BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23835_g1_i1 len=344 path=[6742:0-67 164:68-91 188:92-110
207:111-137 6505:138-153 250:154-248 345:249-254 351:255-292
26:293-303 37:304-343]

Length=344
                                                                      Score     E

ref|XP_006358149.1|  PREDICTED: probable LRR receptor-like serine...    103   1e-22   
ref|XP_006428343.1|  hypothetical protein CICLE_v100136772mg          94.7    8e-22   
ref|XP_010316836.1|  PREDICTED: probable LRR receptor-like serine...  98.6    4e-21   
ref|XP_006493622.1|  PREDICTED: LRR receptor-like serine/threonin...  98.2    7e-21   
ref|XP_007025320.1|  Leucine-rich repeat protein kinase family pr...  97.8    1e-20   
ref|XP_006480345.1|  PREDICTED: probable LRR receptor-like serine...  97.4    1e-20   
ref|XP_006480348.1|  PREDICTED: probable LRR receptor-like serine...  97.1    1e-20   
ref|XP_006480347.1|  PREDICTED: probable LRR receptor-like serine...  97.1    2e-20   
ref|XP_006480349.1|  PREDICTED: probable LRR receptor-like serine...  97.1    2e-20   
ref|XP_006480343.1|  PREDICTED: probable LRR receptor-like serine...  97.1    2e-20   
ref|XP_006480344.1|  PREDICTED: probable LRR receptor-like serine...  97.1    2e-20   
ref|XP_009631801.1|  PREDICTED: probable LRR receptor-like serine...  96.3    3e-20   
ref|XP_007025344.1|  Leucine-rich repeat protein kinase family pr...  95.9    4e-20   
emb|CDO96775.1|  unnamed protein product                              95.9    4e-20   
ref|XP_009609321.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-20   
ref|XP_009761465.1|  PREDICTED: LRR receptor-like serine/threonin...  93.2    4e-20   
ref|XP_009609323.1|  PREDICTED: probable LRR receptor-like serine...  95.9    4e-20   
ref|XP_009759632.1|  PREDICTED: LRR receptor-like serine/threonin...  95.9    5e-20   
ref|XP_009759631.1|  PREDICTED: probable LRR receptor-like serine...  95.9    5e-20   
ref|XP_009775747.1|  PREDICTED: probable LRR receptor-like serine...  95.1    6e-20   
ref|XP_009775745.1|  PREDICTED: probable LRR receptor-like serine...  95.1    6e-20   
ref|XP_009775746.1|  PREDICTED: probable LRR receptor-like serine...  95.1    6e-20   
gb|KDO49786.1|  hypothetical protein CISIN_1g001710mg                 94.7    1e-19   
gb|KDO42039.1|  hypothetical protein CISIN_1g001988mg                 94.0    2e-19   
ref|XP_004231674.1|  PREDICTED: probable LRR receptor-like serine...  94.0    2e-19   
ref|XP_006449526.1|  hypothetical protein CICLE_v10017696mg           90.9    4e-19   
ref|XP_007213080.1|  hypothetical protein PRUPE_ppa021211mg           92.8    4e-19   
gb|KDP42121.1|  hypothetical protein JCGZ_01909                       92.4    4e-19   
ref|XP_009760562.1|  PREDICTED: probable LRR receptor-like serine...  92.8    5e-19   
ref|XP_007212588.1|  hypothetical protein PRUPE_ppa015971mg           92.4    6e-19   
ref|XP_006428344.1|  hypothetical protein CICLE_v100136771mg          87.8    8e-19   
ref|XP_007019765.1|  Leucine-rich receptor protein kinase family ...  90.1    8e-19   
ref|XP_010260175.1|  PREDICTED: LRR receptor-like serine/threonin...  92.0    8e-19   
ref|XP_006427090.1|  hypothetical protein CICLE_v10026978mg           92.0    1e-18   
ref|XP_011078429.1|  PREDICTED: probable LRR receptor-like serine...  92.0    1e-18   
ref|XP_002280075.2|  PREDICTED: probable LRR receptor-like serine...  91.7    1e-18   Vitis vinifera
ref|XP_009772557.1|  PREDICTED: probable LRR receptor-like serine...  91.7    1e-18   
ref|XP_011078427.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    1e-18   
ref|XP_011078428.1|  PREDICTED: probable LRR receptor-like serine...  91.7    1e-18   
ref|XP_007019777.1|  Leucine-rich receptor protein kinase family ...  87.8    1e-18   
ref|XP_002527075.1|  serine-threonine protein kinase, plant-type,...  91.3    2e-18   Ricinus communis
ref|XP_006494781.1|  PREDICTED: probable leucine-rich repeat rece...  89.7    2e-18   
emb|CBI31777.3|  unnamed protein product                              90.5    2e-18   
ref|XP_006480346.1|  PREDICTED: probable LRR receptor-like serine...  91.3    2e-18   
ref|XP_011091709.1|  PREDICTED: probable LRR receptor-like serine...  91.3    2e-18   
emb|CDP09585.1|  unnamed protein product                              90.9    2e-18   
ref|XP_006442746.1|  hypothetical protein CICLE_v100193952mg          88.2    2e-18   
ref|XP_008232234.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  90.9    2e-18   
ref|XP_006442747.1|  hypothetical protein CICLE_v100193952mg          88.2    2e-18   
ref|XP_010657055.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    3e-18   
ref|XP_009784945.1|  PREDICTED: probable leucine-rich repeat rece...  90.1    3e-18   
ref|WP_012022692.1|  two component regulator                          90.9    3e-18   
gb|KDO49849.1|  hypothetical protein CISIN_1g001838mg                 90.5    3e-18   
ref|XP_009606161.1|  PREDICTED: putative receptor-like protein ki...  90.5    3e-18   
ref|XP_006489970.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    3e-18   
ref|XP_010932810.1|  PREDICTED: probable LRR receptor-like serine...  89.4    3e-18   
emb|CDP11244.1|  unnamed protein product                              90.1    4e-18   
ref|XP_006427088.1|  hypothetical protein CICLE_v10027419mg           90.1    4e-18   
gb|EYU30656.1|  hypothetical protein MIMGU_mgv1a025198mg              90.1    4e-18   
emb|CDO96827.1|  unnamed protein product                              90.1    4e-18   
ref|XP_006465517.1|  PREDICTED: LRR receptor-like serine/threonin...  90.1    5e-18   
ref|XP_011091710.1|  PREDICTED: probable LRR receptor-like serine...  89.7    5e-18   
emb|CDP15116.1|  unnamed protein product                              89.7    6e-18   
ref|XP_006442663.1|  hypothetical protein CICLE_v10024465mg           86.3    6e-18   
gb|KCW70971.1|  hypothetical protein EUGRSUZ_F040812                  86.3    6e-18   
ref|XP_010657052.1|  PREDICTED: putative receptor-like protein ki...  89.7    7e-18   
ref|XP_002325932.2|  hypothetical protein POPTR_0019s08830g           89.4    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009596314.1|  PREDICTED: probable LRR receptor-like serine...  89.4    7e-18   
ref|XP_010657053.1|  PREDICTED: probable LRR receptor-like serine...  89.7    7e-18   
ref|WP_035091656.1|  hypothetical protein                             86.3    7e-18   
emb|CDP20095.1|  unnamed protein product                              89.0    7e-18   
gb|KDO44560.1|  hypothetical protein CISIN_1g0022142mg                86.7    7e-18   
ref|XP_009765991.1|  PREDICTED: putative receptor-like protein ki...  89.4    7e-18   
emb|CDP19284.1|  unnamed protein product                              88.6    8e-18   
gb|KCW56179.1|  hypothetical protein EUGRSUZ_I01928                   88.6    8e-18   
ref|XP_007214055.1|  hypothetical protein PRUPE_ppa017509mg           89.0    1e-17   
ref|XP_006465462.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    1e-17   
ref|XP_006367139.1|  PREDICTED: probable leucine-rich repeat rece...  87.0    1e-17   
ref|XP_006436338.1|  hypothetical protein CICLE_v10030526mg           88.6    1e-17   
ref|XP_006436336.1|  hypothetical protein CICLE_v10030526mg           89.0    1e-17   
gb|KDO44559.1|  hypothetical protein CISIN_1g043347mg                 86.3    1e-17   
ref|XP_010039052.1|  PREDICTED: probable LRR receptor-like serine...  88.6    1e-17   
ref|XP_009599479.1|  PREDICTED: probable leucine-rich repeat rece...  88.6    1e-17   
emb|CAN61202.1|  hypothetical protein VITISV_009745                   88.6    1e-17   Vitis vinifera
gb|KCW48763.1|  hypothetical protein EUGRSUZ_K02407                   88.6    1e-17   
ref|XP_010317427.1|  PREDICTED: probable LRR receptor-like serine...  88.6    1e-17   
ref|XP_009780958.1|  PREDICTED: probable leucine-rich repeat rece...  88.6    1e-17   
ref|XP_008339463.1|  PREDICTED: probable leucine-rich repeat rece...  87.4    1e-17   
ref|XP_006657092.1|  PREDICTED: probable LRR receptor-like serine...  88.6    1e-17   
ref|XP_006465465.1|  PREDICTED: probable LRR receptor-like serine...  88.6    1e-17   
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...  88.6    1e-17   
ref|XP_008779587.1|  PREDICTED: probable LRR receptor-like serine...  88.2    2e-17   
gb|KCW54189.1|  hypothetical protein EUGRSUZ_I00178                   86.3    2e-17   
gb|KDP31299.1|  hypothetical protein JCGZ_11675                       88.2    2e-17   
ref|XP_006465461.1|  PREDICTED: probable LRR receptor-like serine...  87.4    2e-17   
ref|XP_008339062.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    2e-17   
ref|XP_010268541.1|  PREDICTED: probable LRR receptor-like serine...  88.2    2e-17   
ref|XP_006465459.1|  PREDICTED: probable LRR receptor-like serine...  87.4    2e-17   
ref|XP_010030330.1|  PREDICTED: probable leucine-rich repeat rece...  86.3    2e-17   
gb|KCW56528.1|  hypothetical protein EUGRSUZ_I02256                   87.0    2e-17   
gb|KDO39219.1|  hypothetical protein CISIN_1g045487mg                 87.8    2e-17   
emb|CDP19964.1|  unnamed protein product                              86.3    2e-17   
ref|XP_006495104.1|  PREDICTED: leucine-rich repeat receptor-like...  82.4    2e-17   
ref|XP_006465460.1|  PREDICTED: probable LRR receptor-like serine...  87.0    2e-17   
ref|XP_008372587.1|  PREDICTED: probable LRR receptor-like serine...  87.8    2e-17   
emb|CDP18613.1|  unnamed protein product                              87.8    2e-17   
ref|XP_007021860.1|  Leucine-rich repeat protein kinase family pr...  87.8    2e-17   
gb|KCW48742.1|  hypothetical protein EUGRSUZ_K02381                   87.8    2e-17   
ref|XP_003563067.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    2e-17   
ref|XP_010910120.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    2e-17   
ref|XP_006489993.1|  PREDICTED: leucine-rich repeat receptor prot...  82.0    3e-17   
gb|KHN27325.1|  Putative leucine-rich repeat receptor-like protei...  87.8    3e-17   
ref|XP_010064493.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    3e-17   
ref|XP_009606790.1|  PREDICTED: probable leucine-rich repeat rece...  84.0    3e-17   
ref|XP_010446261.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    3e-17   
ref|WP_030001516.1|  hypothetical protein                             82.8    3e-17   
ref|XP_006830630.1|  hypothetical protein AMTR_s00120p00096470        87.4    3e-17   
gb|AAX19030.1|  Hcr2-p7.1                                             86.3    3e-17   Solanum pimpinellifolium [currant tomato]
gb|AAX19031.1|  Hcr2-p7.2                                             86.3    3e-17   Solanum pimpinellifolium [currant tomato]
ref|XP_008219741.1|  PREDICTED: probable leucine-rich repeat rece...  87.4    3e-17   
emb|CAC20842.1|  receptor protein kinase                              87.4    3e-17   Pinus sylvestris [Scotch pine]
ref|XP_006279918.1|  hypothetical protein CARUB_v10025776mg           87.4    3e-17   
gb|AAX19033.1|  Hcr2-p7.4                                             86.3    3e-17   Solanum pimpinellifolium [currant tomato]
ref|XP_010040512.1|  PREDICTED: probable LRR receptor-like serine...  87.0    3e-17   
ref|XP_010666186.1|  PREDICTED: probable leucine-rich repeat rece...  87.4    3e-17   
gb|AAX19032.1|  Hcr2-p7.3                                             86.3    3e-17   Solanum pimpinellifolium [currant tomato]
ref|XP_002281133.1|  PREDICTED: probably inactive leucine-rich re...  87.4    3e-17   Vitis vinifera
ref|XP_006358724.1|  PREDICTED: probable LRR receptor-like serine...  87.4    3e-17   
ref|XP_006494331.1|  PREDICTED: LRR receptor-like serine/threonin...  87.0    4e-17   
gb|KDO77432.1|  hypothetical protein CISIN_1g001794mg                 87.4    4e-17   
ref|XP_006387609.1|  hypothetical protein POPTR_0780s002001g          82.4    4e-17   
emb|CDY68314.1|  BnaCnng58470D                                        87.0    4e-17   
ref|XP_010520939.1|  PREDICTED: leucine-rich repeat receptor-like...  87.4    4e-17   
gb|KCW80202.1|  hypothetical protein EUGRSUZ_C015471                  83.6    4e-17   
gb|AAC78593.1|  Hcr2-0B                                               87.0    4e-17   Solanum lycopersicum
gb|AAX19036.1|  Hcr2-p7.7                                             85.9    4e-17   Solanum pimpinellifolium [currant tomato]
ref|XP_003571217.1|  PREDICTED: probable LRR receptor-like serine...  87.4    4e-17   
ref|XP_010321824.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  87.0    4e-17   
ref|XP_007021764.1|  Leucine-rich repeat protein kinase family pr...  87.4    4e-17   
gb|AAX19037.1|  Hcr2-p7.8                                             85.9    4e-17   Solanum pimpinellifolium [currant tomato]
gb|KDO47795.1|  hypothetical protein CISIN_1g011044mg                 85.9    4e-17   
gb|EDN70504.1|  conserved hypothetical protein                        87.0    4e-17   Beggiatoa sp. PS
gb|KDO48857.1|  hypothetical protein CISIN_1g046438mg                 87.0    4e-17   
ref|XP_006487701.1|  PREDICTED: probable LRR receptor-like serine...  87.0    4e-17   
ref|XP_003625388.1|  Receptor-like protein kinase                     87.0    5e-17   
ref|XP_010045480.1|  PREDICTED: probable LRR receptor-like serine...  86.7    5e-17   
ref|XP_011099195.1|  PREDICTED: probable LRR receptor-like serine...  87.0    5e-17   
ref|XP_009799747.1|  PREDICTED: probable LRR receptor-like serine...  87.0    5e-17   
ref|WP_010653235.1|  RHS repeat-associated core domain-containing...  84.0    5e-17   
emb|CDP18219.1|  unnamed protein product                              86.7    5e-17   
ref|XP_004493833.1|  PREDICTED: leucine-rich repeat receptor-like...  86.7    5e-17   
ref|XP_010267182.1|  PREDICTED: probably inactive leucine-rich re...  86.7    6e-17   
emb|CBJ26402.1|  LRR-GTPase of the ROCO family                        87.0    6e-17   
ref|XP_010268403.1|  PREDICTED: probable LRR receptor-like serine...  86.7    6e-17   
gb|KCW45155.1|  hypothetical protein EUGRSUZ_L01229                   86.7    6e-17   
ref|XP_006367143.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    6e-17   
ref|XP_006366180.1|  PREDICTED: probable LRR receptor-like serine...  86.7    6e-17   
ref|XP_006421398.1|  hypothetical protein CICLE_v10004266mg           86.7    6e-17   
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  86.7    6e-17   
gb|ABW72737.1|  flagellin-sensing 2-like protein                      86.3    6e-17   Brassica fruticulosa
emb|CDP08216.1|  unnamed protein product                              86.7    6e-17   
ref|XP_011047522.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    6e-17   
gb|KDO37282.1|  hypothetical protein CISIN_1g036127mg                 82.0    7e-17   
gb|KEH22311.1|  LRR receptor-like kinase family protein               86.7    7e-17   
ref|XP_006421396.1|  hypothetical protein CICLE_v10004247mg           86.7    7e-17   
ref|WP_027271448.1|  hypothetical protein                             83.6    7e-17   
gb|AAX19025.1|  Hcr2-p3                                               86.3    7e-17   Solanum pimpinellifolium [currant tomato]
gb|AAX19038.1|  Hcr2-p7.9                                             85.5    7e-17   Solanum pimpinellifolium [currant tomato]
ref|XP_007021761.1|  Leucine-rich repeat protein kinase family pr...  86.7    7e-17   
emb|CDP00850.1|  unnamed protein product                              86.7    7e-17   
ref|XP_007022966.1|  Leucine-rich repeat protein kinase family pr...  86.7    7e-17   
ref|XP_003622567.1|  Receptor-like protein kinase                     86.7    7e-17   
gb|KCW83107.1|  hypothetical protein EUGRSUZ_B00060                   86.3    8e-17   
ref|XP_006358132.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    8e-17   
ref|XP_002864877.1|  hypothetical protein ARALYDRAFT_496585           86.3    8e-17   
gb|AES78785.2|  LRR receptor-like kinase family protein               86.3    8e-17   
gb|AAX19035.1|  Hcr2-p7.6                                             85.1    8e-17   Solanum pimpinellifolium [currant tomato]
ref|XP_007139615.1|  hypothetical protein PHAVU_008G044600g           85.9    8e-17   
gb|AAC78595.1|  Hcr2-5B                                               85.9    9e-17   Solanum lycopersicum
ref|XP_004969827.1|  PREDICTED: probable leucine-rich repeat rece...  85.1    9e-17   
ref|XP_003532650.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    9e-17   
ref|XP_006470719.1|  PREDICTED: probable LRR receptor-like serine...  85.9    9e-17   
ref|XP_006476119.1|  PREDICTED: probable LRR receptor-like serine...  86.3    9e-17   
ref|XP_006470718.1|  PREDICTED: probable LRR receptor-like serine...  85.9    9e-17   
ref|XP_006489992.1|  PREDICTED: leucine-rich repeat receptor prot...  82.0    9e-17   
gb|KCW62655.1|  hypothetical protein EUGRSUZ_G00190                   85.9    9e-17   
ref|XP_006494359.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    9e-17   
emb|CDP21854.1|  unnamed protein product                              84.7    9e-17   
gb|KHN28978.1|  LRR receptor-like serine/threonine-protein kinase...  86.3    9e-17   
gb|ABW72740.1|  flagellin-sensing 2-like protein                      85.5    9e-17   Isatis glauca
gb|EMT24762.1|  LRR receptor-like serine/threonine-protein kinase...  84.3    9e-17   
ref|XP_006420529.1|  hypothetical protein CICLE_v10004196mg           86.3    1e-16   
emb|CDP08219.1|  unnamed protein product                              85.9    1e-16   
ref|XP_010249537.1|  PREDICTED: probably inactive leucine-rich re...  85.9    1e-16   
gb|KDO46289.1|  hypothetical protein CISIN_1g001434mg                 85.9    1e-16   
ref|XP_010249536.1|  PREDICTED: probably inactive leucine-rich re...  85.9    1e-16   
ref|XP_006494358.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    1e-16   
ref|XP_010484156.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    1e-16   
emb|CDP21206.1|  unnamed protein product                              85.5    1e-16   
ref|XP_006492136.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    1e-16   
ref|XP_009363421.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    1e-16   
gb|KDO50403.1|  hypothetical protein CISIN_1g035522mg                 85.1    1e-16   
ref|XP_009363424.1|  PREDICTED: probable LRR receptor-like serine...  85.9    1e-16   
ref|XP_009775548.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    1e-16   
ref|XP_006495355.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    1e-16   
emb|CDP01048.1|  unnamed protein product                              84.3    1e-16   
ref|XP_006470717.1|  PREDICTED: probable LRR receptor-like serine...  85.9    1e-16   
gb|EYU21247.1|  hypothetical protein MIMGU_mgv1a000928mg              85.9    1e-16   
ref|XP_008227225.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    1e-16   
ref|XP_010916724.1|  PREDICTED: putative receptor-like protein ki...  85.9    1e-16   
ref|XP_006465579.1|  PREDICTED: probable LRR receptor-like serine...  85.9    1e-16   
gb|KDO39503.1|  hypothetical protein CISIN_1g040632mg                 82.4    1e-16   
ref|XP_006470716.1|  PREDICTED: probable LRR receptor-like serine...  85.9    1e-16   
ref|XP_006489951.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    1e-16   
gb|AAC15780.1|  Cf-2.2                                                85.9    1e-16   Solanum pimpinellifolium [currant tomato]
gb|EYU28102.1|  hypothetical protein MIMGU_mgv1a000498mg              85.9    1e-16   
ref|XP_006492135.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    1e-16   
emb|CDO96821.1|  unnamed protein product                              85.5    1e-16   
gb|AAX19021.1|  Cf-2.3                                                85.9    1e-16   Solanum pimpinellifolium [currant tomato]
ref|XP_006367500.1|  PREDICTED: probable leucine-rich repeat rece...  85.1    1e-16   
gb|EMS60862.1|  LRR receptor-like serine/threonine-protein kinase...  85.5    1e-16   
ref|XP_008388751.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  85.9    1e-16   
emb|CDP01047.1|  unnamed protein product                              85.5    1e-16   
ref|XP_009589467.1|  PREDICTED: putative receptor-like protein ki...  85.5    1e-16   
gb|AAC15779.1|  Cf-2.1                                                85.9    1e-16   Solanum pimpinellifolium [currant tomato]
gb|EMT29923.1|  LRR receptor-like serine/threonine-protein kinase...  85.9    1e-16   
ref|XP_006465576.1|  PREDICTED: probable LRR receptor-like serine...  85.9    1e-16   
gb|KDO43020.1|  hypothetical protein CISIN_1g002679mg                 85.5    1e-16   
ref|XP_006465577.1|  PREDICTED: probable LRR receptor-like serine...  85.5    1e-16   
ref|XP_010069084.1|  PREDICTED: probable leucine-rich repeat rece...  85.5    1e-16   
ref|XP_006424099.1|  hypothetical protein CICLE_v10027783mg           85.5    1e-16   
ref|XP_010039045.1|  PREDICTED: probable LRR receptor-like serine...  85.9    1e-16   
ref|NP_201198.1|  leucine-rich repeat protein kinase-like protein     85.5    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KHN19731.1|  Probably inactive leucine-rich repeat receptor-li...  84.7    1e-16   
ref|XP_006358148.1|  PREDICTED: probable LRR receptor-like serine...  85.5    1e-16   
ref|XP_006296580.1|  hypothetical protein CARUB_v100225661mg          85.1    1e-16   
ref|XP_007227628.1|  hypothetical protein PRUPE_ppa024924mg           85.5    1e-16   
ref|WP_018052153.1|  MULTISPECIES: hypothetical protein               84.7    1e-16   
ref|XP_007038251.1|  Leucine-rich repeat transmembrane protein ki...  82.4    1e-16   
gb|EYU43344.1|  hypothetical protein MIMGU_mgv11b018117mg             85.5    1e-16   
ref|XP_006371660.1|  hypothetical protein POPTR_0019s14400g           85.5    1e-16   
ref|XP_002513911.1|  receptor protein kinase, putative                85.5    1e-16   Ricinus communis
ref|XP_006465573.1|  PREDICTED: probable LRR receptor-like serine...  85.5    1e-16   
ref|XP_004242680.2|  PREDICTED: probable LRR receptor-like serine...  85.5    1e-16   
ref|XP_010065134.1|  PREDICTED: probable leucine-rich repeat rece...  85.5    2e-16   
