPHFERWNAGVLG  569

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             P++LSGLNEG RDLT Q W YKV
Sbjct  570   PITLSGLNEGRRDLTWQKWSYKV  592


 Score =   148 bits (374),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW  G L++  QPLTWYK TFDAP G  PLALDM SMGKG
Sbjct  591   KVGLKGEALNLHSLSGSSSVEWLQGFLVSRRQPLTWYKTTFDAPAGVAPLALDMGSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A GSC   CNYAGTYN+KKC  NCGQ SQ
Sbjct  651   QVWINGQSLGRYWPAYKASGSCGY-CNYAGTYNEKKCGSNCGQASQ  695



>dbj|BAE72074.1| pear beta-galactosidase2 [Pyrus communis]
Length=725

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/561 (72%), Positives = 472/561 (84%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV YD ++ IING+RRILISGSIHYPRSTP MWP L+QKAK GGLDVIQTYVFWNGHEPS
Sbjct  25    SVGYDHKAIIINGQRRILISGSIHYPRSTPGMWPDLIQKAKAGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLVKFIKL Q+AGL+V+LRIGPY+C EWNFGGFPIWLKYVPGI FRTDN+
Sbjct  85    PGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPIWLKYVPGIAFRTDNE  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIVNMMK+EKLF++QGGPII+SQIENE+GPVEWEIGAPGKAYTKWA QM
Sbjct  145   PFKAAMQKFTEKIVNMMKAEKLFQTQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDP+IDTCNGYYCENF PNK YKPKM+TE+WTGWYT+FGG +
Sbjct  205   AVGLDTGVPWIMCKQEDAPDPVIDTCNGYYCENFKPNKVYKPKMWTEVWTGWYTEFGGAI  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ+ GSF NYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL+ 
Sbjct  265   PTRPAEDLAFSVARFIQSGGSFFNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLLQ  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHLRDLH+AIK  E ALV+  P VT  G NQE HVF S++G C AFL+NYD ++S 
Sbjct  325   QPKWGHLRDLHKAIKSCEHALVAVDPSVTKLGNNQEAHVFNSKSG-CAAFLANYDTKYSV  383

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             +V+F + QYDLPPWSISILPDCK  V+NTA V   + + +M PV +   WQS+ EE  +S
Sbjct  384   RVSFGHGQYDLPPWSISILPDCKTAVFNTAKVAWKASEVQMKPVYSRLPWQSFIEETTTS  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             D+  T   DG++EQI +TRD++DYLWYMT++ I  DE FL+NGK P++T+ SAGHA+HVF
Sbjct  444   DETGTTTLDGLYEQIYMTRDATDYLWYMTDITIGSDEAFLKNGKFPLLTIFSAGHALHVF  503

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKLT++ +VKLR GINK++LLS++VGLPNVG HFE WN GVLGP+
Sbjct  504   INGQLSGTVYGSLENPKLTFSQNVKLRPGINKLALLSISVGLPNVGTHFETWNTGVLGPI  563

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SL GLN GT D++   W YK+
Sbjct  564   SLKGLNTGTWDMSRWKWTYKI  584


 Score =   166 bits (419),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +2

Query  2138  RFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDM  2317
             R+    ++GMKGESL L+TVTGSSSV+W +GP +A  QPLTWYKATFDAP G+ PLALDM
Sbjct  577   RWKWTYKIGMKGESLGLHTVTGSSSVDWAEGPSMAQKQPLTWYKATFDAPPGHAPLALDM  636

Query  2318  SSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              SMGKG+IW+NG+ VGRHWPGY AQGSC + C YAGT+N KKC+  CG+PSQ
Sbjct  637   GSMGKGQIWINGQSVGRHWPGYIAQGSCGN-CYYAGTFNDKKCRTYCGKPSQ  687



>ref|NP_001266102.1| beta-galactosidase 1-like precursor [Cicer arietinum]
 emb|CAA07236.2| beta-galactosidase precursor [Cicer arietinum]
Length=839

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/565 (72%), Positives = 473/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
               SVSYD ++  ING+R+IL+SGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  23    EASVSYDYKAITINGQRKILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  82

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFI+L Q+AGLYVHLRIGPY C EWNFGGFP+WLKY+PGI FRTD
Sbjct  83    PSPGKYYFEGNYDLVKFIRLVQQAGLYVHLRIGPYACAEWNFGGFPVWLKYIPGISFRTD  142

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  MQ F  KIVN+MK+E+L+ESQGGPII+SQIENEYGP+E+E+GAPGKAY +WA 
Sbjct  143   NGPFKFQMQKFTTKIVNIMKAERLYESQGGPIILSQIENEYGPMEYELGAPGKAYAQWAA  202

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
              MA+GL TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T FGG
Sbjct  203   HMAIGLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTGFGG  262

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  263   TVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  322

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS+ P VT  G  QE HVF+S++GAC AFL+NY+P  
Sbjct  323   LRQPKWGHLKDLHRAIKLCEPALVSADPTVTRLGNYQEAHVFKSKSGACAAFLANYNPHS  382

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              + V F N  Y+LPPWSISILP+CK+ VYNTA + S S Q KM  +P+  G SW+++ EE
Sbjct  383   YSTVAFGNQHYNLPPWSISILPNCKHTVYNTARLGSQSAQMKMTRVPIHGGLSWKAFNEE  442

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               ++DD  +    G+ EQIN TRD SDYLWY T+V I PDE + RNGK+PV+TV+SAGHA
Sbjct  443   TTTTDD-SSFTVTGLLEQINATRDLSDYLWYSTDVVINPDEGYFRNGKNPVLTVLSAGHA  501

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVFIN +LSGTVYG L FPKLT++ SV LRAG+NKISLLSVAVGLPNVG HFE WNAGV
Sbjct  502   LHVFINGQLSGTVYGSLDFPKLTFSESVNLRAGVNKISLLSVAVGLPNVGPHFETWNAGV  561

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGP++L+GLNEG RDLT Q W YKV
Sbjct  562   LGPITLNGLNEGRRDLTWQKWSYKV  586


 Score =   131 bits (330),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE LSL++++GSSSV+W  G L++  QPLTWYK TFDAP G  PLALDM+SMGKG
Sbjct  585   KVGLKGEDLSLHSLSGSSSVDWLQGYLVSRRQPLTWYKTTFDAPAGVAPLALDMNSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A GSC   CNYAGTYN+KKC  NCG+ SQ
Sbjct  645   QVWLNGQSLGRYWPAYKATGSCDY-CNYAGTYNEKKCGTNCGEASQ  689



>ref|XP_008450855.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=719

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/562 (71%), Positives = 463/562 (82%), Gaps = 2/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSV+YD ++ IING+RRILISGSIHYPRSTPQMWP L+Q AKDGGLD+I+TYVFWNGHEP
Sbjct  20    GSVTYDQKAIIINGQRRILISGSIHYPRSTPQMWPDLIQNAKDGGLDIIETYVFWNGHEP  79

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFPIWLK+VPGI FRTDN
Sbjct  80    SPGKYYFEERYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPIWLKFVPGIAFRTDN  139

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ FV KIV MMK EKL+ +QGGPII+SQIENEYGPVEW+IGAPGK+YTKWA Q
Sbjct  140   EPFKAAMQKFVSKIVEMMKWEKLYHTQGGPIILSQIENEYGPVEWQIGAPGKSYTKWAAQ  199

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGLKTGVPW+MCKQEDAPDP+IDTCNG+YCENF PN+ YKPK++TE W+GWYT FG P
Sbjct  200   MAVGLKTGVPWVMCKQEDAPDPLIDTCNGFYCENFKPNQIYKPKIWTENWSGWYTAFGAP  259

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
                RPAED+AFSVARFIQNNGS VNYYMYHGGTNFGRT + LFIA SYD+DAP+DEYGL+
Sbjct  260   TPYRPAEDVAFSVARFIQNNGSLVNYYMYHGGTNFGRT-SGLFIANSYDFDAPIDEYGLI  318

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHLRDLH+AIK  EPALVS+ P  TW GKNQE  VF+S +GAC AFL+NYD   S
Sbjct  319   REPKWGHLRDLHKAIKSCEPALVSADPTSTWPGKNQEARVFKSRSGACAAFLANYDTSAS  378

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
               V F N  YDLPPWSISILPDCK V +NTA +   S Q KM  + + F W SY EE AS
Sbjct  379   VTVNFWNHPYDLPPWSISILPDCKTVAFNTAKIGVKSSQEKMTSI-SSFGWLSYKEEPAS  437

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +   DT    G+ EQ++VT D++DYLWYMT++ I P E FL++ K P++T+ SAGH +HV
Sbjct  438   AYATDTTTKAGLVEQVSVTWDTTDYLWYMTDITIDPTEGFLKSRKWPLLTINSAGHVLHV  497

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYG L  P +T++  V L  G+NK+S+LS  VGLPNVGLHF+ WNAGVLGP
Sbjct  498   FINGQLSGTVYGSLKDPAVTFSKYVNLEKGVNKLSMLSATVGLPNVGLHFDTWNAGVLGP  557

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRD++   W YKV
Sbjct  558   VTLKGLNEGTRDMSKYKWSYKV  579


 Score =   128 bits (322),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = +2

Query  2123  SRIAPRFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDP  2302
             +R   ++    ++G++GE+L+L +  GS+SVEW  G L+   QPLTWYK TF+ P G +P
Sbjct  567   TRDMSKYKWSYKVGLRGEALNLYSDKGSNSVEWTKGSLV-QKQPLTWYKTTFNTPAGKEP  625

Query  2303  LALDMSSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             LALDMSSM KG++WVNG+ +GR++PGY A G C ++C+Y GT+   KC  NCG PSQ
Sbjct  626   LALDMSSMSKGQMWVNGQSIGRYFPGYIASGKC-NKCSYTGTFTDDKCLWNCGGPSQ  681



>ref|NP_001289260.1| beta-galactosidase precursor [Pyrus x bretschneideri]
 dbj|BAD91081.1| beta-D-galactosidase [Pyrus pyrifolia]
 gb|AGR44463.1| beta-D-galactosidase 4 [Pyrus x bretschneideri]
Length=725

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/561 (72%), Positives = 472/561 (84%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV YD ++ IING+RRILISGSIHYPRSTP MWP L+QKAK GGLDVIQTYVFWNGHEPS
Sbjct  25    SVGYDHKAIIINGQRRILISGSIHYPRSTPGMWPDLIQKAKAGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLVKFIKL Q+AGL+V+LRIGPY+C EWNFGGFPIWLKYVPGI FRTDN+
Sbjct  85    PGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPIWLKYVPGIAFRTDNE  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIVNMMK+EKLF++QGGPII+SQIENE+GPVEWEIGAPGKAYTKWA QM
Sbjct  145   PFKAAMQKFTEKIVNMMKAEKLFQTQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAAQM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDP+IDTCNGYYCENF PNK YKPKM+TE+WTGWYT+FGG +
Sbjct  205   AVGLDTGVPWIMCKQEDAPDPVIDTCNGYYCENFKPNKVYKPKMWTEVWTGWYTEFGGAI  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ+ GSF NYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL+ 
Sbjct  265   PTRPAEDLAFSVARFIQSGGSFFNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLLQ  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHLRDLH+AIK  E ALV+  P VT  G NQE HVF S++G C AFL+N+D ++S 
Sbjct  325   QPKWGHLRDLHKAIKSCEHALVAVDPSVTKLGNNQEAHVFNSKSG-CAAFLANHDTKYSV  383

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             +V+F + QYDLPPWSISILPDCK  V+NTA V   + + +M PV +   WQS+ EE  +S
Sbjct  384   RVSFGHGQYDLPPWSISILPDCKTAVFNTAKVAWKASEVQMKPVYSRLPWQSFIEETTTS  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             D+  T   DG++EQI +TRD++DYLWYMT++ I  DE FL+NGK P++T+ SAGHA+HVF
Sbjct  444   DETGTTTLDGLYEQIYMTRDATDYLWYMTDITIGSDEAFLKNGKFPLLTIFSAGHALHVF  503

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGTVYG L  PKLT++ +VKLR GINK++LLS++VGLPNVG HFE WN GVLGP+
Sbjct  504   INGQLSGTVYGSLENPKLTFSQNVKLRPGINKLALLSISVGLPNVGTHFETWNTGVLGPI  563

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SL GLN GT D++   W YK+
Sbjct  564   SLKGLNTGTWDMSRWKWTYKI  584


 Score =   166 bits (420),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +2

Query  2138  RFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDM  2317
             R+    ++GMKGESL L+TVTGSSSV+W +GP +A  QPLTWYKATFDAP G+ PLALDM
Sbjct  577   RWKWTYKIGMKGESLGLHTVTGSSSVDWAEGPSMAQKQPLTWYKATFDAPPGHAPLALDM  636

Query  2318  SSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              SMGKG+IW+NG+ VGRHWPGY AQGSC + C YAGT+N KKC+  CG+PSQ
Sbjct  637   GSMGKGQIWINGQSVGRHWPGYIAQGSCGN-CYYAGTFNDKKCRTYCGKPSQ  687



>gb|ACP18875.1| beta-galactosidase pBG(a) [Carica papaya]
Length=836

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/563 (71%), Positives = 468/563 (83%), Gaps = 2/563 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  INGKRRIL+SGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  20    SVSYDHKAITINGKRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  79

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY F G YDLV+FIKL ++AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRT+N 
Sbjct  80    PGKYYFGGNYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIAFRTNNG  139

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIV+MMK+E LFESQGGPII+SQIENEYGP+E+E+GA G+AY++WA QM
Sbjct  140   PFKAYMQRFTKKIVDMMKAEGLFESQGGPIILSQIENEYGPMEYELGAAGRAYSQWAAQM  199

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII++CNG+YC+ F PNK YKPKM+TE WTGW+T+FGG V
Sbjct  200   AVGLGTGVPWVMCKQDDAPDPIINSCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGAV  259

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGLV 
Sbjct  260   PYRPVEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLVR  319

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P V   G+ QE HVF+S+ G C AFL+NY+P+  A
Sbjct  320   QPKWGHLKDLHRAIKLCEPALVSGDPSVMPLGRFQEAHVFKSKYGHCAAFLANYNPRSFA  379

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPV--GNGFSWQSYTEEIA  1653
             KV F N+ Y+LPPWSISILPDCKN VYNTA V + S + KM+PV     FSWQ+Y EE  
Sbjct  380   KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMVPVPIHGAFSWQAYNEEAP  439

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS+   +    G+ EQIN TRD SDYLWY T+V I PDE FL+ GK P +TV+SAGHA+H
Sbjct  440   SSNGERSFTTVGLVEQINTTRDVSDYLWYSTDVKIDPDEGFLKTGKYPTLTVLSAGHALH  499

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGT YG L FPK+T++  V LRAGINKIS+LS+AVGLPNVG HFE WNAGVLG
Sbjct  500   VFVNDQLSGTAYGSLEFPKITFSKGVNLRAGINKISILSIAVGLPNVGPHFETWNAGVLG  559

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L+GLNEG RDL+ Q W YKV
Sbjct  560   PVTLNGLNEGRRDLSWQKWSYKV  582


 Score =   134 bits (336),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE++SL++++GSSSVEW  G  +A  QPLTW+K TF+AP GN PLALDM+SMGKG
Sbjct  581   KVGVEGEAMSLHSLSGSSSVEWTAGSFVARRQPLTWFKTTFNAPAGNSPLALDMNSMGKG  640

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A GSC   C+YAGT+N+KKC  NCG+ SQ
Sbjct  641   QIWINGKSIGRHWPAYKASGSC-GWCDYAGTFNEKKCLSNCGEASQ  685



>ref|XP_010534899.1| PREDICTED: beta-galactosidase 1 [Tarenaya hassleriana]
Length=847

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/560 (71%), Positives = 472/560 (84%), Gaps = 3/560 (1%)
 Frame = +1

Query  409   YDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGK  588
             YD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEP+PGK
Sbjct  36    YDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPAPGK  95

Query  589   YNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFK  768
             Y FEG YDLV+FIKL ++AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN PFK
Sbjct  96    YYFEGNYDLVRFIKLVKEAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDNGPFK  155

Query  769   VAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVG  948
               MQ F  KIVNMMKSE+LFESQGGPII+SQIENEYGP+E+E+GAPGKAYT WA +MAVG
Sbjct  156   AQMQRFTTKIVNMMKSERLFESQGGPIILSQIENEYGPMEYELGAPGKAYTNWAAKMAVG  215

Query  949   LKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHRR  1128
             L TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGGPV  R
Sbjct  216   LGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKGYKPKMWTEAWTGWFTKFGGPVPYR  275

Query  1129  PAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEPK  1308
             PAED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  +PK
Sbjct  276   PAEDMAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  335

Query  1309  YGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKVT  1488
             +GHL+DLHRAIKL EPALVS  P     G+ QE HVF+S++GAC AFL+NY+P+  A V+
Sbjct  336   WGHLKDLHRAIKLCEPALVSGDPTRVPLGRFQEAHVFKSKSGACAAFLANYNPRSYATVS  395

Query  1489  FSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIASSD  1662
             F    Y++PPWSISILPDC N VYNTA V + + + KM  +PV  G SWQ+Y E+ ++ D
Sbjct  396   FGKNHYNIPPWSISILPDCMNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDPSAYD  455

Query  1663  DGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFI  1842
             D ++ +  G+ EQIN TRD+SDYLWYMT+V I  +E FL+ GK P +TV+SAGHA+HVF+
Sbjct  456   D-ESFSMVGLLEQINTTRDASDYLWYMTDVKIDANEGFLKTGKYPTLTVLSAGHALHVFV  514

Query  1843  NSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVS  2022
             N +LSGT YG L FPKL+++ +V LRAGIN+I+LLS+AVGLPNVG HFE+WNAGVLGPVS
Sbjct  515   NGQLSGTAYGSLDFPKLSFSKAVNLRAGINRIALLSIAVGLPNVGPHFERWNAGVLGPVS  574

Query  2023  LSGLNEGTRDLTNQTWFYKV  2082
             L+GLNEG RDL+ Q W YKV
Sbjct  575   LNGLNEGRRDLSWQKWTYKV  594


 Score =   146 bits (368),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++G++SVEW  G  +A  QPLTW+K TF AP GN PLALDM SMGKG
Sbjct  593   KVGLKGEALSLHSLSGTTSVEWAAGAFVARKQPLTWFKTTFSAPAGNSPLALDMESMGKG  652

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A GSC SEC+YAG++N+ KC  NCG+ SQ
Sbjct  653   QIWINGQSLGRYWPAYKASGSC-SECSYAGSFNENKCLRNCGEASQ  697



>ref|XP_004287559.1| PREDICTED: beta-galactosidase-like [Fragaria vesca subsp. vesca]
Length=722

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/563 (71%), Positives = 472/563 (84%), Gaps = 5/563 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SV YD R+ I+NGKRRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  25    ASVGYDHRAIIVNGKRRILISGSIHYPRSTPEMWPDLLQKAKDGGLDVIQTYVFWNGHEP  84

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FE RYDLVKFIKLAQ+ GL+VHLRIGPYIC EWNFGGFP+WLKYVPGI FRTDN
Sbjct  85    SPGKYYFEDRYDLVKFIKLAQQHGLFVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDN  144

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PF  AM+ F  KIV MMK+E+LF++QGGPII+SQIENEYGPVEWEIGAPG++YT+WA +
Sbjct  145   RPFMAAMEKFTQKIVYMMKAERLFQTQGGPIILSQIENEYGPVEWEIGAPGRSYTQWAAK  204

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQEDAPDPIIDTCNG+YCENF PNK YKPKM+TE+WTGWYT+FGG 
Sbjct  205   MAVGLNTGVPWVMCKQEDAPDPIIDTCNGFYCENFTPNKNYKPKMWTEIWTGWYTEFGGA  264

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPA+D+AFSVARFIQN GSF NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  265   VPTRPAQDLAFSVARFIQNGGSFANYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLP  324

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPKY HL+ +H+AIK+AEPAL+++   V+  G NQE HV++S +G C AFL+NYD ++ 
Sbjct  325   REPKYSHLKYMHKAIKMAEPALLATDAAVSKLGNNQEAHVYQSRSG-CAAFLANYDTKYP  383

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATV-RSPSLQTKMIPVGNGFSWQSYTEEIA  1653
              +VTF N QY+LPPWSISILPDCK  V+NTA V +SP   TKM PV +  SWQ+Y E++A
Sbjct  384   VRVTFWNKQYNLPPWSISILPDCKTEVFNTARVGQSPP--TKMTPVAH-LSWQAYIEDVA  440

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             +S D +   + G+ EQ++VT D++DYLWYMT++ I P+E+FLR GK P + V SAGHA+H
Sbjct  441   TSADDNAFTSVGLREQLSVTWDNTDYLWYMTDITIGPNEQFLRTGKYPTLKVDSAGHALH  500

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSG+ YG LA PKL +   VKLRAGINK++LLSV+VGL NVGLHFE WN GVLG
Sbjct  501   VFINGQLSGSAYGTLASPKLEFNQGVKLRAGINKLALLSVSVGLANVGLHFETWNTGVLG  560

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L+G+N GT D++   W YKV
Sbjct  561   PVTLAGVNSGTWDMSRWQWTYKV  583


 Score =   154 bits (388),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = +2

Query  2138  RFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDM  2317
             R+    ++GM+GE +SL+TV+GSSSVEW  G LLA  +PLTWYKA  +AP GN PLALDM
Sbjct  576   RWQWTYKVGMRGEDMSLHTVSGSSSVEWVQGSLLAQYRPLTWYKAILNAPPGNAPLALDM  635

Query  2318  SSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              SMGKG++W+NG+ +GRHWP Y A GSC + C YAGTY + KC+ NCGQPSQ
Sbjct  636   GSMGKGQMWINGQSIGRHWPAYKAHGSCGA-CYYAGTYTENKCRTNCGQPSQ  686



>ref|XP_006426534.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39774.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=846

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/566 (71%), Positives = 471/566 (83%), Gaps = 5/566 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
              GSVSYD ++  INGKRRILISGSIHYPRS+P+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  30    EGSVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  89

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY FEG YDLVKFIKL ++AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRT+
Sbjct  90    PSPGKYYFEGNYDLVKFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTN  149

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  M  F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG++YT+WA 
Sbjct  150   NGPFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAA  209

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WTGWYT+FGG
Sbjct  210   KMAVGLDTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  269

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RP ED+AFSVA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  270   PVPHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P V   G  QE HVF+S++ AC AFL+NY+ + 
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRT  388

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              AKV F N  Y+LPPWSISILPDCKN VYNTA V   S Q KM  +P+  GFSWQ++  E
Sbjct  389   FAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFN-E  447

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             + S+    +    G+ EQIN TRD++DYLWYMT+V I P E FLR+G  PV+TVMSAGHA
Sbjct  448   VPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHA  507

Query  1828  MHVFINSEL-SGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAG  2004
             +HVF+N +L +GT YG L FPKLT+T  V +RAGINKI+LLS+AVGLPNVG HFE WNAG
Sbjct  508   LHVFVNGQLAAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAG  567

Query  2005  VLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             VLGPV+L+GLNEG RDL+ Q W YKV
Sbjct  568   VLGPVTLNGLNEGRRDLSWQKWTYKV  593


 Score =   144 bits (363),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE L+L++++G SSVEW +G L+A  QPLTWY+ TF AP GN PLALDM SMGKG
Sbjct  592   KVGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++WVNG+ +GRHWP Y A GSC   C+Y GTY +KKC  NCG+ SQ
Sbjct  652   QVWVNGQSIGRHWPAYKASGSCGY-CSYTGTYTEKKCLSNCGEASQ  696



>ref|XP_011077977.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=726

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/564 (70%), Positives = 475/564 (84%), Gaps = 2/564 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             R +V+YD +SF+ING R+IL+SGSIHYPRSTP+MWP L+QKAK+GGLD+++TYVFWNGHE
Sbjct  23    RATVTYDEKSFMINGVRKILVSGSIHYPRSTPEMWPQLIQKAKEGGLDIVETYVFWNGHE  82

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGK+N+EGR+DLVKFIKL Q+AGLYVHLRIGPY+C EWN+GG P+WLKYVPG+EFRTD
Sbjct  83    PSPGKFNYEGRFDLVKFIKLVQQAGLYVHLRIGPYVCAEWNYGGLPVWLKYVPGMEFRTD  142

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             NQPF++AM+GFV  IV MMKSEKLFE QGGPIIM+QIENEYGPVEWEIGAPG AYT W  
Sbjct  143   NQPFELAMKGFVESIVYMMKSEKLFEPQGGPIIMAQIENEYGPVEWEIGAPGVAYTAWFT  202

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAV L  GVPWIMCKQE AP P+ID CNG+YC+ F P+KP +PKM+TE+W+GWYT FGG
Sbjct  203   KMAVALDIGVPWIMCKQETAPAPMIDACNGFYCDGFKPSKPNEPKMWTEVWSGWYTPFGG  262

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             P+  RP ED+AFS+A+F+Q+NG+F NYYMYHGGTNFGR+ + LF+ TSYD+DAPLDEYGL
Sbjct  263   PLPYRPVEDLAFSIAKFVQSNGTFFNYYMYHGGTNFGRS-SGLFVTTSYDFDAPLDEYGL  321

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
              NEPK+GHL DLH AIK +E AL+SSYP +TW G NQEV VF+S++GAC AFL+NYD   
Sbjct  322   PNEPKWGHLTDLHSAIKKSEEALLSSYPTITWPGNNQEVRVFKSDSGACAAFLANYDTAD  381

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATV-RSPSLQTKMIPVGNGFSWQSYTEEI  1650
               K+TF N  YDLPPWSISILPDCK  VYNTA + R      KM P  + FSWQSY + I
Sbjct  382   WTKLTFQNFPYDLPPWSISILPDCKTEVYNTAKIKRKIGPTRKMRPAISTFSWQSYNDHI  441

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
              S+ D DT    G+WEQ+NVTRD SDYLWY+TEV+I P+E FL++GK P +TVMSAGHA+
Sbjct  442   PSAGDQDTYPMQGLWEQVNVTRDYSDYLWYLTEVDIDPNEGFLKSGKWPQLTVMSAGHAL  501

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             +V++N +LSG VYG L  P+LT+T++V L+AGINKI+LLSV+VGL NVG+H+EKWN GVL
Sbjct  502   NVYVNGQLSGNVYGTLEKPQLTFTSNVNLKAGINKIALLSVSVGLANVGVHYEKWNVGVL  561

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GP++L GLNEGTRDLT Q+W +KV
Sbjct  562   GPITLDGLNEGTRDLTKQSWSFKV  585


 Score =   145 bits (367),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE L L+T  GSS+ +W  G  ++  QPLTWYK TFDAP+GNDPL LDM SMGKG
Sbjct  584   KVGLIGERLKLDTTAGSSAAQWAQGSQVSLKQPLTWYKTTFDAPDGNDPLGLDMYSMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             E+W+N +G+GRHWPG TA+G+CS+ CNYAG + +KKC  NCG+PSQ
Sbjct  644   EMWINDQGIGRHWPGNTAKGNCSN-CNYAGIFAEKKCLGNCGEPSQ  688



>ref|XP_010911412.1| PREDICTED: beta-galactosidase-like, partial [Elaeis guineensis]
Length=585

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/548 (73%), Positives = 461/548 (84%), Gaps = 2/548 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +VSYD ++ IING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  39    TVSYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  98

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y F GRYDLV+FIKL ++AGLYVHLRIGPY+C EWNFGGFPIWLKYVPGI FRTDN 
Sbjct  99    PGQYYFGGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGISFRTDNG  158

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM+ F  KIV+MMK+E LFE QGGPII+SQIENE+GP+E+  GAP K+YT WA QM
Sbjct  159   PFKAAMEKFTEKIVSMMKAEGLFEWQGGPIILSQIENEFGPLEYYGGAPAKSYTNWAAQM  218

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGLKTGVPW+MCKQ+DAPDP+I+TCNG+YC++F PNKPYKP ++TE WTGW+T FGGPV
Sbjct  219   AVGLKTGVPWVMCKQDDAPDPVINTCNGFYCDDFSPNKPYKPMIWTEAWTGWFTAFGGPV  278

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
              RRP ED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL+ 
Sbjct  279   PRRPVEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLLR  338

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIKL EPALVS  P VT  G NQEVHVFRS++GAC AFL+NY+P    
Sbjct  339   EPKWGHLRDLHKAIKLCEPALVSGDPTVTSLGSNQEVHVFRSKSGACAAFLANYNPSSYG  398

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             ++TF+ + YDLPPWSISILPDCK  V+NTA V + S Q KM  V  GFSW+SY E+I +S
Sbjct  399   RITFNGMHYDLPPWSISILPDCKTTVFNTARVGAQSSQMKMELVA-GFSWESYNEDI-NS  456

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
              D D    DG+ EQI++T D SDYLWY T VNI  DE+FL+NG  PV++V+SAGH MHVF
Sbjct  457   LDSDAFTKDGLLEQISMTWDRSDYLWYTTYVNIGQDEQFLKNGNYPVLSVLSAGHGMHVF  516

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N   +G VYGGL  PKLTY+ +VKL AG NKIS+LSVAVGLPNVG HFE WNAGVLGPV
Sbjct  517   VNGRPAGNVYGGLDSPKLTYSRNVKLWAGSNKISILSVAVGLPNVGDHFETWNAGVLGPV  576

Query  2020  SLSGLNEG  2043
             +L GLNEG
Sbjct  577   TLDGLNEG  584



>ref|XP_003531618.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
 gb|KHN11289.1| Beta-galactosidase 1 [Glycine soja]
Length=843

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/563 (72%), Positives = 473/563 (84%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  29    SVSYDHKAIIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  88

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY F G YDLV+FIKL Q+AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRTDN 
Sbjct  89    PGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDNG  148

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  M+ F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG++YT+WA  M
Sbjct  149   PFKFQMEKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTQWAAHM  208

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG V
Sbjct  209   AVGLGTGVPWIMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGAV  268

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFS+ARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  
Sbjct  269   PHRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLAR  328

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS    V   G  +E HVFRS++GAC AFL+NY+PQ  A
Sbjct  329   QPKWGHLKDLHRAIKLCEPALVSGDSTVQRLGNYEEAHVFRSKSGACAAFLANYNPQSYA  388

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
              V F N  Y+LPPWSISILP+CK+ VYNTA V S S   KM  +P+  G SW+++ EE  
Sbjct  389   TVAFGNQHYNLPPWSISILPNCKHTVYNTARVGSQSTTMKMTRVPIHGGLSWKAFNEETT  448

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD  +    G+ EQIN TRD SDYLWY T+V I  +E FLRNGK+PV+TV+SAGHA+H
Sbjct  449   TTDD-SSFTVTGLLEQINATRDLSDYLWYSTDVVINSNEGFLRNGKNPVLTVLSAGHALH  507

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN++LSGT YG L  PKLT++ SV+LRAG+NKISLLSVAVGLPNVG HFE+WNAGVLG
Sbjct  508   VFINNQLSGTAYGSLEAPKLTFSESVRLRAGVNKISLLSVAVGLPNVGPHFERWNAGVLG  567

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             P++LSGLNEG RDLT Q W YKV
Sbjct  568   PITLSGLNEGRRDLTWQKWSYKV  590


 Score =   147 bits (371),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW  G L++  QPLTWYK TFDAP G  PLALDM SMGKG
Sbjct  589   KVGLKGEALNLHSLSGSSSVEWLQGFLVSRRQPLTWYKTTFDAPAGVAPLALDMGSMGKG  648

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A GSC   CNYAGTYN+KKC  NCG+ SQ
Sbjct  649   QVWINGQSLGRYWPAYKASGSC-GYCNYAGTYNEKKCGSNCGEASQ  693



>ref|NP_187988.1| beta galactosidase 1 [Arabidopsis thaliana]
 sp|Q9SCW1.1|BGAL1_ARATH RecName: Full=Beta-galactosidase 1; Short=Lactase 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64737.1| putative beta-galactosidase [Arabidopsis thaliana]
 dbj|BAB01923.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AEE75407.1| beta galactosidase 1 [Arabidopsis thaliana]
Length=847

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/564 (71%), Positives = 469/564 (83%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSVSYD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEP
Sbjct  32    GSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  91

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FEG YDLVKF+KL Q++GLY+HLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  92    SPGKYYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  151

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +
Sbjct  152   GPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAK  211

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  212   MAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGP  271

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  272   VPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLE  331

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P     G  QE HV++S++GAC AFL+NY+P+  
Sbjct  332   RQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLANYNPKSY  391

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             AKV+F N  Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ 
Sbjct  392   AKVSFGNNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDP  451

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             ++  D ++    G+ EQIN TRD+SDYLWYMT+V +  +E FLRNG  P +TV+SAGHAM
Sbjct  452   STYID-ESFTMVGLVEQINTTRDTSDYLWYMTDVKVDANEGFLRNGDLPTLTVLSAGHAM  510

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVFIN +LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVL
Sbjct  511   HVFINGQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  570

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPVSL+GLN G RDL+ Q W YKV
Sbjct  571   GPVSLNGLNGGRRDLSWQKWTYKV  594


 Score =   130 bits (328),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  593   KVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  652

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A GSC SEC+Y GT+ + KC  NCG+ SQ
Sbjct  653   QIWINGQSLGRHWPAYKAVGSC-SECSYTGTFREDKCLRNCGEASQ  697



>gb|KHN39301.1| Beta-galactosidase 1 [Glycine soja]
Length=838

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/563 (72%), Positives = 473/563 (84%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+RRIL+SGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  24    SVSYDHKAITINGQRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  83

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY F G YDLV+FIKL Q+AGLYV+LRIGPY+C EWNFGGFP+WLKY+ GI FRTDN 
Sbjct  84    PGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYILGISFRTDNG  143

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  M+ F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+EIGAPG+AYT+WA  M
Sbjct  144   PFKFQMEKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRAYTQWAAHM  203

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQEDAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG V
Sbjct  204   AVGLGTGVPWIMCKQEDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGAV  263

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFS+ARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  
Sbjct  264   PHRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLPR  323

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P V   G  +E HVFRS++GAC AFL+NY+PQ  A
Sbjct  324   QPKWGHLKDLHRAIKLCEPALVSGDPTVQQLGNYEEAHVFRSKSGACAAFLANYNPQSYA  383

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
              V F N +Y+LPPWSISILP+CK+ VYNTA V S S   KM  +P+  G SW+++ EE  
Sbjct  384   TVAFGNQRYNLPPWSISILPNCKHTVYNTARVGSQSTTMKMTRVPIHGGLSWKAFNEETT  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD  +    G+ EQIN TRD SDYLWY T+V I  +E FLRNGK+PV+TV+SAGHA+H
Sbjct  444   TTDD-SSFTVTGLLEQINATRDLSDYLWYSTDVVINSNEGFLRNGKNPVLTVLSAGHALH  502

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN++LSGT YG L  PKLT++ SV+LRAG+NKISLLSVAVGLPNVG HFE+WNAGVLG
Sbjct  503   VFINNQLSGTAYGSLEAPKLTFSESVRLRAGVNKISLLSVAVGLPNVGPHFERWNAGVLG  562

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             P++LSGLNEG RDLT Q W YKV
Sbjct  563   PITLSGLNEGRRDLTWQKWSYKV  585


 Score =   148 bits (373),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW  G L++  QPLTWYK TFDAP G  PLALDM SMGKG
Sbjct  584   KVGLKGEALNLHSLSGSSSVEWLQGFLVSRRQPLTWYKTTFDAPAGVAPLALDMGSMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A GSC   CNYAGTYN+KKC  NCGQ SQ
Sbjct  644   QVWINGQSLGRYWPAYKASGSCGY-CNYAGTYNEKKCGSNCGQASQ  688



>ref|XP_007135555.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
 gb|ESW07549.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
Length=844

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/563 (71%), Positives = 473/563 (84%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++  ING+R+IL+SGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEPS
Sbjct  30    SVSYDHKAITINGQRKILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPS  89

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY F G YDLV+FIKL Q+AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRTDN 
Sbjct  90    RGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTDNG  149

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  M+ F  KIV+MMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG+AYT+WA  M
Sbjct  150   PFKFEMEKFTKKIVDMMKAERLFESQGGPIIISQIENEYGPLEYEVGAPGRAYTQWAAHM  209

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWIMCKQ+DAPDPI++TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG V
Sbjct  210   AVGLGTGVPWIMCKQDDAPDPIVNTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGAV  269

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFS+ARFIQ  GS+VNYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  
Sbjct  270   PHRPAEDLAFSIARFIQKGGSYVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLAR  329

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPAL+S  P V   G  +E HVFRS++GAC AFL+NY+PQ  A
Sbjct  330   QPKWGHLKDLHRAIKLCEPALISGDPTVQRLGNYEEAHVFRSKSGACAAFLANYNPQSYA  389

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
              V F N  Y+LPPWSISILP+CK+ VYNTA V S S   KM  +P+  G SW+++ EE  
Sbjct  390   TVAFGNQHYNLPPWSISILPNCKHTVYNTARVGSQSTTMKMSRVPIHGGLSWKAFNEETT  449

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++DD  +    G+ EQIN TRD SDYLWY T+V I P+EEFLRNGK+P +TV+SAGHA+H
Sbjct  450   TTDD-SSFTVSGLLEQINATRDLSDYLWYSTDVVINPNEEFLRNGKNPFLTVLSAGHALH  508

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN++LSGT YG L  PKLT++ SV+LRAG+NKISLLSVAVGLPNVG HFE+WNAGVLG
Sbjct  509   VFINNQLSGTAYGSLESPKLTFSESVRLRAGVNKISLLSVAVGLPNVGPHFERWNAGVLG  568

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             P++LSGLNEG RDLT Q W YKV
Sbjct  569   PITLSGLNEGRRDLTWQKWSYKV  591


 Score =   148 bits (374),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW  G L++  QPLTWYK TFDAP G  PLALDM+SMGKG
Sbjct  590   KVGLKGEALNLHSLSGSSSVEWLQGYLVSKRQPLTWYKTTFDAPVGVAPLALDMASMGKG  649

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WP Y A GSC   CNYAGTYN+KKC  NCG+ SQ
Sbjct  650   QVWINGQSLGRYWPAYKASGSCGY-CNYAGTYNEKKCASNCGEASQ  694



>ref|XP_010542431.1| PREDICTED: beta-galactosidase 1-like [Tarenaya hassleriana]
Length=847