gb|ABW72739.1|  flagellin-sensing 2-like protein                      85.1    2e-16   Eruca vesicaria
ref|XP_011000314.1|  PREDICTED: probable LRR receptor-like serine...  85.5    2e-16   
ref|XP_011024454.1|  PREDICTED: probable LRR receptor-like serine...  85.5    2e-16   
ref|XP_010321913.1|  PREDICTED: probable LRR receptor-like serine...  85.1    2e-16   
ref|XP_002303115.2|  hypothetical protein POPTR_0002s26010g           85.5    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006493827.1|  PREDICTED: probable LRR receptor-like serine...  85.1    2e-16   
ref|XP_009604301.1|  PREDICTED: probable LRR receptor-like serine...  85.1    2e-16   
ref|XP_006493826.1|  PREDICTED: probable LRR receptor-like serine...  85.5    2e-16   
emb|CBJ27112.1|  Hypothetical leucine rich repeat protein             80.1    2e-16   
ref|XP_002450799.1|  hypothetical protein SORBIDRAFT_05g018800        82.0    2e-16   Sorghum bicolor [broomcorn]
ref|XP_010933233.1|  PREDICTED: probable LRR receptor-like serine...  85.5    2e-16   
ref|XP_011070082.1|  PREDICTED: putative receptor-like protein ki...  85.1    2e-16   
ref|XP_009104914.1|  PREDICTED: receptor-like protein 12              85.1    2e-16   
ref|XP_006386916.1|  hypothetical protein POPTR_0002s26010g           85.5    2e-16   
ref|XP_006397386.1|  hypothetical protein EUTSA_v10022488mg           85.1    2e-16   
ref|XP_006377964.1|  kinase family protein                            85.1    2e-16   
ref|XP_010447945.1|  PREDICTED: leucine-rich repeat receptor-like...  85.1    2e-16   
ref|XP_006354069.1|  PREDICTED: probable LRR receptor-like serine...  85.1    2e-16   
ref|XP_006356132.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    2e-16   
gb|AAC78596.1|  Hcr2-5D                                               85.1    2e-16   Solanum lycopersicum
gb|KDO35817.1|  hypothetical protein CISIN_1g035658mg                 82.0    2e-16   
gb|AAC78591.1|  disease resistance protein                            85.1    2e-16   Solanum lycopersicum
ref|XP_010040916.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-16   
ref|XP_011002880.1|  PREDICTED: probable LRR receptor-like serine...  85.1    2e-16   
gb|EPS69792.1|  hypothetical protein M569_04970                       85.1    2e-16   
ref|XP_002523843.1|  serine-threonine protein kinase, plant-type,...  84.0    2e-16   Ricinus communis
emb|CAN79986.1|  hypothetical protein VITISV_039668                   85.1    2e-16   Vitis vinifera
ref|XP_010911270.1|  PREDICTED: probable LRR receptor-like serine...  84.3    2e-16   
ref|XP_009372104.1|  PREDICTED: probable leucine-rich repeat rece...  84.7    2e-16   
ref|XP_008236450.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-16   
emb|CDP19287.1|  unnamed protein product                              84.3    2e-16   
ref|XP_002283031.3|  PREDICTED: probable leucine-rich repeat rece...  84.7    3e-16   Vitis vinifera
gb|KHN25880.1|  LRR receptor-like serine/threonine-protein kinase...  84.3    3e-16   
ref|XP_010051569.1|  PREDICTED: putative receptor-like protein ki...  84.7    3e-16   
ref|XP_006493152.1|  PREDICTED: probable LRR receptor-like serine...  84.7    3e-16   
ref|XP_011002881.1|  PREDICTED: probable LRR receptor-like serine...  84.7    3e-16   
emb|CAN81714.1|  hypothetical protein VITISV_005816                   85.1    3e-16   
gb|EYU42423.1|  hypothetical protein MIMGU_mgv1a024814mg              84.7    3e-16   
ref|XP_011044908.1|  PREDICTED: probable LRR receptor-like serine...  84.7    3e-16   
ref|XP_006349975.1|  PREDICTED: probable leucine-rich repeat rece...  84.7    3e-16   
emb|CDP19735.1|  unnamed protein product                              84.7    3e-16   
gb|AAX19029.1|  Hcr2-p6                                               82.4    3e-16   
ref|XP_007227047.1|  hypothetical protein PRUPE_ppa023531mg           84.7    3e-16   
ref|XP_010461166.1|  PREDICTED: probable leucine-rich repeat rece...  84.7    3e-16   
ref|XP_007040985.1|  Leucine-rich repeat transmembrane protein ki...  84.7    3e-16   
gb|KDO36330.1|  hypothetical protein CISIN_1g035904mg                 81.6    3e-16   
ref|XP_009612574.1|  PREDICTED: probable leucine-rich repeat rece...  79.0    3e-16   
ref|XP_006371653.1|  hypothetical protein POPTR_0019s14340g           84.3    3e-16   
dbj|BAP56049.1|  NHL repeat-containing protein                        84.7    3e-16   
ref|XP_009390137.1|  PREDICTED: probable leucine-rich repeat rece...  84.7    3e-16   
gb|KCW82349.1|  hypothetical protein EUGRSUZ_C03754                   84.3    3e-16   
emb|CDP08222.1|  unnamed protein product                              84.3    3e-16   
emb|CDP18770.1|  unnamed protein product                              84.7    3e-16   
ref|XP_009388306.1|  PREDICTED: putative receptor-like protein ki...  84.3    3e-16   
ref|XP_006436335.1|  hypothetical protein CICLE_v10030526mg           84.7    3e-16   
ref|WP_030001613.1|  hypothetical protein                             82.0    3e-16   
ref|XP_007021924.1|  Serine-threonine protein kinase                  82.8    3e-16   
ref|XP_004488712.1|  PREDICTED: leucine-rich repeat receptor-like...  84.7    3e-16   
ref|XP_006436337.1|  hypothetical protein CICLE_v10030526mg           84.3    3e-16   
ref|XP_010318974.1|  PREDICTED: probable leucine-rich repeat rece...  79.7    3e-16   
emb|CDP16386.1|  unnamed protein product                              84.7    3e-16   
ref|XP_009629804.1|  PREDICTED: probable LRR receptor-like serine...  84.3    3e-16   
ref|XP_004488711.1|  PREDICTED: leucine-rich repeat receptor-like...  84.3    3e-16   
ref|XP_006436334.1|  hypothetical protein CICLE_v10030526mg           84.3    3e-16   
gb|KDO43139.1|  hypothetical protein CISIN_1g047676mg                 83.6    3e-16   
ref|XP_006285784.1|  hypothetical protein CARUB_v10007258mg           84.3    4e-16   
emb|CDP20759.1|  unnamed protein product                              84.7    4e-16   
gb|EYU43346.1|  hypothetical protein MIMGU_mgv1a000589mg              84.3    4e-16   
gb|EMS51979.1|  LRR receptor-like serine/threonine-protein kinase...  83.6    4e-16   
ref|XP_007158959.1|  hypothetical protein PHAVU_002G196200g           84.3    4e-16   
ref|XP_006421393.1|  hypothetical protein CICLE_v10007058mg           84.0    4e-16   
ref|XP_010318949.1|  PREDICTED: probable leucine-rich repeat rece...  79.3    4e-16   
emb|CDP22147.1|  unnamed protein product                              81.6    4e-16   
ref|XP_010655820.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    4e-16   
ref|XP_010050763.1|  PREDICTED: putative receptor-like protein ki...  84.3    4e-16   
emb|CDY31136.1|  BnaA08g26860D                                        84.3    4e-16   
ref|XP_006662949.1|  PREDICTED: somatic embryogenesis receptor ki...  80.9    4e-16   
emb|CAN79970.1|  hypothetical protein VITISV_043680                   84.0    4e-16   
ref|XP_010063638.1|  PREDICTED: receptor-like protein kinase          84.3    4e-16   
ref|XP_008219743.1|  PREDICTED: probable LRR receptor-like serine...  84.3    4e-16   
emb|CDY37560.1|  BnaA02g20100D                                        84.3    4e-16   
ref|XP_010317425.1|  PREDICTED: probable LRR receptor-like serine...  84.0    4e-16   
gb|AAX19026.1|  Hcr2-p4.1                                             84.0    4e-16   
gb|EYU28103.1|  hypothetical protein MIMGU_mgv1a001115mg              84.0    4e-16   
gb|AAX19027.1|  Hcr2-p4.2                                             84.0    4e-16   
ref|XP_010320167.1|  PREDICTED: probable LRR receptor-like serine...  84.3    4e-16   
ref|XP_006495275.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    4e-16   
gb|KCW85333.1|  hypothetical protein EUGRSUZ_B02171                   84.0    4e-16   
gb|KDP33381.1|  hypothetical protein JCGZ_12930                       84.3    4e-16   
ref|XP_006465518.1|  PREDICTED: probable LRR receptor-like serine...  84.3    5e-16   
gb|EYU38095.1|  hypothetical protein MIMGU_mgv1a024467mg              80.9    5e-16   
ref|XP_004294902.1|  PREDICTED: probable LRR receptor-like serine...  84.0    5e-16   
ref|XP_006490007.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    5e-16   
emb|CDP08221.1|  unnamed protein product                              84.0    5e-16   
emb|CDP16388.1|  unnamed protein product                              82.0    5e-16   
ref|XP_010091183.1|  Leucine-rich repeat receptor-like protein ki...  84.0    5e-16   
ref|XP_010050670.1|  PREDICTED: putative receptor-like protein ki...  84.0    5e-16   
emb|CDP18620.1|  unnamed protein product                              84.0    5e-16   
ref|XP_006465578.1|  PREDICTED: probable LRR receptor-like serine...  84.0    5e-16   
ref|XP_009409686.1|  PREDICTED: putative receptor-like protein ki...  84.3    5e-16   
ref|XP_010043323.1|  PREDICTED: probable leucine-rich repeat rece...  84.0    5e-16   
ref|XP_006489991.1|  PREDICTED: probable LRR receptor-like serine...  84.0    5e-16   
gb|KDO77404.1|  hypothetical protein CISIN_1g039290mg                 84.0    5e-16   
gb|KCW80477.1|  hypothetical protein EUGRSUZ_C01820                   84.0    5e-16   
ref|XP_004966011.1|  PREDICTED: probable LRR receptor-like serine...  84.0    5e-16   
gb|KHG23182.1|  hypothetical protein F383_03005                       84.0    5e-16   
gb|EPS63883.1|  hypothetical protein M569_10899                       84.0    6e-16   
gb|AHM95444.1|  somatic embryogenesis receptor-like kinase 2          83.2    6e-16   
ref|XP_006387107.1|  hypothetical protein POPTR_1834s00200g           81.3    6e-16   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  84.0    6e-16   
gb|KCW56991.1|  hypothetical protein EUGRSUZ_I02665                   83.6    6e-16   
ref|XP_010655821.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    6e-16   
ref|XP_006340921.1|  PREDICTED: probable leucine-rich repeat rece...  84.0    6e-16   
ref|XP_006465575.1|  PREDICTED: probable LRR receptor-like serine...  84.0    6e-16   
ref|XP_009619421.1|  PREDICTED: probable LRR receptor-like serine...  84.0    6e-16   
gb|KCW54188.1|  hypothetical protein EUGRSUZ_I00176                   82.8    6e-16   
ref|XP_010433191.1|  PREDICTED: leucine-rich repeat receptor-like...  83.6    6e-16   
gb|KEH19913.1|  LRR receptor-like kinase family protein               83.6    6e-16   
ref|XP_007199095.1|  hypothetical protein PRUPE_ppa020469mg           80.9    6e-16   
ref|XP_010314766.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    6e-16   
gb|ACL53442.1|  unknown                                               83.2    7e-16   
ref|NP_001105133.1|  somatic embryogenesis receptor-like kinase2 ...  83.2    7e-16   
ref|XP_008355519.1|  PREDICTED: LRR receptor-like serine/threonin...  79.3    7e-16   
ref|XP_010050671.1|  PREDICTED: putative receptor-like protein ki...  83.6    7e-16   
emb|CAC37641.1|  somatic embryogenesis receptor-like kinase 2         83.2    7e-16   
ref|XP_006465521.1|  PREDICTED: leucine-rich repeat receptor-like...  80.9    7e-16   
ref|XP_010486706.1|  PREDICTED: receptor-like protein 12              83.6    7e-16   
ref|XP_010030929.1|  PREDICTED: probable LRR receptor-like serine...  83.6    7e-16   
gb|AGO88094.1|  hypothetical protein                                  82.0    7e-16   
gb|KEH36626.1|  LRR receptor-like kinase                              83.6    7e-16   
ref|XP_009375060.1|  PREDICTED: probable LRR receptor-like serine...  83.6    7e-16   
ref|XP_008219676.1|  PREDICTED: probable LRR receptor-like serine...  83.6    7e-16   
gb|EMT01434.1|  Putative LRR receptor-like serine/threonine-prote...  83.6    7e-16   
gb|KCW80214.1|  hypothetical protein EUGRSUZ_C01568                   83.6    7e-16   
ref|XP_003577543.1|  PREDICTED: somatic embryogenesis receptor ki...  80.1    8e-16   
ref|XP_006303147.1|  hypothetical protein CARUB_v10008271mg           83.2    8e-16   
ref|XP_009401726.1|  PREDICTED: probable LRR receptor-like serine...  83.6    8e-16   
ref|XP_006489959.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    8e-16   
ref|XP_006476025.1|  PREDICTED: probably inactive leucine-rich re...  83.6    8e-16   
gb|AAX19024.1|  Hcr2-p2                                               83.2    8e-16   
ref|XP_002317405.2|  hypothetical protein POPTR_0011s07140g           83.6    8e-16   
ref|XP_006358151.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    8e-16   
ref|XP_006442664.1|  hypothetical protein CICLE_v10018643mg           83.6    8e-16   
ref|XP_008438405.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    8e-16   
gb|KCW45801.1|  hypothetical protein EUGRSUZ_L003811                  82.4    8e-16   
gb|KDO49387.1|  hypothetical protein CISIN_1g0429581mg                83.2    8e-16   
gb|KHN20812.1|  Putative leucine-rich repeat receptor-like protei...  83.6    8e-16   
ref|XP_010064760.1|  PREDICTED: probable leucine-rich repeat rece...  80.5    8e-16   
ref|XP_006416726.1|  hypothetical protein EUTSA_v10006611mg           83.6    8e-16   
emb|CBI29526.3|  unnamed protein product                              83.2    8e-16   
ref|XP_003535237.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    8e-16   
ref|XP_010909661.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    8e-16   
ref|XP_006399210.1|  hypothetical protein EUTSA_v10012465mg           83.6    9e-16   
ref|XP_003524111.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    9e-16   
emb|CBI35098.3|  unnamed protein product                              82.8    9e-16   
ref|XP_006442392.1|  hypothetical protein CICLE_v10023311mg           83.2    9e-16   
gb|ABW72736.1|  flagellin-sensing 2-like protein                      82.8    9e-16   
ref|XP_010655741.1|  PREDICTED: LRR receptor-like serine/threonin...  80.5    9e-16   
ref|XP_010647269.1|  PREDICTED: probable LRR receptor-like serine...  83.2    9e-16   
ref|XP_006442932.1|  hypothetical protein CICLE_v10024069mg           83.2    9e-16   
ref|XP_006424103.1|  hypothetical protein CICLE_v10027723mg           83.2    9e-16   
ref|XP_009128461.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    9e-16   
ref|XP_003593158.1|  Somatic embryogenesis receptor-like kinase       82.8    9e-16   
ref|XP_011095588.1|  PREDICTED: probable LRR receptor-like serine...  83.2    9e-16   
gb|KDO39993.1|  hypothetical protein CISIN_1g0015441mg                83.2    9e-16   
emb|CDP20832.1|  unnamed protein product                              83.2    9e-16   
gb|KCW54202.1|  hypothetical protein EUGRSUZ_I00188                   83.2    9e-16   
ref|XP_009799275.1|  PREDICTED: probable LRR receptor-like serine...  83.2    1e-15   
ref|XP_009395674.1|  PREDICTED: putative receptor-like protein ki...  83.2    1e-15   
ref|XP_010030328.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    1e-15   
ref|XP_009780871.1|  PREDICTED: receptor-like protein kinase          82.4    1e-15   
emb|CAN72496.1|  hypothetical protein VITISV_010511                   83.2    1e-15   
ref|XP_010039999.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    1e-15   
ref|XP_006489781.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    1e-15   
ref|XP_006484871.1|  PREDICTED: probable LRR receptor-like serine...  83.2    1e-15   
ref|XP_011005716.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    1e-15   
ref|XP_004233903.2|  PREDICTED: LRR receptor-like serine/threonin...  83.2    1e-15   
ref|XP_009379722.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  83.2    1e-15   
ref|XP_003622584.1|  Receptor protein kinase-like protein             83.2    1e-15   
gb|AAX19022.1|  Hcr2-p1.2                                             83.2    1e-15   
ref|XP_010933230.1|  PREDICTED: probable LRR receptor-like serine...  83.2    1e-15   
ref|XP_009799274.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    1e-15   
ref|XP_006450707.1|  hypothetical protein CICLE_v10007358mg           83.2    1e-15   
emb|CBI15574.3|  unnamed protein product                              82.4    1e-15   
ref|XP_009799273.1|  PREDICTED: probable LRR receptor-like serine...  83.2    1e-15   
gb|AAX19023.1|  Hcr2-p1.1                                             83.2    1e-15   
emb|CDY03225.1|  BnaC09g19310D                                        83.2    1e-15   
ref|XP_004301907.1|  PREDICTED: leucine-rich repeat receptor-like...  83.2    1e-15   
dbj|BAP57509.1|  hypothetical protein THII_3212                       82.0    1e-15   
ref|XP_010064612.1|  PREDICTED: probable LRR receptor-like serine...  82.8    1e-15   
ref|XP_006644658.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    1e-15   
ref|XP_009409684.1|  PREDICTED: putative receptor-like protein ki...  83.2    1e-15   
gb|KDP38862.1|  hypothetical protein JCGZ_05019                       82.8    1e-15   
ref|XP_006410453.1|  hypothetical protein EUTSA_v10016163mg           83.2    1e-15   
ref|XP_010050768.1|  PREDICTED: putative receptor-like protein ki...  82.8    1e-15   
emb|CBI35485.3|  unnamed protein product                              82.4    1e-15   
ref|XP_008648423.1|  PREDICTED: putative receptor-like protein ki...  82.4    1e-15   
ref|XP_007214168.1|  hypothetical protein PRUPE_ppa018998mg           82.8    1e-15   
ref|XP_008809657.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    1e-15   
ref|XP_010030336.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    1e-15   
ref|XP_008809658.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    1e-15   
ref|XP_006494784.1|  PREDICTED: probable LRR receptor-like serine...  82.8    1e-15   
ref|XP_009589465.1|  PREDICTED: probable LRR receptor-like serine...  82.8    1e-15   
ref|XP_010102181.1|  putative leucine-rich repeat receptor-like p...  82.8    1e-15   
ref|XP_010038996.1|  PREDICTED: probable LRR receptor-like serine...  82.8    1e-15   
emb|CDP21284.1|  unnamed protein product                              82.8    1e-15   
ref|XP_010668014.1|  PREDICTED: receptor-like protein kinase 2        81.3    1e-15   
ref|XP_009589466.1|  PREDICTED: probable LRR receptor-like serine...  82.8    1e-15   
gb|KCW80486.1|  hypothetical protein EUGRSUZ_C01828                   82.8    1e-15   
ref|XP_009372221.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    1e-15   
ref|XP_010040522.1|  PREDICTED: probable LRR receptor-like serine...  82.8    1e-15   
gb|KCW45146.1|  hypothetical protein EUGRSUZ_L01243                   82.8    1e-15   
emb|CDO96830.1|  unnamed protein product                              82.0    1e-15   
gb|KCW48456.1|  hypothetical protein EUGRSUZ_K021552                  82.4    1e-15   
ref|XP_006442047.1|  hypothetical protein CICLE_v10023511mg           82.8    1e-15   
ref|XP_011039410.1|  PREDICTED: putative receptor-like protein ki...  82.8    1e-15   
emb|CDP19285.1|  unnamed protein product                              82.8    1e-15   
ref|XP_010030775.1|  PREDICTED: probable LRR receptor-like serine...  82.0    1e-15   
ref|XP_007021885.1|  Leucine-rich repeat protein kinase family pr...  82.8    1e-15   
ref|XP_010256368.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    1e-15   
ref|XP_010316829.1|  PREDICTED: probable LRR receptor-like serine...  82.8    1e-15   
gb|EMT09183.1|  Putative LRR receptor-like serine/threonine-prote...  82.8    1e-15   
ref|XP_008805241.1|  PREDICTED: probable LRR receptor-like serine...  82.4    1e-15   
emb|CBI36563.3|  unnamed protein product                              82.4    1e-15   
ref|XP_007133482.1|  hypothetical protein PHAVU_011G182300g           82.8    1e-15   
ref|XP_002319536.2|  resistance family protein                        82.4    1e-15   
ref|XP_002978200.1|  hypothetical protein SELMODRAFT_50240            82.8    2e-15   
gb|EEE57058.1|  hypothetical protein OsJ_06864                        82.8    2e-15   
gb|AES60034.2|  LRR receptor-like kinase family protein               82.8    2e-15   
ref|XP_006489958.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    2e-15   
gb|KDO69025.1|  hypothetical protein CISIN_1g001974mg                 82.4    2e-15   
emb|CDP08227.1|  unnamed protein product                              82.8    2e-15   
ref|XP_004247815.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    2e-15   
dbj|BAD23652.1|  putative leucine rich repeat containing protein ...  82.4    2e-15   
gb|AAC49559.1|  leucine-rich repeat-containing extracellular glyc...  79.3    2e-15   
ref|XP_002521135.1|  Receptor protein kinase CLAVATA1 precursor, ...  82.4    2e-15   
ref|XP_003589783.1|  Receptor protein kinase-like protein             82.4    2e-15   
gb|KCW54192.1|  hypothetical protein EUGRSUZ_I00181                   82.4    2e-15   
ref|XP_006365821.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    2e-15   
gb|ABW72746.1|  flagellin-sensing 2-like protein                      82.0    2e-15   
gb|ABW72744.1|  flagellin-sensing 2-like protein                      82.0    2e-15   
ref|XP_011101453.1|  PREDICTED: probable LRR receptor-like serine...  82.4    2e-15   
gb|AFW74406.1|  putative leucine-rich repeat receptor-like protei...  82.4    2e-15   
ref|XP_004301322.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    2e-15   
ref|XP_010275839.1|  PREDICTED: putative leucine-rich repeat rece...  82.4    2e-15   
ref|XP_009398051.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    2e-15   
ref|WP_030001612.1|  hypothetical protein                             81.3    2e-15   
ref|XP_010690721.1|  PREDICTED: probable LRR receptor-like serine...  82.4    2e-15   
ref|XP_010922023.1|  PREDICTED: probable LRR receptor-like serine...  82.4    2e-15   
ref|XP_006605735.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    2e-15   
ref|XP_010559254.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    2e-15   
ref|XP_010925659.1|  PREDICTED: probably inactive leucine-rich re...  82.4    2e-15   
gb|EPS61003.1|  hypothetical protein M569_13794                       82.4    2e-15   
gb|KCW68129.1|  hypothetical protein EUGRSUZ_F01801                   82.4    2e-15   
ref|XP_010050145.1|  PREDICTED: putative receptor-like protein ki...  82.4    2e-15   