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/560 (71%), Positives = 469/560 (84%), Gaps = 3/560 (1%)
 Frame = +1

Query  409   YDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGK  588
             YD R+  ING+RRILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEP+PGK
Sbjct  36    YDSRAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPAPGK  95

Query  589   YNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFK  768
             Y FEG YDLV+FIKL ++AGLY+HLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN PFK
Sbjct  96    YYFEGNYDLVRFIKLVKQAGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDNGPFK  155

Query  769   VAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVG  948
               MQ F  KIVNMMKSE LFESQGGPII+SQIENEYGP+E+E+G PG+AYT WA +MAVG
Sbjct  156   AQMQRFTTKIVNMMKSEGLFESQGGPIILSQIENEYGPMEYELGEPGRAYTNWAAKMAVG  215

Query  949   LKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHRR  1128
             L TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGGPV  R
Sbjct  216   LGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYR  275

Query  1129  PAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEPK  1308
             PAED+AF++ARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  +PK
Sbjct  276   PAEDMAFAIARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  335

Query  1309  YGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKVT  1488
             +GHL+DLHRAIKL EPALVS+ P     G+ QE HVF S++GAC AFL+NY+ +  A V+
Sbjct  336   WGHLKDLHRAIKLCEPALVSADPTRIPLGRYQEAHVFNSKSGACAAFLANYNTKSYATVS  395

Query  1489  FSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIASSD  1662
             F N  Y+LPPWSISILPDCKN VYNTA V +   + KM  +PV  G SWQ+Y E+ +S D
Sbjct  396   FGNNHYNLPPWSISILPDCKNTVYNTARVGAQISRMKMVQVPVNGGLSWQAYNEDPSSYD  455

Query  1663  DGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFI  1842
             + ++ +  G+ EQIN TRD+SDYLWYMT+V I  +E FL+ GK P +TV+SAGHA+HVF+
Sbjct  456   E-ESFSMVGLLEQINTTRDASDYLWYMTDVKIDANEGFLKTGKYPTLTVLSAGHALHVFV  514

Query  1843  NSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVS  2022
             N +LSGT YG L FPKLT++ SV LRAGINKI+ LS+AVGLPNVG HFE+WNAGVLGPVS
Sbjct  515   NGQLSGTAYGSLDFPKLTFSESVNLRAGINKIAFLSIAVGLPNVGPHFERWNAGVLGPVS  574

Query  2023  LSGLNEGTRDLTNQTWFYKV  2082
             L+GLNEG RDL+ Q W YKV
Sbjct  575   LNGLNEGRRDLSWQKWTYKV  594


 Score =   141 bits (356),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++G++SVEW  G  +A  QPLTW+K TF  P GN PLA+DM SMGKG
Sbjct  593   KVGLKGEALSLHSLSGTTSVEWAAGAFVAQKQPLTWFKTTFSGPTGNSPLAIDMGSMGKG  652

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A GSC SEC+YAG++++ KC  NCG+ SQ
Sbjct  653   QIWINGQSLGRYWPAYKASGSC-SECSYAGSFDENKCLRNCGEASQ  697



>ref|XP_010545348.1| PREDICTED: beta-galactosidase 12-like isoform X1 [Tarenaya hassleriana]
Length=726

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/563 (70%), Positives = 462/563 (82%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +G+VSYD ++ IING+RRIL+SGSIHYPRSTP+MW  L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  25    KGAVSYDHKAVIINGQRRILLSGSIHYPRSTPEMWSDLIQKAKDGGLDVIQTYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG Y FE RYDLV+FI++ QKAGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRT+
Sbjct  85    PSPGNYYFEDRYDLVRFIRVVQKAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTN  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK AMQ F  KIV MMK+EKLFE+QGGPII+SQIENEYGPVEWEIGAPGKAYTKWA 
Sbjct  145   NGPFKAAMQKFTQKIVGMMKAEKLFETQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MAVGL TGVPWIMCKQEDAP PIIDTCNG+YCENF PN   KPKM+TE WTGW+T+FG 
Sbjct  205   EMAVGLSTGVPWIMCKQEDAPGPIIDTCNGFYCENFKPNSDNKPKMWTENWTGWFTEFGA  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP EDIAFSVARFIQN GSFVNYYMYHGGTNF RTA   F+ATSYDYDAPLDEYGL
Sbjct  265   AVPYRPVEDIAFSVARFIQNGGSFVNYYMYHGGTNFDRTAGE-FVATSYDYDAPLDEYGL  323

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPK+ HLR+LH+ IKL EPALVS  P VTW G  QE HVF+S++ +C AFLSNYDP  
Sbjct  324   PREPKWSHLRELHKVIKLCEPALVSVDPTVTWLGAKQEAHVFKSKS-SCAAFLSNYDPDS  382

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             + +VTF  L YDLPPWS+SILPDCK V +NTA V +  +   MIP G  FSW+SY EE  
Sbjct  383   AVRVTFWGLPYDLPPWSVSILPDCKTVYHNTAKVYAKGVHMNMIPTGVHFSWESYNEETL  442

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S +D  T   +G+ EQI++TRD +DYLWY T++ I  DE+FL+ G +P++T+ SAGHA+H
Sbjct  443   SGNDDGTFTLNGLVEQISMTRDKTDYLWYFTDITIGHDEKFLKTGDNPLLTIWSAGHALH  502

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GTVYG L  PKLT++  +KL AG+NK++LLSVAVGL NVG+HFE WN GVLG
Sbjct  503   VFVNGQLAGTVYGSLDNPKLTFSQKIKLYAGVNKLALLSVAVGLANVGVHFETWNVGVLG  562

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSL G+N GT D++   W YK+
Sbjct  563   PVSLKGMNSGTWDMSKWKWSYKI  585


 Score =   153 bits (386),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TVTG SS++W  G L+A  QPLTWYKATF+ P GN+PLALDM++MGKG
Sbjct  584   KIGLKGEALSLHTVTGDSSLKWVAGSLVAKKQPLTWYKATFNTPAGNEPLALDMNTMGKG  643

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG  +GRHWPGYTA+G+C   C+Y GT+ +KKC  NCG+ SQ
Sbjct  644   QIWINGRNIGRHWPGYTARGNC-GRCSYTGTFTEKKCLSNCGEASQ  688



>gb|AGW47883.1| beta-galactosidase precursor [Nicotiana tabacum]
Length=841

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/562 (71%), Positives = 466/562 (83%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ I+NG+R+ILISGSIHYPRS P+MWP L+QKAK+GG+DVIQTYVFWNGHE 
Sbjct  28    ASVSYDHKAIIVNGQRKILISGSIHYPRSIPEMWPDLIQKAKEGGVDVIQTYVFWNGHES  87

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FEGRYDLVKFIK+ Q+AGLYVHLRIGPY C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  88    EEGKYYFEGRYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFRTDN  147

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV+MMKSE+L++SQGGPII+SQIENEYGP+EWE+G PGKAY++WA +
Sbjct  148   EPFKAAMQKFTTKIVDMMKSERLYQSQGGPIILSQIENEYGPMEWELGEPGKAYSEWAAK  207

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAV L TGVPWIMCKQ+D PDPII+TCNG+YC+ F PNK  KPKM+TE WT W+T+FGGP
Sbjct  208   MAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFLPNKANKPKMWTEAWTAWFTEFGGP  267

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL+
Sbjct  268   VPYRPAEDMAFAVARFIQTGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLL  327

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS+ PIVT  G  QE  VF+SE+GAC AFL+NY+    
Sbjct  328   RQPKWGHLKDLHRAIKLCEPALVSADPIVTPLGNYQEARVFKSESGACAAFLANYNQHSF  387

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             AKV F N+ Y+LPPWSISILPDCKN V+NTA + + S Q KM  V  GFSW S+ EE AS
Sbjct  388   AKVAFGNMHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTSVSRGFSWDSFNEETAS  447

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +D  +    G+ EQIN TRD SDYLWY T+V I   E FLR+GK P +T+MSAGHA+HV
Sbjct  448   YED-SSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREGFLRSGKWPWLTIMSAGHALHV  506

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GT YG L  PKLT++ +V LRAG+NKISLLS+AVGLPN+G HFE WNAGVLGP
Sbjct  507   FVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNAGVLGP  566

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSLSGLNEG RDLT Q W YKV
Sbjct  567   VSLSGLNEGKRDLTWQKWSYKV  588


 Score =   134 bits (336),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW +G  +A  QPLTWYK TF+AP GNDPLALD+++MGKG
Sbjct  587   KVGLKGEALSLHSLSGSSSVEWVEGSFVAQRQPLTWYKTTFNAPAGNDPLALDLNTMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY A G+C + CNYAG +++KKC  NCG+ SQ
Sbjct  647   QVWINGQSIGRYWPGYKASGNCGA-CNYAGWFDEKKCLSNCGEASQ  691



>gb|AAM13196.1| galactosidase, putative [Arabidopsis thaliana]
Length=847

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/564 (71%), Positives = 469/564 (83%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSVSYD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEP
Sbjct  32    GSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  91

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FEG YDLVKF+KL Q++GLY+HLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  92    SPGKYYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  151

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +
Sbjct  152   GPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAK  211

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  212   MAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGP  271

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  272   VPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLE  331

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P     G  QE HV++S++GAC AFL+NY+P+  
Sbjct  332   RQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLANYNPKSY  391

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             AKV+F N  Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ 
Sbjct  392   AKVSFGNNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDP  451

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             ++  D ++    G+ EQIN TRD+SDYLWYMT+V +  +E FLRNG  P +TV+SAGHAM
Sbjct  452   STYID-ESFTMVGLVEQINTTRDTSDYLWYMTDVKVDANEGFLRNGDLPTLTVLSAGHAM  510

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             H+FIN +LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVL
Sbjct  511   HLFINGQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  570

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPVSL+GLN G RDL+ Q W YKV
Sbjct  571   GPVSLNGLNGGRRDLSWQKWTYKV  594


 Score =   130 bits (328),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  593   KVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  652

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A GSC SEC+Y GT+ + KC  NCG+ SQ
Sbjct  653   QIWINGQSLGRHWPAYKAVGSC-SECSYTGTFREDKCLRNCGEASQ  697



>ref|XP_007150529.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
 gb|ESW22523.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
Length=837

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/565 (71%), Positives = 470/565 (83%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
               SVSYD ++  ING+RRILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  23    EASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  82

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FEG YDLVKFIKL Q+AGLYV+LRIGPY+C EWNFGGFP+WLKY+PGI FRTD
Sbjct  83    PSPGQYYFEGNYDLVKFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  142

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK  MQ F  KIV++MK+E+L+E+QGGPIIMSQIENEYGP+E+EIG  GKAYT WA 
Sbjct  143   NEPFKYQMQKFTTKIVDLMKAERLYETQGGPIIMSQIENEYGPIEYEIGGAGKAYTNWAA  202

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
              MA+ L TGVPWIMCKQ+D PDP+I+TCNG+YC+ F PNK YKPKM+TE WTGW+T+FGG
Sbjct  203   DMAMALGTGVPWIMCKQDDTPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGG  262

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             PV  RPAED+AFSVARF+Q  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL
Sbjct  263   PVPHRPAEDLAFSVARFLQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  322

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVF+S+ GAC AFL+NY+P+ 
Sbjct  323   LRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEAHVFKSKLGACAAFLANYNPKS  382

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              A V F ++ Y+LPPWSISILPDCK+ +YNTA V S S Q KM  +P+  G SW S+ EE
Sbjct  383   YATVAFGSMHYNLPPWSISILPDCKHTIYNTARVGSQSAQMKMTAVPIHGGLSWLSFNEE  442

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
               ++DD  +    G+ EQ+N TRD SDYLWY T+V + P+E FL NGK+PV+TV SAGHA
Sbjct  443   TTTTDD-SSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPNEGFLINGKEPVLTVFSAGHA  501

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVFIN +LSGT YG L FPKLT++  VKLRAG+NKISLLSVAVGLPNVG HFE WNAGV
Sbjct  502   LHVFINGQLSGTSYGSLNFPKLTFSEGVKLRAGVNKISLLSVAVGLPNVGPHFETWNAGV  561

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGP+SLSGLNEG RDL+ Q W YKV
Sbjct  562   LGPISLSGLNEGRRDLSWQKWSYKV  586


 Score =   130 bits (326),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL++++GSSSVEW  G L++  QPLTWYK TFDAP G  PLALDM SMGKG
Sbjct  585   KVGLKGETLSLHSLSGSSSVEWIQGSLVSRRQPLTWYKTTFDAPAGTAPLALDMDSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR WP Y A G+C   C+YAGTYN+ KC+ NCG+ SQ
Sbjct  645   QVWLNGQNLGRFWPAYKAAGAC-DHCDYAGTYNENKCRSNCGEASQ  689



>ref|XP_008793242.1| PREDICTED: beta-galactosidase [Phoenix dactylifera]
Length=840

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/561 (71%), Positives = 469/561 (84%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +VSYD ++ II G+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  38    AVSYDHKAVIIGGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  97

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y F GRYDLV+FIKL ++AGLYVHLRIGPY+C EWNFGGFPIWLKYVPGI FRT+N 
Sbjct  98    PGQYYFGGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGISFRTNNG  157

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM+ F  KIV+MMK+E LFE QGGPII+SQIENE+GP+E++ GAP K+Y  WA QM
Sbjct  158   PFKAAMEKFTEKIVSMMKAEGLFEWQGGPIILSQIENEFGPLEYDGGAPAKSYANWAAQM  217

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGLKTGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNKPYKP M+TE WTGW+T FGGPV
Sbjct  218   AVGLKTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKPYKPTMWTEAWTGWFTAFGGPV  277

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL+ 
Sbjct  278   PHRPAEDMAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLLR  337

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIKL EPALVS  P V   G NQE HVFRS++GAC AFL+NY+P    
Sbjct  338   EPKWGHLRDLHKAIKLCEPALVSGDPTVMSLGSNQEAHVFRSKSGACAAFLANYNPSSYG  397

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             ++TF+ + YDLPPWSISILP+CK  V+NTA V + S Q KM  VG GFSW SY E+  +S
Sbjct  398   RITFNGMHYDLPPWSISILPNCKTTVFNTARVGAQSSQMKMERVG-GFSWNSYNED-TNS  455

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
              D D    DG+ EQI++T D SDYLWY T VNI  +E+FL+NGK PV+TV+SAGHAMHVF
Sbjct  456   LDADAFTKDGLVEQISMTWDRSDYLWYTTYVNIGQNEQFLKNGKYPVLTVLSAGHAMHVF  515

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +L+G V+GGL  PKLTY+ +VKL AG NKIS+LSVAVGLPNVG HFE WNAGVLGPV
Sbjct  516   INGQLAGNVFGGLDNPKLTYSGNVKLWAGSNKISILSVAVGLPNVGNHFETWNAGVLGPV  575

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN+G RDL+ Q W Y++
Sbjct  576   TLDGLNQGKRDLSRQKWTYQI  596


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G+KGE+LSL++++GSSSVEW      +  QPLTWYK  F AP GN+PLALDMSSMGKG
Sbjct  595   QIGLKGEALSLHSLSGSSSVEWGQA---SKKQPLTWYKTVFSAPAGNEPLALDMSSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGE +GR+WPGY A GSC   C+Y GTY++KKCQ NCG+ SQ
Sbjct  652   QIWINGESIGRYWPGYKAYGSCGG-CDYRGTYSEKKCQTNCGESSQ  696



>ref|XP_006300095.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
 gb|EOA32993.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
Length=846

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/564 (71%), Positives = 468/564 (83%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSVSYD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEP
Sbjct  31    GSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  90

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FEG YDLVKF+KL +++GLY+HLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  91    SPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  150

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +
Sbjct  151   GPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAK  210

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  211   MAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGP  270

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  271   VPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLE  330

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P     G  QE HV++S++GAC AFL+NY+P+  
Sbjct  331   RQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLANYNPRSY  390

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             AKV+F N  Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ 
Sbjct  391   AKVSFGNNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDP  450

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             ++  D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLRNG  P +TV+SAGHAM
Sbjct  451   STYID-ESFTMVGLVEQINTTRDTSDYLWYMTDVKIDNNEGFLRNGDLPTLTVLSAGHAM  509

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVFIN  LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVL
Sbjct  510   HVFINGHLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  569

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPVSL+GLN G RDL+ Q W YKV
Sbjct  570   GPVSLNGLNGGRRDLSWQKWTYKV  593


 Score =   132 bits (332),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  592   KVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A GSC SEC+YAGT+ + KC  NCG+ SQ
Sbjct  652   QIWINGQSLGRHWPAYKAVGSC-SECSYAGTFKEDKCLRNCGEASQ  696



>ref|NP_194344.2| beta-galactosidase 12 [Arabidopsis thaliana]
 gb|AAM20463.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAN15586.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE85163.1| beta-galactosidase 12 [Arabidopsis thaliana]
Length=636

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/596 (66%), Positives = 472/596 (79%), Gaps = 10/596 (2%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIK+ Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTD
Sbjct  86    PSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKW  
Sbjct  146   NEPFKAAMQKFTEKIVRMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWVA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA GL TGVPWIMCKQ+DAP+ II+TCNG+YCENF PN   KPKM+TE WTGW+T+FGG
Sbjct  206   EMAQGLSTGVPWIMCKQDDAPNSIINTCNGFYCENFKPNSDNKPKMWTENWTGWFTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIA SVARFIQN GSF+NYYMYHGGTNF RTA   FIATSYDYDAPLDEYGL
Sbjct  266   AVPYRPAEDIALSVARFIQNGGSFINYYMYHGGTNFDRTAGE-FIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+ P VT  G  QE HVF+S++ +C AFLSNY+   
Sbjct  325   PREPKYSHLKRLHKVIKLCEPALVSADPTVTSLGDKQEAHVFKSKS-SCAAFLSNYNTSS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK   YNTA VR+ S+  KM+P    FSW SY EEI 
Sbjct  384   AARVLFGGSTYDLPPWSVSILPDCKTEYYNTAKVRTSSIHMKMVPTNTPFSWGSYNEEIP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S++D  T + DG+ EQI++TRD +DY WY+T++ I+PDE+FL  G+DP++T+ SAGHA+H
Sbjct  444   SANDNGTFSQDGLVEQISITRDKTDYFWYLTDITISPDEKFL-TGEDPLLTIGSAGHALH  502

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS A GLPNVG+H+E WN GVLG
Sbjct  503   VFVNGQLAGTAYGSLEKPKLTFSQKIKLHAGVNKLALLSTAAGLPNVGVHYETWNTGVLG  562

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV*FAQISSQYCIHSF*NCSTISCLFTAWYERRIV  2181
             PV+L+G+N GT D+T   W YK+          +H+    ST+      W E  +V
Sbjct  563   PVTLNGVNSGTWDMTKWKWSYKI--GTKGEALSVHTLAGSSTVE-----WKEGSLV  611


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKA  2272
             ++G KGE+LS++T+ GSS+VEW++G L+A  QPLTWYK 
Sbjct  584   KIGTKGEALSVHTLAGSSTVEWKEGSLVAKKQPLTWYKV  622



>ref|XP_008447606.1| PREDICTED: beta-galactosidase 1 [Cucumis melo]
Length=844

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/565 (70%), Positives = 473/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING+RRILISGSIHYPRST +MWP L+QKAK+GGLDVI+TYVFWNGHE
Sbjct  28    QASVSYDSKAIIINGQRRILISGSIHYPRSTSEMWPDLIQKAKEGGLDVIETYVFWNGHE  87

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P PGKY FEG YDLV+F+KL  +AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTD
Sbjct  88    PEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  147

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  M+ F  KIVNMMK+E+L+ESQGGPII+SQIENEYGP+E+E+GAPGKAY+KWA 
Sbjct  148   NAPFKFQMERFTRKIVNMMKAERLYESQGGPIILSQIENEYGPMEYELGAPGKAYSKWAA  207

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+TQFGG
Sbjct  208   QMALGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGG  267

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+AF+VARFIQ  G+ +NYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL
Sbjct  268   AVPHRPAEDMAFAVARFIQKGGALINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGL  327

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DL+RAIKL EPALVS  PIVT  G  QE HVF+S++GAC AFLSNY+P+ 
Sbjct  328   LRQPKWGHLKDLNRAIKLCEPALVSGDPIVTRLGNYQEAHVFKSKSGACAAFLSNYNPRS  387

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              A V F N+ Y++PPWSISILPDCKN V+NTA V + +   KM  +P+   FSWQ+Y EE
Sbjct  388   YATVAFGNMHYNIPPWSISILPDCKNTVFNTARVGAQTAIMKMSPVPMHGSFSWQAYNEE  447

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
              AS ++       G+ EQIN TRD++DYLWY T+V+I  +E FLR+GK PV+TV+SAGHA
Sbjct  448   PASYNE-KAFTTVGLLEQINTTRDATDYLWYTTDVHIDANEGFLRSGKYPVLTVLSAGHA  506

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             MHVF+N +L+GT YG L FPKLT++  V LRAG NKI+LLS+AVGLPNVG HFE WNAG+
Sbjct  507   MHVFVNGQLAGTAYGSLDFPKLTFSREVNLRAGNNKIALLSIAVGLPNVGPHFEMWNAGI  566

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+GL+EG RDLT Q W YK+
Sbjct  567   LGPVNLNGLDEGRRDLTWQKWTYKI  591


 Score =   132 bits (332),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE++SL++++GSSSVEW  G L+A  QPLTW+K TF+AP GN PLALDM SMGKG
Sbjct  590   KIGLDGEAMSLHSLSGSSSVEWIQGSLVAQKQPLTWFKTTFNAPAGNSPLALDMGSMGKG  649

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y + GSC S C+Y GTYN+KKC  NCG+ SQ
Sbjct  650   QIWLNGQSLGRYWPAYKSTGSCGS-CDYTGTYNEKKCSSNCGEASQ  694



>ref|XP_010448320.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Camelina sativa]
Length=726

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/563 (69%), Positives = 460/563 (82%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTD
Sbjct  86    PSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA 
Sbjct  146   NEPFKAAMQKFTTKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWAA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA GL TGVPWIMCKQ+D P+ II+TCNGYYCENF PN   KPKM+TE WTGW T+FGG
Sbjct  206   EMAEGLSTGVPWIMCKQDDVPNSIINTCNGYYCENFKPNSDNKPKMWTENWTGWLTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIAFSVARFIQN GSF+NYYMYHGGTNF RTA   F+ TSYDYDAPLDEYGL
Sbjct  266   AVPYRPAEDIAFSVARFIQNGGSFMNYYMYHGGTNFDRTAGE-FVTTSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+ P VT  G  QE HVF+S T +C AFLSNY+   
Sbjct  325   PREPKYSHLKSLHKVIKLCEPALVSADPTVTSLGDKQEAHVFKS-TSSCAAFLSNYNASS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK   YNTA VR PS+  KM+     FSW SY EEI 
Sbjct  384   AARVLFGGFPYDLPPWSVSILPDCKTEYYNTAKVRGPSIHMKMVSTNTQFSWGSYNEEIP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++ D  T + DG+ EQI++TRD +DY WY+T++ I+PDE+FL+ G+DP++T+ SAGHA+H
Sbjct  444   AAYDNSTFSNDGLVEQISMTRDKTDYFWYLTDLTISPDEKFLKTGEDPLLTIASAGHALH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GT YG L  PKLT++  +KL AG+NK+SLLS A GLPNVG+H+E WN GVLG
Sbjct  504   VFVNGQLAGTAYGSLEQPKLTFSQKIKLHAGVNKLSLLSTAAGLPNVGVHYETWNTGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L+G+N GT D++   W YK+
Sbjct  564   PVTLTGVNSGTWDMSKWKWSYKI  586


 Score =   162 bits (410),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE LS++TVTGSS+VEW+DGPL+A  QPLTWYK+TF+ P GN+PLALDM+SMGKG
Sbjct  585   KIGTKGEDLSIHTVTGSSNVEWKDGPLVAKKQPLTWYKSTFNTPVGNEPLALDMNSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G C   C+YAGT+ +KKC  NCGQ SQ
Sbjct  645   QIWINGQNIGRHWPAYTARGKC-ERCSYAGTFTEKKCLSNCGQASQ  689



>ref|XP_003589080.1| Beta-galactosidase [Medicago truncatula]
Length=718

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/563 (71%), Positives = 458/563 (81%), Gaps = 7/563 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ +I+G+RRILISGSIHYPRSTP+MWP L QKAKDGGLDVIQTYVFWNGHEP
Sbjct  23    ASVSYDHKALVIDGQRRILISGSIHYPRSTPEMWPDLFQKAKDGGLDVIQTYVFWNGHEP  82

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG Y  + R D VK  KLAQ+A L VHLR+ P       F GFP+WLKYVPG+ FRTDN
Sbjct  83    SPGNYTLKDRLDWVKLSKLAQQAVLNVHLRMVP------TFVGFPVWLKYVPGMAFRTDN  136

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV MMK+E LF++QGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA Q
Sbjct  137   EPFKAAMQKFTTKIVTMMKAESLFQTQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAAQ  196

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW MCKQEDAPDP+IDTCNGYYCENF PN+ +KPKM+TE W+GWYT FGG 
Sbjct  197   MAVGLDTGVPWDMCKQEDAPDPVIDTCNGYYCENFTPNENFKPKMWTENWSGWYTDFGGA  256

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             +  RP ED+A+SVA FIQN GSFVNYYMYHGGTNFGRT++ LFIATSYDYDAP+DEYGL 
Sbjct  257   ISHRPTEDLAYSVATFIQNRGSFVNYYMYHGGTNFGRTSSGLFIATSYDYDAPIDEYGLP  316

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFG-KNQEVHVFRSETGACVAFLSNYDPQF  1473
             NEPK+ HL++LH+AIK  EPAL+S  P VTW G KN E HV+   T  C AFL+NYD + 
Sbjct  317   NEPKWSHLKNLHKAIKQCEPALISVDPTVTWLGNKNLEAHVYYVNTSICAAFLANYDTKS  376

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A VTF N QYDLPPWS+SILPDCK VV+NTATV   S   +M PV   F WQSY+EE A
Sbjct  377   AATVTFGNGQYDLPPWSVSILPDCKTVVFNTATVNGHSFHKRMTPVETTFDWQSYSEEPA  436

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
              S D D++ A+ +WEQINVTRDSSDYLWY+T+VNI+P E F++NG+ P +T+ SAGH +H
Sbjct  437   YSSDDDSIIANALWEQINVTRDSSDYLWYLTDVNISPSESFIKNGQFPTLTINSAGHVLH  496

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGTVYGGL  PK+T++ SV L+ G NKISLLSVAVGLPNVGLHFE WN GVLG
Sbjct  497   VFVNGQLSGTVYGGLDNPKVTFSESVNLKVGNNKISLLSVAVGLPNVGLHFETWNVGVLG  556

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV L GL+EGTRDL+ Q W YKV
Sbjct  557   PVRLKGLDEGTRDLSWQKWSYKV  579


 Score =   162 bits (411),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL+T+TGSSS++W  G  LA  QPLTWYK TFDAP GNDP+ALDMSSMGKG
Sbjct  578   KVGLKGESLSLHTITGSSSIDWTQGSSLAKKQPLTWYKTTFDAPSGNDPVALDMSSMGKG  637

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             EIW+N + +GRHWP Y A G+C  ECNYAGT+   KC+ NCG+P+Q
Sbjct  638   EIWINDQSIGRHWPAYIAHGNC-DECNYAGTFTNPKCRTNCGEPTQ  682



>ref|XP_010487145.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/564 (71%), Positives = 468/564 (83%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSVSYD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEP
Sbjct  31    GSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  90

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FEG YDLVKF+KL +++GLY+HLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  91    SPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  150

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +
Sbjct  151   GPFKAQMQSFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAK  210

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  211   MAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGP  270

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  271   VPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLE  330

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P     G  QE HV+++++GAC AFL+NY+P+  
Sbjct  331   RQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKAKSGACSAFLANYNPKAY  390

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             AKV+F +  Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ 
Sbjct  391   AKVSFGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDP  450

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             ++  D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLRNG  P +TV+SAGHAM
Sbjct  451   STYID-ESFTMVGLVEQINTTRDTSDYLWYMTDVKIDNNEGFLRNGDLPTLTVLSAGHAM  509

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVFIN  LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVL
Sbjct  510   HVFINGHLSGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  569

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPVSL+GLN G RDL+ Q W YKV
Sbjct  570   GPVSLNGLNGGRRDLSWQKWTYKV  593


 Score =   134 bits (338),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  592   KVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A GSC SEC+YAGT+N+ KC  NCG+ SQ
Sbjct  652   QIWINGQSLGRHWPAYKAVGSC-SECSYAGTFNEDKCLRNCGEASQ  696



>ref|XP_004146823.1| PREDICTED: beta-galactosidase 1-like [Cucumis sativus]
 ref|XP_004164891.1| PREDICTED: beta-galactosidase 1-like [Cucumis sativus]
Length=841

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/565 (70%), Positives = 472/565 (84%), Gaps = 3/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING RRILISGSIHYPRST +MWP L+QKAK+GGLDVI+TYVFWNGHE
Sbjct  25    QASVSYDSKAIIINGHRRILISGSIHYPRSTSEMWPDLIQKAKEGGLDVIETYVFWNGHE  84

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             P PGKY FEG YDLV+F+KL  +AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRTD
Sbjct  85    PEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  144

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N PFK  M+ F  KIVNMMK+E+L+ESQGGPII+SQIENEYGP+E+E+GAPGKAY+KWA 
Sbjct  145   NAPFKFQMERFTRKIVNMMKAERLYESQGGPIILSQIENEYGPMEYELGAPGKAYSKWAA  204

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK YKPKM+TE WTGW+TQFGG
Sbjct  205   QMALGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGG  264

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAED+AF+VARFIQ  G+ +NYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL
Sbjct  265   AVPHRPAEDMAFAVARFIQKGGALINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + +PK+GHL+DL+RAIKL EPALVS  PIVT  G  QE HVF+S++GAC AFLSNY+P+ 
Sbjct  325   LRQPKWGHLKDLNRAIKLCEPALVSGDPIVTRLGNYQEAHVFKSKSGACAAFLSNYNPRS  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEE  1647
              A V F N+ Y++PPWSISILPDCKN V+NTA V + +   KM  +P+   FSWQ+Y EE
Sbjct  385   YATVAFGNMHYNIPPWSISILPDCKNTVFNTARVGAQTAIMKMSPVPMHESFSWQAYNEE  444

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
              AS ++       G+ EQIN TRD++DYLWY T+V+I  +E FLR+GK PV+TV+SAGHA
Sbjct  445   PASYNE-KAFTTVGLLEQINTTRDATDYLWYTTDVHIDANEGFLRSGKYPVLTVLSAGHA  503

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             MHVF+N +L+GT YG L FPKLT++  V LRAG NKI+LLS+AVGLPNVG HFE WNAG+
Sbjct  504   MHVFVNGQLAGTAYGSLDFPKLTFSRGVNLRAGNNKIALLSIAVGLPNVGPHFEMWNAGI  563

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+GL+EG RDLT Q W YK+
Sbjct  564   LGPVNLNGLDEGRRDLTWQKWTYKI  588


 Score =   132 bits (332),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE++SL++++GSSSVEW  G L+A  QPLTW+K TF+AP GN PLALDM SMGKG
Sbjct  587   KIGLDGEAMSLHSLSGSSSVEWIQGSLVAQKQPLTWFKTTFNAPAGNSPLALDMGSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y + GSC S C+Y GTYN+KKC  NCG+ SQ
Sbjct  647   QIWLNGQSLGRYWPAYKSTGSCGS-CDYTGTYNEKKCSSNCGEASQ  691



>gb|AFD54987.1| beta-galactosidase [Momordica charantia]
Length=719

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/562 (69%), Positives = 467/562 (83%), Gaps = 2/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              +V+YD ++ IINGKRRIL+SGSIHYPRSTPQMWP L+Q AKDGGLD+I+TYVFWNGHEP
Sbjct  20    ATVTYDQKAIIINGKRRILVSGSIHYPRSTPQMWPSLIQNAKDGGLDIIETYVFWNGHEP  79

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             + GKY FE RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFPIWLK+VPGI FRT+N
Sbjct  80    TQGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPIWLKHVPGIVFRTEN  139

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV MMKSEKL+ESQGGPII+SQIENEYGPVEWEIGAPGK+YTKWA Q
Sbjct  140   EPFKAAMQKFTEKIVGMMKSEKLYESQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  199

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL TGVPW+MCKQEDAPDP+IDTCNG+YCENF PN+  KPK++TE+W+GWYT FGG 
Sbjct  200   MALGLDTGVPWVMCKQEDAPDPVIDTCNGFYCENFKPNRENKPKIWTEVWSGWYTAFGGA  259

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARF+QN GS  NYYMYHGGTNFGR+ + LFIA SYD+DAP+DEYGL 
Sbjct  260   VPYRPAEDLAFSVARFVQNGGSLFNYYMYHGGTNFGRS-SGLFIANSYDFDAPIDEYGLK  318

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+ HLRDLH+AIKL EPALVS+ P VTW GKN E  VF+S +GAC AFL+NYD   S
Sbjct  319   REPKWEHLRDLHKAIKLCEPALVSADPNVTWLGKNLEARVFKSSSGACAAFLANYDISTS  378

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             +KV+F N QYDLPPWSISIL DCK+ ++NTA + + S   KM+ V + F W SY EE+AS
Sbjct  379   SKVSFWNTQYDLPPWSISILSDCKSAIFNTARIGAQSAPMKMMLV-SSFWWLSYKEEVAS  437

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
                 DT   DG+ EQ+N T DS+DYLWYMT++ I P+E F+++G+ P++ + SAGH +HV
Sbjct  438   GYATDTTTKDGLVEQVNFTWDSTDYLWYMTDIQIDPNEAFIKSGQWPLLNISSAGHVLHV  497

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +LSGTVYG L  PK+ ++  V L+AG+NK+S+LSV VGLPNVGLHFE WNAGVLGP
Sbjct  498   FVNGQLSGTVYGSLENPKVAFSKYVNLKAGVNKLSMLSVTVGLPNVGLHFESWNAGVLGP  557

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEG RD++   W +KV
Sbjct  558   VTLKGLNEGIRDMSGYKWSHKV  579


 Score =   143 bits (361),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+++L+T+ GS+SV+W  G  L   QPLTWYK  F+ P GN+PLALDMSSMGKG
Sbjct  578   KVGLKGENMNLHTIGGSNSVQWAKGSGLVQKQPLTWYKTNFNTPAGNEPLALDMSSMGKG  637

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG  +GR+WP Y A GSC  +C+YAG + +KKC  NCGQPSQ
Sbjct  638   QIWINGRSIGRYWPAYAASGSC-GKCSYAGIFTEKKCLSNCGQPSQ  682



>ref|XP_010465236.1| PREDICTED: beta-galactosidase 1 [Camelina sativa]
Length=846

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/564 (71%), Positives = 469/564 (83%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSVSYD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEP
Sbjct  31    GSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  90

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FEG YDLVKF+KL +++GLY+HLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  91    SPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  150

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +
Sbjct  151   GPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAK  210

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  211   MAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGP  270

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  271   VPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLE  330

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P     G  QE HV+++++GAC AFL+NY+P+  
Sbjct  331   RQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKAKSGACSAFLANYNPKAY  390

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             AKV+F +  Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ 
Sbjct  391   AKVSFGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDP  450

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             ++  D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLRNG  P +TV+SAGHAM
Sbjct  451   STYID-ESFTMVGLVEQINTTRDTSDYLWYMTDVKIDNNEGFLRNGDLPTLTVLSAGHAM  509

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVFIN +LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVL
Sbjct  510   HVFINGQLSGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  569

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPVSL+GLN G RDL+ Q W YKV
Sbjct  570   GPVSLNGLNGGRRDLSWQKWTYKV  593


 Score =   134 bits (337),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  592   KVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A GSC SEC+YAGT+N+ KC  NCG+ SQ
Sbjct  652   QIWINGQSLGRHWPAYKAVGSC-SECSYAGTFNEDKCLRNCGEASQ  696



>ref|XP_004144120.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=782

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/563 (70%), Positives = 467/563 (83%), Gaps = 4/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD ++ IING+RRILISGSIHYPRSTPQMWP L+QKAKDGGLD+I+TYVFWNGHEPS
Sbjct  83    SVTYDHKAIIINGQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDIIETYVFWNGHEPS  142

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FE RYDLV+FIKL Q+AGLYVHLRIGPY+C EWN+GGFP+WLK+VPGI FRTDN 
Sbjct  143   PGKYYFEERYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPLWLKFVPGIAFRTDNA  202

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ FV KIV+MMK EKLF +QGGPII+SQIENEYGPVEWEIGAPGK+YTKWA QM
Sbjct  203   PFKAAMQKFVYKIVDMMKWEKLFHTQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQM  262

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGLKTGVPW+MCKQEDAPDP+IDTCNG+YCENF PN+ YKPK++TE W+GWYT FGGP 
Sbjct  263   AVGLKTGVPWVMCKQEDAPDPLIDTCNGFYCENFKPNQIYKPKIWTENWSGWYTAFGGPT  322

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AFSVARFIQN GS VNYYMYHGGTNFGRT + LF+ TSYD+DAP+DEYGL+ 
Sbjct  323   PYRPPEDVAFSVARFIQNGGSLVNYYMYHGGTNFGRT-SGLFVTTSYDFDAPIDEYGLLR  381

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIKL EPALVS+ P  TW GKNQE  VF+S +GAC AFL+NYD     
Sbjct  382   EPKWGHLRDLHKAIKLCEPALVSADPTSTWLGKNQEARVFKSSSGACAAFLANYDTSAFV  441

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVR--SPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +V F N  YDLPPWSISILPDCK V +NT +++    S + KM P+ + F W SY EE A
Sbjct  442   RVNFWNHPYDLPPWSISILPDCKTVTFNTGSLQIGVKSYEAKMTPI-SSFWWLSYKEEPA  500

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+   DT   DG+ EQ++VT D++DYLWY+  + I   E FL++G+ P++TV SAGH +H
Sbjct  501   SAYAQDTTTKDGLVEQVSVTWDTTDYLWYILSIRIDSTEGFLKSGQWPLLTVNSAGHILH  560