>ref|XP_006358149.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=1155

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SI   SSL+ L MWDN+L G LPRE+GNLTM+N L L  NSL+G +P EIGNL  
Sbjct  328  GSIPLSIFNISSLQVLSMWDNKLEGPLPREVGNLTMVNVLDLGMNSLTGVLPDEIGNLQE  387

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L+LD NN  G+IP  IFNISTL  I +  N
Sbjct  388  LLMLKLDFNNFSGSIPIGIFNISTLVSITLTQN  420


 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL +L++L L  N L G IPR I ECS L+ L + +N L G++P E+G L +L  L
Sbjct  236  DLCGRLPRLQKLGLNFNMLSGEIPRRISECSQLQVLLLMENNLIGTIPGELGKLQLLQQL  295

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L G IP EIG+L+ L+ L L+ N L G+IP +IFNIS+L  ++M +N
Sbjct  296  ALGNNKLEGTIPNEIGHLHNLKQLGLEQNALTGSIPLSIFNISSLQVLSMWDN  348


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N  +G LP E   L  L  + L+ N+ +GEIP+ +G+   
Sbjct  87   GTIPSQLGNLSFLVSLDLSYNYFHGELPLEFSRLRKLRAINLSFNNFTGEIPKFLGDFQD  146

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQIL L+NN+  G IP +I N+  L ++N+  N
Sbjct  147  LQILSLENNSFSGFIPSSISNMKNLGFLNLRYN  179


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYM-------------WD-----------NQLNGSLPREIGNLTM  174
            G+IP  +G+ +SL  +Y+             W+           N  NGSLP E+GNL  
Sbjct  622  GSIPSCLGDVTSLREIYLDSNNFTASIPSSLWNLKDILKLNLSSNFFNGSLPLEVGNLKA  681

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               L L+ N +SG IP  +G L  L  L L +N +EG+IPET   + +L  ++++NN
Sbjct  682  TILLDLSRNQISGNIPGTLGGLQKLIQLSLAHNRIEGSIPETFGELISLEALDLSNN  738


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = -1

Query  263  IGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRL  84
            +  C  L  L +  N LN  LP+ IGNL+ L   +    +L G IP EIGNL  L  L+L
Sbjct  508  LANCKYLRELILSINPLNAILPKSIGNLSSLQTFEAIGCNLKGHIPNEIGNLRNLSYLKL  567

Query  83   DNNNLEGTIPETIFNISTLTYINMANN  3
            D N+  G +P TI ++  L   +++ N
Sbjct  568  DENDFTGIVPSTISSLEKLQQFSLSAN  594


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  SSL+        L G +P EIGNL  L+ L+L EN  +G +P  I +L  LQ
Sbjct  528  LPKSIGNLSSLQTFEAIGCNLKGHIPNEIGNLRNLSYLKLDENDFTGIVPSTISSLEKLQ  587

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               L  N + G  P  +  +  L  +N++ N
Sbjct  588  QFSLSANRISGPFPIVLCELPNLGMLNLSQN  618


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G+   L+ L + +N  +G +P  I N+  L  L L  N+L G IP  I  L  
Sbjct  135  GEIPKFLGDFQDLQILSLENNSFSGFIPSSISNMKNLGFLNLRYNNLEGNIPAGIAALRS  194

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            L+ L    N L G+   ++FNISTL Y+++ N
Sbjct  195  LKWLSFGFNKLNGSNVLSMFNISTLEYLDLRN  226


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G   +   L +  NQ++G++P  +G L  L  L L  N + G IP   G L  
Sbjct  670  GSLPLEVGNLKATILLDLSRNQISGNIPGTLGGLQKLIQLSLAHNRIEGSIPETFGELIS  729

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NNN+ G IP+++  +  L   N++ N
Sbjct  730  LEALDLSNNNISGVIPKSLEALKQLQSFNVSFN  762


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    L  L +  N++ GS+P   G L  L  L L+ N++SG IP+ +  L  
Sbjct  694  GNIPGTLGGLQKLIQLSLAHNRIEGSIPETFGELISLEALDLSNNNISGVIPKSLEALKQ  753

Query  101  LQILRLDNNNLEGTIP  54
            LQ   +  N L G IP
Sbjct  754  LQSFNVSFNRLHGEIP  769


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   +L YL + +N   G +P  I +L  L    L+ N +SG  P  +  L  
Sbjct  550  GHIPNEIGNLRNLSYLKLDENDFTGIVPSTISSLEKLQQFSLSANRISGPFPIVLCELPN  609

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N + G+IP  + ++++L  I + +N
Sbjct  610  LGMLNLSQNQMWGSIPSCLGDVTSLREIYLDSN  642


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P +I     L+   +  N+++G  P  +  L  L  L L++N + G IP  +G++  
Sbjct  574  GIVPSTISSLEKLQQFSLSANRISGPFPIVLCELPNLGMLNLSQNQMWGSIPSCLGDVTS  633

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + LD+NN   +IP +++N+  +  +N+++N
Sbjct  634  LREIYLDSNNFTASIPSSLWNLKDILKLNLSSN  666


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 46/101 (46%), Gaps = 25/101 (25%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGS------------------------LPREI-GNLT  177
            GNIP  I    SL++L    N+LNGS                         P ++ G L 
Sbjct  183  GNIPAGIAALRSLKWLSFGFNKLNGSNVLSMFNISTLEYLDLRNAGLTGDFPSDLCGRLP  242

Query  176  MLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIP  54
             L  L L  N LSGEIPR I   + LQ+L L  NNL GTIP
Sbjct  243  RLQKLGLNFNMLSGEIPRRISECSQLQVLLLMENNLIGTIP  283


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 53/122 (43%), Gaps = 29/122 (24%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE----------  132
            G +P SI   S L  L +  N+L GS+P  +GNL ++  L L  NS + +          
Sbjct  449  GLLPSSISNLSKLTVLELSANELTGSIPDFLGNLRLIEILNLQGNSFTSDSSMLSFITPL  508

Query  131  -------------------IPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMA  9
                               +P+ IGNL+ LQ       NL+G IP  I N+  L+Y+ + 
Sbjct  509  ANCKYLRELILSINPLNAILPKSIGNLSSLQTFEAIGCNLKGHIPNEIGNLRNLSYLKLD  568

Query  8    NN  3
             N
Sbjct  569  EN  570



>ref|XP_006428343.1| hypothetical protein CICLE_v100136772mg, partial [Citrus clementina]
 gb|ESR41583.1| hypothetical protein CICLE_v100136772mg, partial [Citrus clementina]
Length=148

 Score = 94.7 bits (234),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+ IG  S L++LY+  N+  G++P+EIGNLT L  L L +N   GEIP E+GNL  L+
Sbjct  2    VPKEIGNVSHLKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDNKFQGEIPHELGNLAELE  61

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L NN+L GTIP +IF +S+L Y++ +NN
Sbjct  62   TLSLQNNSLTGTIPSSIFKLSSLLYLDFSNN  92


 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + LE L + +N L G++P  I  L+ L  L  + N+L GEIP E+GNL  
Sbjct  48   GEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAE  107

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN L GTIP +IF +S+L Y++ +NN
Sbjct  108  LETLSLQNNFLTGTIPSSIFKLSSLLYLDFSNN  140


 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI + SSL YL   +N L G +P E+GNL  L  L L  N L+G IP  I  L+ 
Sbjct  72   GTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAELETLSLQNNFLTGTIPSSIFKLSS  131

Query  101  LQILRLDNNNLEGTIPE  51
            L  L   NNNL G +P+
Sbjct  132  LLYLDFSNNNLRGMLPK  148



>ref|XP_010316836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=1160

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SI   SSL+ L MWDN+L G LPRE+GNLTM+N L L  NSL G +P EIGNL  
Sbjct  333  GSIPVSIFSISSLQVLSMWDNKLEGPLPREVGNLTMVNVLDLGMNSLMGVLPDEIGNLQE  392

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L+LD N+  G+IP  IFN STL  I +  N
Sbjct  393  LLMLKLDFNDFSGSIPVGIFNGSTLVSITLTQN  425


 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR I ECS L+ L + +N L G++P E+GNL +L  L L  N L G IP EIG+L  
Sbjct  261  GEIPRRISECSQLQVLLLMENNLIGTIPGELGNLQLLQQLALGNNKLEGTIPNEIGHLYN  320

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L+ N L G+IP +IF+IS+L  ++M +N
Sbjct  321  LKQLGLEQNALTGSIPVSIFSISSLQVLSMWDN  353


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +GE S L  L +  N  +G LP E   L  L  + L+ N+ +G IPR +G+   
Sbjct  92   GTIPSQLGELSFLVSLDLSYNSFHGELPPEFSRLRKLRAINLSFNNFTGNIPRFLGDFQD  151

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQI  ++NN+  G IP +I N++ L ++N+  N
Sbjct  152  LQIFNIENNSFSGFIPSSISNMTNLGFLNLRYN  184


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP  +G  +SL  +Y+  N+   S+P  + NL  +  L L+ N  +G +P E+GNL  
Sbjct  627  GNIPSCLGNVTSLREIYLDSNKFTASIPSSLWNLKDILKLNLSSNFFNGSLPLEVGNLKA  686

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              IL L  N + G IP T+  +  L  +++A N
Sbjct  687  AIILDLSRNQISGNIPSTLGGLQKLIQLSLAQN  719


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = -1

Query  263  IGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRL  84
            +  C  L  L +  N LN  LP+ IGNL+ L   +    +L G IP EIGNL  L  L+L
Sbjct  513  LANCKHLRELILSINPLNAILPKSIGNLSSLQTFEAIGCNLKGHIPNEIGNLRNLSYLKL  572

Query  83   DNNNLEGTIPETIFNISTLTYINMANN  3
            D N+  G +P TI ++  L   ++  N
Sbjct  573  DKNDFTGIVPTTISSLEKLQQFSLGTN  599


 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIPR +G+   L+   + +N  +G +P  I N+T L  L L  N+L G IP  I  L  
Sbjct  140  GNIPRFLGDFQDLQIFNIENNSFSGFIPSSISNMTNLGFLNLRYNNLEGNIPAGIAVLRS  199

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            L+ L    + L G+   T+FNIS L Y+++ N
Sbjct  200  LKWLSFGFSKLNGSNVLTMFNISILEYLDLRN  231


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 48/91 (53%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  SSL+        L G +P EIGNL  L+ L+L +N  +G +P  I +L  LQ
Sbjct  533  LPKSIGNLSSLQTFEAIGCNLKGHIPNEIGNLRNLSYLKLDKNDFTGIVPTTISSLEKLQ  592

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               L  N + G  P  +  +  L  +N++ N
Sbjct  593  QFSLGTNRISGPFPIVVCELPNLGLLNLSQN  623


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G   +   L +  NQ++G++P  +G L  L  L L +N + G IP   G L  
Sbjct  675  GSLPLEVGNLKAAIILDLSRNQISGNIPSTLGGLQKLIQLSLAQNRIEGFIPETFGELIS  734

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NNN+ G IP+++  +  L   N++ N
Sbjct  735  LEALDLSNNNISGVIPKSLEALKQLHSFNVSFN  767


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P +I     L+   +  N+++G  P  +  L  L  L L++N + G IP  +GN+  
Sbjct  579  GIVPTTISSLEKLQQFSLGTNRISGPFPIVVCELPNLGLLNLSQNQMWGNIPSCLGNVTS  638

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + LD+N    +IP +++N+  +  +N+++N
Sbjct  639  LREIYLDSNKFTASIPSSLWNLKDILKLNLSSN  671


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  DNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
            D   +G++P ++G L+ L +L L+ NS  GE+P E   L  L+ + L  NN  G IP  +
Sbjct  87   DMGFSGTIPSQLGELSFLVSLDLSYNSFHGELPPEFSRLRKLRAINLSFNNFTGNIPRFL  146

Query  44   FNISTLTYINMANN  3
             +   L   N+ NN
Sbjct  147  GDFQDLQIFNIENN  160


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 39/76 (51%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    L  L +  N++ G +P   G L  L  L L+ N++SG IP+ +  L  
Sbjct  699  GNIPSTLGGLQKLIQLSLAQNRIEGFIPETFGELISLEALDLSNNNISGVIPKSLEALKQ  758

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N L G IP
Sbjct  759  LHSFNVSFNRLHGEIP  774



>ref|XP_006493622.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like isoform X1 [Citrus sinensis]
 ref|XP_006493623.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like isoform X2 [Citrus sinensis]
Length=1144

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            +MCSRL KLE+LYL  N  +G IP S+ EC+ L+ L++ DN+ +G LP  IGNL+ L +L
Sbjct  287  DMCSRLPKLEKLYLGSNDFFGQIPSSLSECTHLQTLWLADNKFSGRLPENIGNLSQLTDL  346

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +N+L G++P  IGNL ML+ L L  NNL G +P TIFNIST+  IN+  N
Sbjct  347  NLAQNNLQGDMPTAIGNLQMLEHLNLGMNNLSGPVPPTIFNISTIRLINLIEN  399


 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            +MCSRL KLE+LYL  N  +G IP S+ EC+ L+ L++ DN+L G LP  IGNL+ L  L
Sbjct  190  DMCSRLPKLEKLYLGSNDFFGQIPSSLSECTHLQTLWLADNKLIGRLPESIGNLSKLTLL  249

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIP  54
             L  N+L G IPR   +++ L  + L  N+L G++P
Sbjct  250  NLAHNNLQGPIPRSFYDISSLTKIDLGFNSLSGSLP  285


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 5/96 (5%)
 Frame = -1

Query  281  GNIPRSIGECS---SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN  111
            G++P  +  CS    LE LY+  N   G +P  +   T L  L L +N L G +P  IGN
Sbjct  185  GSLPNDM--CSRLPKLEKLYLGSNDFFGQIPSSLSECTHLQTLWLADNKLIGRLPESIGN  242

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L +L L +NNL+G IP + ++IS+LT I++  N
Sbjct  243  LSKLTLLNLAHNNLQGPIPRSFYDISSLTKIDLGFN  278


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG  S L +L + DN+LNG++P  +G    L  L L +N L G IP  + +L  
Sbjct  533  GSIPQEIGNLSGLMFLKLDDNELNGTIPTTVGRFQQLQGLSLYDNDLQGSIPYYLCHLER  592

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ NNL G IP  + ++++L  +++ +N
Sbjct  593  LSQLLLNGNNLSGAIPACLGSLTSLRELHLGSN  625


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++G    L+ L ++DN L GS+P  + +L  L+ L L  N+LSG IP  +G+L  
Sbjct  557  GTIPTTVGRFQQLQGLSLYDNDLQGSIPYYLCHLERLSQLLLNGNNLSGAIPACLGSLTS  616

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L  +IP +++++  + Y+N+++N
Sbjct  617  LRELHLGSNTLTYSIPSSLWSLEYILYVNLSSN  649


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L + +N   G LP E+G L  L  +    N LSG  P  IG L+ 
Sbjct  89   GIIPPHLGNLSFLVSLDISENNFYGHLPNELGKLRRLRLINFAYNELSGIFPSWIGILSR  148

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQIL   NN+    IP+ + N+S L ++N+  N
Sbjct  149  LQILSFHNNSFTDRIPDFLLNLSKLEFLNLMEN  181


 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P  IG  S SL        +L GS+P+EIGNL+ L  L+L +N L+G IP  +G   
Sbjct  508  GILPPFIGNFSASLRKFEAIKCELKGSIPQEIGNLSGLMFLKLDDNELNGTIPTTVGRFQ  567

Query  104  MLQILRLDNNNLEGTIPETIFNISTLT  24
             LQ L L +N+L+G+IP  + ++  L+
Sbjct  568  QLQGLSLYDNDLQGSIPYYLCHLERLS  594


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP S+     + Y+ +  N L+G LP  I +L +L NL L+ N LSG+IP  I  L  L
Sbjct  630  SIPSSLWSLEYILYVNLSSNSLSGPLPSSIQHLKVLINLDLSRNQLSGDIPITISGLKDL  689

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L  N   G IPE+  ++ +L  +++++N
Sbjct  690  ATLSLAGNQFNGPIPESFGSLISLESLDVSSN  721


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  +SL  L++  N L  S+P  + +L  +  + L+ NSLSG +P  I +L +
Sbjct  605  GAIPACLGSLTSLRELHLGSNTLTYSIPSSLWSLEYILYVNLSSNSLSGPLPSSIQHLKV  664

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP TI  +  L  +++A N
Sbjct  665  LINLDLSRNQLSGDIPITISGLKDLATLSLAGN  697


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +I     L  L +  NQ NG +P   G+L  L +L ++ N++SG+IP+ +  L  
Sbjct  677  GDIPITISGLKDLATLSLAGNQFNGPIPESFGSLISLESLDVSSNNISGKIPKSLEALLY  736

Query  101  LQILRLDNNNLEGTIP  54
            L+ L +  N LEG IP
Sbjct  737  LKKLNVSYNRLEGEIP  752


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P SI     L  L +  NQL+G +P  I  L  L  L L  N  +G IP   G+L  
Sbjct  653  GPLPSSIQHLKVLINLDLSRNQLSGDIPITISGLKDLATLSLAGNQFNGPIPESFGSLIS  712

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +NN+ G IP+++  +  L  +N++ N
Sbjct  713  LESLDVSSNNISGKIPKSLEALLYLKKLNVSYN  745


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 53/118 (45%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLS------------  138
            G  P  IG  S L+ L   +N     +P  + NL+ L  L L ENSLS            
Sbjct  137  GIFPSWIGILSRLQILSFHNNSFTDRIPDFLLNLSKLEFLNLMENSLSGSLPNDMCSRLP  196

Query  137  -------------GEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                         G+IP  +     LQ L L +N L G +PE+I N+S LT +N+A+N
Sbjct  197  KLEKLYLGSNDFFGQIPSSLSECTHLQTLWLADNKLIGRLPESIGNLSKLTLLNLAHN  254


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G +P  +GNL+ L +L ++EN+  G +P E+G L  L+++    N L G  P  I  +
Sbjct  87   LGGIIPPHLGNLSFLVSLDISENNFYGHLPNELGKLRRLRLINFAYNELSGIFPSWIGIL  146

Query  35   STLTYINMANN  3
            S L  ++  NN
Sbjct  147  SRLQILSFHNN  157



>ref|XP_007025320.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY27942.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=1142

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            NMC  L KLE L +  N+  G+IP SIGECS+L+ L +  N+ NG++PR  GNLT L  L
Sbjct  261  NMCHHLSKLEVLIISLNEFSGHIPSSIGECSNLQNLSLSTNRFNGTIPRSFGNLTSLKRL  320

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L EN L+GEIP EIGNL  L+IL + +  L G IP +IFNIS+L  I++ NN
Sbjct  321  SLRENDLTGEIPWEIGNLYSLEILAVQHMRLNGPIPPSIFNISSLKEISLNNN  373


 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G+C++L  L + +N+  G +PR IGNLT L  ++L+ NSL G IP EIGNL  
Sbjct  159  GSVPSRLGDCTNLRNLSLSNNRFYGFIPRSIGNLTRLKEIRLSGNSLQGAIPWEIGNLFN  218

Query  101  LQILRLDNN-NLEGTIPETIFNISTLTYINMANN  3
            L+I   ++N  L G IP +IFNIS+LT + + NN
Sbjct  219  LEIFAAESNGGLTGGIPASIFNISSLTKLVLFNN  252


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SI   S SL + Y  D ++ GS+PREIGNL+ +  L L+ N LSG IP  IG L 
Sbjct  479  GILPSSISNLSTSLHFFYASDVKITGSIPREIGNLSNITTLDLSHNELSGSIPATIGRLR  538

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +Q L L  N L+G+IP ++  +  L  +++  N
Sbjct  539  NVQGLLLHGNQLQGSIPPSVCGLERLYNLSLGGN  572


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG   +++ L +  NQL GS+P  +  L  L NL L  N L G IP  + NL  
Sbjct  528  GSIPATIGRLRNVQGLLLHGNQLQGSIPPSVCGLERLYNLSLGGNMLHGPIPTCLANLTS  587

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L LD+N L  TIP ++++++ +  +++++N
Sbjct  588  LRYLYLDSNKLNSTIPLSLWSLNDILEVDLSSN  620


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR IG  S++  L +  N+L+GS+P  IG L  +  L L  N L G IP  +  L  
Sbjct  504  GSIPREIGNLSNITTLDLSHNELSGSIPATIGRLRNVQGLLLHGNQLQGSIPPSVCGLER  563

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP  + N+++L Y+ + +N
Sbjct  564  LYNLSLGGNMLHGPIPTCLANLTSLRYLYLDSN  596


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   SLE L +   +LNG +P  I N++ L  + L  NSLSGEIP  I +++ 
Sbjct  329  GEIPWEIGNLYSLEILAVQHMRLNGPIPPSIFNISSLKEISLNNNSLSGEIPSMI-SISN  387

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ LRL  NNL G IP  I + S L  + +  N
Sbjct  388  LEELRLWGNNLSGNIPNFISSASKLRILALEEN  420


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 57/117 (49%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYM-------------WD-----------NQLNGSLPREIGNLTM  174
            G IP  +   +SL YLY+             W            N LNGSLP  I  L +
Sbjct  576  GPIPTCLANLTSLRYLYLDSNKLNSTIPLSLWSLNDILEVDLSSNYLNGSLPLGIEKLKV  635

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L+ N LSGEI   IG L  L  L L NN  +G IPE+  ++ +L  ++++NN
Sbjct  636  LTHLNLSRNLLSGEILSSIGELQDLISLDLSNNRFDGYIPESFGDLISLESLDLSNN  692


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  I +   L +L +  N L+G +   IG L  L +L L+ N   G IP   G+L  
Sbjct  624  GSLPLGIEKLKVLTHLNLSRNLLSGEILSSIGELQDLISLDLSNNRFDGYIPESFGDLIS  683

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NNNL G IP+++  +S+L + N++ N
Sbjct  684  LESLDLSNNNLSGVIPKSLERLSSLNHFNVSFN  716


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 8/100 (8%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   S+LE L +W N L+G++P  I + + L  L L ENS  G IP  +GNL  
Sbjct  377  GEIPSMI-SISNLEELRLWGNNLSGNIPNFISSASKLRILALEENSFFGLIPNTLGNLTF  435

Query  101  LQILRLDNNNL-------EGTIPETIFNISTLTYINMANN  3
            L+ L L +NNL       E +   ++ N   L Y+N++ N
Sbjct  436  LERLSLASNNLITETSTHEWSFLSSLANCRNLRYLNLSFN  475


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I  SIGE   L  L + +N+ +G +P   G+L  L +L L+ N+LSG IP+ +  L+ 
Sbjct  648  GEILSSIGELQDLISLDLSNNRFDGYIPESFGDLISLESLDLSNNNLSGVIPKSLERLSS  707

Query  101  LQILRLDNNNLEGTIPE--TIFNISTLTYIN  15
            L    +  N LEG IP      N S  +++N
Sbjct  708  LNHFNVSFNRLEGEIPSGGPFRNFSAKSFMN  738



>ref|XP_006480345.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X3 [Citrus sinensis]
Length=1258

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ IG  S L++LY+  N+  G++P+EIGNLT L  L L +N   GEIP E+GNL  
Sbjct  281  GTVPKEIGNVSHLKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDNKFQGEIPHELGNLAE  340

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y++ +NN
Sbjct  341  LETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNN  373


 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  ++L+ L +++N+  G++P+EIGN T L  L L+ N L GEIP EIGNL  
Sbjct  425  GTIPKEIGNLTNLKELSLYNNRFKGTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRD  484

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G +P TIFN+STL    ++NN
Sbjct  485  LEWLELSDNKLVGVVPATIFNLSTLKVFAVSNN  517


 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  LY+  NQ  G++P+EIG LT L+ L L +N   GEIP+E+GNL  
Sbjct  185  GEIPSTLSNCRQLRKLYLSLNQFTGAIPKEIGKLTRLSVLSLRDNKFQGEIPQELGNLAK  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L GTIP +IF  S L Y++++NN
Sbjct  245  LEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNN  277


 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI + SSL YL   +N L G++P+EIGNLT L  L L  N   G IP+EIGN   
Sbjct  401  GTIPSSIFKLSSLLYLGFSNNSLRGTIPKEIGNLTNLKELSLYNNRFKGTIPKEIGNFTK  460

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN LEG IP  I N+  L ++ +++N
Sbjct  461  LKELILSNNRLEGEIPHEIGNLRDLEWLELSDN  493


 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + LE L + +N L G++P  I  L+ L  L  + N+L GEIP E+GNL  
Sbjct  329  GEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAE  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y+  +NN
Sbjct  389  LETLSLQNNSLTGTIPSSIFKLSSLLYLGFSNN  421


 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI + SSL YL   +N L G +P E+GNL  L  L L  NSL+G IP  I  L+ 
Sbjct  353  GTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSS  412

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L   NN+L GTIP+ I N++ L  +++ NN
Sbjct  413  LLYLGFSNNSLRGTIPKEIGNLTNLKELSLYNN  445


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + LE L + +N L G++P  I  L+ L  L  + NSL G IP+EIGNL  
Sbjct  377  GEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSSLLYLGFSNNSLRGTIPKEIGNLTN  436

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN  +GTIP+ I N + L  + ++NN
Sbjct  437  LKELSLYNNRFKGTIPKEIGNFTKLKELILSNN  469


 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L++  N LNG++P  I   + L  L L+ NSL G +P+EIGN++ 
Sbjct  233  GEIPQELGNLAKLEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNNSLRGTVPKEIGNVSH  292

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N   G IP+ I N++ L  +++ +N
Sbjct  293  LKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDN  325


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ L + +N+L G +P EIGNL  L  L+L++N L G +P  I NL+ 
Sbjct  449  GTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRDLEWLELSDNKLVGVVPATIFNLST  508

Query  101  LQILRLDN-------------------------NNLEGTIPETIFNISTLTYINMANN  3
            L++  + N                         NN  GTIP  IFN S L+ + + +N
Sbjct  509  LKVFAVSNNSLSGSLQSSADVQLPNLEGIYLWGNNFSGTIPSFIFNASKLSTLALGDN  566


 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = -1

Query  245  LEY---LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNN  75
            LEY   L    N L G LP EIGNL +L  +  + N+ SG IP  IG L  LQ L L +N
Sbjct  754  LEYIMNLNFSSNFLTGPLPLEIGNLKVLVGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  813

Query  74   NLEGTIPETIFNISTLTYINMANN  3
             LEG+IP  I ++ +L Y++++NN
Sbjct  814  KLEGSIPNPIGDLISLEYLDLSNN  837


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG  + L+YL +  N+L GS+P  IG+L  L  L L+ N+LSG IP  +  L  
Sbjct  793  GAIPTTIGGLAYLQYLLLGHNKLEGSIPNPIGDLISLEYLDLSNNNLSGPIPVSLEKLLY  852

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  NNLEG IP+
Sbjct  853  LKDLNLSFNNLEGEIPK  869


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG  +SL  L +  N+L   +P  + NL  + NL  + N L+G +P EIGNL +L
Sbjct  722  SIPTCIGNLTSLRTLSLGSNELISVIPSTLWNLEYIMNLNFSSNFLTGPLPLEIGNLKVL  781

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +    NN  G IP TI  ++ L Y+ + +N
Sbjct  782  VGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  813


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L +L L+ N LSG IP  I ++N LQIL L +N L G+ P +I N+
Sbjct  86   LTGTIPSQLGNLSSLQSLNLSHNRLSGAIPSSIFSINSLQILDLSDNQLSGSFPSSISNM  145

Query  35   STLTYINMANN  3
            S+LT+I+ ++N
Sbjct  146  SSLTFIDFSSN  156


 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L   DN+L GS+P ++ +L  L  L L  N LS  IP  IGNL  
Sbjct  673  GSIPITLGKLQKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGNKLSRSIPTCIGNLTS  732

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L   IP T++N+  +  +N ++N
Sbjct  733  LRTLSLGSNELISVIPSTLWNLEYIMNLNFSSN  765


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE +Y+W N  +G++P  I N + L+ L L +NS  G IP   GNL  L+   ++NN L 
Sbjct  534  LEGIYLWGNNFSGTIPSFIFNASKLSTLALGDNSFFGFIPNTFGNLGNLRRFNIENNYLT  593

Query  65   GTIPETIF  42
             + PE  F
Sbjct  594  SSTPELNF  601


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPR-SIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            G +PR S+G  S SLE   M +  + G++P EI NLT L  +  + N L+G IP  +G L
Sbjct  623  GILPRTSMGNLSHSLEKFVMINCNVGGAIPEEISNLTNLRMIGFSGNKLNGSIPITLGKL  682

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              LQ+L   +N LEG+IPE + +++ L  +++  N
Sbjct  683  QKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGN  717



>ref|XP_006480348.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X6 [Citrus sinensis]
Length=1186

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ IG  S L++LY+  N+  G++P+EIGNLT L  L L +N   GEIP E+GNL  
Sbjct  281  GTVPKEIGNVSHLKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDNKFQGEIPHELGNLAE  340

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y++ +NN
Sbjct  341  LETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNN  373


 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI + SSL YL   +N L G++P+EIGN T L  L L+ N L GEIP EIGNL  
Sbjct  353  GTIPSSIFKLSSLLYLDFSNNNLRGTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRD  412

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G +P TIFN+STL    ++NN
Sbjct  413  LEWLELSDNKLVGVVPATIFNLSTLKVFAVSNN  445


 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  LY+  NQ  G++P+EIG LT L+ L L +N   GEIP+E+GNL  
Sbjct  185  GEIPSTLSNCRQLRKLYLSLNQFTGAIPKEIGKLTRLSVLSLRDNKFQGEIPQELGNLAK  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L GTIP +IF  S L Y++++NN
Sbjct  245  LEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNN  277


 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L++  N LNG++P  I   + L  L L+ NSL G +P+EIGN++ 
Sbjct  233  GEIPQELGNLAKLEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNNSLRGTVPKEIGNVSH  292

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N   G IP+ I N++ L  +++ +N
Sbjct  293  LKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDN  325


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + LE L + +N L G++P  I  L+ L  L  + N+L G IP+EIGN   
Sbjct  329  GEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNNNLRGTIPKEIGNFTK  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN LEG IP  I N+  L ++ +++N
Sbjct  389  LKELILSNNRLEGEIPHEIGNLRDLEWLELSDN  421


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ L + +N+L G +P EIGNL  L  L+L++N L G +P  I NL+ 
Sbjct  377  GTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRDLEWLELSDNKLVGVVPATIFNLST  436

Query  101  LQILRLDN-------------------------NNLEGTIPETIFNISTLTYINMANN  3
            L++  + N                         NN  GTIP  IFN S L+ + + +N
Sbjct  437  LKVFAVSNNSLSGSLQSSADVQLPNLEGIYLWGNNFSGTIPSFIFNASKLSTLALGDN  494


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = -1

Query  245  LEYLY---MWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNN  75
            LEY+       N L G LP EIGNL +L  +  + N+ SG IP  IG L  LQ L L +N
Sbjct  682  LEYIMNLNFSSNFLTGPLPLEIGNLKVLVGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  741

Query  74   NLEGTIPETIFNISTLTYINMANN  3
             LEG+IP  I ++ +L Y++++NN
Sbjct  742  KLEGSIPNPIGDLISLEYLDLSNN  765


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG  + L+YL +  N+L GS+P  IG+L  L  L L+ N+LSG IP  +  L  
Sbjct  721  GAIPTTIGGLAYLQYLLLGHNKLEGSIPNPIGDLISLEYLDLSNNNLSGPIPVSLEKLLY  780

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  NNLEG IP+
Sbjct  781  LKDLNLSFNNLEGEIPK  797


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG  +SL  L +  N+L   +P  + NL  + NL  + N L+G +P EIGNL +L
Sbjct  650  SIPTCIGNLTSLRTLSLGSNELISVIPSTLWNLEYIMNLNFSSNFLTGPLPLEIGNLKVL  709

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +    NN  G IP TI  ++ L Y+ + +N
Sbjct  710  VGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  741


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L +L L+ N LSG IP  I ++N LQIL L +N L G+ P +I N+
Sbjct  86   LTGTIPSQLGNLSSLQSLNLSHNRLSGAIPSSIFSINSLQILDLSDNQLSGSFPSSISNM  145

Query  35   STLTYINMANN  3
            S+LT+I+ ++N
Sbjct  146  SSLTFIDFSSN  156


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L   DN+L GS+P ++ +L  L  L L  N LS  IP  IGNL  
Sbjct  601  GSIPITLGKLQKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGNKLSRSIPTCIGNLTS  660

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L   IP T++N+  +  +N ++N
Sbjct  661  LRTLSLGSNELISVIPSTLWNLEYIMNLNFSSN  693


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE +Y+W N  +G++P  I N + L+ L L +NS  G IP   GNL  L+   ++NN L 
Sbjct  462  LEGIYLWGNNFSGTIPSFIFNASKLSTLALGDNSFFGFIPNTFGNLGNLRRFNIENNYLT  521

Query  65   GTIPETIF  42
             + PE  F
Sbjct  522  SSTPELNF  529


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPR-SIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            G +PR S+G  S SLE   M +  + G++P EI NLT L  +  + N L+G IP  +G L
Sbjct  551  GILPRTSMGNLSHSLEKFVMINCNVGGAIPEEISNLTNLRMIGFSGNKLNGSIPITLGKL  610

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              LQ+L   +N LEG+IPE + +++ L  +++  N
Sbjct  611  QKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGN  645



>ref|XP_006480347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X5 [Citrus sinensis]
Length=1210

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ IG  S L++LY+  N+  G++P+EIGNLT L  L L +N   GEIP E+GNL  
Sbjct  281  GTVPKEIGNVSHLKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDNKFQGEIPHELGNLAE  340

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y++ +NN
Sbjct  341  LETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNN  373


 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  ++L+ L +++N+  G++P+EIGN T L  L L+ N L GEIP EIGNL  
Sbjct  377  GTIPKEIGNLTNLKELSLYNNRFKGTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRD  436

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G +P TIFN+STL    ++NN
Sbjct  437  LEWLELSDNKLVGVVPATIFNLSTLKVFAVSNN  469


 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  LY+  NQ  G++P+EIG LT L+ L L +N   GEIP+E+GNL  
Sbjct  185  GEIPSTLSNCRQLRKLYLSLNQFTGAIPKEIGKLTRLSVLSLRDNKFQGEIPQELGNLAK  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L GTIP +IF  S L Y++++NN
Sbjct  245  LEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNN  277


 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI + SSL YL   +N L G++P+EIGNLT L  L L  N   G IP+EIGN   
Sbjct  353  GTIPSSIFKLSSLLYLDFSNNNLRGTIPKEIGNLTNLKELSLYNNRFKGTIPKEIGNFTK  412

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN LEG IP  I N+  L ++ +++N
Sbjct  413  LKELILSNNRLEGEIPHEIGNLRDLEWLELSDN  445


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L++  N LNG++P  I   + L  L L+ NSL G +P+EIGN++ 
Sbjct  233  GEIPQELGNLAKLEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNNSLRGTVPKEIGNVSH  292

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N   G IP+ I N++ L  +++ +N
Sbjct  293  LKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDN  325


 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + LE L + +N L G++P  I  L+ L  L  + N+L G IP+EIGNL  
Sbjct  329  GEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNNNLRGTIPKEIGNLTN  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN  +GTIP+ I N + L  + ++NN
Sbjct  389  LKELSLYNNRFKGTIPKEIGNFTKLKELILSNN  421


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ L + +N+L G +P EIGNL  L  L+L++N L G +P  I NL+ 
Sbjct  401  GTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRDLEWLELSDNKLVGVVPATIFNLST  460

Query  101  LQILRLDN-------------------------NNLEGTIPETIFNISTLTYINMANN  3
            L++  + N                         NN  GTIP  IFN S L+ + + +N
Sbjct  461  LKVFAVSNNSLSGSLQSSADVQLPNLEGIYLWGNNFSGTIPSFIFNASKLSTLALGDN  518


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = -1

Query  245  LEYLY---MWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNN  75
            LEY+       N L G LP EIGNL +L  +  + N+ SG IP  IG L  LQ L L +N
Sbjct  706  LEYIMNLNFSSNFLTGPLPLEIGNLKVLVGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  765

Query  74   NLEGTIPETIFNISTLTYINMANN  3
             LEG+IP  I ++ +L Y++++NN
Sbjct  766  KLEGSIPNPIGDLISLEYLDLSNN  789


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG  + L+YL +  N+L GS+P  IG+L  L  L L+ N+LSG IP  +  L  
Sbjct  745  GAIPTTIGGLAYLQYLLLGHNKLEGSIPNPIGDLISLEYLDLSNNNLSGPIPVSLEKLLY  804

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  NNLEG IP+
Sbjct  805  LKDLNLSFNNLEGEIPK  821


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG  +SL  L +  N+L   +P  + NL  + NL  + N L+G +P EIGNL +L
Sbjct  674  SIPTCIGNLTSLRTLSLGSNELISVIPSTLWNLEYIMNLNFSSNFLTGPLPLEIGNLKVL  733

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +    NN  G IP TI  ++ L Y+ + +N
Sbjct  734  VGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  765


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L +L L+ N LSG IP  I ++N LQIL L +N L G+ P +I N+
Sbjct  86   LTGTIPSQLGNLSSLQSLNLSHNRLSGAIPSSIFSINSLQILDLSDNQLSGSFPSSISNM  145

Query  35   STLTYINMANN  3
            S+LT+I+ ++N
Sbjct  146  SSLTFIDFSSN  156


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L   DN+L GS+P ++ +L  L  L L  N LS  IP  IGNL  
Sbjct  625  GSIPITLGKLQKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGNKLSRSIPTCIGNLTS  684

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L   IP T++N+  +  +N ++N
Sbjct  685  LRTLSLGSNELISVIPSTLWNLEYIMNLNFSSN  717


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE +Y+W N  +G++P  I N + L+ L L +NS  G IP   GNL  L+   ++NN L 
Sbjct  486  LEGIYLWGNNFSGTIPSFIFNASKLSTLALGDNSFFGFIPNTFGNLGNLRRFNIENNYLT  545

Query  65   GTIPETIF  42
             + PE  F
Sbjct  546  SSTPELNF  553


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPR-SIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            G +PR S+G  S SLE   M +  + G++P EI NLT L  +  + N L+G IP  +G L
Sbjct  575  GILPRTSMGNLSHSLEKFVMINCNVGGAIPEEISNLTNLRMIGFSGNKLNGSIPITLGKL  634

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              LQ+L   +N LEG+IPE + +++ L  +++  N
Sbjct  635  QKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGN  669



>ref|XP_006480349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X7 [Citrus sinensis]
Length=1186

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ IG  S L++LY+  N+  G++P+EIGNLT L  L L +N   GEIP E+GNL  
Sbjct  281  GTVPKEIGNVSHLKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDNKFQGEIPHELGNLAE  340

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y++ +NN
Sbjct  341  LETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNN  373


 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI + SSL YL   +N L G++P+EIGNLT L  L L  N   GEIP EIGNL  
Sbjct  353  GTIPSSIFKLSSLLYLDFSNNNLRGTIPKEIGNLTNLKELSLYNNRFKGEIPHEIGNLRD  412

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G +P TIFN+STL    ++NN
Sbjct  413  LEWLELSDNKLVGVVPATIFNLSTLKVFAVSNN  445


 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  LY+  NQ  G++P+EIG LT L+ L L +N   GEIP+E+GNL  
Sbjct  185  GEIPSTLSNCRQLRKLYLSLNQFTGAIPKEIGKLTRLSVLSLRDNKFQGEIPQELGNLAK  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L GTIP +IF  S L Y++++NN
Sbjct  245  LEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNN  277


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L++  N LNG++P  I   + L  L L+ NSL G +P+EIGN++ 
Sbjct  233  GEIPQELGNLAKLEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNNSLRGTVPKEIGNVSH  292

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N   G IP+ I N++ L  +++ +N
Sbjct  293  LKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDN  325


 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + LE L + +N L G++P  I  L+ L  L  + N+L G IP+EIGNL  
Sbjct  329  GEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNNNLRGTIPKEIGNLTN  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN  +G IP  I N+  L ++ +++N
Sbjct  389  LKELSLYNNRFKGEIPHEIGNLRDLEWLELSDN  421


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 60/118 (51%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  ++L+ L +++N+  G +P EIGNL  L  L+L++N L G +P  I NL+ 
Sbjct  377  GTIPKEIGNLTNLKELSLYNNRFKGEIPHEIGNLRDLEWLELSDNKLVGVVPATIFNLST  436

Query  101  LQILRLDN-------------------------NNLEGTIPETIFNISTLTYINMANN  3
            L++  + N                         NN  GTIP  IFN S L+ + + +N
Sbjct  437  LKVFAVSNNSLSGSLQSSADVQLPNLEGIYLWGNNFSGTIPSFIFNASKLSTLALGDN  494


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = -1

Query  245  LEYLY---MWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNN  75
            LEY+       N L G LP EIGNL +L  +  + N+ SG IP  IG L  LQ L L +N
Sbjct  682  LEYIMNLNFSSNFLTGPLPLEIGNLKVLVGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  741