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSG+VYG L  P++T++  V L+ G+NK+S+LSV VGLPNVGLHF+ WNAGVLG
Sbjct  561   VFINGQLSGSVYGSLEDPRITFSKYVNLKQGVNKLSMLSVTVGLPNVGLHFDTWNAGVLG  620

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L GLNEGTRD++   W YKV
Sbjct  621   PVTLKGLNEGTRDMSKYKWSYKV  643


 Score =   131 bits (329),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (72%), Gaps = 3/117 (3%)
 Frame = +2

Query  2123  SRIAPRFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDP  2302
             +R   ++    ++G++GE L+L +V GS+SV+W  G      QPLTWYK TF+ P GN+P
Sbjct  631   TRDMSKYKWSYKVGLRGEILNLYSVKGSNSVQWMKGSF--QKQPLTWYKTTFNTPAGNEP  688

Query  2303  LALDMSSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             LALDMSSM KG+IWVNG  +GR++PGY A+G C ++C+Y G + +KKC  NCG PSQ
Sbjct  689   LALDMSSMSKGQIWVNGRSIGRYFPGYIARGKC-NKCSYTGFFTEKKCLWNCGGPSQ  744



>ref|XP_006413222.1| hypothetical protein EUTSA_v10024511mg [Eutrema salsugineum]
 gb|ESQ54675.1| hypothetical protein EUTSA_v10024511mg [Eutrema salsugineum]
Length=737

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/563 (69%), Positives = 460/563 (82%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  VSYD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  26    KAMVSYDHKAVIINGQRRILVSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFPIWLKYVPG+ FRTD
Sbjct  86    PSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGMAFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGPVEW IGAPGKAYTKWA 
Sbjct  146   NEPFKAAMQTFTEKIVGMMKEEKLFETQGGPIILSQIENEYGPVEWTIGAPGKAYTKWAA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA GL TGVPWIMCKQ+DAP  II+TCNG+YCENF PN   KPKM+TE WTGW+T+FGG
Sbjct  206   QMAEGLSTGVPWIMCKQDDAPTSIINTCNGFYCENFKPNSDNKPKMWTENWTGWFTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIAFSVARFI N GSF+NYYMYHGGTNF RTA   FIATSYDYDAPLDEYGL
Sbjct  266   AVPYRPAEDIAFSVARFIHNGGSFINYYMYHGGTNFDRTAGE-FIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+   VT  G NQE HVF+S++ +C AFLSNY+   
Sbjct  325   PREPKYSHLKRLHKVIKLCEPALVSADATVTSLGDNQEAHVFKSKS-SCAAFLSNYNASS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWSISILP+CK   YNTA V +PS+  KM+P    FSW SY EEI 
Sbjct  384   TARVLFGGSTYDLPPWSISILPNCKTEYYNTAKVNAPSIHMKMVPTNTQFSWGSYNEEIP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S +D  T A DG+ EQI++TRD +DY WY+T++ I  DE+FL+ G+DP++TV SAGHA+H
Sbjct  444   SPNDNGTFAQDGLAEQISITRDKTDYFWYLTDITIGTDEKFLKTGEDPLLTVGSAGHALH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS+A GLPNVG+H+E WN GVLG
Sbjct  504   VFVNGQLAGTAYGSLEKPKLTFSQKIKLHAGVNKLALLSIAAGLPNVGVHYETWNTGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             P++L+G+N GT D++   W YK+
Sbjct  564   PITLNGVNSGTWDMSKWKWSYKI  586


 Score =   160 bits (405),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE+LSL+TVTGSSSVEW++G L+A  QPLTWYK+TFD P GN+PLALDM++MGKG
Sbjct  585   KIGTKGEALSLHTVTGSSSVEWKEGSLVAKKQPLTWYKSTFDTPAGNEPLALDMNTMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP YTA+G C   C+YAGTY++KKC  NCG+ SQ
Sbjct  645   QVWINGQNIGRHWPAYTARGKC-DRCSYAGTYSEKKCLSNCGEASQ  689



>ref|XP_002882842.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59101.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
Length=847

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/564 (71%), Positives = 469/564 (83%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSVSYD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEP
Sbjct  32    GSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  91

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FEG YDLV+F+KL Q++GLY+HLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  92    SPGKYYFEGNYDLVRFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  151

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +
Sbjct  152   GPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAK  211

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  212   MAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGP  271

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  272   VPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLE  331

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P     G  QE HV+++++GAC AFL+NY+P+  
Sbjct  332   RQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKAKSGACSAFLANYNPKSY  391

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             AKV+F +  Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ 
Sbjct  392   AKVSFGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDP  451

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             ++  D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLRNG  P +TV+SAGHAM
Sbjct  452   STYID-ESFTMVGLVEQINTTRDTSDYLWYMTDVKIDANEGFLRNGDLPTLTVLSAGHAM  510

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVFIN +LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVL
Sbjct  511   HVFINGQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  570

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPVSL+GL+ G RDL+ Q W YKV
Sbjct  571   GPVSLNGLSGGRRDLSWQKWTYKV  594


 Score =   130 bits (328),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  593   KVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  652

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A GSC SEC+Y GT+ + KC  NCG+ SQ
Sbjct  653   QIWINGQSLGRHWPAYKAVGSC-SECSYTGTFREDKCLRNCGEASQ  697



>ref|XP_010049745.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82505.1| hypothetical protein EUGRSUZ_C03897 [Eucalyptus grandis]
Length=722

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/561 (71%), Positives = 469/561 (84%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ II+GKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPS
Sbjct  22    SVSYDRKAIIIDGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPS  81

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG Y FE RYDLV+FIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLK+VPGI FRT+N+
Sbjct  82    PGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGIAFRTNNK  141

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PF+ AMQ F  KIVNMMK+E+LF+SQGGPII+SQIENE+G VE  IGAPGKAYTKWA  M
Sbjct  142   PFQDAMQRFTQKIVNMMKAERLFQSQGGPIILSQIENEFGLVERGIGAPGKAYTKWAASM  201

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDP+I+T N +Y ++F PN   KPKM+TE WTGWYT+FGG V
Sbjct  202   AVGLGTGVPWVMCKQDDAPDPVINTWNDFYFKDFKPNSNNKPKMWTENWTGWYTEFGGAV  261

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSV  FIQN+GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ 
Sbjct  262   PYRPAEDLAFSVTSFIQNSGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  321

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+ HLRDLH+AIK +E ALVS+ P V   G NQE HVF++ +  C AFL+NYD ++S 
Sbjct  322   EPKWSHLRDLHKAIKQSEWALVSADPAVQSLGSNQEAHVFKAGS-RCAAFLANYDTKYSV  380

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             +V F N QYDL PWSISILPDCK  VYNTA V + S Q KM+PVG GFSWQSY EE  S+
Sbjct  381   RVNFGNGQYDLLPWSISILPDCKTAVYNTARVNASSSQNKMVPVG-GFSWQSYVEETVSA  439

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                DT   DG+ EQI++TRD+SDYLWY T++ I+P+E FLR+G+ PV+T++SAGHAMHVF
Sbjct  440   FGSDTFTKDGLLEQISLTRDASDYLWYTTDITISPNEAFLRSGQSPVLTILSAGHAMHVF  499

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN EL+G+VYG L  PKL+Y N+VKLRAGINK+S+LSVAVGLPNVGLHFE WN GVLGPV
Sbjct  500   INDELTGSVYGSLENPKLSYGNNVKLRAGINKLSILSVAVGLPNVGLHFETWNTGVLGPV  559

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GL+ GT D++   W YKV
Sbjct  560   TLKGLDSGTWDMSKWKWCYKV  580


 Score =   155 bits (393),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +2

Query  2150  CSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMG  2329
             C ++G+KGE+LS+NT++GSSSVEW +  +LA  QPLTWYKATF+AP G  PL LDM+SMG
Sbjct  577   CYKVGLKGENLSINTLSGSSSVEWLEDSMLAQRQPLTWYKATFNAPPGRSPLVLDMNSMG  636

Query  2330  KGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             KGEIW+NG+ +GRHWP YTA+GSC   C+YAGT+N+ KC+  CG+ SQ
Sbjct  637   KGEIWINGQSIGRHWPAYTARGSCGG-CSYAGTFNENKCRSGCGEASQ  683



>ref|XP_010501131.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/564 (71%), Positives = 468/564 (83%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSVSYD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEP
Sbjct  31    GSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  90

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGKY FEG YDLVKF+KL +++GLY+HLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN
Sbjct  91    SPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  150

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +
Sbjct  151   GPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAK  210

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGP
Sbjct  211   MAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGP  270

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  271   VPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLE  330

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P     G  QE HV+++++GAC AFL+NY+P+  
Sbjct  331   RQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKAKSGACSAFLANYNPKAY  390

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEI  1650
             AKV+F +  Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ 
Sbjct  391   AKVSFGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDP  450

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             ++  D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLRNG  P +TV+SAGHAM
Sbjct  451   STYID-ESFTMVGLVEQINTTRDTSDYLWYMTDVKIDNNEGFLRNGDLPTLTVLSAGHAM  509

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVFIN  LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVL
Sbjct  510   HVFINGHLSGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  569

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPVSL+GLN G RDL+ Q W YKV
Sbjct  570   GPVSLNGLNGGRRDLSWQKWTYKV  593


 Score =   134 bits (338),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  592   KVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A GSC SEC+YAGT+N+ KC  NCG+ SQ
Sbjct  652   QIWINGQSLGRHWPAYKAVGSC-SECSYAGTFNEDKCLRNCGEASQ  696



>ref|XP_004170887.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase-like [Cucumis 
sativus]
Length=716

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/562 (70%), Positives = 466/562 (83%), Gaps = 3/562 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             G+V+YD ++ IIN +RRILISGSIHYPRSTPQMWP L+QKAKDGGLD+I+TYVFWNGHEP
Sbjct  20    GAVTYDEKAIIINDQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDIIETYVFWNGHEP  79

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             S GKY FE RYDLV FIKL QKAGLYVHLRIGPY+C EWN+GGFPIWLK+VPGI FRTDN
Sbjct  80    SEGKYYFEERYDLVGFIKLVQKAGLYVHLRIGPYVCAEWNYGGFPIWLKFVPGIAFRTDN  139

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ FV KIV+MMK EKL+ +QGGPII+SQIENEYGPVEW+IGAPGK+YTKW  Q
Sbjct  140   EPFKAAMQKFVTKIVDMMKLEKLYHTQGGPIILSQIENEYGPVEWQIGAPGKSYTKWFAQ  199

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAV LKTGVPW+MCKQEDAPDP+IDTCNG+YCENF PN+ YKPK++TE W+GWYT FGGP
Sbjct  200   MAVDLKTGVPWVMCKQEDAPDPLIDTCNGFYCENFKPNQIYKPKIWTENWSGWYTAFGGP  259

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
                RP ED+AFSVARFIQNNGS VNYY+YHGGTNFGRT + LFIATSYD+DAP+DEYGL+
Sbjct  260   TPYRPPEDVAFSVARFIQNNGSLVNYYVYHGGTNFGRT-SGLFIATSYDFDAPIDEYGLI  318

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHLRDLH+AIK  EPALVS+ P +TW GKNQE  VF+S + AC AFL+NYD   S
Sbjct  319   REPKWGHLRDLHKAIKSCEPALVSADPTITWLGKNQEARVFKSSS-ACAAFLANYDTSAS  377

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              KV F N  YDLPPWSISILPDC  V +NTA V   S Q KM+P+ + F W SY EE AS
Sbjct  378   VKVNFWNNPYDLPPWSISILPDCXTVTFNTAQVGVKSYQAKMMPI-SSFGWLSYKEEPAS  436

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +   DT    G+ EQ+++T D++DYLWYM +++I   E FL++GK P+++V SAGH +HV
Sbjct  437   AYAKDTTTKAGLVEQVSITWDTTDYLWYMQDISIDSTEGFLKSGKWPLLSVNSAGHLLHV  496

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSG+VYG L  P +T++ +V L+ G+NK+S+LSV VGLPNVGLHF+ WNAGVLGP
Sbjct  497   FINGQLSGSVYGSLEDPAITFSKNVDLKQGVNKLSMLSVTVGLPNVGLHFDTWNAGVLGP  556

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRD++   W YKV
Sbjct  557   VTLEGLNEGTRDMSKYKWSYKV  578


 Score =   130 bits (326),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +2

Query  2123  SRIAPRFLACSQLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDP  2302
             +R   ++    ++G+ GESL+L +  GS+SV+W  G L    QPLTWYK TF  P GN+P
Sbjct  566   TRDMSKYKWSYKVGLSGESLNLYSDKGSNSVQWTKGSL-TQKQPLTWYKTTFKTPAGNEP  624

Query  2303  LALDMSSMGKGEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             L LDMSSM KG+IW+NG+ +GR++PGY A G C  +C+YAG + +KKC  NCG+PSQ
Sbjct  625   LGLDMSSMSKGQIWINGQSIGRYFPGYIANGKC-DKCSYAGLFTEKKCLGNCGEPSQ  680



>ref|XP_010433545.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Camelina sativa]
Length=726

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/562 (69%), Positives = 459/562 (82%), Gaps = 2/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              +V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  27    ATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEP  86

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG Y FE RY+LVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTDN
Sbjct  87    SPGLYYFEDRYNLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTDN  146

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA +
Sbjct  147   EPFKAAMQKFTAKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWAAE  206

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA GL TGVPWIMCKQ+D P+ II+TCNG+YCENF PN   KPKM+TE WTGW T+FGG 
Sbjct  207   MAEGLSTGVPWIMCKQDDVPNSIINTCNGFYCENFKPNSDNKPKMWTENWTGWLTEFGGA  266

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAEDIAFSVARFIQN GSF+NYYMYHGGTNF RTA   F+ TSYDYDAPLDEYGL 
Sbjct  267   VPHRPAEDIAFSVARFIQNGGSFMNYYMYHGGTNFDRTAGE-FVTTSYDYDAPLDEYGLP  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPKY HL+ LH+ IKL EPALVS+ P VT  G NQE HVF+S++ +C AFLSNY+   +
Sbjct  326   REPKYSHLKRLHKVIKLCEPALVSADPTVTSLGDNQEAHVFKSKS-SCAAFLSNYNASSA  384

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A+V F    YDLPPWS+SILPDCK   YNTA VR PS+  KM+     FSW SY EEI S
Sbjct  385   ARVLFGGFPYDLPPWSVSILPDCKTEYYNTAKVRGPSIHMKMVSTNTQFSWGSYNEEIPS  444

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             + D  T + DG+ EQI++TRD +DY WY+T++ I+PDE+FL+ G+DP++T+ SAGHA+HV
Sbjct  445   AYDNGTFSQDGLVEQISMTRDKTDYFWYLTDLTISPDEKFLKTGEDPLLTIASAGHALHV  504

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GT YG L  PKLT++  +KL AG+NK++LLS A GLPNVG+H+E WN GVLGP
Sbjct  505   FVNGQLAGTAYGSLKQPKLTFSQKIKLHAGVNKLALLSTAAGLPNVGVHYETWNTGVLGP  564

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L G+N GT D++   W YK+
Sbjct  565   VTLQGVNSGTWDMSKWKWSYKI  586


 Score =   157 bits (396),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE++S++TVTGSS+V+W++GPL+A  QPLTWYK+TF+ P GN+PLAL+M+SMGKG
Sbjct  585   KIGTKGEAMSIHTVTGSSNVDWKEGPLMAKKQPLTWYKSTFNTPLGNEPLALEMNSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G C   C+YAGT+ +KKC  NCGQ SQ
Sbjct  645   QIWINGQNIGRHWPAYTARGKC-ERCSYAGTFTEKKCLSNCGQASQ  689



>gb|KDO57770.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=683

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/531 (73%), Positives = 450/531 (85%), Gaps = 1/531 (0%)
 Frame = +1

Query  490   QMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRI  669
             QMWP L+QKAKDGGLDVIQTYVFWNGHEP+ G Y F+ RYDLV+FIKL Q+AGLYVHLRI
Sbjct  14    QMWPDLIQKAKDGGLDVIQTYVFWNGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRI  73

Query  670   GPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFKVAMQGFVGKIVNMMKSEKLFESQGGPI  849
             GPY+C EWN+GGFP+WLKYVPGIEFRTDN PFK AM  F  KIV+MMK+EKLF++QGGPI
Sbjct  74    GPYVCAEWNYGGFPVWLKYVPGIEFRTDNGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPI  133

Query  850   IMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYY  1029
             I+SQIENE+GPVEW+IGAPGKAY KWA QMAVGL TGVPW+MCKQ+DAPDP+I+TCNG+Y
Sbjct  134   ILSQIENEFGPVEWDIGAPGKAYAKWAAQMAVGLNTGVPWVMCKQDDAPDPVINTCNGFY  193

Query  1030  CENFHPNKPYKPKMFTELWTGWYTQFGGPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHG  1209
             CE F PN+ YKPKM+TE WTGW+T+FG  V  RPAED+ FSVARFIQ+ GSF+NYYMYHG
Sbjct  194   CEKFVPNQNYKPKMWTEAWTGWFTEFGSAVPTRPAEDLVFSVARFIQSGGSFINYYMYHG  253

Query  1210  GTNFGRTAAALFIATSYDYDAPLDEYGLVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTW  1389
             GTNFGRT+   F+ATSYDYDAP+DEYGL+NEPK+GHLRDLH+AIKL EPALVS  P V  
Sbjct  254   GTNFGRTSGG-FVATSYDYDAPIDEYGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKS  312

Query  1390  FGKNQEVHVFRSETGACVAFLSNYDPQFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTA  1569
              GKNQE HVF S++G C AFL+NYD  FSAKV+F N QYDLPPWSIS+LPDCK  V+NTA
Sbjct  313   LGKNQEAHVFNSKSGKCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  372

Query  1570  TVRSPSLQTKMIPVGNGFSWQSYTEEIASSDDGDTVAADGMWEQINVTRDSSDYLWYMTE  1749
              V   S Q K +PV N FSWQSY EE ASS D +T   DG+WEQ+ +T D+SDYLWYMT+
Sbjct  373   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  432

Query  1750  VNIAPDEEFLRNGKDPVVTVMSAGHAMHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGI  1929
             VNI  +E FL+NG+DP++T+ SAGHA+ VFIN +LSGTVYG L  PKLT++ +VKLR G+
Sbjct  433   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGV  492

Query  1930  NKISLLSVAVGLPNVGLHFEKWNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             NKISLLS +VGLPNVG HFEKWNAGVLGPV+L GLNEGTRD++ Q W YK+
Sbjct  493   NKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKI  543


 Score =   154 bits (390),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TV+GSSSVEW  G  LA  QP+TWYK TF+ P GNDPLALDM +MGKG
Sbjct  542   KIGLKGEALSLHTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKG  601

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GRHWPGY   G+C   CNYAGTY +KKC+  CG+PSQ
Sbjct  602   MVWINGQSIGRHWPGYIGNGNCGG-CNYAGTYTEKKCRTYCGKPSQ  646



>ref|XP_009402923.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=733

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/562 (70%), Positives = 466/562 (83%), Gaps = 3/562 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING RRIL SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  36    SVSYDRKAVIINGHRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  95

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y F G YDLV+F+KL ++AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  96    PGQYYFGGNYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNG  155

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVE-WEIGAPGKAYTKWAGQ  936
             PFK AM  F  KIV+MMKS+ LFESQGGPII+SQIENEYGP+E +  GA  K Y  WA Q
Sbjct  156   PFKAAMAKFTEKIVSMMKSQGLFESQGGPIILSQIENEYGPLEEYYGGAAAKNYASWAAQ  215

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGLKTGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNKPYKP M+TE WTGW+T FG P
Sbjct  216   MAVGLKTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKPYKPTMWTEAWTGWFTAFGSP  275

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED+ F+VARFIQ  GSFVNYYMYHGGTNFGRTA   FI+TSYDYDAP+DEYGL+
Sbjct  276   VPHRPVEDLTFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFISTSYDYDAPVDEYGLL  335

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHLRDLH+AIK+ EPALVS+ P VT  G  ++ HVFRS++G+C AFLSNY+P+  
Sbjct  336   RQPKWGHLRDLHKAIKMCEPALVSADPTVTKLGNYEQAHVFRSKSGSCAAFLSNYNPRSY  395

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A VTF+ ++YD+PPWSISILPDCK  V+NTA V +P+LQ KM  +G  FSW+S++EE  +
Sbjct  396   ATVTFNRMKYDIPPWSISILPDCKTTVFNTARVEAPTLQIKMTLLGR-FSWKSFSEETNT  454

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              DD ++   DG+ EQI++TRD +DYLWY T V+I P+E FL+NG  PV+TVMSAGH+MH+
Sbjct  455   LDD-NSFMKDGLVEQISMTRDQTDYLWYTTSVDIGPNEPFLKNGPHPVLTVMSAGHSMHI  513

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN + +GTVYGGL  PKLTY    KL AG N+IS+LSVAVGLPNVG HFE WNAGVLGP
Sbjct  514   FINGKRAGTVYGGLDNPKLTYKGKAKLWAGSNQISILSVAVGLPNVGSHFETWNAGVLGP  573

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEG RDLT+Q W Y+V
Sbjct  574   VTLHGLNEGRRDLTSQKWTYQV  595


 Score =   143 bits (360),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G+KGESL+L+ ++G SSVEW      +S Q LTWYKA F+AP GN+PLALDMSSMGKG
Sbjct  594   QVGLKGESLNLHMLSGVSSVEWGGA---SSKQALTWYKAFFNAPSGNEPLALDMSSMGKG  650

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A G+C+S C+Y GTYN+KKCQ NCG+ SQ
Sbjct  651   QIWINGQSIGRYWPAYKAYGTCAS-CDYRGTYNEKKCQTNCGESSQ  695



>gb|KHF98342.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=846

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/564 (70%), Positives = 464/564 (82%), Gaps = 3/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             GSVSYD ++  ING+RRIL+SGSIHYPRSTP+MWP L+QK K+GGLDVIQTYVFWNGHEP
Sbjct  31    GSVSYDHKAITINGQRRILLSGSIHYPRSTPEMWPDLIQKGKEGGLDVIQTYVFWNGHEP  90

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             +PGKY F+G YDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGI FRT+N
Sbjct  91    APGKYYFQGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIIFRTNN  150

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIV+MMK+E+L+ESQGGPII+SQIENEYGP+E+E+GAPGKAY+ W+ +
Sbjct  151   GPFKAQMQRFTKKIVDMMKAERLYESQGGPIILSQIENEYGPMEYELGAPGKAYSYWSAK  210

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+GL TGVPW+MCKQ+DAPDPII+TCNG+YC+ F PNK  KPKM+TE WTGWYT+FGG 
Sbjct  211   MALGLATGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKANKPKMWTEAWTGWYTEFGGA  270

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL 
Sbjct  271   VPYRPAEDLAFSVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLK  330

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALV   P +   G  QE H+F+ + G C AFL+NY+ +  
Sbjct  331   RQPKWGHLKDLHRAIKLCEPALVYGDPTMIRLGNYQEAHLFKYKAGGCAAFLANYNSRDY  390

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPV--GNGFSWQSYTEEI  1650
             A V+F N  Y+LPPWSISILPDCKN VYNTA + +   + KM+PV    G SWQ+Y EE 
Sbjct  391   ATVSFRNNHYNLPPWSISILPDCKNTVYNTARIGAQIARKKMVPVPMHGGLSWQAYNEET  450

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
             AS  D     A G+ EQIN TRD++DYLWY TEV I   E FLRNGK PV+TV+SAGHA+
Sbjct  451   ASDADSSFTMA-GLLEQINTTRDATDYLWYTTEVKIDSREGFLRNGKSPVLTVLSAGHAL  509

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVF+N +LSG+ YG L FPKLT++  V LRAGINKISLLS+AVGLPNVG HFE WNAGVL
Sbjct  510   HVFVNGQLSGSSYGSLEFPKLTFSQGVNLRAGINKISLLSIAVGLPNVGPHFETWNAGVL  569

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPV+L+GLNEG RDL+ Q W YK+
Sbjct  570   GPVTLNGLNEGRRDLSWQKWSYKI  593


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L +++GSSSVEW     ++  QPLTWYK TF+AP GN PLALDM SMGKG
Sbjct  592   KIGLKGEALNLLSLSGSSSVEWAQRSFVSQRQPLTWYKTTFNAPAGNSPLALDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A G+C   C+YAGT+N+KKC  NCG  SQ
Sbjct  652   QIWINGKSIGRHWPAYKASGNCGI-CSYAGTFNEKKCGTNCGGASQ  696



>ref|XP_010448319.1| PREDICTED: beta-galactosidase 12-like isoform X1 [Camelina sativa]
Length=728

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/565 (69%), Positives = 460/565 (81%), Gaps = 4/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTD
Sbjct  86    PSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA 
Sbjct  146   NEPFKAAMQKFTTKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWAA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA GL TGVPWIMCKQ+D P+ II+TCNGYYCENF PN   KPKM+TE WTGW T+FGG
Sbjct  206   EMAEGLSTGVPWIMCKQDDVPNSIINTCNGYYCENFKPNSDNKPKMWTENWTGWLTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIAFSVARFIQN GSF+NYYMYHGGTNF RTA   F+ TSYDYDAPLDEYGL
Sbjct  266   AVPYRPAEDIAFSVARFIQNGGSFMNYYMYHGGTNFDRTAGE-FVTTSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+ P VT  G  QE HVF+S T +C AFLSNY+   
Sbjct  325   PREPKYSHLKSLHKVIKLCEPALVSADPTVTSLGDKQEAHVFKS-TSSCAAFLSNYNASS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTA--TVRSPSLQTKMIPVGNGFSWQSYTEE  1647
             +A+V F    YDLPPWS+SILPDCK   YNTA   VR PS+  KM+     FSW SY EE
Sbjct  384   AARVLFGGFPYDLPPWSVSILPDCKTEYYNTAKVQVRGPSIHMKMVSTNTQFSWGSYNEE  443

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             I ++ D  T + DG+ EQI++TRD +DY WY+T++ I+PDE+FL+ G+DP++T+ SAGHA
Sbjct  444   IPAAYDNSTFSNDGLVEQISMTRDKTDYFWYLTDLTISPDEKFLKTGEDPLLTIASAGHA  503

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L  PKLT++  +KL AG+NK+SLLS A GLPNVG+H+E WN GV
Sbjct  504   LHVFVNGQLAGTAYGSLEQPKLTFSQKIKLHAGVNKLSLLSTAAGLPNVGVHYETWNTGV  563

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+G+N GT D++   W YK+
Sbjct  564   LGPVTLTGVNSGTWDMSKWKWSYKI  588


 Score =   162 bits (410),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE LS++TVTGSS+VEW+DGPL+A  QPLTWYK+TF+ P GN+PLALDM+SMGKG
Sbjct  587   KIGTKGEDLSIHTVTGSSNVEWKDGPLVAKKQPLTWYKSTFNTPVGNEPLALDMNSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G C   C+YAGT+ +KKC  NCGQ SQ
Sbjct  647   QIWINGQNIGRHWPAYTARGKC-ERCSYAGTFTEKKCLSNCGQASQ  691



>ref|XP_006285652.1| hypothetical protein CARUB_v10007108mg [Capsella rubella]
 gb|EOA18550.1| hypothetical protein CARUB_v10007108mg [Capsella rubella]
Length=730

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/565 (69%), Positives = 461/565 (82%), Gaps = 4/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  V+YD ++ IING+RRIL+SGSIHYPRSTPQMWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  27    KAMVTYDHKAVIINGQRRILLSGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVFWNGHE  86

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTD
Sbjct  87    PSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTD  146

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA 
Sbjct  147   NEPFKAAMQKFTEKIVGMMKQEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWAA  206

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA GL TGVPWIMCKQ+D P+ II+TCNG+YCENF PN   KPKM+TE WTGW+T+FGG
Sbjct  207   EMAQGLSTGVPWIMCKQDDVPNSIINTCNGFYCENFKPNSDNKPKMWTENWTGWFTEFGG  266

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIA SVARFIQN GSF+NYYMYHGGTNF RTA   F+ATSYDYDAPLDEYGL
Sbjct  267   AVPYRPAEDIALSVARFIQNGGSFMNYYMYHGGTNFDRTAGE-FVATSYDYDAPLDEYGL  325

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+ P VT  G  QE HVF+S++ +C AFLSNY+   
Sbjct  326   PREPKYSHLKKLHKVIKLCEPALVSADPTVTSLGDKQEAHVFKSKS-SCAAFLSNYNASS  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTA--TVRSPSLQTKMIPVGNGFSWQSYTEE  1647
             +A+V+F    YDLPPWS+SILPDCK   YNTA   VR+P +  KM P    FSW+SY EE
Sbjct  385   AARVSFGGSTYDLPPWSVSILPDCKTEYYNTAKVQVRAPRIHMKMSPTNTQFSWESYNEE  444

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             I S+ D    + DG+ EQI++TRD +DY WYMT++ I+PDE FL+ G+DP++T+ SAGHA
Sbjct  445   IPSAYDNGNFSHDGLVEQISITRDKTDYFWYMTDITISPDETFLKTGEDPLLTIGSAGHA  504

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HV++N +L+GT YG L  PKLT++ ++KL AG+NK++LLS A GLPNVGLH+E WN GV
Sbjct  505   LHVYVNGQLAGTAYGSLEQPKLTFSQNIKLHAGVNKLALLSTAAGLPNVGLHYETWNTGV  564

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L G+N GT D++   W YK+
Sbjct  565   LGPVTLKGVNSGTWDMSKWKWSYKI  589


 Score =   159 bits (401),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE+LS++TVTGSS+VEW+ GPL+   QPLTWYK+TFD P GN+PLALDM+SMGKG
Sbjct  588   KIGTKGEALSIHTVTGSSTVEWKAGPLVVEKQPLTWYKSTFDTPVGNEPLALDMNSMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G C   C+YAGT+ +KKC  NCG+ SQ
Sbjct  648   QIWINGQNIGRHWPAYTARGKC-ERCSYAGTFTEKKCLSNCGEASQ  692



>ref|XP_010438797.1| PREDICTED: beta-galactosidase 12 isoform X2 [Camelina sativa]
Length=726

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/563 (68%), Positives = 458/563 (81%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +V+YD ++ IING+RRIL+SGS+HYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KATVTYDRKAVIINGQRRILLSGSVHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTD
Sbjct  86    PSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PF+ AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA 
Sbjct  146   NEPFQAAMQKFTAKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWAA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA GL TGVPWIMCKQ+D P+ II+TCNG+YCENF PN   KPKM+TE WTGW T+FGG
Sbjct  206   EMAEGLSTGVPWIMCKQDDVPNSIINTCNGFYCENFKPNSDNKPKMWTENWTGWLTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIAFSVARFIQN GSF+NYYMYHGGTNF RTA   F+ TSYDYDAPLDEYGL
Sbjct  266   AVPYRPAEDIAFSVARFIQNGGSFMNYYMYHGGTNFDRTAGE-FVTTSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+ P VT  G  QE HVF+S + +C AFLSNY+   
Sbjct  325   PREPKYSHLKRLHKVIKLCEPALVSADPTVTSLGDKQEAHVFKSNS-SCAAFLSNYNASS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK   YNTA VR PS+  KM+     FSW SY EEI 
Sbjct  384   AARVLFGGFPYDLPPWSVSILPDCKTEYYNTAKVRGPSIHMKMVSTNTQFSWGSYNEEIP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+ D  T + DG+ EQI++TRD +DY WY+ ++ I+PDE+FL+ G+DP++T+ SAGHA+H
Sbjct  444   SAYDNSTFSKDGLVEQISMTRDKTDYFWYLNDLTISPDEKFLKTGEDPLLTIASAGHALH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS A GLPNVG+H+E WN GVLG
Sbjct  504   VFVNGQLAGTAYGSLEQPKLTFSQKIKLYAGVNKLALLSTAAGLPNVGVHYETWNTGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YK+
Sbjct  564   PVTLQGVNSGTWDMSKWKWSYKI  586


 Score =   159 bits (402),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE++S+ TVTGSSSVEW++G L+A  QPLTWYK+TFD P GN+PLALDM+SMGKG
Sbjct  585   KIGTKGEAMSIQTVTGSSSVEWKEGTLVAKKQPLTWYKSTFDTPVGNEPLALDMNSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G C   C+YAGT+ +KKC  NCGQ SQ
Sbjct  645   KIWINGQNIGRHWPAYTARGKC-ERCSYAGTFTEKKCLSNCGQASQ  689



>ref|XP_006407174.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
 gb|ESQ48627.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
Length=846

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/560 (71%), Positives = 464/560 (83%), Gaps = 3/560 (1%)
 Frame = +1

Query  409   YDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGK  588
             YD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPSPGK
Sbjct  35    YDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPSPGK  94

Query  589   YNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFK  768
             Y FEG YDLVKF+KL +++GLY+HLRIGPY+C EWNFGGFP+WLKY+PGI FRTDN PFK
Sbjct  95    YYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDNGPFK  154

Query  769   VAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVG  948
               MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +MAVG
Sbjct  155   AQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKMAVG  214

Query  949   LKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHRR  1128
             L TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGPV  R
Sbjct  215   LGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYR  274

Query  1129  PAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEPK  1308
             PAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  +PK
Sbjct  275   PAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  334

Query  1309  YGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKVT  1488
             +GHL+DLHRAIKL EPALVS  P     G  QE HV++S++GAC AFL+NY+P+  AKV+
Sbjct  335   WGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLANYNPRSYAKVS  394

Query  1489  FSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIASSD  1662
             F +  Y+LPPWSISILPDCKN VYNTA V S + + KM  +PV  G SWQ+Y E+ ++  
Sbjct  395   FGSNHYNLPPWSISILPDCKNTVYNTARVGSQTSRMKMVRVPVHGGLSWQAYNEDPSTYV  454

Query  1663  DGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFI  1842
             D ++    G+ EQIN TRD+SDYLWYMT++ I  +E FLR G  P +TV+SAGHAMHVFI
Sbjct  455   D-ESFTMVGLVEQINTTRDTSDYLWYMTDLKIDSNEGFLRTGDLPTLTVLSAGHAMHVFI  513

Query  1843  NSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVS  2022
             N +LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVLGPVS
Sbjct  514   NGQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLGPVS  573

Query  2023  LSGLNEGTRDLTNQTWFYKV  2082
             L+GLN G RDL+ Q W YKV
Sbjct  574   LNGLNGGRRDLSWQKWTYKV  593


 Score =   133 bits (334),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GESLSL++++GS+SVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  592   KVGLRGESLSLHSLSGSTSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  651

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A GSC SEC+Y GT+N+ KC  NCG+ SQ
Sbjct  652   QIWINGQSVGRHWPAYKAVGSC-SECSYKGTFNENKCLRNCGEASQ  696



>ref|XP_008805774.1| PREDICTED: beta-galactosidase-like isoform X2 [Phoenix dactylifera]
Length=841

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/561 (71%), Positives = 461/561 (82%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +VSYD ++ IING+RRILISGSIHYPRSTP MWP L+QKAK GGLDVIQTYVFWN HEPS
Sbjct  33    AVSYDHKAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKVGGLDVIQTYVFWNAHEPS  92

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y FEGRYDLV+FIKL ++AGLYVHLRIGPY+C EWNFGGFPIWLKYVPGI FRT+N 
Sbjct  93    PGQYYFEGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGISFRTENG  152

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM+ F GKIV+MMK+E LFE QGGPII+SQIENE+GP+E+  GAP K Y  WA QM
Sbjct  153   PFKAAMEKFTGKIVSMMKAEGLFEWQGGPIILSQIENEFGPMEYNGGAPAKVYANWAAQM  212

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGLKTGVPW+MCKQEDAPDP+I+TCNG+YC++F PNKPYKP ++TE WTGW+T FGGPV
Sbjct  213   AVGLKTGVPWVMCKQEDAPDPVINTCNGFYCDDFSPNKPYKPMIWTEAWTGWFTAFGGPV  272

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSY+YDAP+DEYGL+ 
Sbjct  273   PHRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYEYDAPIDEYGLLR  332

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRD+H+AIK+ E ALVS  P  T  G  QE HVFRS++G C AFL+NY+P    
Sbjct  333   EPKWGHLRDMHKAIKMCESALVSGDPTATSLGSYQEAHVFRSKSGVCAAFLANYNPSSYG  392

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             +VTF+ + YDLPPWSISILPDCK  V+NTA V + S   KM  VG GFSW+SY EEI +S
Sbjct  393   RVTFNGIHYDLPPWSISILPDCKTAVFNTARVGAQSSHMKMERVG-GFSWKSYNEEI-NS  450

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
              D D    DG+ EQI++T D SDYLWY T +NI  DE+FL+NGK PV+ V+SAGH MHVF
Sbjct  451   LDADAFTKDGLIEQISITWDRSDYLWYTTYINIGQDEQFLKNGKYPVLNVLSAGHGMHVF  510

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN + +G VYG L  PKLTY+ +VKL AG NKIS+LSVAVGLPNVG HFE WNAGVLGPV
Sbjct  511   INGQPAGNVYGSLNSPKLTYSGNVKLWAGSNKISILSVAVGLPNVGDHFETWNAGVLGPV  570

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEG RDL+ Q W Y++
Sbjct  571   TLDGLNEGERDLSRQKWTYQI  591


 Score =   130 bits (328),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G+KGE+LSL++++GSS+VEW D    ++ QPLTWYK  F+AP GN+PLALDM SMGKG
Sbjct  590   QIGLKGEALSLHSLSGSSTVEWGD---TSNMQPLTWYKTFFNAPAGNEPLALDMRSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGE +GR+WPG  A GSC   C+Y GTY++KKCQ NCG+PSQ
Sbjct  647   QIWINGESIGRYWPGNKAYGSCGV-CDYRGTYDEKKCQTNCGEPSQ  691



>ref|XP_009146456.1| PREDICTED: beta-galactosidase 1 [Brassica rapa]
Length=839

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/560 (71%), Positives = 464/560 (83%), Gaps = 3/560 (1%)
 Frame = +1

Query  409   YDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGK  588
             YD R+  ING+RRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPSPGK
Sbjct  28    YDSRAITINGERRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPSPGK  87

Query  589   YNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFK  768
             Y FEG YDLVKF+KL Q++GLY+HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN PFK
Sbjct  88    YYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNGPFK  147

Query  769   VAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVG  948
               MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +MAVG
Sbjct  148   AQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKMAVG  207