Query  74   NLEGTIPETIFNISTLTYINMANN  3
             LEG+IP  I ++ +L Y++++NN
Sbjct  742  KLEGSIPNPIGDLISLEYLDLSNN  765


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG  + L+YL +  N+L GS+P  IG+L  L  L L+ N+LSG IP  +  L  
Sbjct  721  GAIPTTIGGLAYLQYLLLGHNKLEGSIPNPIGDLISLEYLDLSNNNLSGPIPVSLEKLLY  780

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  NNLEG IP+
Sbjct  781  LKDLNLSFNNLEGEIPK  797


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG  +SL  L +  N+L   +P  + NL  + NL  + N L+G +P EIGNL +L
Sbjct  650  SIPTCIGNLTSLRTLSLGSNELISVIPSTLWNLEYIMNLNFSSNFLTGPLPLEIGNLKVL  709

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +    NN  G IP TI  ++ L Y+ + +N
Sbjct  710  VGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  741


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L +L L+ N LSG IP  I ++N LQIL L +N L G+ P +I N+
Sbjct  86   LTGTIPSQLGNLSSLQSLNLSHNRLSGAIPSSIFSINSLQILDLSDNQLSGSFPSSISNM  145

Query  35   STLTYINMANN  3
            S+LT+I+ ++N
Sbjct  146  SSLTFIDFSSN  156


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L   DN+L GS+P ++ +L  L  L L  N LS  IP  IGNL  
Sbjct  601  GSIPITLGKLQKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGNKLSRSIPTCIGNLTS  660

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L   IP T++N+  +  +N ++N
Sbjct  661  LRTLSLGSNELISVIPSTLWNLEYIMNLNFSSN  693


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE +Y+W N  +G++P  I N + L+ L L +NS  G IP   GNL  L+   ++NN L 
Sbjct  462  LEGIYLWGNNFSGTIPSFIFNASKLSTLALGDNSFFGFIPNTFGNLGNLRRFNIENNYLT  521

Query  65   GTIPETIF  42
             + PE  F
Sbjct  522  SSTPELNF  529


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPR-SIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            G +PR S+G  S SLE   M +  + G++P EI NLT L  +  + N L+G IP  +G L
Sbjct  551  GILPRTSMGNLSHSLEKFVMINCNVGGAIPEEISNLTNLRMIGFSGNKLNGSIPITLGKL  610

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              LQ+L   +N LEG+IPE + +++ L  +++  N
Sbjct  611  QKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGN  645



>ref|XP_006480343.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X1 [Citrus sinensis]
Length=1286

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ IG  S L++LY+  N+  G++P+EIGNLT L  L L +N   GEIP E+GNL  
Sbjct  281  GTVPKEIGNVSHLKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDNKFQGEIPHELGNLAE  340

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y++ +NN
Sbjct  341  LETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNN  373


 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  ++L+ L +++N+  G++P+EIGN T L  L L+ N L GEIP EIGNL  
Sbjct  453  GTIPKEIGNLTNLKELSLYNNRFKGTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRD  512

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G +P TIFN+STL    ++NN
Sbjct  513  LEWLELSDNKLVGVVPATIFNLSTLKVFAVSNN  545


 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  LY+  NQ  G++P+EIG LT L+ L L +N   GEIP+E+GNL  
Sbjct  185  GEIPSTLSNCRQLRKLYLSLNQFTGAIPKEIGKLTRLSVLSLRDNKFQGEIPQELGNLAK  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L GTIP +IF  S L Y++++NN
Sbjct  245  LEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNN  277


 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + LE L + +N L G++P  I  L+ L  L  + N+L GEIP E+GNL  
Sbjct  329  GEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAE  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y+  +NN
Sbjct  389  LETLSLQNNSLTGTIPSSIFKLSSLLYLGFSNN  421


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L++  N LNG++P  I   + L  L L+ NSL G +P+EIGN++ 
Sbjct  233  GEIPQELGNLAKLEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNNSLRGTVPKEIGNVSH  292

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N   G IP+ I N++ L  +++ +N
Sbjct  293  LKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDN  325


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 59/121 (49%), Gaps = 28/121 (23%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYL----------------------YMWDNQL------NGSLPREIG  186
            G IP SI + SSL YL                      Y W N        NG++P+EIG
Sbjct  401  GTIPSSIFKLSSLLYLGFSNNSLRGKLEGKVENLESLCYRWRNLKGNYFTGNGTIPKEIG  460

Query  185  NLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            NLT L  L L  N   G IP+EIGN   L+ L L NN LEG IP  I N+  L ++ +++
Sbjct  461  NLTNLKELSLYNNRFKGTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRDLEWLELSD  520

Query  5    N  3
            N
Sbjct  521  N  521


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ L + +N+L G +P EIGNL  L  L+L++N L G +P  I NL+ 
Sbjct  477  GTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRDLEWLELSDNKLVGVVPATIFNLST  536

Query  101  LQILRLDN-------------------------NNLEGTIPETIFNISTLTYINMANN  3
            L++  + N                         NN  GTIP  IFN S L+ + + +N
Sbjct  537  LKVFAVSNNSLSGSLQSSADVQLPNLEGIYLWGNNFSGTIPSFIFNASKLSTLALGDN  594


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI + SSL YL   +N L G +P E+GNL  L  L L  NSL+G IP  I  L+ 
Sbjct  353  GTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSS  412

Query  101  LQILRLDNNNLEGTIPETIFNISTLTY  21
            L  L   NN+L G +   + N+ +L Y
Sbjct  413  LLYLGFSNNSLRGKLEGKVENLESLCY  439


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = -1

Query  245  LEY---LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNN  75
            LEY   L    N L G LP EIGNL +L  +  + N+ SG IP  IG L  LQ L L +N
Sbjct  782  LEYIMNLNFSSNFLTGPLPLEIGNLKVLVGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  841

Query  74   NLEGTIPETIFNISTLTYINMANN  3
             LEG+IP  I ++ +L Y++++NN
Sbjct  842  KLEGSIPNPIGDLISLEYLDLSNN  865


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG  + L+YL +  N+L GS+P  IG+L  L  L L+ N+LSG IP  +  L  
Sbjct  821  GAIPTTIGGLAYLQYLLLGHNKLEGSIPNPIGDLISLEYLDLSNNNLSGPIPVSLEKLLY  880

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  NNLEG IP+
Sbjct  881  LKDLNLSFNNLEGEIPK  897


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG  +SL  L +  N+L   +P  + NL  + NL  + N L+G +P EIGNL +L
Sbjct  750  SIPTCIGNLTSLRTLSLGSNELISVIPSTLWNLEYIMNLNFSSNFLTGPLPLEIGNLKVL  809

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +    NN  G IP TI  ++ L Y+ + +N
Sbjct  810  VGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  841


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L +L L+ N LSG IP  I ++N LQIL L +N L G+ P +I N+
Sbjct  86   LTGTIPSQLGNLSSLQSLNLSHNRLSGAIPSSIFSINSLQILDLSDNQLSGSFPSSISNM  145

Query  35   STLTYINMANN  3
            S+LT+I+ ++N
Sbjct  146  SSLTFIDFSSN  156


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L   DN+L GS+P ++ +L  L  L L  N LS  IP  IGNL  
Sbjct  701  GSIPITLGKLQKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGNKLSRSIPTCIGNLTS  760

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L   IP T++N+  +  +N ++N
Sbjct  761  LRTLSLGSNELISVIPSTLWNLEYIMNLNFSSN  793


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE +Y+W N  +G++P  I N + L+ L L +NS  G IP   GNL  L+   ++NN L 
Sbjct  562  LEGIYLWGNNFSGTIPSFIFNASKLSTLALGDNSFFGFIPNTFGNLGNLRRFNIENNYLT  621

Query  65   GTIPETIF  42
             + PE  F
Sbjct  622  SSTPELNF  629


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPR-SIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            G +PR S+G  S SLE   M +  + G++P EI NLT L  +  + N L+G IP  +G L
Sbjct  651  GILPRTSMGNLSHSLEKFVMINCNVGGAIPEEISNLTNLRMIGFSGNKLNGSIPITLGKL  710

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              LQ+L   +N LEG+IPE + +++ L  +++  N
Sbjct  711  QKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGN  745



>ref|XP_006480344.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X2 [Citrus sinensis]
Length=1262

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ IG  S L++LY+  N+  G++P+EIGNLT L  L L +N   GEIP E+GNL  
Sbjct  281  GTVPKEIGNVSHLKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDNKFQGEIPHELGNLAE  340

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y++ +NN
Sbjct  341  LETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNN  373


 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  LY+  NQ  G++P+EIG LT L+ L L +N   GEIP+E+GNL  
Sbjct  185  GEIPSTLSNCRQLRKLYLSLNQFTGAIPKEIGKLTRLSVLSLRDNKFQGEIPQELGNLAK  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L GTIP +IF  S L Y++++NN
Sbjct  245  LEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNN  277


 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + LE L + +N L G++P  I  L+ L  L  + N+L GEIP E+GNL  
Sbjct  329  GEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAE  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y+  +NN
Sbjct  389  LETLSLQNNSLTGTIPSSIFKLSSLLYLGFSNN  421


 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 61/121 (50%), Gaps = 28/121 (23%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYL----------------------YMWDNQL------NGSLPREIG  186
            G IP SI + SSL YL                      Y W N        NG++P+EIG
Sbjct  401  GTIPSSIFKLSSLLYLGFSNNSLRGKLEGKVENLESLCYRWRNLKGNYFTGNGTIPKEIG  460

Query  185  NLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            NLT L  L L  N   GEIP EIGNL  L+ L L +N L G +P TIFN+STL    ++N
Sbjct  461  NLTNLKELSLYNNRFKGEIPHEIGNLRDLEWLELSDNKLVGVVPATIFNLSTLKVFAVSN  520

Query  5    N  3
            N
Sbjct  521  N  521


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L++  N LNG++P  I   + L  L L+ NSL G +P+EIGN++ 
Sbjct  233  GEIPQELGNLAKLEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNNSLRGTVPKEIGNVSH  292

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N   G IP+ I N++ L  +++ +N
Sbjct  293  LKWLYLHYNRFLGAIPKEIGNLTKLLRLSLQDN  325


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 60/118 (51%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  ++L+ L +++N+  G +P EIGNL  L  L+L++N L G +P  I NL+ 
Sbjct  453  GTIPKEIGNLTNLKELSLYNNRFKGEIPHEIGNLRDLEWLELSDNKLVGVVPATIFNLST  512

Query  101  LQILRLDN-------------------------NNLEGTIPETIFNISTLTYINMANN  3
            L++  + N                         NN  GTIP  IFN S L+ + + +N
Sbjct  513  LKVFAVSNNSLSGSLQSSADVQLPNLEGIYLWGNNFSGTIPSFIFNASKLSTLALGDN  570


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI + SSL YL   +N L G +P E+GNL  L  L L  NSL+G IP  I  L+ 
Sbjct  353  GTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSS  412

Query  101  LQILRLDNNNLEGTIPETIFNISTLTY  21
            L  L   NN+L G +   + N+ +L Y
Sbjct  413  LLYLGFSNNSLRGKLEGKVENLESLCY  439


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = -1

Query  245  LEY---LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNN  75
            LEY   L    N L G LP EIGNL +L  +  + N+ SG IP  IG L  LQ L L +N
Sbjct  758  LEYIMNLNFSSNFLTGPLPLEIGNLKVLVGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  817

Query  74   NLEGTIPETIFNISTLTYINMANN  3
             LEG+IP  I ++ +L Y++++NN
Sbjct  818  KLEGSIPNPIGDLISLEYLDLSNN  841


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG  + L+YL +  N+L GS+P  IG+L  L  L L+ N+LSG IP  +  L  
Sbjct  797  GAIPTTIGGLAYLQYLLLGHNKLEGSIPNPIGDLISLEYLDLSNNNLSGPIPVSLEKLLY  856

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  NNLEG IP+
Sbjct  857  LKDLNLSFNNLEGEIPK  873


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG  +SL  L +  N+L   +P  + NL  + NL  + N L+G +P EIGNL +L
Sbjct  726  SIPTCIGNLTSLRTLSLGSNELISVIPSTLWNLEYIMNLNFSSNFLTGPLPLEIGNLKVL  785

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +    NN  G IP TI  ++ L Y+ + +N
Sbjct  786  VGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  817


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L +L L+ N LSG IP  I ++N LQIL L +N L G+ P +I N+
Sbjct  86   LTGTIPSQLGNLSSLQSLNLSHNRLSGAIPSSIFSINSLQILDLSDNQLSGSFPSSISNM  145

Query  35   STLTYINMANN  3
            S+LT+I+ ++N
Sbjct  146  SSLTFIDFSSN  156


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L   DN+L GS+P ++ +L  L  L L  N LS  IP  IGNL  
Sbjct  677  GSIPITLGKLQKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGNKLSRSIPTCIGNLTS  736

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L   IP T++N+  +  +N ++N
Sbjct  737  LRTLSLGSNELISVIPSTLWNLEYIMNLNFSSN  769


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE +Y+W N  +G++P  I N + L+ L L +NS  G IP   GNL  L+   ++NN L 
Sbjct  538  LEGIYLWGNNFSGTIPSFIFNASKLSTLALGDNSFFGFIPNTFGNLGNLRRFNIENNYLT  597

Query  65   GTIPETIF  42
             + PE  F
Sbjct  598  SSTPELNF  605


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPR-SIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            G +PR S+G  S SLE   M +  + G++P EI NLT L  +  + N L+G IP  +G L
Sbjct  627  GILPRTSMGNLSHSLEKFVMINCNVGGAIPEEISNLTNLRMIGFSGNKLNGSIPITLGKL  686

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              LQ+L   +N LEG+IPE + +++ L  +++  N
Sbjct  687  QKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGN  721



>ref|XP_009631801.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=1153

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +I + SSL  LYM +N+L G LPRE+GNLT+L+ L L  N L+G IP EIGNL M
Sbjct  329  GSIPLTIFDISSLGLLYMRNNKLEGPLPREVGNLTLLSVLDLGNNKLAGVIPDEIGNLQM  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+LD NN  G+IP  IFN+S+L  I++A N
Sbjct  389  LTQLQLDLNNFSGSIPVGIFNMSSLIIISLAQN  421


 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL +L+ L L  N L G IPRSI ECS L+ L +  N   G++P E+GNL +L  L
Sbjct  238  DLCRRLPRLQNLDLSSNMLSGQIPRSISECSELQVLELMQNNFVGTIPGELGNLQLLQGL  297

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N+L G IP EIG+LN L  L ++NN L G+IP TIF+IS+L  + M NN
Sbjct  298  DLGHNTLEGRIPDEIGHLN-LDYLVVENNKLTGSIPLTIFDISSLGLLYMRNN  349


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+YL + +N+L GS+P  I +++ L  L +  N L G +PRE+GNL +
Sbjct  306  GRIPDEIGHLN-LDYLVVENNKLTGSIPLTIFDISSLGLLYMRNNKLEGPLPREVGNLTL  364

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINM  12
            L +L L NN L G IP+ I N+  LT + +
Sbjct  365  LSVLDLGNNKLAGVIPDEIGNLQMLTQLQL  394


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G  + L  L + +N+L G +P EIGNL ML  LQL  N+ SG IP  I N++ 
Sbjct  353  GPLPREVGNLTLLSVLDLGNNKLAGVIPDEIGNLQMLTQLQLDLNNFSGSIPVGIFNMSS  412

Query  101  LQILRLDNNNLEGTIPETI  45
            L I+ L  N++ G IP TI
Sbjct  413  LIIISLAQNHISGNIPSTI  431


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSIGECSS-LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GNIP +IG     +E +++ DN +NG LP  I NL+ML  L+L  N L G IP+ +GNL 
Sbjct  425  GNIPSTIGHWPPNIEQIHLLDNNINGVLPSSISNLSMLTVLKLGGNKLMGSIPKSVGNLT  484

Query  104  MLQILRLDNNNL  69
            +LQ+L L  N+L
Sbjct  485  ILQVLDLYGNSL  496


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP S+G+   +  L +  N  NGSLP + GNL    ++ L+ N +SG IP  +G L  L 
Sbjct  646  IPSSLGKLKDILKLDLSSNFFNGSLPLDFGNLKSAIHVNLSWNQISGNIPSTLGGLQKLT  705

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +N ++G+IPET   +  L  ++++ N
Sbjct  706  QLSLAHNRIKGSIPETFGKLINLEALDLSYN  736


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLN  105
            G+IP  I   SSL  + +  N ++G++P  IG+    +  + L +N+++G +P  I NL+
Sbjct  401  GSIPVGIFNMSSLIIISLAQNHISGNIPSTIGHWPPNIEQIHLLDNNINGVLPSSISNLS  460

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ML +L+L  N L G+IP+++ N++ L  +++  N
Sbjct  461  MLTVLKLGGNKLMGSIPKSVGNLTILQVLDLYGN  494


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  SSL+        L G +P EIGNL  L++L+L +N  +G +PR I +L  LQ
Sbjct  526  LPKSIGNISSLQTFSADGCNLRGHVPAEIGNLRDLSSLKLEDNEFTGIVPRTISSLKKLQ  585

Query  95   ILRLDNNNLEGTIPETI  45
               L  N + G  P+ +
Sbjct  586  RFSLGANRITGPFPKEL  602


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE----------  132
            G +P SI   S L  L +  N+L GS+P+ +GNLT+L  L L  NSL+ +          
Sbjct  450  GVLPSSISNLSMLTVLKLGGNKLMGSIPKSVGNLTILQVLDLYGNSLTSDLSFITPLADW  509

Query  131  ----------------IPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                            +P+ IGN++ LQ    D  NL G +P  I N+  L+ + + +N
Sbjct  510  KFLRELILSFNPLNAMLPKSIGNISSLQTFSADGCNLRGHVPAEIGNLRDLSSLKLEDN  568


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G+ +SL  +Y+  N  +  +P  +G L  +  L L+ N  +G +P + GNL  
Sbjct  620  GSIPSCLGDVTSLREVYLDSNNFSAIIPSSLGKLKDILKLDLSSNFFNGSLPLDFGNLKS  679

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               + L  N + G IP T+  +  LT +++A+N
Sbjct  680  AIHVNLSWNQISGNIPSTLGGLQKLTQLSLAHN  712


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 54/119 (45%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQL--------------------------NGSLPREIGNL  180
            G+IP+S+G  + L+ L ++ N L                          N  LP+ IGN+
Sbjct  474  GSIPKSVGNLTILQVLDLYGNSLTSDLSFITPLADWKFLRELILSFNPLNAMLPKSIGNI  533

Query  179  TMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + L        +L G +P EIGNL  L  L+L++N   G +P TI ++  L   ++  N
Sbjct  534  SSLQTFSADGCNLRGHVPAEIGNLRDLSSLKLEDNEFTGIVPRTISSLKKLQRFSLGAN  592


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG    L  L + DN+  G +PR I +L  L    L  N ++G  P+E+  L+ 
Sbjct  548  GHVPAEIGNLRDLSSLKLEDNEFTGIVPRTISSLKKLQRFSLGANRITGPFPKELCELSN  607

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N ++G+IP  + ++++L  + + +N
Sbjct  608  LGLLNLSQNQMQGSIPSCLGDVTSLREVYLDSN  640


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N   G LP E+ +L  L  + L+ N   G+IP  +G+   
Sbjct  89   GTIPPQLGNLSFLLSLDLSVNNFYGELPLELSHLRKLRAIDLSFNRFYGQIPPFLGDFKD  148

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L ++ N+ +G IP +I N+  L  +NM  N
Sbjct  149  LRMLSIETNDFKGFIPASISNMKNLEILNMRFN  181


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    L  L +  N++ GS+P   G L  L  L L+ N++SG IP  +  L  
Sbjct  692  GNIPSTLGGLQKLTQLSLAHNRIKGSIPETFGKLINLEALDLSYNNISGVIPMSLEELKQ  751

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N L+G IP
Sbjct  752  LGSFNVSFNRLQGEIP  767


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR+I     L+   +  N++ G  P+E+  L+ L  L L++N + G IP  +G++  
Sbjct  572  GIVPRTISSLKKLQRFSLGANRITGPFPKELCELSNLGLLNLSQNQMQGSIPSCLGDVTS  631

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + LD+NN    IP ++  +  +  +++++N
Sbjct  632  LREVYLDSNNFSAIIPSSLGKLKDILKLDLSSN  664



>ref|XP_007025344.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY27966.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=1140

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG CS+L+ L +  NQ NG++PR IGNLT L  L L EN L+GEIP EIGNL  
Sbjct  291  GHIPSSIGGCSNLQDLSLSTNQFNGTIPRGIGNLTSLKRLSLRENDLTGEIPWEIGNLYS  350

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+I    +  L G+IP +IFNIS+L  I++ NN
Sbjct  351  LEIFAAQHMRLTGSIPPSIFNISSLKEISLHNN  383


 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P S+G+C++L+ L + +N+ NG +PR IGNLT L  + L  N L GEIP EIGNL  
Sbjct  169  GSVPSSLGDCTNLQNLSLSNNRFNGFIPRSIGNLTRLKEIHLGGNRLRGEIPWEIGNLFN  228

Query  101  LQILRLDNN-NLEGTIPETIFNISTLTYINMANN  3
            L+I   +NN  L G IP +IFNIS+LT + + NN
Sbjct  229  LEIFAAENNRGLTGGIPSSIFNISSLTKLLLFNN  262


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SI   S SL++ Y    ++ G++PREIGNL+ +  L L+ N LSG I   IG L 
Sbjct  489  GILPGSISNLSTSLQFFYASGVKITGNIPREIGNLSNITTLDLSHNELSGSIRAPIGRLR  548

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +Q L LD N L+G+IP ++  +  L  +++  N
Sbjct  549  NVQGLYLDGNQLQGSIPPSVCGLGRLHTLSLGGN  582


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIPR IG  S++  L +  N+L+GS+   IG L  +  L L  N L G IP  +  L  
Sbjct  514  GNIPREIGNLSNITTLDLSHNELSGSIRAPIGRLRNVQGLYLDGNQLQGSIPPSVCGLGR  573

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP  + N+++L Y+++ +N
Sbjct  574  LHTLSLGGNMLHGPIPTCLANLTSLRYLHLDSN  606


 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 58/117 (50%), Gaps = 25/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNL------------------------TM  174
            G IPR IG  +SL+ L + +N L G +P EIGNL                        + 
Sbjct  315  GTIPRGIGNLTSLKRLSLRENDLTGEIPWEIGNLYSLEIFAAQHMRLTGSIPPSIFNISS  374

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L  NSLSGEIP  I   N L++LRL  NNL G IP  I N S LT +++  N
Sbjct  375  LKEISLHNNSLSGEIPSMISITN-LELLRLWGNNLSGNIPNFISNASKLTTLSLQEN  430


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+I   IG   +++ LY+  NQL GS+P  +  L  L+ L L  N L G IP  + NL  
Sbjct  538  GSIRAPIGRLRNVQGLYLDGNQLQGSIPPSVCGLGRLHTLSLGGNMLHGPIPTCLANLTS  597

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L LD+N L   IP T+++++ +  +++++N
Sbjct  598  LRYLHLDSNKLNSIIPLTLWSLNNILLVDLSSN  630


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE L++  N  +GS+P  +G+ T L NL L+ N  +G IPR IGNL  L+ + L  N L 
Sbjct  157  LEVLHLAFNGFSGSVPSSLGDCTNLQNLSLSNNRFNGFIPRSIGNLTRLKEIHLGGNRLR  216

Query  65   GTIPETIFNISTLTYINMANN  3
            G IP  I N+  L      NN
Sbjct  217  GEIPWEIGNLFNLEIFAAENN  237


 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 8/100 (8%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   ++LE L +W N L+G++P  I N + L  L L ENS SG IP  +GNL  
Sbjct  387  GEIPSMI-SITNLELLRLWGNNLSGNIPNFISNASKLTTLSLQENSFSGLIPNTLGNLRF  445

Query  101  LQILRLDNNNL-------EGTIPETIFNISTLTYINMANN  3
            L+ L L +NNL       E +   ++ N   L Y+N+++N
Sbjct  446  LERLSLASNNLITETSTHEWSFLSSLSNCRNLRYLNLSSN  485


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 57/117 (49%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYM-------------WD-----------NQLNGSLPREIGNLTM  174
            G IP  +   +SL YL++             W            N LNGSLP  I  L +
Sbjct  586  GPIPTCLANLTSLRYLHLDSNKLNSIIPLTLWSLNNILLVDLSSNYLNGSLPSGIQKLKV  645

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L+ N LSGEI   IG L  L  L L NN  +G IPE+  ++ +L  ++++NN
Sbjct  646  LTHLNLSRNLLSGEIWSSIGELQDLISLDLSNNRFDGYIPESFGDLISLKSLDLSNN  702


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  I +   L +L +  N L+G +   IG L  L +L L+ N   G IP   G+L  
Sbjct  634  GSLPSGIQKLKVLTHLNLSRNLLSGEIWSSIGELQDLISLDLSNNRFDGYIPESFGDLIS  693

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L G IP+++  +S L + N++ N
Sbjct  694  LKSLDLSNNDLYGVIPKSLEKLSFLNHFNVSFN  726


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+     L  L +  N L+G +P  + NLT L  L L  N L+  IP  + +LN 
Sbjct  562  GSIPPSVCGLGRLHTLSLGGNMLHGPIPTCLANLTSLRYLHLDSNKLNSIIPLTLWSLNN  621

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + ++ L +N L G++P  I  +  LT++N++ N
Sbjct  622  ILLVDLSSNYLNGSLPSGIQKLKVLTHLNLSRN  654


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I  SIGE   L  L + +N+ +G +P   G+L  L +L L+ N L G IP+ +  L+ 
Sbjct  658  GEIWSSIGELQDLISLDLSNNRFDGYIPESFGDLISLKSLDLSNNDLYGVIPKSLEKLSF  717

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N LEG IP
Sbjct  718  LNHFNVSFNRLEGEIP  733



>emb|CDO96775.1| unnamed protein product [Coffea canephora]
Length=1014

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  LNMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNN  165
            +N+CS+L +L   YL  N L G I      CS LE L + DN LNG+LPREIGNLTML  
Sbjct  214  VNLCSKLSRLHGYYLAYNTLSGQILSRFDNCSELEELSLNDNDLNGTLPREIGNLTMLKL  273

Query  164  LQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L L +N  +G IP+EIGNL  L +L    N L G +P TI+NIST+T+I +  N
Sbjct  274  LSLGQNKFAGTIPKEIGNLQKLNMLNFALNTLSGQVPVTIYNISTMTFIRLTGN  327


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P   G   +L+ L + +N   G++P  + N + L ++ +  N L G IP+EIGNL  L+
Sbjct  116  VPSGFGSLPNLQALDLSNNSFTGAIPTSLFNASKLESISIMSNQLQGNIPQEIGNLGNLK  175

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +LR+ NN L G IP T+FNIS+L  +N+ NN
Sbjct  176  VLRMANNQLTGLIPLTLFNISSLQIVNLRNN  206


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR IG  + L+ L +  N+  G++P+EIGNL  LN L    N+LSG++P  I N++ 
Sbjct  259  GTLPREIGNLTMLKLLSLGQNKFAGTIPKEIGNLQKLNMLNFALNTLSGQVPVTIYNIST  318

Query  101  LQILRLDNNNLEGTIPETIFN-ISTLTYINMANN  3
            +  +RL  N L G++P +I + +  L  +N+A+N
Sbjct  319  MTFIRLTGNKLSGSLPHSIGHLLPNLETLNVAHN  352


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+   S LE + +  NQL G++P+EIGNL  L  L++  N L+G IP  + N++ 
Sbjct  138  GAIPTSLFNASKLESISIMSNQLQGNIPQEIGNLGNLKVLRMANNQLTGLIPLTLFNISS  197

Query  101  LQILRLDNNNLEGTIP  54
            LQI+ L NN L G +P
Sbjct  198  LQIVNLRNNTLSGDLP  213


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP +I   S SLE   +   +L GS+P EIGNL+ L  + L+ N  +G++P     L+
Sbjct  434  GTIPPTIANLSNSLEVFLVSTCELEGSIPPEIGNLSRLTGMDLSSNHFTGQLPLAFQGLS  493

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +Q L L NN + G I     N+ +LT ++++ N
Sbjct  494  NIQALELQNNRISGAISPNFCNLRSLTLLDLSQN  527


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGE----IPREIGNLNMLQILRLDNNNLEGTIPET  48
            L GS+P EIGNL+ +N++ L+ N+  G     +P   G+L  LQ L L NN+  G IP +
Sbjct  84   LQGSIPPEIGNLSFVNSIDLSGNNFQGNLPMLVPSGFGSLPNLQALDLSNNSFTGAIPTS  143

Query  47   IFNISTLTYINMANN  3
            +FN S L  I++ +N
Sbjct  144  LFNASKLESISIMSN  158


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +G  SSL  L +  N LN ++P  +G+L  L NL +  N+  G IP+EIGNL  
Sbjct  531  GQLPECLGNMSSLGKLNLSSNGLNSTMPASVGSLKDLLNLDVHSNAFGGFIPQEIGNLLA  590

Query  101  LQILRLDNNNLEGTIPETI  45
               + L  N   G IP TI
Sbjct  591  AISIDLSWNKFSGNIPTTI  609


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  S L  + +  N   G LP     L+ +  L+L  N +SG I     NL  
Sbjct  459  GSIPPEIGNLSRLTGMDLSSNHFTGQLPLAFQGLSNIQALELQNNRISGAISPNFCNLRS  518

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N   G +PE + N+S+L  +N+++N
Sbjct  519  LTLLDLSQNKFSGQLPECLGNMSSLGKLNLSSN  551


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 31/114 (27%)
 Frame = -1

Query  281  GNIPRSIGEC-SSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P SIG    +LE L +  N L G +P  I N+T L  L+L+ N  +G IPR +G+LN
Sbjct  331  GSLPHSIGHLLPNLETLNVAHNYLTGVIPDSISNMTKLVILELSMNRFTGSIPRSLGSLN  390

Query  104  MLQ------------------------------ILRLDNNNLEGTIPETIFNIS  33
            +L+                              +L LD  +++GTIP TI N+S
Sbjct  391  LLETLDVAGYYLATGSPKELSIISSLANCKSLRVLILDGVSVKGTIPPTIANLS  444



>ref|XP_009609321.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana tomentosiformis]
Length=1172

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL +L +L L  NKL G IPR+I ECS L+ L + +N L+G +PRE+GNL +L +L
Sbjct  239  DLCRRLPRLRKLELNFNKLRGQIPRTISECSQLQVLSLMENNLDGIIPRELGNLQLLQDL  298

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N+L G IP EIG+L  L++L ++ N L+G+IP TIFNIS+L ++ M+ N
Sbjct  299  TLGNNTLEGTIPYEIGHLYNLKLLVMEKNKLKGSIPLTIFNISSLEFLFMSGN  351


 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +I   SSLE+L+M  N L G LPR++GNLTML  L L  N L+G IP E+GNL  
Sbjct  331  GSIPLTIFNISSLEFLFMSGNMLEGPLPRDVGNLTMLTTLDLGNNFLTGVIPDELGNLQE  390

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NN  G+IP  IFNISTL  I++++N
Sbjct  391  LVDLSLYLNNFSGSIPIGIFNISTLVSISLSDN  423


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G    L+ L + +N L G++P EIG+L  L  L + +N L G IP  I N++ 
Sbjct  283  GIIPRELGNLQLLQDLTLGNNTLEGTIPYEIGHLYNLKLLVMEKNKLKGSIPLTIFNISS  342

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L +  N LEG +P  + N++ LT +++ NN
Sbjct  343  LEFLFMSGNMLEGPLPRDVGNLTMLTTLDLGNN  375


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             NIP S+     +  L +  N  NGSLP + GNL     L L+ N LSG IP  +G+L  
Sbjct  645  ANIPLSLWNLKDILKLNLSSNFFNGSLPPQFGNLKAAILLDLSWNQLSGNIPNTLGSLLK  704

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L L +N +EG+IPET   + +L  ++++ N
Sbjct  705  VTQLSLAHNRIEGSIPETFRKLVSLEALDLSYN  737


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGN-LTMLNNLQLTENSLSGEIPREIGNLN  105
            G+IP  I   S+L  + + DN  +G LP  IG+ L  +  + L EN+++G +P  I NL+
Sbjct  403  GSIPIGIFNISTLVSISLSDNHFSGHLPSTIGHGLPNIEGIFLGENNINGILPSSISNLS  462

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +L L  N L G+IP+++ N+  L  +++ +N
Sbjct  463  KLTVLELGGNELTGSIPKSLVNLRLLEVLHLQSN  496


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G+ +SL  +Y+  N L  ++P  + NL  +  L L+ N  +G +P + GNL  
Sbjct  621  GSIPTCLGDLTSLREVYLDSNNLTANIPLSLWNLKDILKLNLSSNFFNGSLPPQFGNLKA  680

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N L G IP T+ ++  +T +++A+N
Sbjct  681  AILLDLSWNQLSGNIPNTLGSLLKVTQLSLAHN  713


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  S L++       L G +P EIGNL  L++L+L +N  +G +P  I +L  LQ
Sbjct  528  LPKSIGNLS-LQWFSAIGCNLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLTNLQ  586

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L  N + G  P  +  +S+L ++ ++ N
Sbjct  587  QLSLGVNRISGPFPNGLCELSSLFFLKLSQN  617


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 56/89 (63%), Gaps = 8/89 (9%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P +IG    ++E +++ +N +NG LP  I NL+ L  L+L  N L+G IP+ + NL 
Sbjct  427  GHLPSTIGHGLPNIEGIFLGENNINGILPSSISNLSKLTVLELGGNELTGSIPKSLVNLR  486

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYI  18
            +L++L L +N+  G   ET    STL++I
Sbjct  487  LLEVLHLQSNSFIG---ET----STLSFI  508


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G  + L  L + +N L G +P E+GNL  L +L L  N+ SG IP  I N++ 
Sbjct  355  GPLPRDVGNLTMLTTLDLGNNFLTGVIPDELGNLQELVDLSLYLNNFSGSIPIGIFNIST  414

Query  101  LQILRLDNNNLEGTIPETI  45
            L  + L +N+  G +P TI
Sbjct  415  LVSISLSDNHFSGHLPSTI  433


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   +L  L + DN   G +P  I +LT L  L L  N +SG  P  +  L+ 
Sbjct  549  GHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLTNLQQLSLGVNRISGPFPNGLCELSS  608

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L  N + G+IP  + ++++L  + + +N
Sbjct  609  LFFLKLSQNQMRGSIPTCLGDLTSLREVYLDSN  641


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G  P  + E SSL +L +  NQ+ GS+P  +G+LT L  + L  N+L+  IP  + NL  
Sbjct  597  GPFPNGLCELSSLFFLKLSQNQMRGSIPTCLGDLTSLREVYLDSNNLTANIPLSLWNLKD  656

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L L +N   G++P    N+     ++++ N
Sbjct  657  ILKLNLSSNFFNGSLPPQFGNLKAAILLDLSWN  689


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P   G   +   L +  NQL+G++P  +G+L  +  L L  N + G IP     L  
Sbjct  669  GSLPPQFGNLKAAILLDLSWNQLSGNIPNTLGSLLKVTQLSLAHNRIEGSIPETFRKLVS  728

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN+ G IP+++  +  L   N++ N
Sbjct  729  LEALDLSYNNMSGVIPKSLEALQQLHSFNVSFN  761


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
             NG++P ++GNL+ L +L L+ N   GE+P EI +L  L+ + L NN L G IP    +I
Sbjct  90   FNGTIPPQLGNLSFLVSLDLSHNDFHGELPPEISHLPRLRAIDLSNNYLTGQIPSFSGDI  149

Query  35   STLT  24
              L+
Sbjct  150  RMLS  153


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 10/96 (10%)
 Frame = -1

Query  263  IGECSSLEY---------LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN  111
            IGE S+L +         L +  N LN  LP+ IGNL+ L        +L G IP EIGN
Sbjct  499  IGETSTLSFITPLINLVDLRLSFNPLNAVLPKSIGNLS-LQWFSAIGCNLKGHIPNEIGN  557

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L  L L++N+  G +P TI +++ L  +++  N
Sbjct  558  LINLSSLELEDNDFTGIVPTTISSLTNLQQLSLGVN  593


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    +  L +  N++ GS+P     L  L  L L+ N++SG IP+ +  L  
Sbjct  693  GNIPNTLGSLLKVTQLSLAHNRIEGSIPETFRKLVSLEALDLSYNNMSGVIPKSLEALQQ  752

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N L G IP
Sbjct  753  LHSFNVSFNRLHGEIP  768



>ref|XP_009761465.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2, partial [Nicotiana sylvestris]
Length=399

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            + C RL +L++L L  N L G +PR+I ECS L+ L++++N   G +P+E+GNL +L +L
Sbjct  212  DFCRRLPRLQKLVLGFNMLSGEVPRTISECSELQLLWLFENNFAGKIPKELGNLELLQDL  271

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L G IP EIG+L+ L+ L + NN L G IP ++FNIS+L Y+ M +N
Sbjct  272  HLGFNKLQGTIPEEIGHLHNLKSLIMANNKLTGPIPLSMFNISSLEYLFMGDN  324


 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+   SSLEYL+M DN L G LPRE+GNL++L  L    N+L+G IP E+GNL  
Sbjct  304  GPIPLSMFNISSLEYLFMGDNMLEGPLPREVGNLSVLVWLDFAYNNLTGIIPHEVGNLKE  363

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN  G+IP  IFNIS L  I++  N
Sbjct  364  LEELSLSYNNFNGSIPTGIFNISPLVSIDLDRN  396


 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G    L+ L++  N+L G++P EIG+L  L +L +  N L+G IP  + N++ 
Sbjct  256  GKIPKELGNLELLQDLHLGFNKLQGTIPEEIGHLHNLKSLIMANNKLTGPIPLSMFNISS  315

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +N LEG +P  + N+S L +++ A N
Sbjct  316  LEYLFMGDNMLEGPLPREVGNLSVLVWLDFAYN  348


 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +L+ L M +N+L G +P  + N++ L  L + +N L G +PRE+GNL++
Sbjct  280  GTIPEEIGHLHNLKSLIMANNKLTGPIPLSMFNISSLEYLFMGDNMLEGPLPREVGNLSV  339

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L    NNL G IP  + N+  L  ++++ N
Sbjct  340  LVWLDFAYNNLTGIIPHEVGNLKELEELSLSYN  372


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N   G LP +   L  L  + L+ N+ +GEIP  I  L  
Sbjct  111  GTIPPQLGNLSFLVSLDLSYNNFQGELPPDFTRLQKLRAINLSYNNFTGEIPIGIATLPS  170

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINM  12
            L+ L L  N L G+   +IFNISTL ++++
Sbjct  171  LKFLNLGYNKLNGSNVLSIFNISTLKFLDL  200


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  DNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
            D   NG++P ++GNL+ L +L L+ N+  GE+P +   L  L+ + L  NN  G IP  I
Sbjct  106  DMGFNGTIPPQLGNLSFLVSLDLSYNNFQGELPPDFTRLQKLRAINLSYNNFTGEIPIGI  165

Query  44   FNISTLTYINMANN  3
              + +L ++N+  N
Sbjct  166  ATLPSLKFLNLGYN  179


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G  S L +L    N L G +P E+GNL  L  L L+ N+ +G IP  I N++ 
Sbjct  328  GPLPREVGNLSVLVWLDFAYNNLTGIIPHEVGNLKELEELSLSYNNFNGSIPTGIFNISP  387

Query  101  LQILRLDNNNL  69
            L  + LD N++
Sbjct  388  LVSIDLDRNHI  398



>ref|XP_009609323.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nicotiana tomentosiformis]
Length=1158

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL +L +L L  NKL G IPR+I ECS L+ L + +N L+G +PRE+GNL +L +L
Sbjct  239  DLCRRLPRLRKLELNFNKLRGQIPRTISECSQLQVLSLMENNLDGIIPRELGNLQLLQDL  298

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N+L G IP EIG+L  L++L ++ N L+G+IP TIFNIS+L ++ M+ N
Sbjct  299  TLGNNTLEGTIPYEIGHLYNLKLLVMEKNKLKGSIPLTIFNISSLEFLFMSGN  351


 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +I   SSLE+L+M  N L G LPR++GNLTML  L L  N L+G IP E+GNL  
Sbjct  331  GSIPLTIFNISSLEFLFMSGNMLEGPLPRDVGNLTMLTTLDLGNNFLTGVIPDELGNLQE  390

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NN  G+IP  IFNISTL  I++++N
Sbjct  391  LVDLSLYLNNFSGSIPIGIFNISTLVSISLSDN  423


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G    L+ L + +N L G++P EIG+L  L  L + +N L G IP  I N++ 
Sbjct  283  GIIPRELGNLQLLQDLTLGNNTLEGTIPYEIGHLYNLKLLVMEKNKLKGSIPLTIFNISS  342

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L +  N LEG +P  + N++ LT +++ NN
Sbjct  343  LEFLFMSGNMLEGPLPRDVGNLTMLTTLDLGNN  375


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             NIP S+     +  L +  N  NGSLP + GNL     L L+ N LSG IP  +G+L  
Sbjct  645  ANIPLSLWNLKDILKLNLSSNFFNGSLPPQFGNLKAAILLDLSWNQLSGNIPNTLGSLLK  704

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L L +N +EG+IPET   + +L  ++++ N
Sbjct  705  VTQLSLAHNRIEGSIPETFRKLVSLEALDLSYN  737


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGN-LTMLNNLQLTENSLSGEIPREIGNLN  105
            G+IP  I   S+L  + + DN  +G LP  IG+ L  +  + L EN+++G +P  I NL+
Sbjct  403  GSIPIGIFNISTLVSISLSDNHFSGHLPSTIGHGLPNIEGIFLGENNINGILPSSISNLS  462

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +L L  N L G+IP+++ N+  L  +++ +N
Sbjct  463  KLTVLELGGNELTGSIPKSLVNLRLLEVLHLQSN  496


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G+ +SL  +Y+  N L  ++P  + NL  +  L L+ N  +G +P + GNL  
Sbjct  621  GSIPTCLGDLTSLREVYLDSNNLTANIPLSLWNLKDILKLNLSSNFFNGSLPPQFGNLKA  680

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N L G IP T+ ++  +T +++A+N
Sbjct  681  AILLDLSWNQLSGNIPNTLGSLLKVTQLSLAHN  713


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  S L++       L G +P EIGNL  L++L+L +N  +G +P  I +L  LQ
Sbjct  528  LPKSIGNLS-LQWFSAIGCNLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLTNLQ  586

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L  N + G  P  +  +S+L ++ ++ N
Sbjct  587  QLSLGVNRISGPFPNGLCELSSLFFLKLSQN  617


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 56/89 (63%), Gaps = 8/89 (9%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P +IG    ++E +++ +N +NG LP  I NL+ L  L+L  N L+G IP+ + NL 
Sbjct  427  GHLPSTIGHGLPNIEGIFLGENNINGILPSSISNLSKLTVLELGGNELTGSIPKSLVNLR  486

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYI  18
            +L++L L +N+  G   ET    STL++I
Sbjct  487  LLEVLHLQSNSFIG---ET----STLSFI  508


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G  + L  L + +N L G +P E+GNL  L +L L  N+ SG IP  I N++ 
Sbjct  355  GPLPRDVGNLTMLTTLDLGNNFLTGVIPDELGNLQELVDLSLYLNNFSGSIPIGIFNIST  414

Query  101  LQILRLDNNNLEGTIPETI  45
            L  + L +N+  G +P TI
Sbjct  415  LVSISLSDNHFSGHLPSTI  433


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   +L  L + DN   G +P  I +LT L  L L  N +SG  P  +  L+ 
Sbjct  549  GHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLTNLQQLSLGVNRISGPFPNGLCELSS  608

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L  N + G+IP  + ++++L  + + +N
Sbjct  609  LFFLKLSQNQMRGSIPTCLGDLTSLREVYLDSN  641