Query  949   LKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHRR  1128
             L TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGPV  R
Sbjct  208   LGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYR  267

Query  1129  PAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEPK  1308
             PAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  +PK
Sbjct  268   PAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  327

Query  1309  YGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKVT  1488
             +GHL+DLHRAIKL EPALVS  P     G  QE HV++S++GAC AFL+NY+P+  AKV+
Sbjct  328   WGHLKDLHRAIKLCEPALVSGEPTRMSLGNYQEAHVYKSKSGACSAFLANYNPRSYAKVS  387

Query  1489  FSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIASSD  1662
             F +  Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ ++  
Sbjct  388   FGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVEVPVHGGLSWQAYNEDPSTYI  447

Query  1663  DGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFI  1842
             D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLR G  P +TV+SAGHAMHVFI
Sbjct  448   D-ESFTMVGLVEQINTTRDTSDYLWYMTDVKIDSNEGFLRTGDLPTLTVLSAGHAMHVFI  506

Query  1843  NSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVS  2022
             N +LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVLGPV+
Sbjct  507   NGQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLGPVN  566

Query  2023  LSGLNEGTRDLTNQTWFYKV  2082
             L+GLN G RDL+ Q W YKV
Sbjct  567   LNGLNGGRRDLSWQKWTYKV  586


 Score =   130 bits (328),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GESLSL+++ GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  585   KVGLRGESLSLHSLGGSSSVEWAEGAYVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A GSC  EC+Y GT+N+ KC  NCG+ SQ
Sbjct  645   QIWINGQSVGRHWPAYKAVGSC-GECSYTGTFNENKCLRNCGEASQ  689



>emb|CDX97513.1| BnaA05g25660D [Brassica napus]
Length=840

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/560 (71%), Positives = 464/560 (83%), Gaps = 3/560 (1%)
 Frame = +1

Query  409   YDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGK  588
             YD R+  ING+RRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPSPGK
Sbjct  29    YDSRAITINGERRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPSPGK  88

Query  589   YNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFK  768
             Y FEG YDLVKF+KL Q++GLY+HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN PFK
Sbjct  89    YYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNAPFK  148

Query  769   VAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVG  948
               MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +MAVG
Sbjct  149   AQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKMAVG  208

Query  949   LKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHRR  1128
             L TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGPV  R
Sbjct  209   LGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYR  268

Query  1129  PAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEPK  1308
             PAED+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  +PK
Sbjct  269   PAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  328

Query  1309  YGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKVT  1488
             +GHL+DLHRAIKL EPALVS  P     G  QE HV++S++GAC AFL+NY+P+  AKV+
Sbjct  329   WGHLKDLHRAIKLCEPALVSGEPTRMSLGNYQEAHVYKSKSGACSAFLANYNPRSYAKVS  388

Query  1489  FSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIASSD  1662
             F +  Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ ++  
Sbjct  389   FGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVEVPVHGGLSWQAYNEDPSTYI  448

Query  1663  DGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFI  1842
             D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLR G  P +TV+SAGHAMHVFI
Sbjct  449   D-ESFTMVGLVEQINTTRDTSDYLWYMTDVKIDSNEGFLRTGDLPTLTVLSAGHAMHVFI  507

Query  1843  NSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVS  2022
             N +LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVLGPV+
Sbjct  508   NGQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLGPVN  567

Query  2023  LSGLNEGTRDLTNQTWFYKV  2082
             L+GLN G RDL+ Q W YKV
Sbjct  568   LNGLNGGRRDLSWQKWTYKV  587


 Score =   130 bits (328),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GESLSL+++ GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  586   KVGLRGESLSLHSLGGSSSVEWAEGAYVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A GSC  EC+Y GT+N+ KC  NCG+ SQ
Sbjct  646   QIWINGQSVGRHWPAYKAVGSC-GECSYTGTFNENKCLRNCGEASQ  690



>ref|XP_008805772.1| PREDICTED: beta-galactosidase-like isoform X1 [Phoenix dactylifera]
Length=846

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/561 (71%), Positives = 461/561 (82%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +VSYD ++ IING+RRILISGSIHYPRSTP MWP L+QKAK GGLDVIQTYVFWN HEPS
Sbjct  33    AVSYDHKAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKVGGLDVIQTYVFWNAHEPS  92

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y FEGRYDLV+FIKL ++AGLYVHLRIGPY+C EWNFGGFPIWLKYVPGI FRT+N 
Sbjct  93    PGQYYFEGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGISFRTENG  152

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM+ F GKIV+MMK+E LFE QGGPII+SQIENE+GP+E+  GAP K Y  WA QM
Sbjct  153   PFKAAMEKFTGKIVSMMKAEGLFEWQGGPIILSQIENEFGPMEYNGGAPAKVYANWAAQM  212

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGLKTGVPW+MCKQEDAPDP+I+TCNG+YC++F PNKPYKP ++TE WTGW+T FGGPV
Sbjct  213   AVGLKTGVPWVMCKQEDAPDPVINTCNGFYCDDFSPNKPYKPMIWTEAWTGWFTAFGGPV  272

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSY+YDAP+DEYGL+ 
Sbjct  273   PHRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYEYDAPIDEYGLLR  332

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRD+H+AIK+ E ALVS  P  T  G  QE HVFRS++G C AFL+NY+P    
Sbjct  333   EPKWGHLRDMHKAIKMCESALVSGDPTATSLGSYQEAHVFRSKSGVCAAFLANYNPSSYG  392

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             +VTF+ + YDLPPWSISILPDCK  V+NTA V + S   KM  VG GFSW+SY EEI +S
Sbjct  393   RVTFNGIHYDLPPWSISILPDCKTAVFNTARVGAQSSHMKMERVG-GFSWKSYNEEI-NS  450

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
              D D    DG+ EQI++T D SDYLWY T +NI  DE+FL+NGK PV+ V+SAGH MHVF
Sbjct  451   LDADAFTKDGLIEQISITWDRSDYLWYTTYINIGQDEQFLKNGKYPVLNVLSAGHGMHVF  510

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN + +G VYG L  PKLTY+ +VKL AG NKIS+LSVAVGLPNVG HFE WNAGVLGPV
Sbjct  511   INGQPAGNVYGSLNSPKLTYSGNVKLWAGSNKISILSVAVGLPNVGDHFETWNAGVLGPV  570

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEG RDL+ Q W Y++
Sbjct  571   TLDGLNEGERDLSRQKWTYQI  591


 Score =   130 bits (328),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G+KGE+LSL++++GSS+VEW D    ++ QPLTWYK  F+AP GN+PLALDM SMGKG
Sbjct  590   QIGLKGEALSLHSLSGSSTVEWGD---TSNMQPLTWYKTFFNAPAGNEPLALDMRSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NGE +GR+WPG  A GSC   C+Y GTY++KKCQ NCG+PSQ
Sbjct  647   QIWINGESIGRYWPGNKAYGSCGV-CDYRGTYDEKKCQTNCGEPSQ  691



>ref|XP_010433544.1| PREDICTED: beta-galactosidase 12-like isoform X1 [Camelina sativa]
Length=728

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/564 (69%), Positives = 459/564 (81%), Gaps = 4/564 (1%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              +V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEP
Sbjct  27    ATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEP  86

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG Y FE RY+LVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTDN
Sbjct  87    SPGLYYFEDRYNLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTDN  146

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA +
Sbjct  147   EPFKAAMQKFTAKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWAAE  206

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA GL TGVPWIMCKQ+D P+ II+TCNG+YCENF PN   KPKM+TE WTGW T+FGG 
Sbjct  207   MAEGLSTGVPWIMCKQDDVPNSIINTCNGFYCENFKPNSDNKPKMWTENWTGWLTEFGGA  266

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAEDIAFSVARFIQN GSF+NYYMYHGGTNF RTA   F+ TSYDYDAPLDEYGL 
Sbjct  267   VPHRPAEDIAFSVARFIQNGGSFMNYYMYHGGTNFDRTAGE-FVTTSYDYDAPLDEYGLP  325

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPKY HL+ LH+ IKL EPALVS+ P VT  G NQE HVF+S++ +C AFLSNY+   +
Sbjct  326   REPKYSHLKRLHKVIKLCEPALVSADPTVTSLGDNQEAHVFKSKS-SCAAFLSNYNASSA  384

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTA--TVRSPSLQTKMIPVGNGFSWQSYTEEI  1650
             A+V F    YDLPPWS+SILPDCK   YNTA   VR PS+  KM+     FSW SY EEI
Sbjct  385   ARVLFGGFPYDLPPWSVSILPDCKTEYYNTAKVQVRGPSIHMKMVSTNTQFSWGSYNEEI  444

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
              S+ D  T + DG+ EQI++TRD +DY WY+T++ I+PDE+FL+ G+DP++T+ SAGHA+
Sbjct  445   PSAYDNGTFSQDGLVEQISMTRDKTDYFWYLTDLTISPDEKFLKTGEDPLLTIASAGHAL  504

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS A GLPNVG+H+E WN GVL
Sbjct  505   HVFVNGQLAGTAYGSLKQPKLTFSQKIKLHAGVNKLALLSTAAGLPNVGVHYETWNTGVL  564

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPV+L G+N GT D++   W YK+
Sbjct  565   GPVTLQGVNSGTWDMSKWKWSYKI  588


 Score =   157 bits (396),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE++S++TVTGSS+V+W++GPL+A  QPLTWYK+TF+ P GN+PLAL+M+SMGKG
Sbjct  587   KIGTKGEAMSIHTVTGSSNVDWKEGPLMAKKQPLTWYKSTFNTPLGNEPLALEMNSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G C   C+YAGT+ +KKC  NCGQ SQ
Sbjct  647   QIWINGQNIGRHWPAYTARGKC-ERCSYAGTFTEKKCLSNCGQASQ  691



>ref|NP_849553.1| beta-galactosidase 12 [Arabidopsis thaliana]
 sp|Q9SCV0.1|BGA12_ARATH RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB64748.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE85162.1| beta-galactosidase 12 [Arabidopsis thaliana]
Length=728

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/565 (69%), Positives = 462/565 (82%), Gaps = 5/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIK+ Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTD
Sbjct  86    PSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKW  
Sbjct  146   NEPFKAAMQKFTEKIVRMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWVA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA GL TGVPWIMCKQ+DAP+ II+TCNG+YCENF PN   KPKM+TE WTGW+T+FGG
Sbjct  206   EMAQGLSTGVPWIMCKQDDAPNSIINTCNGFYCENFKPNSDNKPKMWTENWTGWFTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIA SVARFIQN GSF+NYYMYHGGTNF RTA   FIATSYDYDAPLDEYGL
Sbjct  266   AVPYRPAEDIALSVARFIQNGGSFINYYMYHGGTNFDRTAGE-FIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+ P VT  G  QE HVF+S++ +C AFLSNY+   
Sbjct  325   PREPKYSHLKRLHKVIKLCEPALVSADPTVTSLGDKQEAHVFKSKS-SCAAFLSNYNTSS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTA--TVRSPSLQTKMIPVGNGFSWQSYTEE  1647
             +A+V F    YDLPPWS+SILPDCK   YNTA   VR+ S+  KM+P    FSW SY EE
Sbjct  384   AARVLFGGSTYDLPPWSVSILPDCKTEYYNTAKVQVRTSSIHMKMVPTNTPFSWGSYNEE  443

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             I S++D  T + DG+ EQI++TRD +DY WY+T++ I+PDE+FL  G+DP++T+ SAGHA
Sbjct  444   IPSANDNGTFSQDGLVEQISITRDKTDYFWYLTDITISPDEKFL-TGEDPLLTIGSAGHA  502

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS A GLPNVG+H+E WN GV
Sbjct  503   LHVFVNGQLAGTAYGSLEKPKLTFSQKIKLHAGVNKLALLSTAAGLPNVGVHYETWNTGV  562

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L+G+N GT D+T   W YK+
Sbjct  563   LGPVTLNGVNSGTWDMTKWKWSYKI  587


 Score =   153 bits (387),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE+LS++T+ GSS+VEW++G L+A  QPLTWYK+TFD+P GN+PLALDM++MGKG
Sbjct  586   KIGTKGEALSVHTLAGSSTVEWKEGSLVAKKQPLTWYKSTFDSPTGNEPLALDMNTMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP YTA+G C   C+YAGT+ +KKC  NCG+ SQ
Sbjct  646   QMWINGQNIGRHWPAYTARGKC-ERCSYAGTFTEKKCLSNCGEASQ  690



>emb|CDX94367.1| BnaC01g18170D [Brassica napus]
Length=712

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/582 (67%), Positives = 465/582 (80%), Gaps = 6/582 (1%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPSP
Sbjct  2     VTYDHKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSP  61

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G+Y FE RYDLVKF+KL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTDN+P
Sbjct  62    GQYYFEDRYDLVKFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMAFRTDNEP  121

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA QMA
Sbjct  122   FKAAMQKFTEKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWAAQMA  181

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
              GL TGVPWIMCKQ+DAPD II+TCNGYYCENF PN   KPKM+TE WTGW+++FGG V 
Sbjct  182   EGLSTGVPWIMCKQDDAPDSIINTCNGYYCENFKPNSDNKPKMWTENWTGWFSEFGGAVP  241

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
              RPAEDIAFSVARFIQN GSF+NYYMYHGGTNF RTA   F+ATSYDYDAPLDEYGL  E
Sbjct  242   YRPAEDIAFSVARFIQNGGSFINYYMYHGGTNFDRTAGE-FMATSYDYDAPLDEYGLPRE  300

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKY HL  LH+ IKL EPALVS  P VT  G  QE HVF+S++ +C AFLSNY+   +A+
Sbjct  301   PKYSHLTKLHKVIKLCEPALVSVDPTVTSLGDKQEAHVFKSKS-SCAAFLSNYNTSSAAR  359

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTA--TVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             V+F    YDLPPWS+SILP+CK   YNTA   VR+PS+Q KM+P     SW SY+EEI S
Sbjct  360   VSFGGATYDLPPWSVSILPNCKTEYYNTAKVQVRTPSIQMKMVPTNTQLSWGSYSEEIPS  419

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +   T A DG+ EQI++TRD +DY WY+T++ I+ DE+FL+ G+DP++T+ SAGHA+ V
Sbjct  420   PNYNGTFAKDGLVEQISITRDKTDYFWYLTDITISADEKFLKTGEDPLLTIGSAGHALSV  479

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +  GT YG L  PKLT++  +KL AG+NK++LLS+AVGLPNVGLH+E  N GVLGP
Sbjct  480   FVNGQFVGTAYGSLEKPKLTFSQKIKLAAGVNKLALLSIAVGLPNVGLHYETRNTGVLGP  539

Query  2017  VSLSGLNEGTRDLTNQTWFYKV*FAQISSQYCIHSF*NCSTI  2142
             V+L G+N GT D++   W YK+          IH+    ST+
Sbjct  540   VTLEGVNSGTWDMSKWKWSYKI--GTKGEALSIHTVTGSSTV  579


 Score =   158 bits (399),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE+LS++TVTGSS+VEW++G L+A  QPLTWYK+TFD P GN+PLALDM++MGKG
Sbjct  560   KIGTKGEALSIHTVTGSSTVEWKEGTLVAKKQPLTWYKSTFDTPAGNEPLALDMNTMGKG  619

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP Y A+G C   C+YAGT+N+KKC  NCG+ SQ
Sbjct  620   QVWINGQNIGRHWPAYKARGKC-DRCSYAGTFNEKKCLSNCGEASQ  664



>gb|KDP33831.1| hypothetical protein JCGZ_07402 [Jatropha curcas]
Length=825

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/562 (70%), Positives = 465/562 (83%), Gaps = 2/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              +V+YD ++ IING+RRILISGSIHYPRSTP+MWPGL+QKAK+GGLDVIQTYVFW+GHEP
Sbjct  19    ATVTYDHKAVIINGQRRILISGSIHYPRSTPEMWPGLIQKAKEGGLDVIQTYVFWDGHEP  78

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             + G+Y FE RYD+VKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKY+PGIEFRTDN
Sbjct  79    NQGQYYFEDRYDIVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPLWLKYIPGIEFRTDN  138

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIV+MMK+EKLFE QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA  
Sbjct  139   GPFKAAMQKFTTKIVDMMKAEKLFEPQGGPIILSQIENEYGPIEWEIGAPGKAYTKWAAA  198

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPWIMCKQ+DAPDP IDTCNG+YCE + PNK YKPKM+TE WTGWYT++G P
Sbjct  199   MAVGLNTGVPWIMCKQDDAPDPTIDTCNGFYCEAYVPNKNYKPKMWTENWTGWYTEWGAP  258

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED AFSVARFI N GSFVNYYMYHGGTNFGRT A LF+ATSYDYDAPLDEYGL 
Sbjct  259   VPYRPPEDTAFSVARFIANKGSFVNYYMYHGGTNFGRT-AGLFMATSYDYDAPLDEYGLP  317

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
             ++PK+GHLRDLH+AIKL EPAL+S  P V   GKNQE HV++++T AC AFL+NYD Q+S
Sbjct  318   HDPKWGHLRDLHKAIKLCEPALISVDPEVKSLGKNQEAHVYQTKT-ACAAFLANYDTQYS  376

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              KV F N++Y LPPWSIS+LPDCK  V+NTA + + S Q  M+PV  GFSW+SY + + +
Sbjct  377   VKVNFWNVEYWLPPWSISVLPDCKTAVFNTARMGAQSTQMWMMPVIKGFSWESYKDVVTT  436

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
                  T   DG+WEQ  +T D +DYLWYMT VNI P+E FL+NG++P++TV SAGH +HV
Sbjct  437   GYGAGTFTHDGLWEQKFLTADKTDYLWYMTNVNIDPNEGFLKNGQNPLLTVQSAGHVLHV  496

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN + +GT +G L  P++T++  VKL AG NKISLLS  VGL NVGLH++ WNAGVLGP
Sbjct  497   FINGQYAGTQHGSLEEPRITFSQKVKLNAGTNKISLLSATVGLANVGLHYDTWNAGVLGP  556

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLN+GT D++   W YK+
Sbjct  557   VTLQGLNKGTLDMSKWKWSYKI  578


 Score =   144 bits (364),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE L L T  GSSSV+W  G  L   QPLTWYKATFDAP GNDPLALDMSSMGKG
Sbjct  577   KIGLGGEDLKLPTFAGSSSVKWAQGSQLVKKQPLTWYKATFDAPSGNDPLALDMSSMGKG  636

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++++NG+ +GRHWP  TA+GSC ++C Y GTY  KKC+  CG PSQ
Sbjct  637   QVYINGQSIGRHWPANTARGSC-NDCGYEGTYTDKKCKSKCGGPSQ  681



>emb|CDY51738.1| BnaA01g37210D [Brassica napus]
Length=839

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/563 (70%), Positives = 463/563 (82%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPS
Sbjct  25    SVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEG YDLVKF+KL +++GLY+HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  85    PGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNG  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +M
Sbjct  145   PFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGPV
Sbjct  205   AVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPV  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYM+HGGTNFGRTA   FIATSYDYDAPLDEYGL  
Sbjct  265   PYRPAEDMAFSVARFIQKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPLDEYGLER  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS        G  QE H ++S++GAC AFL+NY+ +  A
Sbjct  325   QPKWGHLKDLHRAIKLCEPALVSGQLTRIPLGNYQEAHQYKSKSGACSAFLANYNQRSYA  384

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KVTF    Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ +
Sbjct  385   KVTFGKNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDPS  444

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S  D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLR G  P +T++SAGHAMH
Sbjct  445   SYVD-ESFTMVGLLEQINTTRDTSDYLWYMTDVKINSNEGFLRGGNLPTLTILSAGHAMH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVLG
Sbjct  504   VFINGQLSGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSL+GLN G RDL+ Q W YKV
Sbjct  564   PVSLNGLNGGRRDLSWQKWTYKV  586


 Score =   131 bits (329),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  585   KVGLRGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A G+C  EC+Y GT+N+ KC  NCG+ SQ
Sbjct  645   QIWINGQSVGRHWPAYKAVGTC-RECSYIGTFNENKCLRNCGEASQ  689



>emb|CAB39679.1| putative beta-galactosidase [Arabidopsis thaliana]
 emb|CAB79469.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=729

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/588 (67%), Positives = 471/588 (80%), Gaps = 12/588 (2%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIK+ Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTD
Sbjct  86    PSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKW  
Sbjct  146   NEPFKAAMQKFTEKIVRMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWVA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA GL TGVPWIMCKQ+DAP+ II+TCNG+YCENF PN   KPKM+TE WTGW+T+FGG
Sbjct  206   EMAQGLSTGVPWIMCKQDDAPNSIINTCNGFYCENFKPNSDNKPKMWTENWTGWFTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIA SVARFIQN GSF+NYYMYHGGTNF RTA   FIATSYDYDAPLDEYGL
Sbjct  266   AVPYRPAEDIALSVARFIQNGGSFINYYMYHGGTNFDRTAGE-FIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+ P VT  G  QE HVF+S++ +C AFLSNY+   
Sbjct  325   PREPKYSHLKRLHKVIKLCEPALVSADPTVTSLGDKQEAHVFKSKS-SCAAFLSNYNTSS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTA--TVRSPSLQTKMIPVGNGFSWQSYTEE  1647
             +A+V F    YDLPPWS+SILPDCK   YNTA   VR+ S+  KM+P    FSW SY EE
Sbjct  384   AARVLFGGSTYDLPPWSVSILPDCKTEYYNTAKVQVRTSSIHMKMVPTNTPFSWGSYNEE  443

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             I S++D  T + DG+ EQI++TRD +DY WY+T++ I+PDE+FL  G+DP++T+ SAGHA
Sbjct  444   IPSANDNGTFSQDGLVEQISITRDKTDYFWYLTDITISPDEKFL-TGEDPLLTIGSAGHA  502

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS A GLPNVG+H+E WN GV
Sbjct  503   LHVFVNGQLAGTAYGSLEKPKLTFSQKIKLHAGVNKLALLSTAAGLPNVGVHYETWNTGV  562

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV*FAQISSQ---YCIHSF*NCSTI  2142
             LGPV+L+G+N GT D+T   W YK    QI ++     +H+    ST+
Sbjct  563   LGPVTLNGVNSGTWDMTKWKWSYK----QIGTKGEALSVHTLAGSSTV  606


 Score =   155 bits (391),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G KGE+LS++T+ GSS+VEW++G L+A  QPLTWYK+TFD+P GN+PLALDM++MGKG
Sbjct  587   QIGTKGEALSVHTLAGSSTVEWKEGSLVAKKQPLTWYKSTFDSPTGNEPLALDMNTMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP YTA+G C   C+YAGT+ +KKC  NCG+ SQ
Sbjct  647   QMWINGQNIGRHWPAYTARGKC-ERCSYAGTFTEKKCLSNCGEASQ  691



>ref|XP_010438795.1| PREDICTED: beta-galactosidase 12 isoform X1 [Camelina sativa]
Length=728

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/565 (68%), Positives = 458/565 (81%), Gaps = 4/565 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +V+YD ++ IING+RRIL+SGS+HYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KATVTYDRKAVIINGQRRILLSGSVHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVPG+ FRTD
Sbjct  86    PSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PF+ AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA 
Sbjct  146   NEPFQAAMQKFTAKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWAA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA GL TGVPWIMCKQ+D P+ II+TCNG+YCENF PN   KPKM+TE WTGW T+FGG
Sbjct  206   EMAEGLSTGVPWIMCKQDDVPNSIINTCNGFYCENFKPNSDNKPKMWTENWTGWLTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIAFSVARFIQN GSF+NYYMYHGGTNF RTA   F+ TSYDYDAPLDEYGL
Sbjct  266   AVPYRPAEDIAFSVARFIQNGGSFMNYYMYHGGTNFDRTAGE-FVTTSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+ P VT  G  QE HVF+S + +C AFLSNY+   
Sbjct  325   PREPKYSHLKRLHKVIKLCEPALVSADPTVTSLGDKQEAHVFKSNS-SCAAFLSNYNASS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTA--TVRSPSLQTKMIPVGNGFSWQSYTEE  1647
             +A+V F    YDLPPWS+SILPDCK   YNTA   VR PS+  KM+     FSW SY EE
Sbjct  384   AARVLFGGFPYDLPPWSVSILPDCKTEYYNTAKVQVRGPSIHMKMVSTNTQFSWGSYNEE  443

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             I S+ D  T + DG+ EQI++TRD +DY WY+ ++ I+PDE+FL+ G+DP++T+ SAGHA
Sbjct  444   IPSAYDNSTFSKDGLVEQISMTRDKTDYFWYLNDLTISPDEKFLKTGEDPLLTIASAGHA  503

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS A GLPNVG+H+E WN GV
Sbjct  504   LHVFVNGQLAGTAYGSLEQPKLTFSQKIKLYAGVNKLALLSTAAGLPNVGVHYETWNTGV  563

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV+L G+N GT D++   W YK+
Sbjct  564   LGPVTLQGVNSGTWDMSKWKWSYKI  588


 Score =   159 bits (401),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE++S+ TVTGSSSVEW++G L+A  QPLTWYK+TFD P GN+PLALDM+SMGKG
Sbjct  587   KIGTKGEAMSIQTVTGSSSVEWKEGTLVAKKQPLTWYKSTFDTPVGNEPLALDMNSMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP YTA+G C   C+YAGT+ +KKC  NCGQ SQ
Sbjct  647   KIWINGQNIGRHWPAYTARGKC-ERCSYAGTFTEKKCLSNCGQASQ  691



>ref|XP_009139949.1| PREDICTED: beta-galactosidase 12 isoform X2 [Brassica rapa]
Length=738

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/584 (67%), Positives = 467/584 (80%), Gaps = 5/584 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  V+YD ++  ING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KAMVTYDHKAVTINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKA-GLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRT  750
             PSPG+Y FE RYDLVKF+KL Q+A GLYVH+RIGPY+C EWNFGGFP+WLKYVPG+ FRT
Sbjct  86    PSPGQYYFEDRYDLVKFVKLVQQADGLYVHIRIGPYVCAEWNFGGFPVWLKYVPGMAFRT  145

Query  751   DNQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA  930
             DN+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA
Sbjct  146   DNEPFKAAMQKFTEKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWA  205

Query  931   GQMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFG  1110
              QMA GL TGVPWIMCKQ+DAPD II+TCNGYYCENF PN   KPKM+TE WTGW+T+FG
Sbjct  206   AQMAEGLSTGVPWIMCKQDDAPDSIINTCNGYYCENFKPNSDNKPKMWTENWTGWFTEFG  265

Query  1111  GPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYG  1290
             G V  RPAEDIAFSVARFIQN GSF+NYYMYHGGTNF RTA   F+ATSYDYDAPLDEYG
Sbjct  266   GAVPYRPAEDIAFSVARFIQNGGSFINYYMYHGGTNFDRTAGE-FMATSYDYDAPLDEYG  324

Query  1291  LVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQ  1470
             L  EPKY HL  LH+ IKL EPALVS  P VT  G  QE HVF+S++ +C AFLSNY+  
Sbjct  325   LPREPKYSHLTKLHKVIKLCEPALVSVDPTVTSLGDKQEAHVFKSKS-SCAAFLSNYNSS  383

Query  1471  FSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEI  1650
              +A+V+F    YDLPPWS+SILP+CK   YNTA VR+PS+  KM+P     SW SY+EEI
Sbjct  384   SAARVSFGGSTYDLPPWSVSILPNCKTEYYNTAKVRAPSIHMKMVPTDTQLSWGSYSEEI  443

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
              S +   T A DG+ EQI++TRD +DY WY+T++ I+ DE+FL+ G+DP++T+ SAGHA+
Sbjct  444   PSPNYNGTFAKDGLVEQISITRDKTDYFWYLTDITISADEKFLKTGEDPLLTIGSAGHAL  503

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
              VF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS+AVGLPNVGLH+E  N+GVL
Sbjct  504   SVFVNGQLAGTAYGSLEKPKLTFSQKIKLAAGVNKLALLSIAVGLPNVGLHYETRNSGVL  563

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV*FAQISSQYCIHSF*NCSTI  2142
             GPV+L G+N GT D++   W YK+          IH+    ST+
Sbjct  564   GPVTLEGVNSGTWDMSKWKWSYKI--GTKGEALSIHTVTGSSTV  605


 Score =   157 bits (397),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE+LS++TVTGSS+VEW++GPL+A  QPLTWYK+TF+ P GN+PLALDM++MGKG
Sbjct  586   KIGTKGEALSIHTVTGSSTVEWKEGPLVAKKQPLTWYKSTFETPAGNEPLALDMNTMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP Y A+G C   C+YAGT+N+ KC  NCG+ SQ
Sbjct  646   QVWINGQNIGRHWPAYKARGKC-ERCSYAGTFNENKCLSNCGEASQ  690



>ref|XP_009117469.1| PREDICTED: beta-galactosidase 1-like [Brassica rapa]
Length=839

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/563 (70%), Positives = 463/563 (82%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD R+  INGKRRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPS
Sbjct  25    SVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEG YDLVKF+KL +++GLY+HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  85    PGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNG  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +M
Sbjct  145   PFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGPV
Sbjct  205   AVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPV  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYM+HGGTNFGRTA   FIATSYDYDAPLDEYGL  
Sbjct  265   PYRPAEDMAFSVARFIQKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPLDEYGLER  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS        G  QE H ++S++GAC AFL+NY+ +  A
Sbjct  325   QPKWGHLKDLHRAIKLCEPALVSGQLTRIPLGNYQEAHQYKSKSGACSAFLANYNQRSYA  384

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KVTF    Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ +
Sbjct  385   KVTFGKNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDPS  444

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S  D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLR G  P +T++SAGHAMH
Sbjct  445   SYVD-ESFTMVGLVEQINTTRDTSDYLWYMTDVKINSNEGFLRGGNLPTLTILSAGHAMH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN +L+G+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVLG
Sbjct  504   VFINGQLTGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSL+GLN G RDL+ Q W YKV
Sbjct  564   PVSLNGLNGGRRDLSWQKWTYKV  586


 Score =   131 bits (329),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  585   KVGLRGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A G+C  EC+Y GT+N+ KC  NCG+ SQ
Sbjct  645   QIWINGQSVGRHWPAYKAVGTC-RECSYIGTFNENKCLRNCGEASQ  689



>emb|CDY23637.1| BnaC05g39570D [Brassica napus]
Length=839

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/557 (71%), Positives = 462/557 (83%), Gaps = 3/557 (1%)
 Frame = +1

Query  418   RSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGKYNF  597
             R+  ING+RRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPSPGKY F
Sbjct  31    RAITINGERRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPSPGKYYF  90

Query  598   EGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQPFKVAM  777
             EG YDLVKF+KL Q++GLY+HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN PFK  M
Sbjct  91    EGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNGPFKAQM  150

Query  778   QGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMAVGLKT  957
             Q F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++YT WA +MAVGL T
Sbjct  151   QRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKMAVGLGT  210

Query  958   GVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHRRPAE  1137
             GVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGPV  RPAE
Sbjct  211   GVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYRPAE  270

Query  1138  DIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEPKYGH  1317
             D+AFSVARFIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  +PK+GH
Sbjct  271   DMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPKWGH  330

Query  1318  LRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKVTFSN  1497
             L+DLHRAIKL EPALVS  P     G  QE HV++S++GAC AFLSNY+P+  AKV+F +
Sbjct  331   LKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLSNYNPRSYAKVSFGS  390

Query  1498  LQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIASSDDGD  1671
               Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ ++  D +
Sbjct  391   NHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVEVPVHGGLSWQAYNEDPSTYID-E  449

Query  1672  TVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFINSE  1851
             +    G+ EQIN TRD+SDYLWYMT+V I  +E FLR G  P +TV+SAGHAMHVFIN +
Sbjct  450   SFTMVGLVEQINTTRDTSDYLWYMTDVKIDSNEGFLRTGDLPTLTVLSAGHAMHVFINGQ  509

Query  1852  LSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVSLSG  2031
             LSG+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVLGPV+L+G
Sbjct  510   LSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLGPVNLNG  569

Query  2032  LNEGTRDLTNQTWFYKV  2082
             LN G RDL+ Q W YKV
Sbjct  570   LNGGRRDLSWQKWTYKV  586


 Score =   130 bits (328),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GESLSL+++ GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  585   KVGLRGESLSLHSLGGSSSVEWAEGAYVAEKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A GSC  EC+Y GT+N+ KC  NCG+ SQ
Sbjct  645   QIWINGQSVGRHWPAYKAVGSC-GECSYTGTFNENKCLRNCGEASQ  689



>ref|XP_010915229.1| PREDICTED: beta-galactosidase isoform X2 [Elaeis guineensis]
Length=836

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/561 (70%), Positives = 462/561 (82%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +VSYD R+ IING+RRILISGSIHYPRSTP MWP L+QKAKDGGLDVIQTYVFWNGHEP 
Sbjct  34    AVSYDHRAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKDGGLDVIQTYVFWNGHEPF  93

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y FEGRYDLV+F+KL ++AGLYV+LRIGPY+C EWNFGGFPIWLKYVPGI FRTDN 
Sbjct  94    PGQYYFEGRYDLVRFVKLVKQAGLYVNLRIGPYVCAEWNFGGFPIWLKYVPGISFRTDNG  153

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM+ F  KIV+MMK+E LFE QGGPII+SQ+ENE+GP+E+  GA  + Y  WA QM
Sbjct  154   PFKAAMEKFTAKIVSMMKAEGLFEWQGGPIILSQVENEFGPMEYNGGAAARVYANWAAQM  213

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV LKTGVPW+MCKQ+DAPDP+I+TCNG+YC++F PNKPYKP ++TE WTGW+T FGGPV
Sbjct  214   AVSLKTGVPWVMCKQDDAPDPVINTCNGFYCDDFSPNKPYKPMIWTEAWTGWFTAFGGPV  273

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
              RRP ED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSY+YDAP+DEYGL+ 
Sbjct  274   PRRPVEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYEYDAPIDEYGLLR  333

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIKL EPALVS  P VT  G   E HVF+S++GAC AFLSNY+P    
Sbjct  334   EPKWGHLRDLHKAIKLCEPALVSGDPTVTSLGSYHEAHVFQSKSGACAAFLSNYNPSSYG  393

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             +VTF+ + +DLPPWSI+ILPDC+  V+NTA V + S Q KM  VG GFSW+SY E+I +S
Sbjct  394   RVTFNGMHHDLPPWSITILPDCRTAVFNTARVGAQSSQMKMELVG-GFSWESYNEDI-NS  451

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
              D D    DG+ EQI++T D SDYLWY T VNI  DE+FL+NG  PV++V+SAGH MHVF
Sbjct  452   LDSDAFTKDGLLEQISMTWDRSDYLWYTTYVNIGQDEQFLKNGNYPVLSVLSAGHGMHVF  511

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N    G VYGGL  PKLTY+ +VKL AG NKIS+LSVAVGLPNVG HFE WNAGVLGPV
Sbjct  512   VNGRPEGNVYGGLDSPKLTYSRNVKLWAGSNKISILSVAVGLPNVGDHFETWNAGVLGPV  571

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEG RDL+ + W Y+V
Sbjct  572   TLDGLNEGKRDLSREKWTYQV  592


 Score =   131 bits (329),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 6/107 (6%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASN-QPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE+LSL++++GSSSVEW      ASN QPLTWYK  F+AP GN+PLALDM SMGK
Sbjct  591   QVGLKGEALSLHSLSGSSSVEWGG----ASNMQPLTWYKTLFNAPSGNEPLALDMRSMGK  646

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G+IW+NGE +GR+WP Y A GSC   C+Y GTYN+KKCQ NCG+PSQ
Sbjct  647   GQIWINGESIGRYWPAYKAYGSCGG-CDYRGTYNEKKCQTNCGEPSQ  692



>ref|XP_010915228.1| PREDICTED: beta-galactosidase isoform X1 [Elaeis guineensis]
Length=841

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/561 (70%), Positives = 462/561 (82%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +VSYD R+ IING+RRILISGSIHYPRSTP MWP L+QKAKDGGLDVIQTYVFWNGHEP 
Sbjct  34    AVSYDHRAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKDGGLDVIQTYVFWNGHEPF  93

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y FEGRYDLV+F+KL ++AGLYV+LRIGPY+C EWNFGGFPIWLKYVPGI FRTDN 
Sbjct  94    PGQYYFEGRYDLVRFVKLVKQAGLYVNLRIGPYVCAEWNFGGFPIWLKYVPGISFRTDNG  153

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM+ F  KIV+MMK+E LFE QGGPII+SQ+ENE+GP+E+  GA  + Y  WA QM
Sbjct  154   PFKAAMEKFTAKIVSMMKAEGLFEWQGGPIILSQVENEFGPMEYNGGAAARVYANWAAQM  213

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV LKTGVPW+MCKQ+DAPDP+I+TCNG+YC++F PNKPYKP ++TE WTGW+T FGGPV
Sbjct  214   AVSLKTGVPWVMCKQDDAPDPVINTCNGFYCDDFSPNKPYKPMIWTEAWTGWFTAFGGPV  273

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
              RRP ED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSY+YDAP+DEYGL+ 
Sbjct  274   PRRPVEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYEYDAPIDEYGLLR  333

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLH+AIKL EPALVS  P VT  G   E HVF+S++GAC AFLSNY+P    
Sbjct  334   EPKWGHLRDLHKAIKLCEPALVSGDPTVTSLGSYHEAHVFQSKSGACAAFLSNYNPSSYG  393

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             +VTF+ + +DLPPWSI+ILPDC+  V+NTA V + S Q KM  VG GFSW+SY E+I +S
Sbjct  394   RVTFNGMHHDLPPWSITILPDCRTAVFNTARVGAQSSQMKMELVG-GFSWESYNEDI-NS  451

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
              D D    DG+ EQI++T D SDYLWY T VNI  DE+FL+NG  PV++V+SAGH MHVF
Sbjct  452   LDSDAFTKDGLLEQISMTWDRSDYLWYTTYVNIGQDEQFLKNGNYPVLSVLSAGHGMHVF  511

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N    G VYGGL  PKLTY+ +VKL AG NKIS+LSVAVGLPNVG HFE WNAGVLGPV
Sbjct  512   VNGRPEGNVYGGLDSPKLTYSRNVKLWAGSNKISILSVAVGLPNVGDHFETWNAGVLGPV  571

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEG RDL+ + W Y+V
Sbjct  572   TLDGLNEGKRDLSREKWTYQV  592