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G  P  + E SSL +L +  NQ+ GS+P  +G+LT L  + L  N+L+  IP  + NL  
Sbjct  597  GPFPNGLCELSSLFFLKLSQNQMRGSIPTCLGDLTSLREVYLDSNNLTANIPLSLWNLKD  656

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L L +N   G++P    N+     ++++ N
Sbjct  657  ILKLNLSSNFFNGSLPPQFGNLKAAILLDLSWN  689


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P   G   +   L +  NQL+G++P  +G+L  +  L L  N + G IP     L  
Sbjct  669  GSLPPQFGNLKAAILLDLSWNQLSGNIPNTLGSLLKVTQLSLAHNRIEGSIPETFRKLVS  728

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN+ G IP+++  +  L   N++ N
Sbjct  729  LEALDLSYNNMSGVIPKSLEALQQLHSFNVSFN  761


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
             NG++P ++GNL+ L +L L+ N   GE+P EI +L  L+ + L NN L G IP    +I
Sbjct  90   FNGTIPPQLGNLSFLVSLDLSHNDFHGELPPEISHLPRLRAIDLSNNYLTGQIPSFSGDI  149

Query  35   STLT  24
              L+
Sbjct  150  RMLS  153


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 10/96 (10%)
 Frame = -1

Query  263  IGECSSLEY---------LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN  111
            IGE S+L +         L +  N LN  LP+ IGNL+ L        +L G IP EIGN
Sbjct  499  IGETSTLSFITPLINLVDLRLSFNPLNAVLPKSIGNLS-LQWFSAIGCNLKGHIPNEIGN  557

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L  L L++N+  G +P TI +++ L  +++  N
Sbjct  558  LINLSSLELEDNDFTGIVPTTISSLTNLQQLSLGVN  593


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    +  L +  N++ GS+P     L  L  L L+ N++SG IP+ +  L  
Sbjct  693  GNIPNTLGSLLKVTQLSLAHNRIEGSIPETFRKLVSLEALDLSYNNMSGVIPKSLEALQQ  752

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N L G IP
Sbjct  753  LHSFNVSFNRLHGEIP  768



>ref|XP_009759632.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR isoform X2 [Nicotiana sylvestris]
Length=1172

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL +L +L L  NKL G IPR+I ECS L+ L + +N L+G++PRE+GNL +L +L
Sbjct  252  DLCRRLPRLRKLELNFNKLRGQIPRTISECSLLQVLSLMENNLDGTIPRELGNLKLLQDL  311

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N+L G IP EIG+L  L++L ++ N L+G IP TIFNIS+L ++ M+ N
Sbjct  312  TLGNNTLEGTIPSEIGHLYNLKLLVMEKNKLKGPIPLTIFNISSLEFLYMSGN  364


 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I   SSLE+LYM  N L G LPR+IGNLTML  L L  N L+G IP E+GNL  
Sbjct  344  GPIPLTIFNISSLEFLYMSGNMLEGPLPRDIGNLTMLTALDLGNNHLTGVIPDELGNLQE  403

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NN  G+IP  IFNISTL  I++++N
Sbjct  404  LVDLSLYLNNFSGSIPIGIFNISTLESISLSDN  436


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G    L+ L + +N L G++P EIG+L  L  L + +N L G IP  I N++ 
Sbjct  296  GTIPRELGNLKLLQDLTLGNNTLEGTIPSEIGHLYNLKLLVMEKNKLKGPIPLTIFNISS  355

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L +  N LEG +P  I N++ LT +++ NN
Sbjct  356  LEFLYMSGNMLEGPLPRDIGNLTMLTALDLGNN  388


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR IG  + L  L + +N L G +P E+GNL  L +L L  N+ SG IP  I N++ 
Sbjct  368  GPLPRDIGNLTMLTALDLGNNHLTGVIPDELGNLQELVDLSLYLNNFSGSIPIGIFNIST  427

Query  101  LQILRLDNNNLEGTIPETI  45
            L+ + L +N+  G +P TI
Sbjct  428  LESISLSDNHFSGNLPSTI  446


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGN-LTMLNNLQLTENSLSGEIPREIGNLN  105
            G+IP  I   S+LE + + DN  +G+LP  IG+ L  +  + L EN+++G +P  I NL+
Sbjct  416  GSIPIGIFNISTLESISLSDNHFSGNLPSTIGHGLPNIEGIFLGENNINGILPSSISNLS  475

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L L  N L G+IP+++ N+  L  +++ +N
Sbjct  476  KLTALELGGNELTGSIPKSLVNLRLLEVLHLQSN  509


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G+ +SL  +Y+  N    S+P  + NL  +  L L+ N  +G +P E GNL  
Sbjct  634  GSIPTCLGDLTSLREVYLDSNNFTSSIPSSLWNLKDILKLNLSSNFFNGSLPLEFGNLKA  693

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N L G IP T+  +  +T + +A+N
Sbjct  694  AILLDLSWNQLSGNIPNTLGTLLKVTQLYLAHN  726


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 56/89 (63%), Gaps = 8/89 (9%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GN+P +IG    ++E +++ +N +NG LP  I NL+ L  L+L  N L+G IP+ + NL 
Sbjct  440  GNLPSTIGHGLPNIEGIFLGENNINGILPSSISNLSKLTALELGGNELTGSIPKSLVNLR  499

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYI  18
            +L++L L +N+  G   ET    STL++I
Sbjct  500  LLEVLHLQSNSFIG---ET----STLSFI  521


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  S L++       L G +P EIGNL  L++L+L +N  +G +P  I +L  LQ
Sbjct  541  LPKSIGNLS-LQWFSAIGCNLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQ  599

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L  N + G  P  +  +S+L ++ ++ N
Sbjct  600  QLSLGVNRISGPFPNGLCELSSLFFLKLSQN  630


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP S+     +  L +  N  NGSLP E GNL     L L+ N LSG IP  +G L  +
Sbjct  659  SIPSSLWNLKDILKLNLSSNFFNGSLPLEFGNLKAAILLDLSWNQLSGNIPNTLGTLLKV  718

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L +N +EG+IPET   +  L  ++++ N
Sbjct  719  TQLYLAHNRIEGSIPETFGKLVNLEALDLSYN  750


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P +I    +L+ L +  N+++G  P  +  L+ L  L+L++N + G IP  +G+L  
Sbjct  586  GIVPTTISSLKNLQQLSLGVNRISGPFPNGLCELSSLFFLKLSQNQMWGSIPTCLGDLTS  645

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + LD+NN   +IP +++N+  +  +N+++N
Sbjct  646  LREVYLDSNNFTSSIPSSLWNLKDILKLNLSSN  678


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 59/119 (50%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLS-----------  138
            GNIP+ I  +  SL+ L    N+LNGS    I N+++L +L L ++ LS           
Sbjct  198  GNIPKGIATDLQSLKLLSFGFNKLNGSNVLSIFNISLLEDLDLEKSGLSGNLPSDLCRRL  257

Query  137  --------------GEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                          G+IPR I   ++LQ+L L  NNL+GTIP  + N+  L  + + NN
Sbjct  258  PRLRKLELNFNKLRGQIPRTISECSLLQVLSLMENNLDGTIPRELGNLKLLQDLTLGNN  316


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    +  LY+  N++ GS+P   G L  L  L L+ N++SG IP+ +  L  
Sbjct  706  GNIPNTLGTLLKVTQLYLAHNRIEGSIPETFGKLVNLEALDLSYNNMSGVIPKSLEELKQ  765

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N L G IP
Sbjct  766  LDSFNVSFNRLHGEIP  781


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P   G   +   L +  NQL+G++P  +G L  +  L L  N + G IP   G L  
Sbjct  682  GSLPLEFGNLKAAILLDLSWNQLSGNIPNTLGTLLKVTQLYLAHNRIEGSIPETFGKLVN  741

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN+ G IP+++  +  L   N++ N
Sbjct  742  LEALDLSYNNMSGVIPKSLEELKQLDSFNVSFN  774


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 21/100 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N  +G LP EI +L  L  + L++N L+G+IP   G++ M
Sbjct  105  GTIPPQLGNLSFLVSLDLSHNYFHGELPSEISHLPRLRAIDLSDNYLTGQIPSFSGDIRM  164

Query  101  L---------------------QILRLDNNNLEGTIPETI  45
            L                     + L+L  NNLEG IP+ I
Sbjct  165  LSLEINSFSGFIPSSISRIKNLEFLKLGYNNLEGNIPKGI  204


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   +L  L + DN   G +P  I +L  L  L L  N +SG  P  +  L+ 
Sbjct  562  GHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVNRISGPFPNGLCELSS  621

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L  N + G+IP  + ++++L  + + +N
Sbjct  622  LFFLKLSQNQMWGSIPTCLGDLTSLREVYLDSN  654


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
             NG++P ++GNL+ L +L L+ N   GE+P EI +L  L+ + L +N L G IP    +I
Sbjct  103  FNGTIPPQLGNLSFLVSLDLSHNYFHGELPSEISHLPRLRAIDLSDNYLTGQIPSFSGDI  162

Query  35   STLT  24
              L+
Sbjct  163  RMLS  166


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 10/96 (10%)
 Frame = -1

Query  263  IGECSSLEY---------LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN  111
            IGE S+L +         L +  N LN  LP+ IGNL+ L        +L G IP EIGN
Sbjct  512  IGETSTLSFITPLINLVDLRLSFNPLNALLPKSIGNLS-LQWFSAIGCNLKGHIPNEIGN  570

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L  L L++N+  G +P TI ++  L  +++  N
Sbjct  571  LINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVN  606



>ref|XP_009759631.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana sylvestris]
Length=1183

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL +L +L L  NKL G IPR+I ECS L+ L + +N L+G++PRE+GNL +L +L
Sbjct  252  DLCRRLPRLRKLELNFNKLRGQIPRTISECSLLQVLSLMENNLDGTIPRELGNLKLLQDL  311

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N+L G IP EIG+L  L++L ++ N L+G IP TIFNIS+L ++ M+ N
Sbjct  312  TLGNNTLEGTIPSEIGHLYNLKLLVMEKNKLKGPIPLTIFNISSLEFLYMSGN  364


 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I   SSLE+LYM  N L G LPR+IGNLTML  L L  N L+G IP E+GNL  
Sbjct  344  GPIPLTIFNISSLEFLYMSGNMLEGPLPRDIGNLTMLTALDLGNNHLTGVIPDELGNLQE  403

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NN  G+IP  IFNISTL  I++++N
Sbjct  404  LVDLSLYLNNFSGSIPIGIFNISTLESISLSDN  436


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G    L+ L + +N L G++P EIG+L  L  L + +N L G IP  I N++ 
Sbjct  296  GTIPRELGNLKLLQDLTLGNNTLEGTIPSEIGHLYNLKLLVMEKNKLKGPIPLTIFNISS  355

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L +  N LEG +P  I N++ LT +++ NN
Sbjct  356  LEFLYMSGNMLEGPLPRDIGNLTMLTALDLGNN  388


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR IG  + L  L + +N L G +P E+GNL  L +L L  N+ SG IP  I N++ 
Sbjct  368  GPLPRDIGNLTMLTALDLGNNHLTGVIPDELGNLQELVDLSLYLNNFSGSIPIGIFNIST  427

Query  101  LQILRLDNNNLEGTIPETI  45
            L+ + L +N+  G +P TI
Sbjct  428  LESISLSDNHFSGNLPSTI  446


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGN-LTMLNNLQLTENSLSGEIPREIGNLN  105
            G+IP  I   S+LE + + DN  +G+LP  IG+ L  +  + L EN+++G +P  I NL+
Sbjct  416  GSIPIGIFNISTLESISLSDNHFSGNLPSTIGHGLPNIEGIFLGENNINGILPSSISNLS  475

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L L  N L G+IP+++ N+  L  +++ +N
Sbjct  476  KLTALELGGNELTGSIPKSLVNLRLLEVLHLQSN  509


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G+ +SL  +Y+  N    S+P  + NL  +  L L+ N  +G +P E GNL  
Sbjct  634  GSIPTCLGDLTSLREVYLDSNNFTSSIPSSLWNLKDILKLNLSSNFFNGSLPLEFGNLKA  693

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N L G IP T+  +  +T + +A+N
Sbjct  694  AILLDLSWNQLSGNIPNTLGTLLKVTQLYLAHN  726


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 56/89 (63%), Gaps = 8/89 (9%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GN+P +IG    ++E +++ +N +NG LP  I NL+ L  L+L  N L+G IP+ + NL 
Sbjct  440  GNLPSTIGHGLPNIEGIFLGENNINGILPSSISNLSKLTALELGGNELTGSIPKSLVNLR  499

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYI  18
            +L++L L +N+  G   ET    STL++I
Sbjct  500  LLEVLHLQSNSFIG---ET----STLSFI  521


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  S L++       L G +P EIGNL  L++L+L +N  +G +P  I +L  LQ
Sbjct  541  LPKSIGNLS-LQWFSAIGCNLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQ  599

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L  N + G  P  +  +S+L ++ ++ N
Sbjct  600  QLSLGVNRISGPFPNGLCELSSLFFLKLSQN  630


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP S+     +  L +  N  NGSLP E GNL     L L+ N LSG IP  +G L  +
Sbjct  659  SIPSSLWNLKDILKLNLSSNFFNGSLPLEFGNLKAAILLDLSWNQLSGNIPNTLGTLLKV  718

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L +N +EG+IPET   +  L  ++++ N
Sbjct  719  TQLYLAHNRIEGSIPETFGKLVNLEALDLSYN  750


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P +I    +L+ L +  N+++G  P  +  L+ L  L+L++N + G IP  +G+L  
Sbjct  586  GIVPTTISSLKNLQQLSLGVNRISGPFPNGLCELSSLFFLKLSQNQMWGSIPTCLGDLTS  645

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + LD+NN   +IP +++N+  +  +N+++N
Sbjct  646  LREVYLDSNNFTSSIPSSLWNLKDILKLNLSSN  678


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    +  LY+  N++ GS+P   G L  L  L L+ N++SG IP+ +  L  
Sbjct  706  GNIPNTLGTLLKVTQLYLAHNRIEGSIPETFGKLVNLEALDLSYNNMSGVIPKSLEELKQ  765

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N L G IP
Sbjct  766  LDSFNVSFNRLHGEIP  781


 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 59/119 (50%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLS-----------  138
            GNIP+ I  +  SL+ L    N+LNGS    I N+++L +L L ++ LS           
Sbjct  198  GNIPKGIATDLQSLKLLSFGFNKLNGSNVLSIFNISLLEDLDLEKSGLSGNLPSDLCRRL  257

Query  137  --------------GEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                          G+IPR I   ++LQ+L L  NNL+GTIP  + N+  L  + + NN
Sbjct  258  PRLRKLELNFNKLRGQIPRTISECSLLQVLSLMENNLDGTIPRELGNLKLLQDLTLGNN  316


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P   G   +   L +  NQL+G++P  +G L  +  L L  N + G IP   G L  
Sbjct  682  GSLPLEFGNLKAAILLDLSWNQLSGNIPNTLGTLLKVTQLYLAHNRIEGSIPETFGKLVN  741

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN+ G IP+++  +  L   N++ N
Sbjct  742  LEALDLSYNNMSGVIPKSLEELKQLDSFNVSFN  774


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 3/79 (4%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  I     L  + + DN L G +P   G++ ML+   L  NS SG IP  I  +  
Sbjct  129  GELPSEISHLPRLRAIDLSDNYLTGQIPSFSGDIRMLS---LEINSFSGFIPSSISRIKN  185

Query  101  LQILRLDNNNLEGTIPETI  45
            L+ L+L  NNLEG IP+ I
Sbjct  186  LEFLKLGYNNLEGNIPKGI  204


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   +L  L + DN   G +P  I +L  L  L L  N +SG  P  +  L+ 
Sbjct  562  GHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVNRISGPFPNGLCELSS  621

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L  N + G+IP  + ++++L  + + +N
Sbjct  622  LFFLKLSQNQMWGSIPTCLGDLTSLREVYLDSN  654


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
             NG++P ++GNL+ L +L L+ N   GE+P EI +L  L+ + L +N L G IP    +I
Sbjct  103  FNGTIPPQLGNLSFLVSLDLSHNYFHGELPSEISHLPRLRAIDLSDNYLTGQIPSFSGDI  162

Query  35   STLT  24
              L+
Sbjct  163  RMLS  166


 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 10/96 (10%)
 Frame = -1

Query  263  IGECSSLEY---------LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN  111
            IGE S+L +         L +  N LN  LP+ IGNL+ L        +L G IP EIGN
Sbjct  512  IGETSTLSFITPLINLVDLRLSFNPLNALLPKSIGNLS-LQWFSAIGCNLKGHIPNEIGN  570

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L  L L++N+  G +P TI ++  L  +++  N
Sbjct  571  LINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVN  606



>ref|XP_009775747.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X3 [Nicotiana sylvestris]
Length=905

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SI   SSLEYL + DN+L G LPRE+GNL+ML  L  + N+L+G IP  IGNL  
Sbjct  100  GSIPLSIFNISSLEYLSIGDNKLEGPLPREVGNLSMLQVLDFSMNNLTGVIPHGIGNLQE  159

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN +G+IP  IFNIS+L Y+ +A N
Sbjct  160  LEDLSLSYNNFKGSIPIGIFNISSLIYLQLAGN  192


 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPRSI ECS L+ L + +N   G++P E+GNL +L  L +  N+  G IP EIG+L  
Sbjct  4    GEIPRSISECSELQVLALMENNFLGTIPGELGNLQLLKVLDIGFNNFEGTIPYEIGHLYN  63

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L +D N L G++P  I  +  L Y++M  N
Sbjct  64   LELLAMDYNKLTGSVPYVIGRLYKLEYLSMERN  96


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +LE L M  N+L GS+P  IG L  L  L +  N L+G IP  I N++ 
Sbjct  52   GTIPYEIGHLYNLELLAMDYNKLTGSVPYVIGRLYKLEYLSMERNKLTGSIPLSIFNISS  111

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +N LEG +P  + N+S L  ++ + N
Sbjct  112  LEYLSIGDNKLEGPLPREVGNLSMLQVLDFSMN  144


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G   +   L +  NQ+ G++P  +G+L  L +L L  N + G IP   G L  
Sbjct  439  GSLPLEVGNLKAAILLDLSWNQILGNIPSTLGSLQKLTHLFLAHNRIEGSIPEAFGGLKS  498

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  NNL G IP+++  +  L Y N++ N
Sbjct  499  LEVLDLSYNNLSGVIPKSLEALKYLHYFNVSFN  531


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = -1

Query  263  IGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRL  84
            +  C  L  L +  N LN  LP+ IGNL+ L     T  +L G IP E+GNL  L  L L
Sbjct  277  LANCKYLRKLILSSNPLNAMLPKSIGNLSSLEMFLATGCNLKGHIPNEVGNLRNLSSLEL  336

Query  83   DNNNLEGTIPETIFNISTLTYINMANN  3
            ++N+  G +P TI ++  L  +++  N
Sbjct  337  EDNDFNGIVPMTISSLKNLQRLSLGAN  363


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    L +L++  N++ GS+P   G L  L  L L+ N+LSG IP+ +  L  
Sbjct  463  GNIPSTLGSLQKLTHLFLAHNRIEGSIPEAFGGLKSLEVLDLSYNNLSGVIPKSLEALKY  522

Query  101  LQILRLDNNNLEGTI  57
            L    +  N L G I
Sbjct  523  LHYFNVSFNRLHGEI  537


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN-LN  105
            G IP  IG    LE L +  N   GS+P  I N++ L  LQL  N +S  +P  IG+ L 
Sbjct  148  GVIPHGIGNLQELEDLSLSYNNFKGSIPIGIFNISSLIYLQLAGNHISANLPSTIGHGLP  207

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             ++ + L  NN+ G +P +I N+S L Y+ +  N
Sbjct  208  NVEGIHLSGNNINGVLPSSISNMSKLMYLELYRN  241


 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L+G +PR I   + L  L L EN+  G IP E+GNL +L++L +  NN EGTIP  I ++
Sbjct  2    LSGEIPRSISECSELQVLALMENNFLGTIPGELGNLQLLKVLDIGFNNFEGTIPYEIGHL  61

Query  35   STLTYINMANN  3
              L  + M  N
Sbjct  62   YNLELLAMDYN  72


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  SSLE        L G +P E+GNL  L++L+L +N  +G +P  I +L  LQ
Sbjct  297  LPKSIGNLSSLEMFLATGCNLKGHIPNEVGNLRNLSSLELEDNDFNGIVPMTISSLKNLQ  356

Query  95   ILRLDNNNLEGTIP  54
             L L  N + G  P
Sbjct  357  RLSLGANRISGPFP  370


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE----------  132
            G +P SI   S L YL ++ N+L GS+P  +GNL +L  L L+ NS + E          
Sbjct  221  GVLPSSISNMSKLMYLELYRNELTGSIPESLGNLRLLEVLGLSSNSFNSELSFITPLANC  280

Query  131  ----------------IPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                            +P+ IGNL+ L++      NL+G IP  + N+  L+ + + +N
Sbjct  281  KYLRKLILSSNPLNAMLPKSIGNLSSLEMFLATGCNLKGHIPNEVGNLRNLSSLELEDN  339


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G  S L+ L    N L G +P  IGNL  L +L L+ N+  G IP  I N++ 
Sbjct  124  GPLPREVGNLSMLQVLDFSMNNLTGVIPHGIGNLQELEDLSLSYNNFKGSIPIGIFNISS  183

Query  101  LQILRLDNNNLEGTIPETI  45
            L  L+L  N++   +P TI
Sbjct  184  LIYLQLAGNHISANLPSTI  202


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP ++     +  L +  N  NGSLP E+GNL     L L+ N + G IP  +G+L  L 
Sbjct  417  IPSNLWTLKDILKLNLSSNFFNGSLPLEVGNLKAAILLDLSWNQILGNIPSTLGSLQKLT  476

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +N +EG+IPE    + +L  ++++ N
Sbjct  477  HLFLAHNRIEGSIPEAFGGLKSLEVLDLSYN  507