 Score =   130 bits (328),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 6/107 (6%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASN-QPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE+LSL++++GSSSVEW      ASN QPLTWYK  F+AP GN+PLALDM SMGK
Sbjct  591   QVGLKGEALSLHSLSGSSSVEWGG----ASNMQPLTWYKTLFNAPSGNEPLALDMRSMGK  646

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G+IW+NGE +GR+WP Y A GSC   C+Y GTYN+KKCQ NCG+PSQ
Sbjct  647   GQIWINGESIGRYWPAYKAYGSCGG-CDYRGTYNEKKCQTNCGEPSQ  692



>ref|XP_010049744.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
Length=703

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/561 (70%), Positives = 460/561 (82%), Gaps = 14/561 (2%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ +I+GKRRILISGSIHYPRSTP+MWP L+ KAK GG+DVIQ+YVFWNGHEPS
Sbjct  16    SVSYDRKAIVIDGKRRILISGSIHYPRSTPEMWPDLIWKAKRGGVDVIQSYVFWNGHEPS  75

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y FE RYDLV+FIKL Q+AGLYVHLRIGPYIC EWNFGGFP+WLK+VPGI FRTDN+
Sbjct  76    PGQYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKFVPGISFRTDNK  135

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
              FK AMQ F  KIV++MK+E+LF+SQGGPII+SQIENEYGPVEWEIGAPGKAY+KWA  +
Sbjct  136   AFKDAMQRFTYKIVDIMKAERLFQSQGGPIILSQIENEYGPVEWEIGAPGKAYSKWAANL  195

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV L TGVPWIMCKQEDAPDP+IDTCNGYYCE F PN   KPKM+T++ T WYT+FGG V
Sbjct  196   AVRLNTGVPWIMCKQEDAPDPMIDTCNGYYCEGFKPNSNNKPKMWTDVCTCWYTEFGGAV  255

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED            GSF+NYYMYHGGTNFGRTA   F+ATSYDYDAPLDE+GL+ 
Sbjct  256   PHRPAED------------GSFINYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEFGLLR  303

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPKY HLRDLH+AIK +E AL+S+ P+V   G+NQE HVF++ +G C AFL+NYD ++  
Sbjct  304   EPKYSHLRDLHQAIKQSEWALISADPVVQSLGRNQEAHVFKAGSG-CAAFLANYDTKYPV  362

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV F N QYDLPPWSISILPDCK  VYNTA V  P+ Q KM+PVG GFSWQSY EEI S+
Sbjct  363   KVNFGNGQYDLPPWSISILPDCKTAVYNTARVSVPTSQIKMVPVG-GFSWQSYVEEIVSA  421

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
               GDT   DG+ EQI++TRD SDYLWY T++ I+P+E FLR+ + PV+T+ SAGHAMHVF
Sbjct  422   FGGDTFTKDGLLEQISLTRDVSDYLWYTTDITISPNEAFLRSSQSPVLTISSAGHAMHVF  481

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N EL+G+ YG L  PKLT++  VKLRAGINK+S+LSVAVGLPNVGLHFE WN GVLGPV
Sbjct  482   VNGELAGSAYGSLENPKLTFSEKVKLRAGINKLSILSVAVGLPNVGLHFETWNTGVLGPV  541

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLN GT D++   W YKV
Sbjct  542   TLRGLNSGTWDMSKWKWSYKV  562


 Score =   152 bits (383),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+ SL+T +GSSSVEW +G  LA  QPLTWYKATF+AP G+ PLALDM+SMGKG
Sbjct  561   KVGLKGEAQSLHTQSGSSSVEWLEGSTLAQKQPLTWYKATFNAPLGHAPLALDMNSMGKG  620

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP YTA+GSC S C YAGT+++ KC+ NCG+PSQ
Sbjct  621   QMWINGQSIGRHWPAYTARGSCGS-CIYAGTFDENKCRSNCGEPSQ  665



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/561 (68%), Positives = 458/561 (82%), Gaps = 1/561 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             V+YD ++ IING+RRILISGSIHYPRSTP MW GL+QKAKDGGLDVIQTYVFWNGHEPSP
Sbjct  28    VTYDSKAVIINGQRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPSP  87

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G YNFEGRYDLV+FIK  QK GLYVHLRIGPYICGEWNFGGFP+WLKYV GI FRTDN+P
Sbjct  88    GSYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYICGEWNFGGFPVWLKYVSGISFRTDNEP  147

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK AMQGF  KIV MMKSE LF SQGGPII+SQIENEYGP    +GA G AY  WA +MA
Sbjct  148   FKNAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESNALGAAGHAYVNWAAKMA  207

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             VG+ TGVPW+MCK++DAPDP+I+ CNG+YC+ F PNKPYKP M+TE W+GW+T+FGG VH
Sbjct  208   VGMGTGVPWVMCKEDDAPDPMINACNGFYCDAFTPNKPYKPTMWTEAWSGWFTEFGGTVH  267

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
             +RP ED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FI TSYDYDAP+DEYGL+ E
Sbjct  268   QRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  327

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKYGHL++LH+AIKL EPALVS+ P VT FG   + HVF SE+G+C AFL+NY+P   ++
Sbjct  328   PKYGHLKELHKAIKLCEPALVSADPTVTSFGSYAQAHVFSSESGSCAAFLANYNPNSFSR  387

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPV-GNGFSWQSYTEEIASS  1659
             V F+N+ Y LPPWSISILPDC+NVV+NTA V   + Q +M P       W++Y EE+AS 
Sbjct  388   VMFNNMHYSLPPWSISILPDCRNVVFNTAKVGVQTSQMQMFPADSTSLMWETYDEEVASF  447

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             DD   ++  G+ EQINVTRD+SDYLWY+T V+++  E FL+ G+ PV+TV SAGHA+HVF
Sbjct  448   DDNSLISTTGLLEQINVTRDASDYLWYITSVDVSSAEGFLQGGQLPVLTVQSAGHALHVF  507

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +LSG+ YG     ++TYT ++ LRAG N+I+LLSVAVGLPNVG+H+E WN GVLGPV
Sbjct  508   VNGQLSGSAYGTREDRRITYTGNINLRAGSNRIALLSVAVGLPNVGMHYELWNTGVLGPV  567

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
              L G++EG RDLT Q W Y+V
Sbjct  568   VLHGVDEGKRDLTWQKWSYQV  588


 Score =   132 bits (331),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLA-SNQPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE+++LN++ G+SSVEW    L +   QPLTWY+A FDAP G+DPLALDM SMGK
Sbjct  587   QVGLKGEAMNLNSLDGTSSVEWMKQSLTSQKQQPLTWYRAYFDAPAGDDPLALDMGSMGK  646

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G+ W+NG+ +GR+W  +   G C+  CNYAGTY   KCQ  CGQP+Q
Sbjct  647   GQAWINGQSIGRYWSLWAPNGDCNG-CNYAGTYRSPKCQSGCGQPTQ  692



>ref|XP_002867577.1| beta-galactosidase 12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43836.1| beta-galactosidase 12 [Arabidopsis lyrata subsp. lyrata]
Length=728

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/585 (66%), Positives = 466/585 (80%), Gaps = 7/585 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KAMVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLKYVP + FRTD
Sbjct  86    PSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPDMVFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKW  
Sbjct  146   NEPFKAAMQKFTEKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWVA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             +MA GL TGVPWIMCKQ+DAP+ II+TCNG+YCENF PN   KPKM+TE WTGW+T+FGG
Sbjct  206   KMAQGLSTGVPWIMCKQDDAPNSIINTCNGFYCENFKPNSDKKPKMWTENWTGWFTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RPAEDIA SVARFIQN GSF+NYYMYHGGTNF RTA   FIATSYDYDAPLDEYGL
Sbjct  266   AVPYRPAEDIALSVARFIQNGGSFINYYMYHGGTNFDRTAGE-FIATSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL EPALVS+ P VT  G  QE  VF+S++ +C AFLSNY+   
Sbjct  325   PREPKYSHLKRLHKVIKLCEPALVSADPTVTSLGDKQEAQVFKSQS-SCAAFLSNYNTSS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTA--TVRSPSLQTKMIPVGNGFSWQSYTEE  1647
             +A+V+F    YDLPPWS+SILPDCK   YNTA   VR+ S+  KM+P    FSW SY EE
Sbjct  384   AARVSFGGSTYDLPPWSVSILPDCKTEYYNTAKVQVRTSSIHMKMVPTNTLFSWGSYNEE  443

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             I S++D  T + DG+ EQI++TRD +DY WY+T++ I+PDE+FL  G+DP++ + SAGHA
Sbjct  444   IPSANDNGTFSQDGLVEQISITRDKTDYFWYLTDITISPDEKFL-TGEDPLLNIGSAGHA  502

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HVF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS+A GLPNVG+H+E WN GV
Sbjct  503   LHVFVNGQLAGTAYGSLEKPKLTFSQKIKLHAGVNKLALLSIAAGLPNVGVHYETWNTGV  562

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV*FAQISSQYCIHSF*NCSTI  2142
             LGPV+L G+N GT D++   W YK+          IH+    ST+
Sbjct  563   LGPVTLKGVNSGTWDMSQWKWSYKI--GTKGEALSIHTVTGSSTV  605


 Score =   153 bits (387),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE+LS++TVTGSS+VEW+ G L+A+ QPLTWYK+TFD P GN+PLALDM++MGKG
Sbjct  586   KIGTKGEALSIHTVTGSSTVEWKQGSLVATKQPLTWYKSTFDTPAGNEPLALDMNTMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             + W+NG+ +GRHWP YTA+G C   C+YAGT+ + KC  NCG+ SQ
Sbjct  646   QTWINGQNIGRHWPAYTARGKC-ERCSYAGTFTENKCLSNCGEASQ  690



>ref|XP_009388558.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=738

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/562 (70%), Positives = 466/562 (83%), Gaps = 3/562 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  41    SVSYDRKALIINGRRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  100

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y F G YDLV+F+KL ++AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  101   PGQYYFGGNYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  160

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVE-WEIGAPGKAYTKWAGQ  936
             PFK AM  F  KIV++MKSE LFESQGGPII+SQIENEYGP+E +  G   K Y  WA  
Sbjct  161   PFKAAMSKFTEKIVSVMKSEGLFESQGGPIILSQIENEYGPLEDYYGGGVAKNYASWAAH  220

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL TGVPW+MCKQ+DAPDP+I+TCNG+YC++F PNKPYKP M+TE WT WYT FGGP
Sbjct  221   MAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCDDFSPNKPYKPTMWTEAWTAWYTAFGGP  280

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FI+TSYDYDAP+DEYGL+
Sbjct  281   VPERPVEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEYGLL  340

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHLRD+H+AIK+ EPALVS+   VT  G  ++ HVF+S++GAC AFLSNY+P+ S
Sbjct  341   RKPKWGHLRDMHKAIKMCEPALVSADATVTKLGNYEQAHVFKSKSGACAAFLSNYNPKSS  400

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A VT++  +YD+PPWSISILPDCK  V+NTA V + + Q KM PVG  FSW S++EE  S
Sbjct  401   AIVTYNGKKYDIPPWSISILPDCKTAVFNTARVGAQTSQVKMSPVGK-FSWTSFSEETNS  459

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              DD ++   +G+ EQI++T D +DYLWY T ++I  +E FL+NG++PV+TVMSAGHAMHV
Sbjct  460   LDD-NSFTKNGLVEQISMTWDRTDYLWYTTSIDIGRNENFLKNGQNPVLTVMSAGHAMHV  518

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN + +GTVYGGL  PKLTYT +VKL AG NKIS+LSVAVGLPNVG HFE WN GVLGP
Sbjct  519   FINGQKAGTVYGGLDSPKLTYTGNVKLWAGSNKISILSVAVGLPNVGNHFETWNVGVLGP  578

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEG  DLT+Q W Y++
Sbjct  579   VTLEGLNEGRIDLTSQKWTYQI  600


 Score =   144 bits (362),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 85/106 (80%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G++GESL+L+T++GSSSVEW    +   NQPLTWYKA F+AP GN+PLALDMSSMGKG
Sbjct  599   QIGLRGESLNLHTISGSSSVEWGGASI---NQPLTWYKAFFNAPAGNEPLALDMSSMGKG  655

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             E W+NG+ +GR+WP Y A GSC   C+Y GTY++KKCQ  CG+ SQ
Sbjct  656   EAWINGQSIGRYWPAYKAYGSCGG-CDYHGTYSEKKCQTKCGESSQ  700



>gb|KHN17668.1| Beta-galactosidase [Glycine soja]
Length=771

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/530 (75%), Positives = 445/530 (84%), Gaps = 9/530 (2%)
 Frame = +1

Query  493   MWPGLMQKAKDGGLDVIQTYVFWNGHEPSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIG  672
             MWP L+QKAKDGGLDVIQTYVFWNGHEPSPGKY FE RYDLVKFIKL Q+AGLYVHLRIG
Sbjct  1     MWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGKYYFEDRYDLVKFIKLVQQAGLYVHLRIG  60

Query  673   PYICGEWNFGGFPIWLKYVPGIEFRTDNQPFKVAMQGFVGKIVNMMKSEKLFESQGGPII  852
             PYIC EWNFGGFP+WLKYVPGI FRTDN+PFK AMQ F  KIV++MK EKLF++QG    
Sbjct  61    PYICAEWNFGGFPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSIMKEEKLFQTQG----  116

Query  853   MSQIENEYGPVEWEIGAPGKAYTKWAGQMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYC  1032
                 ENEYGPVEWEIGAPGKAYTKW  QMAVGL TGVPWIMCKQ D PDP+IDTCNGYYC
Sbjct  117   ----ENEYGPVEWEIGAPGKAYTKWFSQMAVGLDTGVPWIMCKQIDTPDPLIDTCNGYYC  172

Query  1033  ENFHPNKPYKPKMFTELWTGWYTQFGGPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGG  1212
             ENF PNK YKPKM+TE WTGWYT+FGG V RRPAED+AFSVARF+QN GSFVNYYMYHGG
Sbjct  173   ENFTPNKKYKPKMWTENWTGWYTEFGGAVPRRPAEDMAFSVARFVQNGGSFVNYYMYHGG  232

Query  1213  TNFGRTAAALFIATSYDYDAPLDEYGLVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWF  1392
             TNF RT++ LFIATSYDYD P+DEYGL+NEPK+GHLRDLH+AIKL EPALVS  P VTW 
Sbjct  233   TNFDRTSSGLFIATSYDYDGPIDEYGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVTWP  292

Query  1393  GKNQEVHVFRSETGACVAFLSNYDPQFSAKVTFSNLQYDLPPWSISILPDCKNVVYNTAT  1572
             G N EVHVF++ +GAC AFL+NYD + SA V F N QYDLPPWSISILPDCK  V+NTA 
Sbjct  293   GNNLEVHVFKT-SGACAAFLANYDTKSSASVKFGNGQYDLPPWSISILPDCKTAVFNTAR  351

Query  1573  VRSPSLQTKMIPVGNGFSWQSYTEEIASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEV  1752
             + + S   KM  V + F WQSY EE ASS++ D++ A  +WEQINVTRDS+DYLWYMT+V
Sbjct  352   LGAQSSLMKMTAVNSAFDWQSYNEEPASSNEDDSLTAYALWEQINVTRDSTDYLWYMTDV  411

Query  1753  NIAPDEEFLRNGKDPVVTVMSAGHAMHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGIN  1932
             NI  +E F++NG+ PV+TVMSAGH +HV IN +LSGTVYGGL   KLT+++SVKLR G N
Sbjct  412   NIDANEGFIKNGQSPVLTVMSAGHVLHVLINDQLSGTVYGGLDSHKLTFSDSVKLRVGNN  471

Query  1933  KISLLSVAVGLPNVGLHFEKWNAGVLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             KISLLS+AVGLPNVG HFE WNAGVLGPV+L GLNEGTRDL+ Q W YK+
Sbjct  472   KISLLSIAVGLPNVGPHFETWNAGVLGPVTLKGLNEGTRDLSKQKWSYKI  521


 Score =   157 bits (397),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+LNTV+GSSSVEW  G LLA  QPL WYK TF  P GNDPLALDM SMGKG
Sbjct  520   KIGLKGEALNLNTVSGSSSVEWVQGSLLAKQQPLAWYKTTFSTPAGNDPLALDMISMGKG  579

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             + W+NG  +GRHWPGY A+G+C  +C YAGTY  KKC+ NCG+PSQ
Sbjct  580   QAWINGRSIGRHWPGYIARGNC-GDCYYAGTYTDKKCRTNCGEPSQ  624



>ref|XP_009408846.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=730

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/561 (70%), Positives = 462/561 (82%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ IING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  34    SVSYDHKAIIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  93

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y F G YDLV+FIKL ++AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  94    PGQYYFGGNYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGINFRTDNG  153

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM  F  KIV MMKSE LFESQGGPII+SQIENEYGPVE+  G   K Y  WA QM
Sbjct  154   PFKAAMAKFTEKIVAMMKSEGLFESQGGPIILSQIENEYGPVEYYGGTAAKNYLSWAAQM  213

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDP+I+ CNG+YC+ F PNKPYKP M+TE WTGW+T FGGPV
Sbjct  214   AVGLNTGVPWVMCKQDDAPDPVINACNGFYCDYFSPNKPYKPTMWTEAWTGWFTAFGGPV  273

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FI+TSYDYDAP+DEYGL+ 
Sbjct  274   PHRPVEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEYGLLR  333

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHLRDLH+AIK+ EPALVS  P VT  G  QE HV+RS++G+C AFLSN++P   A
Sbjct  334   QPKWGHLRDLHKAIKMCEPALVSGDPTVTKLGNYQEAHVYRSKSGSCAAFLSNFNPHSYA  393

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              VTF+ ++Y++P WSISILPDCK  V+NTA V +P+ Q KM  VG GFSW+S++E+  S 
Sbjct  394   SVTFNGMKYNIPSWSISILPDCKTSVFNTAKVGAPTSQIKMTWVG-GFSWESFSEDTNSL  452

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
              D ++   DG+ EQI++TRD +DYLWY + VNI  +E+FL+NG+ P +TVMSAGH+MHVF
Sbjct  453   GD-NSFTKDGLVEQISMTRDRTDYLWYTSYVNIDSNEQFLKNGRYPFLTVMSAGHSMHVF  511

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN E +GTV G L  PKLT+  +VKL AG NKIS+LSVAVGLPNVG HFE WNAGVLGPV
Sbjct  512   INGERAGTVSGSLDNPKLTFRENVKLWAGSNKISILSVAVGLPNVGNHFETWNAGVLGPV  571

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEG RDL++Q W Y++
Sbjct  572   TLEGLNEGKRDLSSQKWIYQI  592


 Score =   149 bits (377),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 88/106 (83%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G++GESLS++T++GSSSVEW      ++ QPLTWYKA F+AP GN+PLALDMSSMGKG
Sbjct  591   QIGLRGESLSIHTLSGSSSVEWGGA---STKQPLTWYKAFFNAPAGNEPLALDMSSMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A GSC   C+Y GTYN+KKCQ NCG+PSQ
Sbjct  648   QIWINGQSIGRYWPAYKAYGSC-DWCDYRGTYNEKKCQTNCGEPSQ  692



>ref|XP_006403764.1| hypothetical protein EUTSA_v10010152mg [Eutrema salsugineum]
 gb|ESQ45217.1| hypothetical protein EUTSA_v10010152mg [Eutrema salsugineum]
Length=725

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/563 (67%), Positives = 459/563 (82%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  VSYD ++ IING+RRIL+SGSIHYPRSTP+MWP L++K+KDGGLDVIQTYVFWNGHE
Sbjct  24    KAVVSYDHKALIINGQRRILLSGSIHYPRSTPEMWPDLIKKSKDGGLDVIQTYVFWNGHE  83

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPGKY F  RYDLVKFIKL QKAGLYV LRIGPY+C EWNFGG P+WLKYVPG+ FRTD
Sbjct  84    PSPGKYYFGDRYDLVKFIKLVQKAGLYVSLRIGPYVCAEWNFGGIPVWLKYVPGMVFRTD  143

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK+AMQ F  KIV+M+K EKLFE+QGGPII+SQIENEYGP+EWEIG+ GKAYTKW  
Sbjct  144   NEPFKIAMQKFTKKIVDMIKEEKLFETQGGPIILSQIENEYGPMEWEIGSAGKAYTKWTA  203

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
              MA+GL TGVPW+MCKQ+DAP PII+TCNG+YCE F PN   +PKM+TE WTGW+T+FGG
Sbjct  204   AMALGLSTGVPWVMCKQDDAPYPIINTCNGFYCEGFKPNSDKQPKMWTENWTGWFTEFGG  263

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              +  RP EDIAFSVARFIQN GSF+NYYMYHGGTNF RT A +F+ATSYDYDAPLDEYGL
Sbjct  264   ALPNRPVEDIAFSVARFIQNGGSFMNYYMYHGGTNFDRT-AGVFVATSYDYDAPLDEYGL  322

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL++LH+ IKL EP LVS  P +T  G  QE HVF+S+T +C AFLSNYDP +
Sbjct  323   PREPKYSHLKELHKVIKLCEPTLVSVDPTITSLGDKQEAHVFKSKT-SCAAFLSNYDPSY  381

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK   YNTA +R+P++  KM+P    FSW+SY E + 
Sbjct  382   AARVMFRGFPYDLPPWSVSILPDCKTEFYNTAKIRAPTILMKMVPTSTRFSWESYNEAVP  441

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS+D  T A DG+ EQI++TRD +DY WY+T++ I+ +E FL+ G DP++T+ SAGHA+H
Sbjct  442   SSNDAGTFAKDGLLEQISMTRDKTDYFWYLTDITISSNERFLKTGDDPLLTICSAGHALH  501

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GT YGGL+  KLT++  +KL  G+NK++LLS AVGLPN G+H+E WN GVLG
Sbjct  502   VFVNGQLAGTSYGGLSSLKLTFSQKIKLHVGVNKLALLSTAVGLPNAGVHYETWNTGVLG  561

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             P +L+G+N GT D++   W YK+
Sbjct  562   PATLNGVNSGTWDMSKWKWSYKI  584


 Score =   150 bits (380),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE++SL+T+TGSSSVEW +   +A  QPLTWYK++FD P GN+PLALDM++MGKG
Sbjct  583   KIGTKGEAMSLHTMTGSSSVEWIEESFVAKKQPLTWYKSSFDTPVGNEPLALDMNTMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +WVNG  +GRHWP YTA+G+C   CNY G YN+KKC   CGQ SQ
Sbjct  643   HVWVNGHNIGRHWPAYTARGNC-GRCNYGGIYNEKKCLSKCGQSSQ  687



>ref|XP_008799994.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=845

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/561 (68%), Positives = 454/561 (81%), Gaps = 1/561 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             VSYD ++ IING+RRILISGSIHYPRSTP MW GL+QKAKDGGLDVIQTY FWNGHEPSP
Sbjct  24    VSYDRKAIIINGQRRILISGSIHYPRSTPDMWEGLLQKAKDGGLDVIQTYAFWNGHEPSP  83

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G YNFEGRYDLV+FIK   K GLYVHLRIGPYICGEWNFGGFP+WLKY PGI FRTDN+P
Sbjct  84    GNYNFEGRYDLVRFIKTVHKVGLYVHLRIGPYICGEWNFGGFPVWLKYAPGISFRTDNEP  143

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK+AMQGF  KIV MMKSE LF SQGGPII+SQIENEYGP     GA G AY  WA +MA
Sbjct  144   FKMAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESKAFGAAGNAYVNWAAKMA  203

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             VGL TGVPW+MCK++DAPDP+I+ CNG+YC+ F PNKPYKP M+TE W+GW+T+FGG V 
Sbjct  204   VGLGTGVPWVMCKEDDAPDPVINACNGFYCDAFTPNKPYKPTMWTEAWSGWFTEFGGTVR  263

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
             +RP ED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FI TSYDYDAP+DEYGL+ E
Sbjct  264   QRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  323

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKYGHL++LH+AIKL EPALVS+ P VT  G  +E HVF SE+G C AFL+NY+P   A+
Sbjct  324   PKYGHLKELHKAIKLCEPALVSADPTVTSLGSYEEAHVFSSESGGCAAFLANYNPNSFAR  383

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGN-GFSWQSYTEEIASS  1659
             V F+N+ Y+LPPWSISILPDC+N+++NTA V   + Q +M+P  +    W++Y E++AS 
Sbjct  384   VMFNNMHYNLPPWSISILPDCRNILFNTAKVGVQTSQMQMLPANSQSLMWETYDEDVASL  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +D     A G+ EQINVTRD+SDYLWY+T V+ +P E FLR G+ PV+TV SAGHA+HVF
Sbjct  444   EDNTPTTAAGLLEQINVTRDASDYLWYITSVDASPAEGFLRGGQLPVLTVQSAGHALHVF  503

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N  LSG+ YG     + TYT S+ LRAG N+I+LLSV+VGLPNVG+H+E WN GVLGPV
Sbjct  504   VNGRLSGSAYGSRENRRFTYTGSINLRAGSNRIALLSVSVGLPNVGVHYELWNTGVLGPV  563

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
              L G++EG RDLT Q W Y+V
Sbjct  564   VLHGVDEGKRDLTWQKWSYQV  584


 Score =   131 bits (329),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLA-SNQPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE+++LNT+ G+SSVEW    L++   QPLTWY+A FDAP G+DPLALDM SMGK
Sbjct  583   QVGLKGEAMNLNTLEGTSSVEWIKESLVSQKQQPLTWYRAYFDAPAGDDPLALDMGSMGK  642

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G+ W+NG+ +GR+W  +   G C+  CNYAGTY   KCQ  C QP+Q
Sbjct  643   GQAWLNGQSIGRYWTLWAPNGDCNG-CNYAGTYRTPKCQTGCSQPTQ  688



>dbj|BAF31234.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/565 (68%), Positives = 458/565 (81%), Gaps = 7/565 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD ++ IING+R+ILISGSIHYPRSTP MW GLMQKAKDGGLDVIQTYVFWN HEPS
Sbjct  29    SVTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLMQKAKDGGLDVIQTYVFWNVHEPS  88

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG YNFEGRYDLV+F+K  QKAGLY+HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  89    PGNYNFEGRYDLVRFVKTVQKAGLYMHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  148

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK+AMQGF  KIV MMKSE LFESQGGPII+SQIENEYG     +GAPG AY  WA +M
Sbjct  149   PFKMAMQGFTEKIVQMMKSESLFESQGGPIILSQIENEYGSESKALGAPGHAYMTWAAKM  208

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL+TGVPW+MCK++DAPDP+I+TCNG+YC+ F PNKPYKP M+TE W+GW+T+FGG V
Sbjct  209   AVGLRTGVPWVMCKEDDAPDPVINTCNGFYCDAFTPNKPYKPTMWTEAWSGWFTEFGGTV  268

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
             H RP ED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FI TSYDYDAP+DEYGL+ 
Sbjct  269   HERPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIR  328

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PKYGHL++LHRAIKL EPAL+S+ PIVT  G  Q+ HVF S TG C AFLSNY+P   A
Sbjct  329   QPKYGHLKELHRAIKLCEPALISADPIVTSLGPYQQSHVFSSGTGGCAAFLSNYNPNSVA  388

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNG----FSWQSYTEE  1647
             +V F+N+ Y LPPWSISILPDC+NVV+NTA V    +QT  + +  G     SW+ Y E+
Sbjct  389   RVMFNNMHYSLPPWSISILPDCRNVVFNTAKV---GVQTSQMHMSAGETKLLSWEMYDED  445

Query  1648  IASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHA  1827
             IAS  D   + A G+ EQ+NVTRD+SDYLWYMT V+I+P E  LR G+ PV+TV SAGHA
Sbjct  446   IASLGDNSMITAVGLLEQLNVTRDTSDYLWYMTSVDISPSESSLRGGRPPVLTVQSAGHA  505

Query  1828  MHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGV  2007
             +HV+IN +LSG+ +G     + T+T  V +RAGIN+I+LLS+AV LPNVGLH+E  N GV
Sbjct  506   LHVYINGQLSGSAHGSRENRRFTFTGDVNMRAGINRIALLSIAVELPNVGLHYESTNTGV  565

Query  2008  LGPVSLSGLNEGTRDLTNQTWFYKV  2082
             LGPV L GL++G RDLT Q W Y+V
Sbjct  566   LGPVVLHGLDQGKRDLTWQKWSYQV  590


 Score =   120 bits (300),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASN-QPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE+++L   +G S VEW          QPLTWYKA F+AP G++PLALD+ SMGK
Sbjct  589   QVGLKGEAMNLVAPSGISYVEWMQASFATQKLQPLTWYKAYFNAPGGDEPLALDLGSMGK  648

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G++W+NGE +GR+W    A G C + C+YAGTY   KCQ  CGQP+Q
Sbjct  649   GQVWINGESIGRYWTA-AANGDC-NHCSYAGTYRAPKCQTGCGQPTQ  693



>ref|XP_009139943.1| PREDICTED: beta-galactosidase 12 isoform X1 [Brassica rapa]
Length=740

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/586 (67%), Positives = 467/586 (80%), Gaps = 7/586 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  V+YD ++  ING+RRIL+SGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHE
Sbjct  26    KAMVTYDHKAVTINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKA-GLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRT  750
             PSPG+Y FE RYDLVKF+KL Q+A GLYVH+RIGPY+C EWNFGGFP+WLKYVPG+ FRT
Sbjct  86    PSPGQYYFEDRYDLVKFVKLVQQADGLYVHIRIGPYVCAEWNFGGFPVWLKYVPGMAFRT  145

Query  751   DNQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA  930
             DN+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGP+EWEIGAPGKAYTKWA
Sbjct  146   DNEPFKAAMQKFTEKIVGMMKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWA  205

Query  931   GQMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFG  1110
              QMA GL TGVPWIMCKQ+DAPD II+TCNGYYCENF PN   KPKM+TE WTGW+T+FG
Sbjct  206   AQMAEGLSTGVPWIMCKQDDAPDSIINTCNGYYCENFKPNSDNKPKMWTENWTGWFTEFG  265

Query  1111  GPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYG  1290
             G V  RPAEDIAFSVARFIQN GSF+NYYMYHGGTNF RTA   F+ATSYDYDAPLDEYG
Sbjct  266   GAVPYRPAEDIAFSVARFIQNGGSFINYYMYHGGTNFDRTAGE-FMATSYDYDAPLDEYG  324

Query  1291  LVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQ  1470
             L  EPKY HL  LH+ IKL EPALVS  P VT  G  QE HVF+S++ +C AFLSNY+  
Sbjct  325   LPREPKYSHLTKLHKVIKLCEPALVSVDPTVTSLGDKQEAHVFKSKS-SCAAFLSNYNSS  383

Query  1471  FSAKVTFSNLQYDLPPWSISILPDCKNVVYNTA--TVRSPSLQTKMIPVGNGFSWQSYTE  1644
              +A+V+F    YDLPPWS+SILP+CK   YNTA   VR+PS+  KM+P     SW SY+E
Sbjct  384   SAARVSFGGSTYDLPPWSVSILPNCKTEYYNTAKVQVRAPSIHMKMVPTDTQLSWGSYSE  443

Query  1645  EIASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGH  1824
             EI S +   T A DG+ EQI++TRD +DY WY+T++ I+ DE+FL+ G+DP++T+ SAGH
Sbjct  444   EIPSPNYNGTFAKDGLVEQISITRDKTDYFWYLTDITISADEKFLKTGEDPLLTIGSAGH  503

Query  1825  AMHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAG  2004
             A+ VF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS+AVGLPNVGLH+E  N+G
Sbjct  504   ALSVFVNGQLAGTAYGSLEKPKLTFSQKIKLAAGVNKLALLSIAVGLPNVGLHYETRNSG  563

Query  2005  VLGPVSLSGLNEGTRDLTNQTWFYKV*FAQISSQYCIHSF*NCSTI  2142
             VLGPV+L G+N GT D++   W YK+          IH+    ST+
Sbjct  564   VLGPVTLEGVNSGTWDMSKWKWSYKI--GTKGEALSIHTVTGSSTV  607


 Score =   157 bits (397),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE+LS++TVTGSS+VEW++GPL+A  QPLTWYK+TF+ P GN+PLALDM++MGKG
Sbjct  588   KIGTKGEALSIHTVTGSSTVEWKEGPLVAKKQPLTWYKSTFETPAGNEPLALDMNTMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP Y A+G C   C+YAGT+N+ KC  NCG+ SQ
Sbjct  648   QVWINGQNIGRHWPAYKARGKC-ERCSYAGTFNENKCLSNCGEASQ  692



>gb|AEG76892.1| putative beta-galactosidase [Linum usitatissimum]
 gb|AEG76893.1| putative beta-galactosidase [Linum usitatissimum]
Length=731

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/561 (69%), Positives = 453/561 (81%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +V+YDG++ I+NG+RRILI+GSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  30    TVTYDGKAIIVNGQRRILIAGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  89

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG Y FE R+DLVKF+K+ Q+AGLYV+LRIGPY C EWNFGGFP+WLKYVPG+ FRTDN+
Sbjct  90    PGNYYFEDRFDLVKFVKVVQQAGLYVNLRIGPYACAEWNFGGFPVWLKYVPGMSFRTDNE  149

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIVNMMK E+LFE QGGPII+SQIENEYGP+EWE+ APGKAY +WA QM
Sbjct  150   PFKAAMQKFTEKIVNMMKQEQLFEPQGGPIILSQIENEYGPIEWELKAPGKAYAQWAAQM  209

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPWI CKQEDAPDP+IDTCN YYCE F PNK YKPKM+TE WT W+T +G PV
Sbjct  210   AVGLNTGVPWIACKQEDAPDPLIDTCNAYYCEKFTPNKSYKPKMWTEAWTAWFTSWGNPV  269

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED AFSV +FIQ+ GS+ NYYMYHGGTNFGRTA   F+ATSYDYDAPLDEYGL N
Sbjct  270   LYRPAEDQAFSVLKFIQSGGSYANYYMYHGGTNFGRTAGGPFVATSYDYDAPLDEYGLTN  329

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PKY HL+ +H+AIK +E ALVS+   VT  G NQE HV+ S +G C AFL+NYD  +S 
Sbjct  330   DPKYTHLKHMHKAIKQSEKALVSADATVTSLGTNQEAHVYSSSSG-CAAFLANYDVSYSV  388

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KV F + QYDLP WSISILPDCK  VYNTA V +P +  KM P+G GF+W SY +E+AS 
Sbjct  389   KVNFGSGQYDLPAWSISILPDCKTEVYNTAKVLAPRVHKKMTPLG-GFTWDSYIDEVASG  447

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                DT   DG+WEQ+ +T+DSSDYLWYM +V I  DE FL NGKDP + V SAGH ++VF
Sbjct  448   FASDTTTEDGLWEQLYMTKDSSDYLWYMQDVKIGSDEAFLTNGKDPFLNVQSAGHFLNVF  507

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +L G+ YG    PKLT++ SVKL  G+NKI+LLS +VGL NVGLHFE +N GVLGPV
Sbjct  508   VNGKLIGSAYGSNDNPKLTFSQSVKLNVGVNKIALLSASVGLANVGLHFENYNVGVLGPV  567

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L+GLN+GT D+T   W YKV
Sbjct  568   TLTGLNQGTVDMTKWKWSYKV  588


 Score =   156 bits (394),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE L LNTV GSSSVEW  G +LA  QPLTWYK+TF+APEGNDP+ALDM SMGKG
Sbjct  587   KVGVQGEKLQLNTVAGSSSVEWVKGSMLAKKQPLTWYKSTFNAPEGNDPVALDMISMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+G+GR+WP YTAQG+C   C+Y G + +KKC   CGQP+Q
Sbjct  647   QIWINGQGIGRYWPAYTAQGNCGG-CSYGGYFTEKKCLTGCGQPTQ  691



>ref|XP_006357461.1| PREDICTED: beta-galactosidase-like, partial [Solanum tuberosum]
Length=866

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/561 (69%), Positives = 455/561 (81%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD  + I+NG+RRIL+SGSIHYPRSTP+MWP L+QKAK+GG+DVIQTYVFWNGHEP 
Sbjct  54    SVSYDRNAIIVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEPE  113

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FE RYDLVKFIK+  +AGLYVHLR+GPY C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  114   QGKYYFEERYDLVKFIKIVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGISFRTDNE  173

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIVNMMK+E+L+ESQGGPII+SQIENEYGP+E  +G PGK+Y+ WA +M
Sbjct  174   PFKSAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPIEKRLGEPGKSYSDWAAKM  233

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             A+ L TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNK YKPK++TE WT W+T+FGGP+
Sbjct  234   ALDLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKIWTEAWTAWFTEFGGPI  293

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AF VA+FIQN GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL+ 
Sbjct  294   PYRPVEDLAFGVAKFIQNGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLLR  353

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE HVF S++G C AFL+NY+    A
Sbjct  354   QPKWGHLKDLHRAIKLCEPALVSGDPTVTSLGNFQEAHVFSSKSGVCAAFLANYNQHSFA  413

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              VTF N  Y+LPPWSISILPDCKN VYNTA V + S   KM P   GFSWQSY +E +S 
Sbjct  414   TVTFGNRHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMTPADKGFSWQSYNDEPSSY  473

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +D  T    G+ EQIN TRD SDYLWYMT+V I P E FLR+G+ P + V SAG A+HVF
Sbjct  474   ED-STFTVVGLLEQINTTRDVSDYLWYMTDVKIDPSEGFLRSGQWPWLRVSSAGPALHVF  532

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +L+GTVYG L   K+T+  +V LRAG+NKISLLS+AVGLPN+G HFE WN GVLGPV
Sbjct  533   VNGQLAGTVYGSLKSQKITFNKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNTGVLGPV  592

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SLSGLNEG RDL  Q W YKV
Sbjct  593   SLSGLNEGKRDLAWQKWSYKV  613


 Score =   145 bits (367),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW +G L+   QPLTW+K TF+AP GN+PLALDM++MGKG
Sbjct  612   KVGLKGEALNLHSLSGSSSVEWVEGSLVTQRQPLTWFKTTFNAPAGNEPLALDMNTMGKG  671

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY + G+CS+ CNYAG +N+ KC  NCG+ SQ
Sbjct  672   QMWINGQSLGRYWPGYKSSGTCSA-CNYAGYFNENKCLSNCGEASQ  716



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/561 (67%), Positives = 459/561 (82%), Gaps = 1/561 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             V+YD ++ IING+R+ILISGSIHYPRSTP MW GL+QKAKDGGLDVIQTYVFWNGHEPSP
Sbjct  28    VTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPSP  87

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G YNFEGRYDLV+FIK  QK GLYVHLR+GPY+C EWNFGGFP+WLKYVPGI FRTDN+P
Sbjct  88    GTYNFEGRYDLVRFIKTVQKVGLYVHLRVGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  147

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK+AMQGF  KIV MMKSE LF SQGGPII+SQIENEYGP    +G+ G++Y  WA  MA
Sbjct  148   FKMAMQGFTQKIVEMMKSESLFASQGGPIILSQIENEYGPESKALGSAGRSYVNWAADMA  207

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             VGL TGVPW+MCK+EDAPDP+I+TCNG+YC++F PNKPYKP M+TE W+GW+T+FGG + 
Sbjct  208   VGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSFTPNKPYKPMMWTEAWSGWFTEFGGTIR  267

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
              RPAED+AF+VARFIQN GSF+NYYMYHGGTNFGRTA   FI TSYDYDAP+DEYGL+ E
Sbjct  268   HRPAEDLAFAVARFIQNGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  327

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKYGHL++LH+AIKL E ALVS+ P VT  G  Q+ HVF SE+G C AFLSN++P   AK
Sbjct  328   PKYGHLKELHKAIKLCEQALVSADPTVTSLGSLQQAHVFSSESGGCAAFLSNHEPNSYAK  387

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVG-NGFSWQSYTEEIASS  1659
             + F+N+ Y+LPPWSISILPDC+NVV+NTA +   + Q +M P       W+ Y EE+AS 
Sbjct  388   IMFNNMHYNLPPWSISILPDCRNVVFNTAKIGVQTSQMQMYPTNTQSLMWERYDEEVASL  447

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             ++   + A G+ EQINVTRD+SDYLWY+T V+I+  EEFL+ GK PV+TV SAGHA+H+F
Sbjct  448   EENSLITATGLLEQINVTRDTSDYLWYITSVDISSAEEFLKGGKLPVLTVRSAGHALHIF  507

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +LSG+ YG     ++ ++ ++ LRAG N+I+LLSVAVGLPN G+H+E W+ GVLGPV
Sbjct  508   VNGQLSGSAYGTRENKRIKFSGNINLRAGTNRIALLSVAVGLPNSGVHYELWSTGVLGPV  567

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
              L  L+EG+RDLT QTW Y+V
Sbjct  568   VLHELDEGSRDLTWQTWSYQV  588


 Score =   140 bits (353),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G+KGE ++LN++ G+SSVEW  G L+ + QPLTWY+A FDAP+G++PLALDM+SMGKG
Sbjct  587   QVGLKGEDMNLNSLEGASSVEWMQGSLVQNQQPLTWYRAYFDAPDGDEPLALDMASMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG+ +GR+W  Y  + +C S C+Y GTY   KCQ  CGQP+Q
Sbjct  647   HVWINGQSIGRYWTAYAPKENCKS-CSYTGTYRSPKCQSGCGQPTQ  691



>ref|XP_009606115.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=844

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/562 (70%), Positives = 454/562 (81%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD  + I+NG++RILISGSIHYPRSTP+MWP L+QKAK GG+DVIQTYVFWNGHEP
Sbjct  31    ASVSYDRNAIIVNGQKRILISGSIHYPRSTPEMWPDLIQKAKKGGIDVIQTYVFWNGHEP  90

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FE RYDLVKFIKL  +AGLYVHLR+GPY C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  91    EQGKYYFEERYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGISFRTDN  150

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIVNMMK+E+L+ESQGGPII+SQIENEYGP+E  +G  GK+Y++WA +
Sbjct  151   GPFKAAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPIELRLGEAGKSYSEWAAK  210

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+ L TGVPW+MCKQ DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WT W+T+FGGP
Sbjct  211   MALDLGTGVPWVMCKQNDAPDPVINTCNGFYCDTFSPNKAYKPKMWTEAWTAWFTEFGGP  270

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED+AF VA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL+
Sbjct  271   VPYRPVEDLAFGVAKFIQTGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLL  330

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE  VFRS++GAC AFL+NY+    
Sbjct  331   RQPKWGHLKDLHRAIKLCEPALVSGDPTVTSLGHYQEARVFRSKSGACAAFLANYNQHSF  390

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A V F+N  Y+LPPWSISILPDCKN VYNTA V + S   KM PV  GFSWQSY +E AS
Sbjct  391   ATVAFANRHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMTPVNRGFSWQSYNDEPAS  450

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +D +T    G+ EQIN TRD SDYLWYMT+V I P E FL +GK P + V SAG A+HV
Sbjct  451   YED-NTFTVVGLLEQINTTRDVSDYLWYMTDVKIDPREGFLSSGKWPWLRVSSAGPALHV  509

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GTVYG L   KLT+  +V LRAG+NKISLLS+AVGLPN+G HFE WN GVLGP
Sbjct  510   FVNDQLAGTVYGSLKSQKLTFNKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNTGVLGP  569

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSLSGL+EG RDLT + W YKV
Sbjct  570   VSLSGLDEGKRDLTWRKWSYKV  591


 Score =   147 bits (371),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW +G L+A  QPLTW+K TF+AP GN+PLALDM+ MGKG
Sbjct  590   KVGLKGEALNLHSLSGSSSVEWVEGSLVAQRQPLTWFKTTFNAPAGNEPLALDMNVMGKG  649

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY A G+C + CNYAG +++ KCQ NCG+ SQ
Sbjct  650   QVWINGQSLGRYWPGYKASGTCGA-CNYAGFFSEDKCQSNCGEASQ  694



>ref|XP_010443345.1| PREDICTED: beta-galactosidase 4-like [Camelina sativa]
Length=725

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/563 (68%), Positives = 457/563 (81%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD ++ IING+RRIL+SGSIHYPRSTP+MWPGL+QKAK+GGLDVI+TYVFWNGHE
Sbjct  27    KATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGHE  86

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y F  RYDLVKFIKLA +AGLYV+LRIGP++C EWNFGGFP+WLK+VPGI FRTD
Sbjct  87    PSPGQYYFGDRYDLVKFIKLAHQAGLYVNLRIGPFVCAEWNFGGFPVWLKFVPGIAFRTD  146

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AM+ F  KIV +MK+EKLF++QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  147   NEPFKAAMKKFTEKIVWLMKAEKLFQTQGGPIILAQIENEYGPVEWEIGAPGKAYTKWVA  206

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPWIMCKQEDAP PIIDTCNGYYCE+F PN   KPKM+TE WTGWYT+FGG
Sbjct  207   QMALGLSTGVPWIMCKQEDAPSPIIDTCNGYYCEDFKPNSSNKPKMWTENWTGWYTEFGG  266

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP EDIA+SV RFI   GSFVNYYMYHGGTNF RTA   F+A+SYDYDAPLDEYGL
Sbjct  267   AVPYRPVEDIAYSVVRFIAKGGSFVNYYMYHGGTNFDRTAGE-FMASSYDYDAPLDEYGL  325

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+AIKL+EPALVS+  IVTW G  QE HVF S++ +C AFLSN D + 
Sbjct  326   TREPKYSHLKALHKAIKLSEPALVSADAIVTWLGAKQEAHVFWSKS-SCAAFLSNKDEKS  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK  VYNTA V +P +   M+P G GFSW SY E   
Sbjct  385   AARVMFRGFPYDLPPWSVSILPDCKTEVYNTAKVNAPGIHRNMVPTGTGFSWGSYNEAAP  444

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++  T A +G+ EQ+++T D SDY WY+T+V I   E FL+ G  P++T MSAGH +H
Sbjct  445   SANEAGTFARNGLVEQLSMTWDKSDYFWYLTDVTIGAGERFLKTGDYPLLTAMSAGHVVH  504

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSG+ YG LA  K+T++  +KL AG+NK++LLSVAVGLPNVG HFE+WN GVLG
Sbjct  505   VFVNGQLSGSAYGALAHTKVTFSQKIKLHAGVNKLALLSVAVGLPNVGTHFEQWNKGVLG  564

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YKV
Sbjct  565   PVTLKGVNSGTWDMSKWKWSYKV  587


 Score =   150 bits (378),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+T T SSSV W  G  +   QPLTWYK+TF  P GN+PLALDM++MGKG
Sbjct  586   KVGVKGEALSLHTNTESSSVRWTQGSFVVKRQPLTWYKSTFATPAGNEPLALDMNTMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GRHWPGY AQGSC   CNYAGTY+ KKC  NCG+ SQ
Sbjct  646   QVWINGRNIGRHWPGYKAQGSC-GRCNYAGTYDAKKCLSNCGEASQ  690



>ref|XP_009789773.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=842

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/562 (70%), Positives = 454/562 (81%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD  S I+NG++RILISGSIHYPRSTP+MWP L+QKAK GG+DVIQTYVFWNGHEP
Sbjct  29    ASVSYDRNSIIVNGQKRILISGSIHYPRSTPEMWPDLIQKAKKGGIDVIQTYVFWNGHEP  88

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FE RYDLVKFIKL  +AGLYVHLR+GPY C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  89    EQGKYYFEERYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGISFRTDN  148

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIVNMMK+E+L+ESQGGPII+SQIENEYGP+E  +G  GK+Y++WA +
Sbjct  149   GPFKAAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPMELRLGEAGKSYSEWAAK  208

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+ L TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNK YKPKM+TE WT W+T+FGGP
Sbjct  209   MALDLGTGVPWVMCKQDDAPDPVINTCNGFYCDTFSPNKDYKPKMWTEAWTAWFTEFGGP  268

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED+AF VA+FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDE+GL+
Sbjct  269   VPYRPVEDLAFGVAKFIQTGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLL  328

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P VT  G  QE  VFRS++GAC AFL+NY+    
Sbjct  329   RQPKWGHLKDLHRAIKLCEPALVSGDPTVTSLGHYQEARVFRSKSGACAAFLANYNQHSF  388

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A V F+N  Y+LPPWSISILPDC+N VYNTA V + S   KM P   GFSWQSY +E AS
Sbjct  389   ATVAFANRHYNLPPWSISILPDCRNTVYNTARVGAQSALMKMTPANRGFSWQSYNDEPAS  448

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +D +T    G+ EQIN TRD SDYLWYMT+V I P E FL +GK P + V SAG A+HV
Sbjct  449   YED-NTFTVVGLLEQINTTRDVSDYLWYMTDVKIDPREGFLSSGKWPWLRVSSAGPALHV  507

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GTVYG L   KLT+  +V LRAG+NKISLLS+AVGLPN+G HFE WN GVLGP
Sbjct  508   FVNDQLAGTVYGSLKSQKLTFNKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNTGVLGP  567

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSLSGL+EG RDLT Q W YKV
Sbjct  568   VSLSGLDEGKRDLTWQKWSYKV  589


 Score =   150 bits (380),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW +G L+A  QPLTW+K TF+AP GN+PLALDM++MGKG
Sbjct  588   KVGLKGEALNLHSLSGSSSVEWVEGSLVAQRQPLTWFKTTFNAPAGNEPLALDMNAMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY A G+C + CNYAG +N+ KCQ NCG+ SQ
Sbjct  648   QVWINGQSIGRYWPGYKASGTCGA-CNYAGYFNEDKCQSNCGEASQ  692



>emb|CDY37486.1| BnaC01g37460D [Brassica napus]
Length=839

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/563 (70%), Positives = 459/563 (82%), Gaps = 3/563 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD R+  INGKRRILISGSIHYPRS P+MWP L++KAK+GGLDVIQTYVFWNGHEPS
Sbjct  25    SVSYDSRAITINGKRRILISGSIHYPRSAPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPS  84

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEG YDLVKF+KL +++GLY+HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  85    PGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNG  144

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  MQ F  KIVNMMK+E+LFESQGGPII+SQIENEYGP+E+E+GAPG++Y  WA +M
Sbjct  145   PFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYANWAAKM  204

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDPII+ CNG+YC+ F PNK YKPKM+TE WTGW+T+FGGPV
Sbjct  205   AVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPV  264

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RPAED+AFSVARFIQ  GSF+NYYM+HGGTNFGRTA   FIATSYDYDAPLDEYGL  
Sbjct  265   PYRPAEDMAFSVARFIQKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPLDEYGLER  324

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAI L EPALVS        G  QE H ++S++GAC AFL+NY+ +  A
Sbjct  325   QPKWGHLKDLHRAINLCEPALVSGQLTRIPLGNYQEAHQYKSKSGACSAFLANYNQRSYA  384

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKM--IPVGNGFSWQSYTEEIA  1653
             KV+F    Y+LPPWSISILPDCKN VYNTA V + + + KM  +PV  G SWQ+Y E+ +
Sbjct  385   KVSFGKNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHAGLSWQAYNEDPS  444

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S  D ++    G+ EQIN TRD+SDYLWYMT+V I  +E FLR G  P +TV+SAGHAMH
Sbjct  445   SYVD-ESFTMVGLVEQINTTRDTSDYLWYMTDVKINSNEGFLRGGNLPTLTVLSAGHAMH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VFIN  L+G+ YG L  PKLT+   V LRAG NKI++LS+AVGLPNVG HFE WNAGVLG
Sbjct  504   VFINGHLTGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PVSL+GLN G RDL+ Q W YKV
Sbjct  564   PVSLNGLNGGRRDLSWQKWTYKV  586


 Score =   131 bits (329),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GESLSL++++GSSSVEW +G  +A  QPLTWYK TF AP G+ PLA+DM SMGKG
Sbjct  585   KVGLRGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ VGRHWP Y A G+C  EC+Y GT+N+ KC  NCG+ SQ
Sbjct  645   QIWINGQSVGRHWPAYKAVGTC-RECSYIGTFNENKCLRNCGEASQ  689



>ref|XP_004241849.1| PREDICTED: beta-galactosidase-like [Solanum lycopersicum]
Length=841

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/561 (69%), Positives = 454/561 (81%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD  + I+NG+RRIL+SGSIHYPRSTP+MWP L+QKAK+GG+DVIQTYVFWNGHEP 
Sbjct  29    SVSYDRNAIIVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEPE  88

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
              GKY FE RYDLVKFIK+  +AGLYVHLRIGPY C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  89    QGKYYFEERYDLVKFIKIVHQAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFRTDNA  148

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQ F  KIVNMMK+E+L+ESQGGPII+SQIENEYGP+E  +G PGK+Y+ WA +M
Sbjct  149   PFKSAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPIEKRLGEPGKSYSDWAAKM  208

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             A+ L TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNK YKPK++TE WT W+T+FGGP+
Sbjct  209   ALDLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKIWTEAWTAWFTEFGGPI  268

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AF VA+FIQN GSF+NYYMYHGGTNFGRTA   FIATSYDYDAP+DE+GL+ 
Sbjct  269   PYRPVEDLAFGVAKFIQNGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  328

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHL+DLHRAIKL EPALVS  P VT  G  Q+ HVF S++G C AFL+NY+    A
Sbjct  329   QPKWGHLKDLHRAIKLCEPALVSGDPTVTSLGNFQQAHVFTSKSGVCAAFLANYNQHSFA  388

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              VTF N  Y+LPPWSISILPDCKN VYNTA V + S   KM P   GFSWQSY +E +S 
Sbjct  389   TVTFGNRHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMTPAVRGFSWQSYNDEPSSY  448

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +D  T    G+ EQIN TRD SDYLWYMT+V I P E FLR+G+ P + V SAG A+HVF
Sbjct  449   ED-STFTVVGLLEQINTTRDVSDYLWYMTDVKIDPSEGFLRSGQWPWLKVSSAGPALHVF  507

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +L+GTVYG L   K+T+  +V LRAGINKISLLS+AVGLPN+G HFE WN GVLGPV
Sbjct  508   VNGQLAGTVYGSLKSQKITFNKAVNLRAGINKISLLSIAVGLPNIGPHFETWNTGVLGPV  567

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             SLSGLNEG RDL  Q W YKV
Sbjct  568   SLSGLNEGKRDLAWQKWSYKV  588


 Score =   145 bits (366),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW +G L+   QPLTW+K TF+AP GN+PLALDM++MGKG
Sbjct  587   KVGLKGEALNLHSLSGSSSVEWVEGSLVTQRQPLTWFKTTFNAPAGNEPLALDMNTMGKG  646

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY + G+CS+ CNYAG +N+ KC  NCG+ SQ
Sbjct  647   QMWINGQSLGRYWPGYKSSGTCSA-CNYAGYFNENKCLSNCGEASQ  691



>ref|XP_010667155.1| PREDICTED: putative beta-galactosidase [Beta vulgaris subsp. 
vulgaris]
Length=720

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/562 (69%), Positives = 454/562 (81%), Gaps = 9/562 (2%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
             G V YD ++  IN +RRIL+SGSIHYPRSTP+MWP L+QK+KD GLDVIQTYVFWNGHEP
Sbjct  28    GDVWYDNKAITINKQRRILLSGSIHYPRSTPEMWPDLIQKSKDNGLDVIQTYVFWNGHEP  87

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPGK+NFEGRYDLVKFIK  Q+AGLYVHLRIGP++C EWNFGGFP+WLKYVPGIEFRTDN
Sbjct  88    SPGKFNFEGRYDLVKFIKTIQQAGLYVHLRIGPFVCAEWNFGGFPVWLKYVPGIEFRTDN  147

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK  MQ F  KIVNMMK+EK F  QGGPII+SQIENEYGPVEWEIGAPGKAYTKWA Q
Sbjct  148   GPFKEKMQEFTAKIVNMMKAEKFFHWQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAAQ  207

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA  L  GVPWIMCKQ+DAP  +I+TCNG+YCENF PN   KPKM+TE WTGWYT+FG P
Sbjct  208   MAQSLNAGVPWIMCKQDDAPGEVINTCNGFYCENFVPNSKTKPKMWTENWTGWYTEFGKP  267

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVARFIQN GSFVNYYM+HGGTNFG TA   F+ATSYDYDAPLDEYGL 
Sbjct  268   VPYRPAEDVAFSVARFIQNGGSFVNYYMFHGGTNFGNTAGR-FVATSYDYDAPLDEYGLP  326

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPKY HL++LHRAIK+ EPALVS+ P VT  GK+QE HVF S +G C AFL+NYD Q+S
Sbjct  327   REPKYTHLKNLHRAIKMCEPALVSADPTVTSLGKHQEAHVFSSNSGRCAAFLANYDTQWS  386

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
               VTFS  +Y+LPPWSISILPDCK  VYNTA + +PS   KM P+   FSWQSY +E  S
Sbjct  387   VTVTFSGAKYELPPWSISILPDCKKEVYNTARMSAPSYHAKMTPISR-FSWQSYLDETPS  445

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             + D  + +  G++EQ+NVTRD+SDYLWY T+V +   EE       P++TVMS+GHA++V
Sbjct  446   NADDRSFSGTGLYEQLNVTRDNSDYLWYTTDVTVKRSEE-------PILTVMSSGHALNV  498

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +  GTVYG L  P++T++  V+LRAG+NKISLLS AVGL NVG HFE++N GVLGP
Sbjct  499   FVNGQFQGTVYGSLEQPQITFSQKVQLRAGLNKISLLSAAVGLANVGAHFERYNQGVLGP  558

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             ++L GL+EGT DL+   W YKV
Sbjct  559   ITLKGLSEGTWDLSKWKWSYKV  580


 Score =   148 bits (374),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G +GE+L L+T++GSSSVEWE   + A  QPLTW+K TF+APEGNDPLALDMSSMGKG
Sbjct  579   KVGTRGENLGLHTISGSSSVEWEQSAV-ARKQPLTWFKTTFNAPEGNDPLALDMSSMGKG  637

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NGE +GRHWP   A+G C  +CNYAGTY Q KC   CGQPSQ
Sbjct  638   QMWINGESIGRHWPANKARGKC-GQCNYAGTYIQNKCLGECGQPSQ  682



>emb|CDY11899.1| BnaC03g13250D [Brassica napus]
Length=722

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/563 (68%), Positives = 457/563 (81%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD ++ IING+RRIL+SGSIHYPRSTP+MWPGL+QKAK+GGLDVI+TYVFWNGHE
Sbjct  26    KATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG Y F  RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLK+VPG+ FRTD
Sbjct  86    PSPGNYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AM+ F  KIV MMK+EKLF++QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  146   NEPFKAAMKKFTEKIVWMMKAEKLFQTQGGPIILAQIENEYGPVEWEIGAPGKAYTKWVA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPWIMCKQEDAP PIIDTCNGYYCENF PN   KPKM+TE WTGWYT+FGG
Sbjct  206   QMALGLSTGVPWIMCKQEDAPSPIIDTCNGYYCENFKPNSNNKPKMWTENWTGWYTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP EDIA+SVARFIQN GSFVNYYMYHGGTNF RTA   F+A+SYDYDAPLDEYGL
Sbjct  266   AVPYRPVEDIAYSVARFIQNGGSFVNYYMYHGGTNFDRTAGE-FMASSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL+EPALVS+   VT+ G  QE HVF S++ +C AFLSN D   
Sbjct  325   TREPKYSHLKALHKVIKLSEPALVSADATVTYLGAKQEAHVFWSKS-SCAAFLSNNDANS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK   YNTA V +P +   M+P G  FSW+S+ E   
Sbjct  384   AARVMFRGFPYDLPPWSVSILPDCKTEYYNTAKVNAPRIHRTMVPTGTRFSWESFNEATP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++ DT A +G+ EQI++T D SDY WY+T++ I   E FL+ G  P++T+ SAGHA+H
Sbjct  444   SANERDTFARNGLVEQISMTWDKSDYFWYLTDITIGAGERFLKTGDYPLLTIWSAGHALH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+G+ YGGL+ PKLT++  +KL AG+NK++LLSVAVGLPNVG HFE WN GVLG
Sbjct  504   VFVNGQLAGSAYGGLSHPKLTFSQKIKLHAGVNKLALLSVAVGLPNVGQHFETWNKGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YK+
Sbjct  564   PVTLKGVNSGTWDMSKWKWSYKI  586


 Score =   140 bits (352),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE++SL+T   SSSV W  G  +   QPLTWYK+TF AP GN+PLALDM++MGKG
Sbjct  585   KIGVKGEAMSLHT--DSSSVSWNQGSYVVKKQPLTWYKSTFSAPGGNEPLALDMNTMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG  +GRHWP Y AQG+C   CNYAGT++ KKC  NCG+ SQ
Sbjct  643   HVWINGRNIGRHWPAYKAQGNC-RRCNYAGTFDAKKCLSNCGEASQ  687



>ref|XP_010483173.1| PREDICTED: beta-galactosidase 4 [Camelina sativa]
Length=725

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/563 (68%), Positives = 457/563 (81%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD ++ IING+RRIL+SGSIHYPRSTP+MWPGL+QKAK+GGLDVI+TYVFWNGHE
Sbjct  27    KATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGHE  86

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y F  RYDLVKFIKLA +AGLYV+LRIGPY+C EWNFGGFP+WLK+VPG+ FRTD
Sbjct  87    PSPGQYYFGDRYDLVKFIKLAHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRTD  146

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AM+ F  KIV +MK+EKLF++QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  147   NEPFKAAMKKFTEKIVWLMKAEKLFQTQGGPIILAQIENEYGPVEWEIGAPGKAYTKWVA  206

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPWIMCKQEDAP PIIDTCNGYYCE+F PN   KPKM+TE WTGWYT+FGG
Sbjct  207   QMALGLSTGVPWIMCKQEDAPSPIIDTCNGYYCEDFKPNSINKPKMWTENWTGWYTEFGG  266

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP EDIA+SV RFI   GSFVNYYMYHGGTNF RTA   F+A+SYDYDAP+DEYGL
Sbjct  267   AVPYRPVEDIAYSVVRFIAKGGSFVNYYMYHGGTNFDRTAGE-FMASSYDYDAPIDEYGL  325

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+AIKL+EPALVS+   VTW G  QE HVF S++ +C AFLSN D + 
Sbjct  326   TREPKYSHLKALHKAIKLSEPALVSADATVTWLGAKQEAHVFWSKS-SCAAFLSNKDEKS  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK  VYNTA V +P +   M+P G GFSW SY E   
Sbjct  385   AARVMFRGFPYDLPPWSVSILPDCKTEVYNTAKVNAPGIHRNMVPTGTGFSWGSYNEAAP  444

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++  T A +G+ EQ+++T D SDY WY+T+V I   E FL+ G  P++TVMSAGH +H
Sbjct  445   SANEAGTFARNGLVEQLSMTWDKSDYFWYLTDVTIGAGERFLKTGDYPLLTVMSAGHVVH  504

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSG+ YG LA  K+T++  +KL AG+NK++LLSVAVGLPNVG HFE+WN GVLG
Sbjct  505   VFVNGQLSGSAYGALAHTKVTFSQKIKLHAGVNKLALLSVAVGLPNVGTHFEQWNKGVLG  564

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YKV
Sbjct  565   PVTLKGVNSGTWDMSKWKWSYKV  587


 Score =   150 bits (378),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+T T SSSV W  G  +   QPLTWYK+TF  P GN+PLALDM++MGKG
Sbjct  586   KVGVKGEALSLHTNTESSSVRWTQGSFVVKRQPLTWYKSTFATPAGNEPLALDMNTMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GRHWPGY AQGSC   CNYAGTY+ KKC  NCG+ SQ
Sbjct  646   QVWINGRNIGRHWPGYKAQGSC-GRCNYAGTYDAKKCLSNCGEASQ  690



>ref|XP_009132166.1| PREDICTED: beta-galactosidase 4 [Brassica rapa]
Length=722

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/563 (67%), Positives = 457/563 (81%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD ++ IING+RRIL+SGSIHYPRSTP+MWPGL+QKAK+GGLDVI+TYVFWNGHE
Sbjct  26    KATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG Y F  RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLK+VPG+ FRTD
Sbjct  86    PSPGNYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AM+ F  KIV MMK+EKLF++QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  146   NEPFKAAMKKFTEKIVWMMKAEKLFQTQGGPIILAQIENEYGPVEWEIGAPGKAYTKWVA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPWIMCKQEDAP PIIDTCNGYYCENF PN   KPKM+TE WTGWYT+FGG
Sbjct  206   QMALGLSTGVPWIMCKQEDAPSPIIDTCNGYYCENFKPNSNNKPKMWTENWTGWYTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP EDIA+SVARFIQN GSFVNYYMYHGGTNF RTA   F+A+SYDYDAPLDEYGL
Sbjct  266   AVPYRPVEDIAYSVARFIQNGGSFVNYYMYHGGTNFDRTAGE-FMASSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL+EPALVS+   VT+ G  QE HVF S++ +C AFLSN D   
Sbjct  325   TREPKYSHLKALHKVIKLSEPALVSADATVTYLGAKQEAHVFWSKS-SCAAFLSNNDANS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK   YNTA V +P +   M+P G  FSW+S+ E   
Sbjct  384   AARVMFRGFPYDLPPWSVSILPDCKTEYYNTAKVNAPRVHRNMVPTGTRFSWESFNEATP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++ DT A +G+ EQI++T D SDY WY+T++ +   E FL+ G  P++T+ SAGHA+H
Sbjct  444   SANERDTFARNGLVEQISMTWDKSDYFWYLTDITVGAGERFLKTGDYPLLTIWSAGHALH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+G+ YGGL+ PKLT++  +KL AG+NK++LLSVAVGLPNVG HFE WN GVLG
Sbjct  504   VFVNGQLAGSAYGGLSHPKLTFSQKIKLHAGVNKLALLSVAVGLPNVGQHFETWNKGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YK+
Sbjct  564   PVTLKGVNSGTWDMSKWKWSYKI  586


 Score =   138 bits (348),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE++SL+T   SSSV W  G  +   QPLTWYK+TF AP GN+PLA+DM++MGKG
Sbjct  585   KIGVKGEAMSLHT--DSSSVSWNQGSYVIKKQPLTWYKSTFAAPGGNEPLAIDMNTMGKG  642

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
              +W+NG  +GRHWP Y AQG+C   CNYAGT++ KKC  NCG+ SQ
Sbjct  643   HVWINGRNIGRHWPAYKAQGNC-GRCNYAGTFDAKKCLSNCGEASQ  687



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/561 (67%), Positives = 456/561 (81%), Gaps = 1/561 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             V+YD ++ IING+RRILISGSIHYPRSTP MW GL+QKA+DGGLDVIQTYVFWNGHEPSP
Sbjct  24    VTYDRKAIIINGRRRILISGSIHYPRSTPDMWEGLVQKARDGGLDVIQTYVFWNGHEPSP  83

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G YNFEGRYDLV+FIK A K G+YVHLRIGPY+CGEWNFGGFP+WLKYVPGI FRTDN+P
Sbjct  84    GNYNFEGRYDLVRFIKTAHKVGMYVHLRIGPYVCGEWNFGGFPVWLKYVPGISFRTDNEP  143

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK+AMQGF  KIV MMKSE LF SQGGPII+SQIENEYGP      A G AY  WA +MA
Sbjct  144   FKIAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESKAFDAAGHAYVNWAAKMA  203

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             VGL TGVPW+MCK++DAPDP+I+ CNG+YC+ F PNKPYKP M+TE W+GW+T+FGG V 
Sbjct  204   VGLGTGVPWVMCKEDDAPDPVINACNGFYCDAFTPNKPYKPTMWTEAWSGWFTEFGGTVR  263

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
             +RP ED+AF+VARF+Q  GSF+NYYMYHGGTNFGRTA   FI+TSYDYDAP+DE+GL+ E
Sbjct  264   QRPVEDLAFAVARFLQKGGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEFGLIRE  323

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKYGHLR+LH+AIKL E ALVS+ P VT  G  +E HVF SE+G C AFL+NY+P   A+
Sbjct  324   PKYGHLRELHKAIKLCESALVSADPTVTSLGSYEEAHVFSSESGGCAAFLANYNPNSFAR  383

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGN-GFSWQSYTEEIASS  1659
             V F+N+ Y+LPPWSISILPDC+N+V+NTA V   + Q +M+P  +    W++Y E++AS 
Sbjct  384   VIFNNMHYNLPPWSISILPDCRNIVFNTAKVGVQTSQMQMLPANSQSLMWETYDEDVASL  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
              D   +   G+ EQINVTRD+SDYLWY+T V+++P E FLR G+ PV+TV SAGHA+HVF
Sbjct  444   GDNSLITIAGLLEQINVTRDASDYLWYITSVDVSPAEGFLRGGQFPVLTVQSAGHALHVF  503

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +LSG+ YG     ++TYT +V L AG N+I+LLSVAVGLPN G+H+E WN GVLGPV
Sbjct  504   VNGQLSGSAYGNRKNRRITYTGNVNLHAGSNRIALLSVAVGLPNAGVHYELWNTGVLGPV  563

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
              L G++EG RDLT Q W Y+V
Sbjct  564   VLHGVDEGKRDLTWQKWSYQV  584


 Score =   130 bits (326),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQ-PLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE+++LN++ G+SSVEW    L++  Q PLTWY+A FDAP G+DPL LDM SMGK
Sbjct  583   QVGLKGEAMNLNSLEGTSSVEWIKESLVSQRQQPLTWYRAYFDAPAGHDPLGLDMGSMGK  642

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G+ W+NG+ +GR+W      G C   CNYAGTY   KCQ  CGQP+Q
Sbjct  643   GQAWINGQSIGRYWTLLAPNGDCKG-CNYAGTYRIPKCQTGCGQPTQ  688



>gb|KFK34528.1| hypothetical protein AALP_AA5G157800 [Arabis alpina]
Length=708

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/563 (66%), Positives = 459/563 (82%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             +  VSYD ++ IING+RRIL+SGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHE
Sbjct  7     KAEVSYDHKALIINGQRRILLSGSIHYPRSTPEMWPDLVKKAKEGGLDVIQTYVFWNGHE  66

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIK+ Q+AGLYV LRIGPY+C EWNFGG P+WLKYVPGI FRTD
Sbjct  67    PSPGQYYFEDRYDLVKFIKVVQQAGLYVSLRIGPYVCAEWNFGGLPVWLKYVPGIVFRTD  126

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK+AMQ F  KIV+MMK EKLFE+QGGPII+SQIENE+GP+EWEIG+ GKAY+KW  
Sbjct  127   NEPFKIAMQKFTKKIVDMMKQEKLFETQGGPIILSQIENEFGPMEWEIGSAGKAYSKWTA  186

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             Q+A+GL TGVPWIMCKQEDAP PII+TCNG+YCE F PN   +P+M+TE WTGW+T+FGG
Sbjct  187   QIALGLSTGVPWIMCKQEDAPYPIINTCNGFYCEGFKPNSVNQPQMWTENWTGWFTEFGG  246

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
             P+  RP ED+A+SVARFIQN GSF+NYYMYHGGTNF RT + +F+ TSYDYDAPLDEYGL
Sbjct  247   PLPNRPVEDLAYSVARFIQNGGSFMNYYMYHGGTNFDRT-SGVFVGTSYDYDAPLDEYGL  305

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
             + EPKY HL++LH+ IKL EPALVS+ P +TW G  QE HVF S+T +C AFLSNYDP +
Sbjct  306   LREPKYSHLKELHKVIKLCEPALVSADPTITWLGDKQEAHVFNSKT-SCAAFLSNYDPIY  364

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             + +V F    YDLP WS+SILPDCK   +NTA +R PS+  KM+P    FSW+SY EEI 
Sbjct  365   ATRVMFRGFPYDLPAWSVSILPDCKTEYHNTAKIRVPSIFMKMVPTRTRFSWESYHEEIP  424

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             SS D  T A DG+ EQI++TRD +DY WY+ ++ I+ DE+FL+ G DP++T+ SAGHA+H
Sbjct  425   SSYDVGTFAKDGLVEQISMTRDKTDYFWYLADITISSDEKFLKTGVDPLLTICSAGHALH  484

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+GT YG L+  K T++  +KLR GINK++LLS AVGLPN G+H+E WN GVLG
Sbjct  485   VFVNGQLAGTSYGALSNSKFTFSQKIKLRVGINKLALLSTAVGLPNAGVHYETWNTGVLG  544

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             P +L G+N GT D++   W YK+
Sbjct  545   PATLYGVNSGTWDMSKWKWSYKI  567


 Score =   154 bits (390),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGE+LSL+TVTGSSSVEW  G  +A  QPL WYK+ FD P GN+PLALDM++MGKG
Sbjct  566   KIGTKGEALSLHTVTGSSSVEWIKGSFVAKKQPLIWYKSYFDTPVGNEPLALDMNTMGKG  625

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++WVNG  +GRHWP Y A+G+C S CNY G YN+KKC  NCGQ SQ
Sbjct  626   QVWVNGHNIGRHWPAYKARGNC-SRCNYGGIYNEKKCLSNCGQASQ  670



>ref|XP_008809207.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=852

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/561 (68%), Positives = 455/561 (81%), Gaps = 1/561 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             V+YD ++ +ING RRILISGSIHYPRSTP MW GL+QKAKDGGLDV+QTYVFWNGHEPSP
Sbjct  31    VTYDRKAVVINGHRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVVQTYVFWNGHEPSP  90

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G YNF+G YDLV+FIK  QKAGLYVHLRIGPYICGEWNFGGFP+WLKYV GI FRTDN+P
Sbjct  91    GSYNFKGSYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVSGISFRTDNEP  150

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK AMQGF  KIV MMKSE LF SQGGPII+SQIENEYGP     GA G AY  WA +MA
Sbjct  151   FKTAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESNAFGAAGHAYVNWAAKMA  210

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             VG+ TGVPW+MCK+EDAPDP+I+ CNG+YC+ F PNKPYKP M+TE W+GW+T+FGG V 
Sbjct  211   VGMGTGVPWVMCKEEDAPDPMINACNGFYCDAFTPNKPYKPTMWTEAWSGWFTEFGGTVR  270

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
             +RP ED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FI TSYDYDAP+DEYGL+ E
Sbjct  271   QRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  330

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKYGHL++LH+AIKL EPALVS+ P VT  G  ++ HVF SE+G C AFL+NY+    A+
Sbjct  331   PKYGHLKELHKAIKLCEPALVSADPTVTSLGSYEQAHVFSSESGRCAAFLANYNLNSVAR  390

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPV-GNGFSWQSYTEEIASS  1659
             V F+N+ Y+LPPWSISILPDC+NVV+NTA V   + Q +M P       W++Y EE+AS 
Sbjct  391   VMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMFPADSQSLMWETYDEEVASL  450

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +D   ++  G+ EQINVTRD+SDYLWY+T V+++P E FLR G+ PV+TV SAGHA+HVF
Sbjct  451   EDNSLISTTGLLEQINVTRDASDYLWYITSVDVSPAEGFLRGGQLPVLTVQSAGHALHVF  510

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +LSG+ YG     ++TYT ++ LRAG N+I+LLSVAVGLPNVG+H+E WN GVLGPV
Sbjct  511   VNDQLSGSAYGTRENRRITYTGNINLRAGSNRIALLSVAVGLPNVGVHYELWNTGVLGPV  570

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
              L G++EG RDLT Q W Y+V
Sbjct  571   VLHGVDEGKRDLTWQKWSYQV  591


 Score =   131 bits (329),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLA-SNQPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE++++N++ G+SSVEW    L +   QPLTWY+A FDAP G+DPLALDM SMGK
Sbjct  590   QVGLKGEAMNINSLDGTSSVEWMKESLASQKQQPLTWYRAYFDAPAGDDPLALDMGSMGK  649

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G++W+NG+ VGR+W  +   G C   CNYAGTY    CQ  CGQP+Q
Sbjct  650   GQVWINGQSVGRYWSLWAPDGDCKG-CNYAGTYRSPNCQSGCGQPTQ  695



>gb|KHG11296.1| Beta-galactosidase [Gossypium arboreum]
Length=706

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/562 (68%), Positives = 452/562 (80%), Gaps = 32/562 (6%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              +VSYD ++ IING+RRIL+SGSIHYPRSTP+                            
Sbjct  35    ATVSYDSKAIIINGRRRILLSGSIHYPRSTPE----------------------------  66

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
                 Y FE RYDLV+F+KL Q+AGLYV+LRIGPY+C EWNFGGFP+WLKYV GI FRTDN
Sbjct  67    ----YYFEDRYDLVRFVKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVRGIAFRTDN  122

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
              PFK AMQ F  KIVNMMK+EKLF++QGGPIIM+QIENE+GPVEWEIGAPGK+YTKWA Q
Sbjct  123   GPFKAAMQKFTAKIVNMMKAEKLFQTQGGPIIMAQIENEFGPVEWEIGAPGKSYTKWAAQ  182

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAVGL+TGVPWIMCKQ+DAPDP+I+TCNG+YCENF PN  YKPKM+TE WTGW+T+FGG 
Sbjct  183   MAVGLRTGVPWIMCKQDDAPDPVINTCNGFYCENFTPNAKYKPKMWTENWTGWFTEFGGA  242

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAEDIAFSVARFIQN GSFVNYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL 
Sbjct  243   VPTRPAEDIAFSVARFIQNGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLT  302

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHLRDLH+AIK +E ALVS+YP VT  G  QE HVF+S++GAC AFL+NYD ++S
Sbjct  303   REPKWGHLRDLHKAIKSSEAALVSAYPTVTSLGSKQEAHVFKSKSGACAAFLANYDTRYS  362

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              KV F N QYDLP WSISILPDCK  V+NTA + + S +  M+P+   FSWQSY E+  +
Sbjct  363   VKVKFGNGQYDLPRWSISILPDCKTAVFNTARIGAHSSKKAMVPLNRAFSWQSYNEQSPT  422

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             +DD +    +G+WEQI +TRD+SDYLWYMT+V I P+E FL+ G+ P++TV SAGHA+HV
Sbjct  423   ADDREATVHNGLWEQIYLTRDASDYLWYMTDVKIDPNEGFLKGGQGPILTVWSAGHALHV  482

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSGTVYGGL  PKLT++N+VKLRAGIN+ISLLSVAVGLPNVG HFE WNAG+LGP
Sbjct  483   FINGQLSGTVYGGLDNPKLTFSNNVKLRAGINRISLLSVAVGLPNVGTHFETWNAGILGP  542

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLNEGTRD++ Q W YK+
Sbjct  543   VTLKGLNEGTRDISKQNWSYKI  564


 Score =   162 bits (410),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L+TVTGSSSVEW  G  L   QP+TWYK TF+AP GN+PLALDMSSMGKG
Sbjct  563   KIGLKGEALNLHTVTGSSSVEWVQGSQLVKKQPMTWYKTTFNAPGGNEPLALDMSSMGKG  622

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWPGY A+GSC + C+YAGTY  KKC+ NCG+PSQ
Sbjct  623   QVWINGQSIGRHWPGYIARGSCGA-CDYAGTYTDKKCRTNCGEPSQ  667



>ref|XP_009409594.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=735

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/561 (69%), Positives = 461/561 (82%), Gaps = 2/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ I+NG+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  39    SVSYDHKAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  98

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y F G YDLV+FIKL + AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  99    PGQYYFGGNYDLVRFIKLVKHAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGINFRTDNE  158

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM  F  KIV MMKSE+LFESQGGPII+SQIENEYGP+E   GA  K Y  WA QM
Sbjct  159   PFKAAMAKFTEKIVAMMKSERLFESQGGPIILSQIENEYGPMEKFGGAAAKNYVTWAAQM  218

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDP+I+ CNG+YC+ F PNKPYKP M+TE WTGW+T FGGPV
Sbjct  219   AVGLNTGVPWVMCKQDDAPDPVINACNGFYCDYFSPNKPYKPTMWTEAWTGWFTGFGGPV  278

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP +D+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FIATSYDYDAP+DEYGL+ 
Sbjct  279   PHRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLLR  338

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHLRDLH+AIK  EPALVS+ P VT  G  QE HVFRS++GAC AFLSN++P   A
Sbjct  339   QPKWGHLRDLHKAIKWCEPALVSADPTVTKLGNYQEAHVFRSKSGACAAFLSNFNPHSYA  398

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              VTF+ ++Y +P WS+SILPDCK  V+NTA V +P+ Q  M  VG GFSW+S++E   S 
Sbjct  399   PVTFNGMKYYIPAWSVSILPDCKTAVFNTAKVGAPTSQIIMTWVG-GFSWESFSEVTHSL  457

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
              D  + + DG+ EQI++TRD +DYLWY T VNI  +E+FL+NG+DP++TVMSAGH+MHVF
Sbjct  458   RD-KSFSKDGLVEQISLTRDRTDYLWYTTYVNIDSNEQFLKNGRDPLLTVMSAGHSMHVF  516

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N E +GTVYG    PK+ +T +VKL AG NKIS+LSVAVGLPN+G HF+  NAGVLGPV
Sbjct  517   VNGERAGTVYGSFGSPKVRFTGNVKLWAGSNKISILSVAVGLPNIGPHFDTRNAGVLGPV  576

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEG R+L++Q W Y++
Sbjct  577   TLEGLNEGKRNLSSQKWIYQI  597


 Score =   149 bits (375),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G++GESLS+ T++GSSSV+W      ++ QPLTWYKA F+AP GN+PLALDMSSMGKG
Sbjct  596   QIGLRGESLSIYTLSGSSSVKWWGA---STRQPLTWYKAFFNAPAGNEPLALDMSSMGKG  652

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A GSC   C+Y GTYNQKKCQ NCG+PSQ
Sbjct  653   QIWINGQSIGRYWPAYKAYGSC-DWCDYRGTYNQKKCQTNCGEPSQ  697



>gb|EPS62826.1| beta-galactosidase, partial [Genlisea aurea]
Length=638

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/560 (68%), Positives = 453/560 (81%), Gaps = 1/560 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             VSYD +   ING++++LISGSIHYPRSTP+MWP L+QKAKDGG+DVIQTYVFWNGHEP P
Sbjct  18    VSYDSKGISINGQKKLLISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYVFWNGHEPEP  77

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G Y F  RYDLV+FIKL Q+AGLY HLRIGPY C EWNFGGFPIWLKYVPGI FRTDN P
Sbjct  78    GNYYFGDRYDLVRFIKLVQQAGLYAHLRIGPYACAEWNFGGFPIWLKYVPGISFRTDNGP  137

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK AMQ F  KIVNMMK+EKL+ SQGGPI++SQIENEYGPVEW +G PGK+Y +WA  MA
Sbjct  138   FKAAMQKFTTKIVNMMKAEKLYASQGGPIVLSQIENEYGPVEWAVGNPGKSYIQWAADMA  197

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             V L TGVPWIMCKQ+DAPDPII+TCNG+YC+ F PNK YKPK++TE WTGW+T+FGG V 
Sbjct  198   VNLGTGVPWIMCKQDDAPDPIINTCNGFYCDYFTPNKAYKPKIWTEAWTGWFTEFGGAVP  257

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
              RP +D+AF+VARF Q  GS+VNYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL+ E
Sbjct  258   YRPVQDMAFAVARFFQTGGSYVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLRE  317

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PK+GHL+DLHRAIKL E AL+     VT  G ++E HV+++ +GAC  FL+NYD    A 
Sbjct  318   PKWGHLKDLHRAIKLCEQALLYGTHTVTSLGNSREAHVYKTTSGACALFLANYDKNSYAT  377

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASSD  1662
             ++F N QY+LPPWSISILPDCKNVVYNTA + S + + KM  VG GF W+SY EE A   
Sbjct  378   LSFWNSQYNLPPWSISILPDCKNVVYNTAMIGSQTSKMKMSNVGGGFDWKSYYEETA-FH  436

Query  1663  DGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFI  1842
              G+   A G+ EQIN TRD++DYLWY TEV I P E FL++G  PV+TV+SAGHA+HVF+
Sbjct  437   HGNLFTATGLVEQINTTRDNTDYLWYSTEVVIDPSEGFLKSGVWPVLTVLSAGHALHVFV  496

Query  1843  NSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVS  2022
             N +L GT YG L  P+LT++ SV L++G+N+I LLS+AVGLPNVG HFE WNAG+LGPV+
Sbjct  497   NGQLVGTAYGRLEEPRLTFSKSVNLKSGVNQIELLSIAVGLPNVGTHFETWNAGILGPVT  556

Query  2023  LSGLNEGTRDLTNQTWFYKV  2082
             L+GLN+G RDLT Q W Y++
Sbjct  557   LTGLNQGKRDLTWQKWTYQI  576


 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G+KGE LSL+T TG SSV+W  G  +   QPLTWYKATF+AP GN+PLALDM+SM KG
Sbjct  575   QIGLKGEFLSLHTTTGDSSVDWMQGSYVGQRQPLTWYKATFNAPSGNEPLALDMNSMSKG  634

Query  2336  EIWV  2347
             +IW+
Sbjct  635   QIWI  638



>ref|XP_002876169.1| AT3g52840/F8J2_10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52428.1| AT3g52840/F8J2_10 [Arabidopsis lyrata subsp. lyrata]
Length=728

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/560 (67%), Positives = 454/560 (81%), Gaps = 2/560 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             V+YD ++ IING+RRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPSP
Sbjct  29    VTYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIKKAKEGGLDVIQTYVFWNGHEPSP  88

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G Y F+ RYDLVKF KL  +AGLY+ LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+P
Sbjct  89    GNYYFQDRYDLVKFTKLVHQAGLYLDLRIGPYVCAEWNFGGFPVWLKYVPGIVFRTDNEP  148

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK+AMQ F  KIV+MMK EKLFE+QGGPII+SQIENEYGP+EWE+GA GKAY+KW  +MA
Sbjct  149   FKIAMQRFTKKIVDMMKEEKLFETQGGPIILSQIENEYGPMEWEMGAAGKAYSKWTAEMA  208

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             +GL TGVPWIMCKQEDAP PIIDTCNG+YCE F PN   KPK++TE WTGW+T+FGG + 
Sbjct  209   LGLSTGVPWIMCKQEDAPYPIIDTCNGFYCEGFKPNSDNKPKLWTENWTGWFTEFGGAIP  268

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
              RP EDIAFSVARFIQN GSF+NYYMY+GGTNF RT A +FIATSYDYDAPLDEYGL+ E
Sbjct  269   NRPVEDIAFSVARFIQNGGSFLNYYMYYGGTNFDRT-AGVFIATSYDYDAPLDEYGLLRE  327

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKY HL++LH+ IKL EPALVS  P +T  G  QEVHVF+S+T +C AFLSNYD   +A+
Sbjct  328   PKYSHLKELHKVIKLCEPALVSVDPTITSLGDKQEVHVFKSKT-SCAAFLSNYDTSSAAR  386

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASSD  1662
             + F    YDLPPWS+SILPDCK   YNTA +R+P++  KM+P    FSW+SY E   SS+
Sbjct  387   IMFRGFPYDLPPWSVSILPDCKTEYYNTAKIRAPTILMKMVPTSTKFSWESYNEGSPSSN  446

Query  1663  DGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFI  1842
             D  T   DG+ EQI++TRD +DY WY+T++ I  DE FL+ G DP++T+ SAGHA+HVF+
Sbjct  447   DDGTFVKDGLVEQISMTRDKTDYFWYLTDITIGSDESFLKTGDDPLLTIFSAGHALHVFV  506

Query  1843  NSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVS  2022
             N  L+GT YG L+  KLT++  +KL  GINK++LLS AVGLPN G+H+E WN GVLGPV+
Sbjct  507   NGLLAGTSYGALSNSKLTFSQKIKLSVGINKLALLSTAVGLPNAGVHYETWNTGVLGPVT  566

Query  2023  LSGLNEGTRDLTNQTWFYKV  2082
             L G+N GT D++   W YK+
Sbjct  567   LKGVNSGTWDMSKWKWSYKI  586


 Score =   147 bits (370),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 87/107 (81%), Gaps = 2/107 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEW-EDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             ++G++GE++S +T+ GSS+V+W   G  +   +PLTWYK++FD P+GN+PLALDM++MGK
Sbjct  585   KIGIRGEAMSFHTIAGSSAVKWWIKGSFVVKKEPLTWYKSSFDTPKGNEPLALDMNTMGK  644

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G++WVNG  +GRHWP YTA+G+C   CNYAG YN+KKC  +CG+PSQ
Sbjct  645   GQVWVNGHNIGRHWPAYTARGNC-GRCNYAGIYNEKKCLSHCGEPSQ  690



>ref|XP_009409593.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=712

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/561 (68%), Positives = 458/561 (82%), Gaps = 1/561 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ I+NG+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  15    SVSYDHKAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  74

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y F G YDLV+FIKL ++AGLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  75    PGQYYFGGNYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGITFRTDNE  134

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM  F  KIV MMKSE LFESQGGPII+SQIENEYGP+E   G   K Y  WA QM
Sbjct  135   PFKAAMAKFTEKIVAMMKSEGLFESQGGPIILSQIENEYGPMENFGGDGAKNYVNWAAQM  194

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL T VPW+MCKQ+DAPDP+I+ CNG+YC+ F PNKPYKP M+TE W+GW++ FG PV
Sbjct  195   AVGLNTSVPWVMCKQDDAPDPVINACNGFYCDYFSPNKPYKPTMWTEAWSGWFSAFGAPV  254

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FIAT+YDYDAP+DEYGL+ 
Sbjct  255   PHRPVEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATTYDYDAPIDEYGLLR  314

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHLRDLH+AIK  EPALVS  P VT  GK Q  HV+RS++GAC AFLSN++   SA
Sbjct  315   QPKWGHLRDLHKAIKSCEPALVSGDPTVTNVGKYQTAHVYRSKSGACAAFLSNFNRLSSA  374

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
             KVTF+ ++Y +P WS SILPDCK  V+NTA V +P+ Q  M  VG GFSW+SY E+  S 
Sbjct  375   KVTFNGMEYHIPAWSTSILPDCKTAVFNTAKVGAPTSQINMTRVG-GFSWESYGEDTHSL  433

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
                 + + DG+ EQI++TRD +DYLWY T+VNI  +E+FL+NG+DP++TVMSAGH+MHVF
Sbjct  434   LRDKSFSKDGLVEQISMTRDRTDYLWYTTDVNIDSNEQFLKNGRDPLLTVMSAGHSMHVF  493

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N E +GT YG    PK+ +T +VKLRAG NKIS+LSVAVGLPN+G HF+ WNAGVLGPV
Sbjct  494   VNGERAGTFYGRFGSPKVRFTGNVKLRAGSNKISILSVAVGLPNIGPHFDTWNAGVLGPV  553

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L GLNEG R+L++Q W Y++
Sbjct  554   TLEGLNEGKRNLSSQKWIYQI  574


 Score =   144 bits (364),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G++GESLS+ T++GSSSV+W      ++ QPLTWYKA FDAP GN+PLALDMSSMGKG
Sbjct  573   QIGLRGESLSIYTLSGSSSVKWGGA---STRQPLTWYKAFFDAPAGNEPLALDMSSMGKG  629

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP Y A G C   C+Y GTY + KCQ +CG+PSQ
Sbjct  630   QIWINGQSIGRHWPAYKANGVCDL-CDYKGTYRKMKCQTDCGEPSQ  674



>gb|KCW82506.1| hypothetical protein EUGRSUZ_C03898, partial [Eucalyptus grandis]
Length=700

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/564 (70%), Positives = 458/564 (81%), Gaps = 17/564 (3%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SVSYD ++ +I+GKRRILISGSIHYPRSTP+MWP L+ KAK GG+DVIQ+YVFWNGHEPS
Sbjct  16    SVSYDRKAIVIDGKRRILISGSIHYPRSTPEMWPDLIWKAKRGGVDVIQSYVFWNGHEPS  75

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y FE RYDLV+FIKL Q+AGLYVHLRIGPYIC EWNFGGFP+WLK+VPGI FRTDN+
Sbjct  76    PGQYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKFVPGISFRTDNK  135

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
              FK AMQ F  KIV++MK+E+LF+SQGGPII+SQIENEYGPVEWEIGAPGKAY+KWA  +
Sbjct  136   AFKDAMQRFTYKIVDIMKAERLFQSQGGPIILSQIENEYGPVEWEIGAPGKAYSKWAANL  195

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTEL---WTGWYTQFG  1110
             AV L TGVPWIMCKQEDAPDP+IDTCNGYYCE F PN   KPKM+T+L       YT+FG
Sbjct  196   AVRLNTGVPWIMCKQEDAPDPMIDTCNGYYCEGFKPNSNNKPKMWTDLIIIMISRYTEFG  255

Query  1111  GPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYG  1290
             G V  RPAED            GSF+NYYMYHGGTNFGRTA   F+ATSYDYDAPLDE+G
Sbjct  256   GAVPHRPAED------------GSFINYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEFG  303

Query  1291  LVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQ  1470
             L+ EPKY HLRDLH+AIK +E AL+S+ P+V   G+NQE HVF++ +G C AFL+NYD +
Sbjct  304   LLREPKYSHLRDLHQAIKQSEWALISADPVVQSLGRNQEAHVFKAGSG-CAAFLANYDTK  362

Query  1471  FSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEI  1650
             +  KV F N QYDLPPWSISILPDCK  VYNTA V  P+ Q KM+PVG GFSWQSY EEI
Sbjct  363   YPVKVNFGNGQYDLPPWSISILPDCKTAVYNTARVSVPTSQIKMVPVG-GFSWQSYVEEI  421

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
              S+  GDT   DG+ EQI++TRD SDYLWY T++ I+P+E FLR+ + PV+T+ SAGHAM
Sbjct  422   VSAFGGDTFTKDGLLEQISLTRDVSDYLWYTTDITISPNEAFLRSSQSPVLTISSAGHAM  481

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
             HVF+N EL+G+ YG L  PKLT++  VKLRAGINK+S+LSVAVGLPNVGLHFE WN GVL
Sbjct  482   HVFVNGELAGSAYGSLENPKLTFSEKVKLRAGINKLSILSVAVGLPNVGLHFETWNTGVL  541

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPV+L GLN GT D++   W YKV
Sbjct  542   GPVTLRGLNSGTWDMSKWKWSYKV  565


 Score =   152 bits (384),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+ SL+T +GSSSVEW +G  LA  QPLTWYKATF+AP G+ PLALDM+SMGKG
Sbjct  564   KVGLKGEAQSLHTQSGSSSVEWLEGSTLAQKQPLTWYKATFNAPLGHAPLALDMNSMGKG  623

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP YTA+GSC S C YAGT+++ KC+ NCG+PSQ
Sbjct  624   QMWINGQSIGRHWPAYTARGSCGS-CIYAGTFDENKCRSNCGEPSQ  668



>ref|NP_200498.1| beta-galactosidase 4 [Arabidopsis thaliana]
 sp|Q9SCV8.1|BGAL4_ARATH RecName: Full=Beta-galactosidase 4; Short=Lactase 4; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64740.1| putative beta-galactosidase [Arabidopsis thaliana]
 dbj|BAA97206.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AED96817.1| beta-galactosidase 4 [Arabidopsis thaliana]
Length=724

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/563 (68%), Positives = 456/563 (81%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING+RRIL+SGSIHYPRSTP+MWPGL+QKAK+GGLDVI+TYVFWNGHE
Sbjct  26    KASVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y F  RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLK+VPG+ FRTD
Sbjct  86    PSPGQYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AM+ F  KIV MMK+EKLF++QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  146   NEPFKAAMKKFTEKIVWMMKAEKLFQTQGGPIILAQIENEYGPVEWEIGAPGKAYTKWVA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPWIMCKQEDAP PIIDTCNGYYCE+F PN   KPKM+TE WTGWYT FGG
Sbjct  206   QMALGLSTGVPWIMCKQEDAPGPIIDTCNGYYCEDFKPNSINKPKMWTENWTGWYTDFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP EDIA+SVARFIQ  GS VNYYMYHGGTNF RTA   F+A+SYDYDAPLDEYGL
Sbjct  266   AVPYRPVEDIAYSVARFIQKGGSLVNYYMYHGGTNFDRTAGE-FMASSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+AIKL+EPAL+S+   VT  G  QE +VF S++ +C AFLSN D   
Sbjct  325   PREPKYSHLKALHKAIKLSEPALLSADATVTSLGAKQEAYVFWSKS-SCAAFLSNKDENS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK  VYNTA V +PS+   M+P G  FSW S+ E   
Sbjct  384   AARVLFRGFPYDLPPWSVSILPDCKTEVYNTAKVNAPSVHRNMVPTGTKFSWGSFNEATP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++++  T A +G+ EQI++T D SDY WY+T++ I   E FL+ G  P++TVMSAGHA+H
Sbjct  444   TANEAGTFARNGLVEQISMTWDKSDYFWYITDITIGSGETFLKTGDSPLLTVMSAGHALH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGT YGGL  PKLT++  +KL AG+NKI+LLSVAVGLPNVG HFE+WN GVLG
Sbjct  504   VFVNGQLSGTAYGGLDHPKLTFSQKIKLHAGVNKIALLSVAVGLPNVGTHFEQWNKGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YK+
Sbjct  564   PVTLKGVNSGTWDMSKWKWSYKI  586


 Score =   146 bits (369),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+T T SS V W  G  +A  QPLTWYK+TF  P GN+PLALDM++MGKG
Sbjct  585   KIGVKGEALSLHTNTESSGVRWTQGSFVAKKQPLTWYKSTFATPAGNEPLALDMNTMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GRHWP Y AQGSC   CNYAGT++ KKC  NCG+ SQ
Sbjct  645   QVWINGRNIGRHWPAYKAQGSC-GRCNYAGTFDAKKCLSNCGEASQ  689



>ref|XP_009137581.1| PREDICTED: beta-galactosidase 12-like [Brassica rapa]
Length=729

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/566 (68%), Positives = 455/566 (80%), Gaps = 5/566 (1%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +V+YD ++ IING+RRIL+SGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHE
Sbjct  26    KATVTYDHKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y FE RYDLVKFIKL Q+AGLYVHLRIGPY+C EWNFGGFP+WLK+VP + FRTD
Sbjct  86    PSPGQYYFEERYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPDMAFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AMQ F  KIV MMK EKLFE+QGGPII+SQIENEYGPVEWEIGAPGKAYTKWA 
Sbjct  146   NEPFKAAMQKFTEKIVGMMKQEKLFETQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAA  205

Query  934   QMAVGLKTGVPWIMCKQ-EDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFG  1110
             QMA GL TGVPWIMCKQ ED PD II+TCNG+YCE F P    KPKM+TE WTGWY +FG
Sbjct  206   QMAEGLSTGVPWIMCKQDEDVPDSIINTCNGFYCEGFKPKSDNKPKMWTENWTGWYPEFG  265

Query  1111  GPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYG  1290
             G V  RPAEDIAFSVARFI N GSF+NYYMYHGGTNF RTA   FIATSYDYDAPLDEYG
Sbjct  266   GAVPYRPAEDIAFSVARFIHNGGSFMNYYMYHGGTNFDRTAGQ-FIATSYDYDAPLDEYG  324

Query  1291  LVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQ  1470
             L  EPKY HL  LH+ IKL EPALVS  P VTW G   E HVF+S + +C AFLSNY+  
Sbjct  325   LPREPKYSHLTKLHKVIKLCEPALVSVDPTVTWLGDKLEAHVFKSNS-SCAAFLSNYNDS  383

Query  1471  FSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEI  1650
              +A+V+F    YDLPPWS+SILPDCK   YNTA VR+PS+  KM+P     SW SY EEI
Sbjct  384   SAARVSFWGSTYDLPPWSVSILPDCKTEYYNTAKVRTPSIHMKMVPTNTKLSWGSYNEEI  443

Query  1651  ASSDDGD--TVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGH  1824
              S +D D  T + DG+ EQI++TRD +DYLWY+ +V ++ DE+FL  G+DP++T+ S+GH
Sbjct  444   PSPNDNDNGTFSQDGLVEQISMTRDKTDYLWYLADVEVSDDEKFLTTGEDPLLTIESSGH  503

Query  1825  AMHVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAG  2004
             A+ VF+N +L+GT YG L  PKLT++  +KL AG+NK++LLS+A GLPN G+H+E WN G
Sbjct  504   ALSVFVNGQLAGTAYGSLEKPKLTFSQKIKLHAGVNKLALLSIAAGLPNGGVHYETWNTG  563

Query  2005  VLGPVSLSGLNEGTRDLTNQTWFYKV  2082
             VLGPV+L+G+N GT D++   W YK+
Sbjct  564   VLGPVTLTGVNSGTWDMSKWKWSYKI  589


 Score =   145 bits (365),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G KGESLSL+T    S+VEW++G L+A+ QPLTWYK+TFD P GN+PLALDM++MGKG
Sbjct  588   KIGTKGESLSLHT--EGSTVEWKEGSLVATKQPLTWYKSTFDTPAGNEPLALDMNTMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GRHWP YT +G+C   C+YAGT+ +KKC  NCG+ SQ
Sbjct  646   QVWINGKNIGRHWPAYTVRGNC-ERCSYAGTFTEKKCLSNCGEASQ  690



>gb|AAK96780.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AAL47393.1| beta-galactosidase [Arabidopsis thaliana]
Length=724

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/563 (68%), Positives = 456/563 (81%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + SVSYD ++ IING+RRIL+SGSIHYPRSTP+MWPGL+QKAK+GGLDVI+TYVFWNGHE
Sbjct  26    KASVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y F  RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLK+VPG+ FRTD
Sbjct  86    PSPGQYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AM+ F  KIV MMK+EKLF++QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  146   NEPFKAAMKKFTEKIVWMMKAEKLFQTQGGPIILAQIENEYGPVEWEIGAPGKAYTKWVA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPWIMCKQEDAP PIIDTCNGYYCE+F PN   KPKM+TE WTGWYT FGG
Sbjct  206   QMALGLSTGVPWIMCKQEDAPGPIIDTCNGYYCEDFKPNSINKPKMWTENWTGWYTDFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP EDIA+SVARFIQ  GS +NYYMYHGGTNF RTA   F+A+SYDYDAPLDEYGL
Sbjct  266   AVPYRPVEDIAYSVARFIQKGGSLINYYMYHGGTNFDRTAGE-FMASSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+AIKL+EPAL+S+   VT  G  QE +VF S++ +C AFLSN D   
Sbjct  325   PREPKYSHLKALHKAIKLSEPALLSADATVTSLGAKQEAYVFWSKS-SCAAFLSNKDENS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK  VYNTA V +PS+   M+P G  FSW S+ E   
Sbjct  384   AARVLFRGFPYDLPPWSVSILPDCKTEVYNTAKVNAPSVHRNMVPTGTKFSWGSFNEATP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             ++++  T A +G+ EQI++T D SDY WY+T++ I   E FL+ G  P++TVMSAGHA+H
Sbjct  444   TANEAGTFARNGLVEQISMTWDKSDYFWYITDITIGSGETFLKTGDSPLLTVMSAGHALH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSGT YGGL  PKLT++  +KL AG+NKI+LLSVAVGLPNVG HFE+WN GVLG
Sbjct  504   VFVNGQLSGTAYGGLDHPKLTFSQKIKLHAGVNKIALLSVAVGLPNVGTHFEQWNKGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YK+
Sbjct  564   PVTLKGVNSGTWDMSKWKWSYKI  586


 Score =   146 bits (369),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+T T SS V W  G  +A  QPLTWYK+TF  P GN+PLALDM++MGKG
Sbjct  585   KIGVKGEALSLHTNTESSGVRWTQGSFVAKKQPLTWYKSTFATPAGNEPLALDMNTMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GRHWP Y AQGSC   CNYAGT++ KKC  NCG+ SQ
Sbjct  645   QVWINGRNIGRHWPAYKAQGSC-GRCNYAGTFDAKKCLSNCGEASQ  689



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/562 (67%), Positives = 455/562 (81%), Gaps = 1/562 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +V+YD ++ IING+RRILISGSIHYPRSTP+MW  L+QKAK+GGLDVIQTYVFWN HEPS
Sbjct  26    TVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKEGGLDVIQTYVFWNVHEPS  85

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG YNFEGRYDLV+FIK  QKAGLYVHLRIGPYICGEWNFGGFP+WLKYVPGI FRTDN+
Sbjct  86    PGNYNFEGRYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  145

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK+AMQGF  KIV MMKSE LFESQGGPII+SQIENEYG      GA G AY  WA  M
Sbjct  146   PFKMAMQGFTQKIVEMMKSEMLFESQGGPIILSQIENEYGTESKAFGAAGHAYMTWAANM  205

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             A+GL TGVPW+MCK+ DAPDP+I+ CNG+YC+ FHPNKPYKP M+TE W+GW+T+FGG V
Sbjct  206   AIGLGTGVPWVMCKEGDAPDPVINACNGFYCDAFHPNKPYKPAMWTEAWSGWFTEFGGTV  265

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
             H+RP +D+AF+VARFIQN GSFVNYYMYHGGTNFGRTA   FI TSYDYDAP+DEYGL+ 
Sbjct  266   HQRPVQDLAFAVARFIQNGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIR  325

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PKYGHL++LHRAIKL E +LVSS P +T  G  Q+ HVF SE+G C AF++NYDP  +A
Sbjct  326   QPKYGHLKELHRAIKLCERSLVSSDPTITSLGSYQQAHVFSSESGDCAAFIANYDPNSAA  385

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNG-FSWQSYTEEIAS  1656
             +V F+N+ Y+LPPWSISILPDC+N+V+NTA V   + Q +M+P  +  FSW++Y E+++S
Sbjct  386   RVMFNNMHYNLPPWSISILPDCRNMVFNTAKVGVQTSQMQMLPSNSELFSWETYDEDVSS  445

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              +D   + + G+ EQINVTRD+SDYLWY+T V+I+  E FLR G+ P + V S GHA+HV
Sbjct  446   LEDNSMITSVGLLEQINVTRDTSDYLWYITSVDISSSESFLRGGQSPTLIVESTGHALHV  505

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSG+  G     +  +T  V LRAGINKI+LLS+AVGLPNVG HFE W  G+LGP
Sbjct  506   FINGQLSGSASGTRENRRFMFTGKVNLRAGINKIALLSIAVGLPNVGTHFEAWKTGILGP  565

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V L GL++G  DLT Q W Y+V
Sbjct  566   VVLHGLDQGKMDLTWQKWSYQV  587


 Score =   129 bits (324),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLA-SNQPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE+++L +  G SSV+W  G L+    QPLTWYKA F+APEG++PLALDMSSMGK
Sbjct  586   QVGLKGEAMNLVSPNGISSVDWMQGSLVVQKQQPLTWYKAYFNAPEGDEPLALDMSSMGK  645

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G++W+NG+ +GR+W  Y A G+C+  C+Y+GT+   KCQ+ CGQP+Q
Sbjct  646   GQVWINGQSIGRYWTIY-ANGNCNG-CSYSGTFRPPKCQIGCGQPTQ  690



>ref|XP_006401275.1| hypothetical protein EUTSA_v10012847mg [Eutrema salsugineum]
 gb|ESQ42728.1| hypothetical protein EUTSA_v10012847mg [Eutrema salsugineum]
Length=693

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/563 (67%), Positives = 455/563 (81%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD ++ IING+RRIL+SGSIHYPRSTP+MWPGL+QKAK+GGLDV++TYVFWNGHE
Sbjct  26    KATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVVETYVFWNGHE  85

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG Y F  RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLK+VPG+ FRTD
Sbjct  86    PSPGNYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRTD  145

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AM+ F  KIV MMK+EKLF++QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  146   NEPFKAAMKKFTEKIVWMMKAEKLFQTQGGPIILAQIENEYGPVEWEIGAPGKAYTKWVA  205

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPWIMCKQEDAP PIIDTCNGYYCENF PN   KPKM+TE WTGWYT+FGG
Sbjct  206   QMALGLSTGVPWIMCKQEDAPSPIIDTCNGYYCENFKPNSSNKPKMWTENWTGWYTEFGG  265

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP EDIA+SVARFIQN GSFVNYYMYHGGTNF RTA   F+A+SYDYDAPLDEYGL
Sbjct  266   AVPYRPVEDIAYSVARFIQNGGSFVNYYMYHGGTNFDRTAGE-FMASSYDYDAPLDEYGL  324

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LH+ IKL+EPALVS+   VT  G  QE HVF S++ +C AFLSN D   
Sbjct  325   TREPKYSHLKALHKVIKLSEPALVSADATVTSLGAKQEAHVFWSKS-SCAAFLSNNDANS  383

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK   YNTA V +P +   M+P G  FSW+SY E   
Sbjct  384   AARVMFRGFPYDLPPWSVSILPDCKTEYYNTAKVNAPRVHRNMVPTGTRFSWESYNEAAP  443

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++  T A +G+ EQI++T D +DY WY+T++ I   E FL+ G  P++T+ SAGHA+H
Sbjct  444   SANEAGTFAKNGLVEQISMTWDKTDYFWYLTDITIGAGERFLKTGDYPLLTIWSAGHALH  503

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +L+G+ YGGL+  KLT++  +KL AG+NK++LLSVAVGLPNVG HFEKWN GVLG
Sbjct  504   VFVNGQLAGSAYGGLSHTKLTFSQKIKLHAGVNKLALLSVAVGLPNVGTHFEKWNKGVLG  563

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT +++   W YK+
Sbjct  564   PVTLKGVNSGTWEMSKWKWSYKI  586


 Score = 93.2 bits (230),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%), Gaps = 32/106 (30%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE LSL+T                               + N+PLALDM++MGKG
Sbjct  585   KIGVKGEGLSLHT-------------------------------DRNEPLALDMNTMGKG  613

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GRHWP Y AQG+C   CNYAGT++ KKC  NCG+ SQ
Sbjct  614   QVWINGRNIGRHWPAYKAQGNC-GRCNYAGTFDAKKCLSNCGEASQ  658



>gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida]
Length=842

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/562 (69%), Positives = 453/562 (81%), Gaps = 1/562 (0%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD ++ I+NG+RRILISGSIHYPRSTP+MWP L+QKAK+GG+DVIQTYVFWNGHEP
Sbjct  29    ASVSYDHKAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEP  88

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
               GKY FE RYDLVKFIKL  +AGLYV+LR+GPY C EWNFGGFP+WLKYVPGI FRTDN
Sbjct  89    EQGKYYFEERYDLVKFIKLVHQAGLYVNLRVGPYACAEWNFGGFPVWLKYVPGISFRTDN  148

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIVNMMK+E+L+ESQGGPII+SQIENEYGP+E   G  GK+Y +WA +
Sbjct  149   EPFKAAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPLEVRFGEQGKSYAEWAAK  208

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MA+ L TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F+PNK YKPK++TE WT W+T+FG P
Sbjct  209   MALDLGTGVPWLMCKQDDAPDPVINTCNGFYCDYFYPNKAYKPKIWTEAWTAWFTEFGSP  268

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RP ED+AF VA FIQ  GSF+NYYMYHGGTNFGRTA   F+ATSYDYDAPLDE+GL+
Sbjct  269   VPYRPVEDLAFGVANFIQTGGSFINYYMYHGGTNFGRTAGGPFVATSYDYDAPLDEFGLL  328

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              +PK+GHL+DLHRAIKL EPALVS  P VT  G  Q+ HVFRS +GAC AFL+N DP   
Sbjct  329   RQPKWGHLKDLHRAIKLCEPALVSGDPTVTALGNYQKAHVFRSTSGACAAFLANNDPNSF  388

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
             A V F N  Y+LPPWSISILPDCK+ VYNTA V + S   KM P   G+SWQSY ++ A 
Sbjct  389   ATVAFGNKHYNLPPWSISILPDCKHTVYNTARVGAQSALMKMTPANEGYSWQSYNDQTAF  448

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              DD +     G+ EQ+N TRD SDYLWYMT+V I P E FLR+G  P +TV SAG A+HV
Sbjct  449   YDD-NAFTVVGLLEQLNTTRDVSDYLWYMTDVKIDPSEGFLRSGNWPWLTVSSAGDALHV  507

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +L+GTVYG L   K+T++ +V LRAG+NKISLLS+AVGLPN+G HFE WN GVLGP
Sbjct  508   FVNGQLAGTVYGSLKKQKITFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWNTGVLGP  567

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             VSLSGL+EG RDLT Q W YKV
Sbjct  568   VSLSGLDEGKRDLTWQKWSYKV  589


 Score =   152 bits (383),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+L+L++++GSSSVEW +G L+A  QPLTWYK TF+AP GN+PLALDM+SMGKG
Sbjct  588   KVGLKGEALNLHSLSGSSSVEWVEGSLVAQRQPLTWYKTTFNAPAGNEPLALDMNSMGKG  647

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG+ +GR+WPGY A G+C + CNYAG +N+KKC  NCG  SQ
Sbjct  648   QVWINGQSIGRYWPGYKASGTCDA-CNYAGPFNEKKCLSNCGDASQ  692



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/561 (66%), Positives = 455/561 (81%), Gaps = 1/561 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             V+YD ++ II+G+RRILISGSIHYPRSTP+MW GL+QKAKDGGLDVIQTYVFWNGHEPSP
Sbjct  21    VTYDRKAIIIDGQRRILISGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPSP  80

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G YNFEGRYDLV+FIK  QK GLYVHLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+P
Sbjct  81    GTYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  140

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK+AMQGF  KIV MMKSE LF SQGGPII+SQIENEYGP     G+ G +Y  WA +MA
Sbjct  141   FKMAMQGFTQKIVQMMKSESLFGSQGGPIILSQIENEYGPESKAFGSAGHSYVNWAAEMA  200

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             VGLKTGVPW+MCK++DAPDP+I+ CNG+YC++F PNKPYKP M+TE W+GW+T+FGG +H
Sbjct  201   VGLKTGVPWVMCKEDDAPDPVINACNGFYCDSFTPNKPYKPTMWTEAWSGWFTEFGGTIH  260

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
              RP ED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FI TSYDYDAP+DEYGLV E
Sbjct  261   HRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLVRE  320

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKYGHL++LHRAIKL E ALVS+ P V   G  Q+ HVF S++G C AFLSN++P   A+
Sbjct  321   PKYGHLKELHRAIKLCERALVSADPTVISLGSLQQAHVFSSQSGGCAAFLSNHNPNSFAR  380

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVG-NGFSWQSYTEEIASS  1659
             V F+N+ Y++PPWSISILPDC+NVV+NTA V   + Q +M P+      W+ Y EE+AS 
Sbjct  381   VMFNNMHYNIPPWSISILPDCRNVVFNTAKVGVQTSQMQMYPINVQSLMWERYDEEVASL  440

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             ++   +   G+ EQINVTRD+SDYLWY+T V+++P E FLR  K PV+ V SAGHA+H+F
Sbjct  441   EENSLITTTGLLEQINVTRDTSDYLWYITSVDVSPAEGFLRGRKRPVLMVESAGHALHIF  500

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +LSG+ YG     ++ ++ +V LRAG N+I+LLSVAVGLPN G+H+E W+ GVLGPV
Sbjct  501   VNGQLSGSAYGSREDRRIKFSGNVNLRAGTNRIALLSVAVGLPNAGVHYELWSTGVLGPV  560

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
              L GL+EG+RDLT Q W Y++
Sbjct  561   VLHGLDEGSRDLTWQKWSYQL  581


 Score =   142 bits (358),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQ-PLTWYKATFDAPEGNDPLALDMSSMGK  2332
             QLG+KGE+++LN++ G+SSVEW  G L+A NQ PLTWY+A FDAP+GNDPLALDM SMGK
Sbjct  580   QLGLKGEAMNLNSLEGASSVEWMQGSLVAQNQQPLTWYRAYFDAPDGNDPLALDMGSMGK  639

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G +W+NG+ +GR+W  Y     C+S C+Y GTY   KCQ  CGQP+Q
Sbjct  640   GHVWINGQSIGRYWTAYAPSEYCNS-CSYRGTYRSPKCQSGCGQPTQ  685



>sp|P45582.1|BGAL_ASPOF RecName: Full=Beta-galactosidase; Short=Lactase; Flags: Precursor 
[Asparagus officinalis]
 emb|CAA54525.1| beta-galactosidase [Asparagus officinalis]
Length=832

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/561 (69%), Positives = 467/561 (83%), Gaps = 3/561 (1%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD +S IING+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDVIQTYVFWNGHEPS
Sbjct  26    SVTYDHKSVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  85

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG+Y F GRYDLV+F+KL ++AGLY HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN 
Sbjct  86    PGQYYFGGRYDLVRFLKLVKQAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGIHFRTDNG  145

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AM  F  KIV+MMK+E L+E+QGGPII+SQIENEYGPVE+  GA GK+YT WA +M
Sbjct  146   PFKAAMGKFTEKIVSMMKAEGLYETQGGPIILSQIENEYGPVEYYDGAAGKSYTNWAAKM  205

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCKQ+DAPDP+I+TCNG+YC+ F PNK  KPKM+TE WTGW+T FGG V
Sbjct  206   AVGLNTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKDNKPKMWTEAWTGWFTGFGGAV  265

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
              +RPAED+AF+VARFIQ  GSF+NYYMYHGGTNFGRTA   FI+TSYDYDAP+DEYGL+ 
Sbjct  266   PQRPAEDMAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEYGLLR  325

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PK+GHLRDLH+AIKL EPALVS  P +T  G+NQE +V+RS++ +C AFL+N++ ++ A
Sbjct  326   QPKWGHLRDLHKAIKLCEPALVSGEPTITSLGQNQESYVYRSKS-SCAAFLANFNSRYYA  384

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASS  1659
              VTF+ + Y+LPPWS+SILPDCK  V+NTA V + +   KM  +G GFSW++YTE+  + 
Sbjct  385   TVTFNGMHYNLPPWSVSILPDCKTTVFNTARVGAQTTTMKMQYLG-GFSWKAYTEDTDAL  443

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +D +T   DG+ EQ++ T D SDYLWY T V+IA +EEFL+ GK P +TVMSAGHA+HVF
Sbjct  444   ND-NTFTKDGLVEQLSTTWDRSDYLWYTTYVDIAKNEEFLKTGKYPYLTVMSAGHAVHVF  502

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             IN +LSGT YG L  PKLTY+ S KL AG NKIS+LSV+VGLPNVG HFE WN GVLGPV
Sbjct  503   INGQLSGTAYGSLDNPKLTYSGSAKLWAGSNKISILSVSVGLPNVGNHFETWNTGVLGPV  562

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
             +L+GLNEG RDL+ Q W Y++
Sbjct  563   TLTGLNEGKRDLSLQKWTYQI  583


 Score =   140 bits (352),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 85/106 (80%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G+ GE+LSL+++TGSS+VEW +    +  QPLTWYK  F+AP GN+PLALDM++MGKG
Sbjct  582   QIGLHGETLSLHSLTGSSNVEWGEA---SQKQPLTWYKTFFNAPPGNEPLALDMNTMGKG  638

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A GSC S C+Y GTYN+KKC  NCG+ SQ
Sbjct  639   QIWINGQSIGRYWPAYKASGSCGS-CDYRGTYNEKKCLSNCGEASQ  683



>ref|XP_008230925.1| PREDICTED: beta-galactosidase-like [Prunus mume]
Length=808

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/562 (69%), Positives = 449/562 (80%), Gaps = 28/562 (5%)
 Frame = +1

Query  397   GSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEP  576
              SVSYD RS IING++RILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEP
Sbjct  25    ASVSYDHRSIIINGRKRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  84

Query  577   SPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDN  756
             SPG+Y FE RYDLVKFIKL  +AGLYV+LRIGPY+C EWNFGGFP+WLK+VPGI FRTDN
Sbjct  85    SPGQYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGIAFRTDN  144

Query  757   QPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQ  936
             +PFK AMQ F  KIV MMK+E LF+SQGGPII+SQIENEYGPVEWEIGAPGKAYT WA Q
Sbjct  145   EPFKAAMQTFTEKIVGMMKAESLFQSQGGPIILSQIENEYGPVEWEIGAPGKAYTNWAAQ  204

Query  937   MAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGP  1116
             MAV L  GVPWIMCKQEDAPDPII+TCNG+YC+NF P K YKPKM+TE+WTGWYT+FGG 
Sbjct  205   MAVNLNIGVPWIMCKQEDAPDPIINTCNGFYCQNFTPTKKYKPKMWTEVWTGWYTEFGGA  264

Query  1117  VHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLV  1296
             V  RPAED+AFSVA FIQN GSFVNYYMYHGGTNFGRTA   FIATSYDYD+PLDE+GL 
Sbjct  265   VPTRPAEDLAFSVAMFIQNGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDSPLDEFGLP  324

Query  1297  NEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFS  1476
              EPK+GHLRDLHRAIKL+E ALVS+ P V   G++QE HVF+S    C AFL+NYD  +S
Sbjct  325   REPKWGHLRDLHRAIKLSESALVSADPSVISLGRHQEAHVFKSSY-QCAAFLANYDTNYS  383

Query  1477  AKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIAS  1656
              +V F + QYDLPPWSISILPDCK  VYNTA + + S Q KM PV N  SWQS+TEE AS
Sbjct  384   VEVRFGDGQYDLPPWSISILPDCKTAVYNTARLGAQSSQMKMTPVNNALSWQSFTEETAS  443

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
             SDD DT   DG+ +QIN+T DS+DYLWYMT++ I+PDE FL                   
Sbjct  444   SDDPDTFTLDGLRDQINMTWDSTDYLWYMTDITISPDEGFLE------------------  485

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
                       YG L   +L ++++V+LR+GINK++LLSV++GLPN+GLHFE WN GVLGP
Sbjct  486   ---------TYGSLEKRRLRFSDNVRLRSGINKLALLSVSLGLPNIGLHFETWNVGVLGP  536

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GLN GTRDL+ + W YKV
Sbjct  537   VTLQGLNSGTRDLSQRKWTYKV  558


 Score =   160 bits (405),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+TV GSSSVEW   P LA   PLTWYKATFDAP GNDPLALDM SMGKG
Sbjct  557   KVGLKGEALSLHTVNGSSSVEWVQKPYLAKKPPLTWYKATFDAPSGNDPLALDMVSMGKG  616

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG  +GRHWP YTA G+C   C YAGTYN+ KC   CG+PSQ
Sbjct  617   QIWINGRSIGRHWPAYTAHGACHY-CYYAGTYNENKCLTKCGEPSQ  661



>dbj|BAB83260.1| beta-D-galactosidase [Persea americana]
Length=766

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/562 (70%), Positives = 458/562 (81%), Gaps = 2/562 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD ++ +ING+RRILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFW+GHEPS
Sbjct  36    SVTYDRKAIVINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWDGHEPS  95

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PGKY FEGRYDLVKFIKL ++AGLYV+LRIGPYIC EWN GGFP+WLKY+PGI FRTDN+
Sbjct  96    PGKYYFEGRYDLVKFIKLVKQAGLYVNLRIGPYICAEWNLGGFPVWLKYIPGISFRTDNE  155

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK  M GF  KIV MMK+E LFE QGGPIIMSQIENEYGPVEWEIGA GK YT+WA  M
Sbjct  156   PFKRYMAGFTKKIVEMMKAESLFEPQGGPIIMSQIENEYGPVEWEIGAIGKVYTRWAASM  215

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AV L TGVPWIMCKQ++ PDPII+TCNG+YC+ F PNK YKP M+TELWTGW+T FGGPV
Sbjct  216   AVNLNTGVPWIMCKQDEVPDPIINTCNGFYCDWFKPNKDYKPIMWTELWTGWFTAFGGPV  275

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
               RP ED+A++V +FIQ  GSF+NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYGL  
Sbjct  276   PYRPVEDVAYAVVKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLKR  335

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPK+GHLRDLHRAIK+ EPALVS+ P VT  G +QE HVF+ E+GAC AFL N D     
Sbjct  336   EPKWGHLRDLHRAIKMCEPALVSNDPTVTKIGDSQEAHVFKFESGACSAFLENKDETNFV  395

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRS-PSLQTKMIPVGNGFSWQSYTEEIAS  1656
             KVTF  +QY+LPPWSISILPDC NVVYNT  V +  S+ T +    N FSW SY E+ AS
Sbjct  396   KVTFQGMQYELPPWSISILPDCVNVVYNTGRVGTQTSMMTMLSASNNEFSWASYNEDTAS  455

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              ++ +++  +G+ EQI++T+DS+DYL Y T+V I  +E FL+NG+ PV+TV SAGHA+ V
Sbjct  456   YNE-ESMTIEGLSEQISITKDSTDYLRYTTDVTIGQNEGFLKNGEYPVLTVNSAGHALQV  514

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             F+N +LSGT YG +  P+LT++  VKL AG NKISLLS AVGLPNVG HFE WN GVLGP
Sbjct  515   FVNGQLSGTAYGSVNDPRLTFSGKVKLWAGNNKISLLSSAVGLPNVGTHFETWNYGVLGP  574

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L+GLNEG RDL+ Q W YKV
Sbjct  575   VTLNGLNEGKRDLSLQKWSYKV  596


 Score =   134 bits (337),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+ GE+L L++ TGSSSVEW  G   +  QP TWYK TF+AP GNDPLALDM++MGKG
Sbjct  595   KVGVIGEALQLHSPTGSSSVEW--GSSTSKIQPFTWYKTTFNAPGGNDPLALDMNTMGKG  652

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GR+WP Y A G CS+ C+Y G Y++KKC  NCG+ SQ
Sbjct  653   QIWINGQSIGRYWPAYKANGKCSA-CHYTGWYDEKKCGFNCGEASQ  697



>ref|NP_190852.2| beta-galactosidase 2 [Arabidopsis thaliana]
 sp|Q9LFA6.2|BGAL2_ARATH RecName: Full=Beta-galactosidase 2; Short=Lactase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK32914.1|AF367327_1 AT3g52840/F8J2_10 [Arabidopsis thaliana]
 emb|CAB64738.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAN18080.1| At3g52840/F8J2_10 [Arabidopsis thaliana]
 gb|AEE78999.1| beta-galactosidase 2 [Arabidopsis thaliana]
Length=727

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/560 (66%), Positives = 454/560 (81%), Gaps = 2/560 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             V+YD ++ IING+RRILISGSIHYPRSTP+MWP L++KAK+GGLDVIQTYVFWNGHEPSP
Sbjct  29    VTYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIKKAKEGGLDVIQTYVFWNGHEPSP  88

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G Y F+ RYDLVKF KL  +AGLY+ LRIGPY+C EWNFGGFP+WLKYVPG+ FRTDN+P
Sbjct  89    GNYYFQDRYDLVKFTKLVHQAGLYLDLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTDNEP  148

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK+AMQ F  KIV+MMK EKLFE+QGGPII+SQIENEYGP++WE+GA GKAY+KW  +MA
Sbjct  149   FKIAMQKFTKKIVDMMKEEKLFETQGGPIILSQIENEYGPMQWEMGAAGKAYSKWTAEMA  208

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             +GL TGVPWIMCKQEDAP PIIDTCNG+YCE F PN   KPK++TE WTGW+T+FGG + 
Sbjct  209   LGLSTGVPWIMCKQEDAPYPIIDTCNGFYCEGFKPNSDNKPKLWTENWTGWFTEFGGAIP  268

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
              RP EDIAFSVARFIQN GSF+NYYMY+GGTNF RT A +FIATSYDYDAP+DEYGL+ E
Sbjct  269   NRPVEDIAFSVARFIQNGGSFMNYYMYYGGTNFDRT-AGVFIATSYDYDAPIDEYGLLRE  327

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKY HL++LH+ IKL EPALVS  P +T  G  QE+HVF+S+T +C AFLSNYD   +A+
Sbjct  328   PKYSHLKELHKVIKLCEPALVSVDPTITSLGDKQEIHVFKSKT-SCAAFLSNYDTSSAAR  386

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASSD  1662
             V F    YDLPPWS+SILPDCK   YNTA +R+P++  KMIP    FSW+SY E   SS+
Sbjct  387   VMFRGFPYDLPPWSVSILPDCKTEYYNTAKIRAPTILMKMIPTSTKFSWESYNEGSPSSN  446

Query  1663  DGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFI  1842
             +  T   DG+ EQI++TRD +DY WY T++ I  DE FL+ G +P++T+ SAGHA+HVF+
Sbjct  447   EAGTFVKDGLVEQISMTRDKTDYFWYFTDITIGSDESFLKTGDNPLLTIFSAGHALHVFV  506

Query  1843  NSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVS  2022
             N  L+GT YG L+  KLT++ ++KL  GINK++LLS AVGLPN G+H+E WN G+LGPV+
Sbjct  507   NGLLAGTSYGALSNSKLTFSQNIKLSVGINKLALLSTAVGLPNAGVHYETWNTGILGPVT  566

Query  2023  LSGLNEGTRDLTNQTWFYKV  2082
             L G+N GT D++   W YK+
Sbjct  567   LKGVNSGTWDMSKWKWSYKI  586


 Score =   149 bits (375),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G++GE++SL+T+ GSS+V+W     +   QPLTWYK++FD P GN+PLALDM++MGKG
Sbjct  585   KIGLRGEAMSLHTLAGSSAVKWWIKGFVVKKQPLTWYKSSFDTPRGNEPLALDMNTMGKG  644

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++WVNG  +GRHWP YTA+G+C   CNYAG YN+KKC  +CG+PSQ
Sbjct  645   QVWVNGHNIGRHWPAYTARGNC-GRCNYAGIYNEKKCLSHCGEPSQ  689



>ref|XP_010090042.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXB38839.1| Beta-galactosidase 1 [Morus notabilis]
Length=733

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/564 (69%), Positives = 445/564 (79%), Gaps = 5/564 (1%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             VSYD R+ IING+RRILISGSIHYPRSTP+MWP L+QKAK+GGLDVIQTYVFWNGHEPSP
Sbjct  28    VSYDNRAIIINGRRRILISGSIHYPRSTPEMWPDLIQKAKNGGLDVIQTYVFWNGHEPSP  87

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFG----GFPIWLKYVPGIEFRT  750
             GKY FEGRYDLV+FIKL QKAGLYVHLRIGPY+C EWNFG    GFP+WLKYVPGI FRT
Sbjct  88    GKYYFEGRYDLVQFIKLVQKAGLYVHLRIGPYVCAEWNFGFAIRGFPVWLKYVPGIVFRT  147

Query  751   DNQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWA  930
             DNQPFK AM+ F  KIVNMMKSE LFE QGGPII+SQIENEY  VE   G  GK+Y +W+
Sbjct  148   DNQPFKAAMEKFTQKIVNMMKSENLFEPQGGPIILSQIENEYEIVENSFGDAGKSYARWS  207

Query  931   GQMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFG  1110
               MAVGLKT VPW+MCKQ DA DPII++CNG+YCENF PN+  KPKM+TE WTGW  +FG
Sbjct  208   ANMAVGLKTEVPWVMCKQGDALDPIINSCNGFYCENFLPNRDNKPKMWTEAWTGWLLKFG  267

Query  1111  GPVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYG  1290
             GP   RP ED+AF+V RFIQN GS++NYYMYHGGTNFGRTA   FIATSYDYDAPLDEYG
Sbjct  268   GPAPYRPVEDLAFAVTRFIQNKGSYINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYG  327

Query  1291  LVNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQ  1470
             L  EPK+ HLRDLH  I+L EPALVS+ P+ T  G+ QE HVF +++G C AFL+NYDPQ
Sbjct  328   LTREPKHSHLRDLHTTIRLCEPALVSANPVRTSVGRKQEAHVFNTKSGVCAAFLANYDPQ  387

Query  1471  FSAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEI  1650
             +   VTF   QY LPPWSISILP C+   +NTA VR+ SL  KM      FSW+SYTE +
Sbjct  388   YFVNVTFRGRQYGLPPWSISILPHCQEATFNTARVRAASLDVKM-EFAKKFSWESYTEGV  446

Query  1651  ASSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAM  1830
              S+DD ++  A G+ EQ+NVTRD+SDYLWY T VNI  D+ FL  G  P++ V SAGHA+
Sbjct  447   PSTDDMNSFVAHGLLEQLNVTRDTSDYLWYTTNVNIRKDDGFLNYGDFPILKVSSAGHAL  506

Query  1831  HVFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVL  2010
              VFIN ELSGT YG LA PKL +++ V L+AGINKISLLSV VGLPNVGLHFEKWN GVL
Sbjct  507   QVFINGELSGTAYGRLANPKLKFSDKVTLKAGINKISLLSVTVGLPNVGLHFEKWNVGVL  566

Query  2011  GPVSLSGLNEGTRDLTNQTWFYKV  2082
             GPV+L GL+  T D +   W YK 
Sbjct  567   GPVTLEGLSGRTLDFSKWKWSYKT  590


 Score =   132 bits (333),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             + G++GE+L L +  GSSSV+W  G  +   Q LTWYK  FDAPEG DPLALDMSSMGKG
Sbjct  589   KTGLEGETLGLYSFKGSSSVKWAKGSSVRKEQALTWYKTIFDAPEGKDPLALDMSSMGKG  648

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+ +GRHWP + A G C S+C+Y+GT+ + KC   CG  SQ
Sbjct  649   QIWINGQSIGRHWPAHKASGGC-SQCSYSGTFLENKCLRGCGDASQ  693



>ref|XP_007046795.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
 gb|EOX90952.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
Length=702

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/562 (66%), Positives = 451/562 (80%), Gaps = 1/562 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             SV+YD ++ +ING+RRIL SGSIHYPRSTP MW  L+QKAKDGGLDVI+TYVFWN HEPS
Sbjct  27    SVTYDRKAVVINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVIETYVFWNVHEPS  86

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG YNFEGRYDLV+F+K  Q+AGLY HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  87    PGNYNFEGRYDLVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  146

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQGF  KIV +MKS  LFESQGGPII+SQIENEYG     +GA G  Y  WA +M
Sbjct  147   PFKRAMQGFTEKIVGLMKSHNLFESQGGPIILSQIENEYGAQSKLLGASGYNYVTWAAKM  206

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             A+   TGVPW+MCK+EDAPDP+I+TCNG+YC+ F PNKPYKP M+TE W+GW+T+FGGP+
Sbjct  207   AIETGTGVPWVMCKEEDAPDPVINTCNGFYCDTFQPNKPYKPTMWTEAWSGWFTEFGGPL  266

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
             H RPAED+AF+VARFIQ  GSFVNYYMYHGGTNFGRTA   FI TSYDYDAP+DEYGL+ 
Sbjct  267   HHRPAEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIR  326

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             +PKYGHL++LHRAIK++E ALVS+ PIVT  G  Q+ +++ SE+G C AFLSNYD + +A
Sbjct  327   QPKYGHLKELHRAIKMSERALVSADPIVTSLGSFQQAYMYTSESGDCAAFLSNYDTKSAA  386

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPV-GNGFSWQSYTEEIAS  1656
             +V F+N+ Y+LPPWSISILPDC+N V+NTA V   + Q +M+P     FSW+SY E+ +S
Sbjct  387   RVLFNNMHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMQMLPTNAEMFSWESYDEDTSS  446

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
              DD  T+ ADG+ EQINVTRD+SDYLWY+T VNI   E FL  G+ P + V S GHA+H+
Sbjct  447   LDDSSTITADGLLEQINVTRDASDYLWYITSVNIGSSESFLHGGELPTLIVQSTGHAVHI  506

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN +LSG+ +G     + TYT  V LRAG N+I+LLSVAVGLPNVG HFE WN G+LGP
Sbjct  507   FINGQLSGSAFGTRQNRRFTYTGKVNLRAGTNRIALLSVAVGLPNVGGHFETWNTGILGP  566

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V+L GL++G  DL+ Q W Y+V
Sbjct  567   VALHGLDQGKWDLSWQKWTYQV  588


 Score =   127 bits (320),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 81/107 (76%), Gaps = 3/107 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLA-SNQPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE+++L +    SSVEW +G L A   QPL W+KA F+APEG++PLALDM SMGK
Sbjct  587   QVGLKGEAMNLVSPNSISSVEWMEGSLAAQKQQPLRWHKAYFNAPEGDEPLALDMESMGK  646

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G+IW+NG+ +GR+W  Y A G C+  C+YAGT+   KCQL CGQP+Q
Sbjct  647   GQIWINGQSIGRYWTAY-AHGDCNG-CSYAGTFRPPKCQLGCGQPTQ  691



>ref|XP_010451557.1| PREDICTED: beta-galactosidase 4-like [Camelina sativa]
Length=725

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/563 (67%), Positives = 456/563 (81%), Gaps = 2/563 (0%)
 Frame = +1

Query  394   RGSVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHE  573
             + +VSYD ++ IING+RRIL+SGSIHYPRSTP+MWPGL+QKAK+GGLDVI+TYVFWNGHE
Sbjct  27    KATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGHE  86

Query  574   PSPGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTD  753
             PSPG+Y F  RYDLVKFIKLAQ+AGLYV+LRIGP++C EWNFGGFP+WLK+VPGI FRT+
Sbjct  87    PSPGQYYFGDRYDLVKFIKLAQQAGLYVNLRIGPFVCAEWNFGGFPVWLKFVPGIAFRTN  146

Query  754   NQPFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAG  933
             N+PFK AM+ F  KIV +MK+EKLF++QGGPII++QIENEYGPVEWEIGAPGKAYTKW  
Sbjct  147   NEPFKAAMKKFTEKIVWLMKAEKLFQTQGGPIILAQIENEYGPVEWEIGAPGKAYTKWVA  206

Query  934   QMAVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGG  1113
             QMA+GL TGVPWIMCKQEDAP PIIDTCNGYYCE+F PN   KPKM+TE WTGWYT+FGG
Sbjct  207   QMALGLSTGVPWIMCKQEDAPSPIIDTCNGYYCEDFKPNAINKPKMWTENWTGWYTEFGG  266

Query  1114  PVHRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGL  1293
              V  RP ED+A+SV RFI   GSFVNYYMYHGGTNF RTA   F+A+SYDYDAPLDEYGL
Sbjct  267   AVPYRPVEDVAYSVVRFIAKGGSFVNYYMYHGGTNFDRTAGE-FMASSYDYDAPLDEYGL  325

Query  1294  VNEPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQF  1473
               EPKY HL+ LHRAIKL+EPALVS+   VT  G  QE HVF S++ +C AFLSN D + 
Sbjct  326   TREPKYSHLKALHRAIKLSEPALVSADATVTSLGAKQEAHVFWSKS-SCAAFLSNKDEKS  384

Query  1474  SAKVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIA  1653
             +A+V F    YDLPPWS+SILPDCK  VYNTA V +P +   M+P G GFSW SY+E   
Sbjct  385   AARVMFRGFPYDLPPWSVSILPDCKTEVYNTAKVNAPGIHRNMVPTGTGFSWGSYSEAAP  444

Query  1654  SSDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMH  1833
             S+++  T A +G+ EQ+++T D SDY WY+T++ +   E FL  G  P++TVMSAGH +H
Sbjct  445   SANEAGTFARNGLVEQLSMTWDKSDYFWYLTDITVGAGERFLTTGDFPLLTVMSAGHVVH  504

Query  1834  VFINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLG  2013
             VF+N +LSG+ YG LA  ++T++  +KL AG+NK++LLSV VGLPNVG HFE+WN GVLG
Sbjct  505   VFVNGQLSGSAYGTLANTRVTFSQKIKLHAGVNKLALLSVVVGLPNVGTHFEQWNKGVLG  564

Query  2014  PVSLSGLNEGTRDLTNQTWFYKV  2082
             PV+L G+N GT D++   W YKV
Sbjct  565   PVTLKGVNSGTWDMSKWKWSYKV  587


 Score =   150 bits (379),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             ++G+KGE+LSL+T T SSSV W  G  +   QPLTWYK+TF  P GN+PLALDM++MGKG
Sbjct  586   KVGVKGEALSLHTNTESSSVRWTQGAFVVKRQPLTWYKSTFATPAGNEPLALDMNTMGKG  645

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             ++W+NG  +GRHWPGY AQGSC   CNYAGTY+ KKC  NCG+ SQ
Sbjct  646   QVWINGRNIGRHWPGYKAQGSC-GRCNYAGTYDAKKCLSNCGEASQ  690



>ref|XP_006646030.1| PREDICTED: beta-galactosidase 2-like [Oryza brachyantha]
Length=827

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/559 (70%), Positives = 452/559 (81%), Gaps = 2/559 (0%)
 Frame = +1

Query  406   SYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSPG  585
             +YD ++ ++NG+RRILISGSIHYPRSTP+MWP L+QKAKDGGLDV+QTYVFWNGHEPSPG
Sbjct  27    TYDRKAVVVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVVQTYVFWNGHEPSPG  86

Query  586   KYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQPF  765
             +Y FEGRYDLV FIKL ++AGLYV+LRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+PF
Sbjct  87    QYYFEGRYDLVHFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPF  146

Query  766   KVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMAV  945
             K  MQ F  KIV+MMKSE LFE QGGPII+SQIENE+GP+EW+ G P KAY  WA  MAV
Sbjct  147   KAEMQKFTTKIVDMMKSEGLFEWQGGPIILSQIENEFGPLEWDQGEPAKAYASWAASMAV  206

Query  946   GLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVHR  1125
             GL TGVPWIMCK++DAPDPII+TCNG+YC+ F PN P KP M+TE WT WYT FG PV  
Sbjct  207   GLNTGVPWIMCKEDDAPDPIINTCNGFYCDWFSPNNPDKPTMWTEAWTAWYTGFGIPVPH  266

Query  1126  RPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNEP  1305
             RP ED+A+ VA+FIQ  GSFVNYYMYHGGTNF RTA   FIATSYDYDAP+DEYGL+ EP
Sbjct  267   RPVEDLAYGVAKFIQKGGSFVNYYMYHGGTNFERTAGGPFIATSYDYDAPIDEYGLLREP  326

Query  1306  KYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAKV  1485
             K+GHL++LH+AIKL EPALV+  PIVT  G  Q+  VF+S TGAC AFL N D    A+V
Sbjct  327   KWGHLKELHKAIKLCEPALVAGDPIVTSLGNAQKSSVFKSSTGACAAFLENKDKVSYARV  386

Query  1486  TFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGFSWQSYTEEIASSDD  1665
              F+ + YDLPPWSISILPDCK  V+NTA V S   Q KM   G GF+WQSY EEI S D+
Sbjct  387   AFNGMHYDLPPWSISILPDCKTTVFNTARVGSQISQMKMEWAG-GFAWQSYNEEINSFDE  445

Query  1666  GDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVFIN  1845
              D     G+ EQINVTRD++DYLWY T V++  DE+FL NG++P +TVMSAGHA+HVFIN
Sbjct  446   -DPFTTVGLLEQINVTRDNTDYLWYTTNVDVEQDEQFLSNGENPKLTVMSAGHALHVFIN  504

Query  1846  SELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPVSL  2025
              +L+GTVYG +  PKLTYT +VKL AG N IS LS+AVGLPNVG HFE WNAG+LGPV+L
Sbjct  505   GQLTGTVYGSVDNPKLTYTGNVKLWAGSNTISCLSIAVGLPNVGEHFETWNAGILGPVTL  564

Query  2026  SGLNEGTRDLTNQTWFYKV  2082
              GLNEG RDLT Q W Y+V
Sbjct  565   DGLNEGRRDLTWQKWTYQV  583


 Score =   125 bits (315),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 87/106 (82%), Gaps = 4/106 (4%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASNQPLTWYKATFDAPEGNDPLALDMSSMGKG  2335
             Q+G+KGESLSL++++GSS+VEW +       QPLTWYKA F+AP+G++PLALDMSSMGKG
Sbjct  582   QVGLKGESLSLHSLSGSSTVEWGEP---VQKQPLTWYKAFFNAPDGDEPLALDMSSMGKG  638

Query  2336  EIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             +IW+NG+G+GR+WPGY A G+C + C+Y G Y++ KCQ NCG  SQ
Sbjct  639   QIWINGQGIGRYWPGYKATGNCGT-CDYRGEYDESKCQTNCGDSSQ  683



>ref|XP_009761050.1| PREDICTED: beta-galactosidase 5 [Nicotiana sylvestris]
Length=729

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/561 (66%), Positives = 452/561 (81%), Gaps = 1/561 (0%)
 Frame = +1

Query  403   VSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPSP  582
             V+YD ++ IING+RRIL+SGSIHYPRSTP+MW  L+ KAKD  LDVI+TYVFWN HEPSP
Sbjct  28    VTYDKKAIIINGQRRILLSGSIHYPRSTPEMWEDLINKAKDANLDVIETYVFWNIHEPSP  87

Query  583   GKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQP  762
             G Y+FEGRYDLV+FIK  QKAGLY HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+P
Sbjct  88    GNYDFEGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  147

Query  763   FKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQMA  942
             FK AMQ F  KIV MMKSE+LFESQGGPII+SQIENEY P    +G  G+AY +WA QMA
Sbjct  148   FKAAMQKFTQKIVEMMKSERLFESQGGPIILSQIENEYEPARKALGTAGEAYVQWAAQMA  207

Query  943   VGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPVH  1122
             VGL TGVPW+MCK++DAPDPII+TCNG+YC+ F PNKPYKP M+TE W+GW+T+FGG + 
Sbjct  208   VGLDTGVPWVMCKEDDAPDPIINTCNGFYCDEFSPNKPYKPTMWTEAWSGWFTEFGGTIP  267

Query  1123  RRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVNE  1302
              RP +D+AF+VARF Q  GSFVNYYM+HGGTNFGRTA   FI TSYDYDAP+DEYGL+ E
Sbjct  268   MRPVQDLAFAVARFTQKGGSFVNYYMFHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  327

Query  1303  PKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSAK  1482
             PKY HL++LH+AIKL E AL+SS P V   G +QE HVF S    C AFLSNYD   +A+
Sbjct  328   PKYSHLKELHKAIKLCEQALISSDPTVISLGSSQEAHVFSSGKRNCAAFLSNYDSNSAAR  387

Query  1483  VTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNGF-SWQSYTEEIASS  1659
             V F+N  ++LPPWSISILPDCK+V +NTA V + + Q KMIP G+   SW +Y+E++ S 
Sbjct  388   VVFNNKHFNLPPWSISILPDCKHVAFNTANVGAQTSQVKMIPTGSQLHSWGAYSEDVFSL  447

Query  1660  DDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHVF  1839
             +DG T AA+G+ EQIN+TRD+SDYLWY+T V+I+P E FLR G+ P ++V S+GHA+HVF
Sbjct  448   EDGSTFAANGLLEQINITRDNSDYLWYITSVDISPSESFLRGGQKPTLSVHSSGHAVHVF  507

Query  1840  INSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGPV  2019
             +N +LSG+ YG     K T+T  V L+AG N+I LLS+AVGLPN+GLH+E+WN G+LGPV
Sbjct  508   VNGKLSGSSYGSRRDTKFTFTGPVDLQAGTNRIELLSIAVGLPNIGLHYEEWNTGILGPV  567

Query  2020  SLSGLNEGTRDLTNQTWFYKV  2082
              L GLN+G +DL++Q W YKV
Sbjct  568   VLQGLNQGHKDLSSQKWTYKV  588


 Score =   130 bits (328),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 81/107 (76%), Gaps = 3/107 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLAS-NQPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             ++G+KGE+++L +  G SSV+W  G L     QPL WYKA FDAPEGNDP+ALDM SMGK
Sbjct  587   KVGLKGEAMNLISHHGVSSVDWIGGALATQGQQPLKWYKAYFDAPEGNDPVALDMRSMGK  646

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G++W+NG+ +GR+W   TA G+C +  +YAGTY Q KCQL CGQP+Q
Sbjct  647   GQVWINGQSIGRYWTA-TANGNCDA-FHYAGTYRQTKCQLGCGQPTQ  691



>ref|XP_002510455.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF52642.1| beta-galactosidase, putative [Ricinus communis]
Length=846

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/562 (66%), Positives = 457/562 (81%), Gaps = 2/562 (0%)
 Frame = +1

Query  400   SVSYDGRSFIINGKRRILISGSIHYPRSTPQMWPGLMQKAKDGGLDVIQTYVFWNGHEPS  579
             +V+YD ++ IING+RRILISGSIHYPRSTP+MW  L+QKAKDGGLDVI TYVFW+ HE S
Sbjct  27    TVTYDKKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVIDTYVFWDVHETS  86

Query  580   PGKYNFEGRYDLVKFIKLAQKAGLYVHLRIGPYICGEWNFGGFPIWLKYVPGIEFRTDNQ  759
             PG YNF+GRYDLV+FIK  QK GLY HLRIGPY+C EWNFGGFP+WLKYVPGI FRTDN+
Sbjct  87    PGNYNFDGRYDLVRFIKTVQKVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  146

Query  760   PFKVAMQGFVGKIVNMMKSEKLFESQGGPIIMSQIENEYGPVEWEIGAPGKAYTKWAGQM  939
             PFK AMQGF  KIV MMK+E LF SQGGPII+SQIENEYGP    +GA G++Y  WA +M
Sbjct  147   PFKAAMQGFTQKIVQMMKNENLFASQGGPIILSQIENEYGPESRALGAAGRSYINWAAKM  206

Query  940   AVGLKTGVPWIMCKQEDAPDPIIDTCNGYYCENFHPNKPYKPKMFTELWTGWYTQFGGPV  1119
             AVGL TGVPW+MCK++DAPDP+I+TCNG+YC+ F PNKPYKP ++TE W+GW+T+FGGP+
Sbjct  207   AVGLDTGVPWVMCKEDDAPDPMINTCNGFYCDAFAPNKPYKPTLWTEAWSGWFTEFGGPI  266

Query  1120  HRRPAEDIAFSVARFIQNNGSFVNYYMYHGGTNFGRTAAALFIATSYDYDAPLDEYGLVN  1299
             H+RP ED+AF+VARFIQ  GS+ NYYMYHGGTNFGR+A   FI TSYDYDAP+DEYGL+ 
Sbjct  267   HQRPVEDLAFAVARFIQKGGSYFNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEYGLIR  326

Query  1300  EPKYGHLRDLHRAIKLAEPALVSSYPIVTWFGKNQEVHVFRSETGACVAFLSNYDPQFSA  1479
             EPKYGHL+ LH+AIKL E ALVSS P +T  G  Q+ HVF S   +C AFL+NY+ + +A
Sbjct  327   EPKYGHLKALHKAIKLCEHALVSSDPSITSLGTYQQAHVFSSGR-SCAAFLANYNAKSAA  385

Query  1480  KVTFSNLQYDLPPWSISILPDCKNVVYNTATVRSPSLQTKMIPVGNG-FSWQSYTEEIAS  1656
             +V F+N+ YDLPPWSISILPDC+NVV+NTA V + +L+ +M+P G+  FSW++Y EEI+S
Sbjct  386   RVMFNNMHYDLPPWSISILPDCRNVVFNTARVGAQTLRMQMLPTGSELFSWETYDEEISS  445

Query  1657  SDDGDTVAADGMWEQINVTRDSSDYLWYMTEVNIAPDEEFLRNGKDPVVTVMSAGHAMHV  1836
               D   + A G+ EQINVTRD+SDYLWY+T V+I+P E FLRNG+ P +TV SAGH +HV
Sbjct  446   LTDSSRITALGLLEQINVTRDTSDYLWYLTSVDISPSEAFLRNGQKPSLTVQSAGHGLHV  505

Query  1837  FINSELSGTVYGGLAFPKLTYTNSVKLRAGINKISLLSVAVGLPNVGLHFEKWNAGVLGP  2016
             FIN + SG+ +G     +LT+T  V LRAG N+I+LLS+AVGLPNVGLH+E W  GV GP
Sbjct  506   FINGQFSGSAFGTRENRQLTFTGPVNLRAGTNRIALLSIAVGLPNVGLHYETWKTGVQGP  565

Query  2017  VSLSGLNEGTRDLTNQTWFYKV  2082
             V L+GLN+G +DLT Q W Y+V
Sbjct  566   VLLNGLNQGKKDLTWQKWSYQV  587


 Score =   122 bits (307),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 3/107 (3%)
 Frame = +2

Query  2156  QLGMKGESLSLNTVTGSSSVEWEDGPLLASN-QPLTWYKATFDAPEGNDPLALDMSSMGK  2332
             Q+G+KGE+++L +  G SSV+W +G L +S  Q L W+KA FDAP GN+PLALDM SMGK
Sbjct  586   QVGLKGEAMNLVSPNGVSSVDWIEGSLASSQGQALKWHKAYFDAPRGNEPLALDMRSMGK  645

Query  2333  GEIWVNGEGVGRHWPGYTAQGSCSSECNYAGTYNQKKCQLNCGQPSQ  2473
             G++W+NG+ +GR+W  Y A+G C+S C+Y  T+   KCQL CG+P+Q
Sbjct  646   GQVWINGQSIGRYWMAY-AKGDCNS-CSYIWTFRPSKCQLGCGEPTQ  690



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7725294694944