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
             N+P +IG    ++E +++  N +NG LP  I N++ L  L+L  N L+G IP  +GNL 
Sbjct  196  ANLPSTIGHGLPNVEGIHLSGNNINGVLPSSISNMSKLMYLELYRNELTGSIPESLGNLR  255

Query  104  MLQILRLDNNNL  69
            +L++L L +N+ 
Sbjct  256  LLEVLGLSSNSF  267


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G+ +SL  + +  N     +P  +  L  +  L L+ N  +G +P E+GNL  
Sbjct  391  GSLPSCLGDMTSLREVSLDSNNFIAIIPSNLWTLKDILKLNLSSNFFNGSLPLEVGNLKA  450

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N + G IP T+ ++  LT++ +A+N
Sbjct  451  AILLDLSWNQILGNIPSTLGSLQKLTHLFLAHN  483



>ref|XP_009775745.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana sylvestris]
Length=1087

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SI   SSLEYL + DN+L G LPRE+GNL+ML  L  + N+L+G IP  IGNL  
Sbjct  282  GSIPLSIFNISSLEYLSIGDNKLEGPLPREVGNLSMLQVLDFSMNNLTGVIPHGIGNLQE  341

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN +G+IP  IFNIS+L Y+ +A N
Sbjct  342  LEDLSLSYNNFKGSIPIGIFNISSLIYLQLAGN  374


 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL +L++L+L  N L G IPRSI ECS L+ L + +N   G++P E+GNL +L  L
Sbjct  166  DLCRRLPRLQKLFLSSNMLSGEIPRSISECSELQVLALMENNFLGTIPGELGNLQLLKVL  225

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +  N+  G IP EIG+L  L++L +D N L G++P  I  +  L Y++M  N
Sbjct  226  DIGFNNFEGTIPYEIGHLYNLELLAMDYNKLTGSVPYVIGRLYKLEYLSMERN  278


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +LE L M  N+L GS+P  IG L  L  L +  N L+G IP  I N++ 
Sbjct  234  GTIPYEIGHLYNLELLAMDYNKLTGSVPYVIGRLYKLEYLSMERNKLTGSIPLSIFNISS  293

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +N LEG +P  + N+S L  ++ + N
Sbjct  294  LEYLSIGDNKLEGPLPREVGNLSMLQVLDFSMN  326


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G   +   L +  NQ+ G++P  +G+L  L +L L  N + G IP   G L  
Sbjct  621  GSLPLEVGNLKAAILLDLSWNQILGNIPSTLGSLQKLTHLFLAHNRIEGSIPEAFGGLKS  680

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  NNL G IP+++  +  L Y N++ N
Sbjct  681  LEVLDLSYNNLSGVIPKSLEALKYLHYFNVSFN  713


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREI-GNLTMLNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+   SSL+YL + D  L G LP ++   L  L  L L+ N LSGEIPR I   + LQ+L
Sbjct  142  SVFNISSLDYLGLMDASLTGDLPSDLCRRLPRLQKLFLSSNMLSGEIPRSISECSELQVL  201

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  NN  GTIP  + N+  L  +++  N
Sbjct  202  ALMENNFLGTIPGELGNLQLLKVLDIGFN  230


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = -1

Query  263  IGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRL  84
            +  C  L  L +  N LN  LP+ IGNL+ L     T  +L G IP E+GNL  L  L L
Sbjct  459  LANCKYLRKLILSSNPLNAMLPKSIGNLSSLEMFLATGCNLKGHIPNEVGNLRNLSSLEL  518

Query  83   DNNNLEGTIPETIFNISTLTYINMANN  3
            ++N+  G +P TI ++  L  +++  N
Sbjct  519  EDNDFNGIVPMTISSLKNLQRLSLGAN  545


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    L +L++  N++ GS+P   G L  L  L L+ N+LSG IP+ +  L  
Sbjct  645  GNIPSTLGSLQKLTHLFLAHNRIEGSIPEAFGGLKSLEVLDLSYNNLSGVIPKSLEALKY  704

Query  101  LQILRLDNNNLEGTI  57
            L    +  N L G I
Sbjct  705  LHYFNVSFNRLHGEI  719


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN-LN  105
            G IP  IG    LE L +  N   GS+P  I N++ L  LQL  N +S  +P  IG+ L 
Sbjct  330  GVIPHGIGNLQELEDLSLSYNNFKGSIPIGIFNISSLIYLQLAGNHISANLPSTIGHGLP  389

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             ++ + L  NN+ G +P +I N+S L Y+ +  N
Sbjct  390  NVEGIHLSGNNINGVLPSSISNMSKLMYLELYRN  423


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE----------  132
            G +P SI   S L YL ++ N+L GS+P  +GNL +L  L L+ NS + E          
Sbjct  403  GVLPSSISNMSKLMYLELYRNELTGSIPESLGNLRLLEVLGLSSNSFNSELSFITPLANC  462

Query  131  ----------------IPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                            +P+ IGNL+ L++      NL+G IP  + N+  L+ + + +N
Sbjct  463  KYLRKLILSSNPLNAMLPKSIGNLSSLEMFLATGCNLKGHIPNEVGNLRNLSSLELEDN  521


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  SSLE        L G +P E+GNL  L++L+L +N  +G +P  I +L  LQ
Sbjct  479  LPKSIGNLSSLEMFLATGCNLKGHIPNEVGNLRNLSSLELEDNDFNGIVPMTISSLKNLQ  538

Query  95   ILRLDNNNLEGTIP  54
             L L  N + G  P
Sbjct  539  RLSLGANRISGPFP  552


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G  S L+ L    N L G +P  IGNL  L +L L+ N+  G IP  I N++ 
Sbjct  306  GPLPREVGNLSMLQVLDFSMNNLTGVIPHGIGNLQELEDLSLSYNNFKGSIPIGIFNISS  365

Query  101  LQILRLDNNNLEGTIPETI  45
            L  L+L  N++   +P TI
Sbjct  366  LIYLQLAGNHISANLPSTI  384


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP ++     +  L +  N  NGSLP E+GNL     L L+ N + G IP  +G+L  L 
Sbjct  599  IPSNLWTLKDILKLNLSSNFFNGSLPLEVGNLKAAILLDLSWNQILGNIPSTLGSLQKLT  658

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +N +EG+IPE    + +L  ++++ N
Sbjct  659  HLFLAHNRIEGSIPEAFGGLKSLEVLDLSYN  689


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
             N+P +IG    ++E +++  N +NG LP  I N++ L  L+L  N L+G IP  +GNL 
Sbjct  378  ANLPSTIGHGLPNVEGIHLSGNNINGVLPSSISNMSKLMYLELYRNELTGSIPESLGNLR  437

Query  104  MLQILRLDNNNL  69
            +L++L L +N+ 
Sbjct  438  LLEVLGLSSNSF  449


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G+ +SL  + +  N     +P  +  L  +  L L+ N  +G +P E+GNL  
Sbjct  573  GSLPSCLGDMTSLREVSLDSNNFIAIIPSNLWTLKDILKLNLSSNFFNGSLPLEVGNLKA  632

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N + G IP T+ ++  LT++ +A+N
Sbjct  633  AILLDLSWNQILGNIPSTLGSLQKLTHLFLAHN  665


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
              G++P ++GNL+ L +L L+ N+  GE+P E+  L  L  + + +N L G+   ++FNI
Sbjct  87   FTGTIPPQLGNLSFLISLDLSYNNFHGELPLELSRLRKLIAIDISSNGLNGSNVLSVFNI  146

Query  35   STLTYINMAN  6
            S+L Y+ + +
Sbjct  147  SSLDYLGLMD  156



>ref|XP_009775746.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nicotiana sylvestris]
Length=1053

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SI   SSLEYL + DN+L G LPRE+GNL+ML  L  + N+L+G IP  IGNL  
Sbjct  248  GSIPLSIFNISSLEYLSIGDNKLEGPLPREVGNLSMLQVLDFSMNNLTGVIPHGIGNLQE  307

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN +G+IP  IFNIS+L Y+ +A N
Sbjct  308  LEDLSLSYNNFKGSIPIGIFNISSLIYLQLAGN  340


 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL +L++L+L  N L G IPRSI ECS L+ L + +N   G++P E+GNL +L  L
Sbjct  132  DLCRRLPRLQKLFLSSNMLSGEIPRSISECSELQVLALMENNFLGTIPGELGNLQLLKVL  191

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +  N+  G IP EIG+L  L++L +D N L G++P  I  +  L Y++M  N
Sbjct  192  DIGFNNFEGTIPYEIGHLYNLELLAMDYNKLTGSVPYVIGRLYKLEYLSMERN  244


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +LE L M  N+L GS+P  IG L  L  L +  N L+G IP  I N++ 
Sbjct  200  GTIPYEIGHLYNLELLAMDYNKLTGSVPYVIGRLYKLEYLSMERNKLTGSIPLSIFNISS  259

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +N LEG +P  + N+S L  ++ + N
Sbjct  260  LEYLSIGDNKLEGPLPREVGNLSMLQVLDFSMN  292


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G   +   L +  NQ+ G++P  +G+L  L +L L  N + G IP   G L  
Sbjct  587  GSLPLEVGNLKAAILLDLSWNQILGNIPSTLGSLQKLTHLFLAHNRIEGSIPEAFGGLKS  646

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  NNL G IP+++  +  L Y N++ N
Sbjct  647  LEVLDLSYNNLSGVIPKSLEALKYLHYFNVSFN  679


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREI-GNLTMLNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+   SSL+YL + D  L G LP ++   L  L  L L+ N LSGEIPR I   + LQ+L
Sbjct  108  SVFNISSLDYLGLMDASLTGDLPSDLCRRLPRLQKLFLSSNMLSGEIPRSISECSELQVL  167

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  NN  GTIP  + N+  L  +++  N
Sbjct  168  ALMENNFLGTIPGELGNLQLLKVLDIGFN  196


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = -1

Query  263  IGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRL  84
            +  C  L  L +  N LN  LP+ IGNL+ L     T  +L G IP E+GNL  L  L L
Sbjct  425  LANCKYLRKLILSSNPLNAMLPKSIGNLSSLEMFLATGCNLKGHIPNEVGNLRNLSSLEL  484

Query  83   DNNNLEGTIPETIFNISTLTYINMANN  3
            ++N+  G +P TI ++  L  +++  N
Sbjct  485  EDNDFNGIVPMTISSLKNLQRLSLGAN  511


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    L +L++  N++ GS+P   G L  L  L L+ N+LSG IP+ +  L  
Sbjct  611  GNIPSTLGSLQKLTHLFLAHNRIEGSIPEAFGGLKSLEVLDLSYNNLSGVIPKSLEALKY  670

Query  101  LQILRLDNNNLEGTI  57
            L    +  N L G I
Sbjct  671  LHYFNVSFNRLHGEI  685


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN-LN  105
            G IP  IG    LE L +  N   GS+P  I N++ L  LQL  N +S  +P  IG+ L 
Sbjct  296  GVIPHGIGNLQELEDLSLSYNNFKGSIPIGIFNISSLIYLQLAGNHISANLPSTIGHGLP  355

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             ++ + L  NN+ G +P +I N+S L Y+ +  N
Sbjct  356  NVEGIHLSGNNINGVLPSSISNMSKLMYLELYRN  389


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  SSLE        L G +P E+GNL  L++L+L +N  +G +P  I +L  LQ
Sbjct  445  LPKSIGNLSSLEMFLATGCNLKGHIPNEVGNLRNLSSLELEDNDFNGIVPMTISSLKNLQ  504

Query  95   ILRLDNNNLEGTIP  54
             L L  N + G  P
Sbjct  505  RLSLGANRISGPFP  518


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE----------  132
            G +P SI   S L YL ++ N+L GS+P  +GNL +L  L L+ NS + E          
Sbjct  369  GVLPSSISNMSKLMYLELYRNELTGSIPESLGNLRLLEVLGLSSNSFNSELSFITPLANC  428

Query  131  ----------------IPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                            +P+ IGNL+ L++      NL+G IP  + N+  L+ + + +N
Sbjct  429  KYLRKLILSSNPLNAMLPKSIGNLSSLEMFLATGCNLKGHIPNEVGNLRNLSSLELEDN  487


 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G  S L+ L    N L G +P  IGNL  L +L L+ N+  G IP  I N++ 
Sbjct  272  GPLPREVGNLSMLQVLDFSMNNLTGVIPHGIGNLQELEDLSLSYNNFKGSIPIGIFNISS  331

Query  101  LQILRLDNNNLEGTIPETI  45
            L  L+L  N++   +P TI
Sbjct  332  LIYLQLAGNHISANLPSTI  350


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP ++     +  L +  N  NGSLP E+GNL     L L+ N + G IP  +G+L  L 
Sbjct  565  IPSNLWTLKDILKLNLSSNFFNGSLPLEVGNLKAAILLDLSWNQILGNIPSTLGSLQKLT  624

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +N +EG+IPE    + +L  ++++ N
Sbjct  625  HLFLAHNRIEGSIPEAFGGLKSLEVLDLSYN  655


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
             N+P +IG    ++E +++  N +NG LP  I N++ L  L+L  N L+G IP  +GNL 
Sbjct  344  ANLPSTIGHGLPNVEGIHLSGNNINGVLPSSISNMSKLMYLELYRNELTGSIPESLGNLR  403

Query  104  MLQILRLDNNNL  69
            +L++L L +N+ 
Sbjct  404  LLEVLGLSSNSF  415


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G+ +SL  + +  N     +P  +  L  +  L L+ N  +G +P E+GNL  
Sbjct  539  GSLPSCLGDMTSLREVSLDSNNFIAIIPSNLWTLKDILKLNLSSNFFNGSLPLEVGNLKA  598

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N + G IP T+ ++  LT++ +A+N
Sbjct  599  AILLDLSWNQILGNIPSTLGSLQKLTHLFLAHN  631



>gb|KDO49786.1| hypothetical protein CISIN_1g001710mg [Citrus sinensis]
Length=1022

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+ EC+ L+ L++ DN+ +G LP  IGNL+ L +L L +N+L G++P  IGNL M
Sbjct  185  GQIPSSLSECTHLQTLWLADNKFSGRLPENIGNLSQLTDLNLAQNNLQGDMPTAIGNLQM  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NNL G +P TIFNIST+  IN+  N
Sbjct  245  LEHLNLGMNNLSGPVPPTIFNISTIRLINLIEN  277


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG  S L +L + DN+LNG++P  +G    L  L L +N L G IP  + +L  
Sbjct  411  GSIPQEIGNLSGLMFLKLDDNELNGTIPTTVGRFQQLQGLSLYDNDLQGSIPYYLCHLER  470

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ NNL G IP  + ++++L  +++ +N
Sbjct  471  LSQLLLNGNNLSGAIPACLGSLTSLRELHLGSN  503


 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++G    L+ L ++DN L GS+P  + +L  L+ L L  N+LSG IP  +G+L  
Sbjct  435  GTIPTTVGRFQQLQGLSLYDNDLQGSIPYYLCHLERLSQLLLNGNNLSGAIPACLGSLTS  494

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L  +IP +++++  + Y+N+++N
Sbjct  495  LRELHLGSNTLTYSIPSSLWSLEYILYVNLSSN  527


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  I     LE LY+  N   G +P  +   T L  L L +N  SG +P  IGNL+ 
Sbjct  162  GSLPNDI-RLPKLEKLYLGSNDFFGQIPSSLSECTHLQTLWLADNKFSGRLPENIGNLSQ  220

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL+G +P  I N+  L ++N+  N
Sbjct  221  LTDLNLAQNNLQGDMPTAIGNLQMLEHLNLGMN  253


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L + +N   G LP E+G L  L  +    N LSG  P  IG L+ 
Sbjct  66   GIIPPHLGNLSFLVSLDISENNFYGHLPNELGKLRRLRLINFAYNELSGSFPSWIGILSR  125

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQIL   NN+    IP+ + N+S L ++++  N
Sbjct  126  LQILSFHNNSFTDRIPDFLLNLSKLEFLDLMEN  158


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P  IG  S SL        +L GS+P+EIGNL+ L  L+L +N L+G IP  +G   
Sbjct  386  GILPPFIGNFSASLRKFEAIKCELKGSIPQEIGNLSGLMFLKLDDNELNGTIPTTVGRFQ  445

Query  104  MLQILRLDNNNLEGTIPETIFNISTLT  24
             LQ L L +N+L+G+IP  + ++  L+
Sbjct  446  QLQGLSLYDNDLQGSIPYYLCHLERLS  472


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP S+     + Y+ +  N L+G LP  I +L +L NL L+ N LSG+IP  I  L  L
Sbjct  508  SIPSSLWSLEYILYVNLSSNSLSGPLPSSIQHLKVLINLDLSRNQLSGDIPITISGLKDL  567

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L  N   G IPE+  ++ +L  +++++N
Sbjct  568  ATLSLAGNQFNGPIPESFGSLISLESLDVSSN  599


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P +IG  S L  L +  N L G +P  IGNL ML +L L  N+LSG +P  I N++ 
Sbjct  209  GRLPENIGNLSQLTDLNLAQNNLQGDMPTAIGNLQMLEHLNLGMNNLSGPVPPTIFNIST  268

Query  101  LQILRLDNNNLEGTIPETI  45
            ++++ L  N L G +P T+
Sbjct  269  IRLINLIENQLSGHLPLTL  287


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  +SL  L++  N L  S+P  + +L  +  + L+ NSLSG +P  I +L +
Sbjct  483  GAIPACLGSLTSLRELHLGSNTLTYSIPSSLWSLEYILYVNLSSNSLSGPLPSSIQHLKV  542

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP TI  +  L  +++A N
Sbjct  543  LINLDLSRNQLSGDIPITISGLKDLATLSLAGN  575


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +I     L  L +  NQ NG +P   G+L  L +L ++ N++SG+IP+ +  L  
Sbjct  555  GDIPITISGLKDLATLSLAGNQFNGPIPESFGSLISLESLDVSSNNISGKIPKSLEALLY  614

Query  101  LQILRLDNNNLEGTIP  54
            L+ L +  N LEG IP
Sbjct  615  LKKLNVSYNRLEGEIP  630


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 51/116 (44%), Gaps = 23/116 (20%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLS------------  138
            G+ P  IG  S L+ L   +N     +P  + NL+ L  L L ENSLS            
Sbjct  114  GSFPSWIGILSRLQILSFHNNSFTDRIPDFLLNLSKLEFLDLMENSLSGSLPNDIRLPKL  173

Query  137  -----------GEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                       G+IP  +     LQ L L +N   G +PE I N+S LT +N+A N
Sbjct  174  EKLYLGSNDFFGQIPSSLSECTHLQTLWLADNKFSGRLPENIGNLSQLTDLNLAQN  229


 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P SI     L  L +  NQL+G +P  I  L  L  L L  N  +G IP   G+L  
Sbjct  531  GPLPSSIQHLKVLINLDLSRNQLSGDIPITISGLKDLATLSLAGNQFNGPIPESFGSLIS  590

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +NN+ G IP+++  +  L  +N++ N
Sbjct  591  LESLDVSSNNISGKIPKSLEALLYLKKLNVSYN  623


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G +P  +GNL+ L +L ++EN+  G +P E+G L  L+++    N L G+ P  I  +
Sbjct  64   LGGIIPPHLGNLSFLVSLDISENNFYGHLPNELGKLRRLRLINFAYNELSGSFPSWIGIL  123

Query  35   STLTYINMANN  3
            S L  ++  NN
Sbjct  124  SRLQILSFHNN  134



>gb|KDO42039.1| hypothetical protein CISIN_1g001988mg [Citrus sinensis]
Length=985

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+ +C  L+ L++  N L+G++P+EIGNLT+L  + L  N L GEIP+EIG L  
Sbjct  184  GKIPSSLSKCKQLQELHLGYNNLSGAIPKEIGNLTVLQRISLINNKLHGEIPQEIGYLQN  243

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L+L  NNL G +P TIFN+STL  I + NN
Sbjct  244  LDVLQLGFNNLTGVVPATIFNMSTLKEIFLYNN  276


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP++IG  S+L  L +  N L+GS+P   G L  L  L L  N L+G IP EI  L+ 
Sbjct  407  GNIPKAIGNLSNLIVLSLGGNNLSGSIPVTFGGLQKLQGLDLAFNKLAGSIPDEICLLSR  466

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N + G+I   + N+++L Y+N+ +N
Sbjct  467  LNELDLNGNKISGSISSCLGNLTSLQYLNLGSN  499


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ + + +N+L+G +P+EIG L  L+ LQL  N+L+G +P  I N++ 
Sbjct  208  GAIPKEIGNLTVLQRISLINNKLHGEIPQEIGYLQNLDVLQLGFNNLTGVVPATIFNMST  267

Query  101  LQILRLDNNNLEGTIPETI-FNISTLTYINMANN  3
            L+ + L NN+L G++P  I   +  L ++N+  N
Sbjct  268  LKEIFLYNNSLSGSLPSRIDLALPNLEFLNLGIN  301


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP + G    L+ L +  N+L GS+P EI  L+ LN L L  N +SG I   +GNL  
Sbjct  431  GSIPVTFGGLQKLQGLDLAFNKLAGSIPDEICLLSRLNELDLNGNKISGSISSCLGNLTS  490

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +N     IP T +N+  +   ++++N
Sbjct  491  LQYLNLGSNRFTFVIPSTFWNLKDILSFDISSN  523


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  S SLE L +    ++G++P+ IGNL+ L  L L  N+LSG IP   G L 
Sbjct  382  GFLPSSIGNLSLSLERLNIAFCNISGNIPKAIGNLSNLIVLSLGGNNLSGSIPVTFGGLQ  441

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L  N L G+IP+ I  +S L  +++  N
Sbjct  442  KLQGLDLAFNKLAGSIPDEICLLSRLNELDLNGN  475


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++    SL+ + +  N+L G +P   GN+T L +L L+ N +SG IP     L+ 
Sbjct  551  GNIPTTLEGLKSLQNISLAYNRLEGPIPESFGNMTSLESLDLSNNKISGSIPVSFEKLSY  610

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  N L+G IP 
Sbjct  611  LKELNLSFNKLKGEIPR  627


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I  +IG   ++  + +  N L+G++P  +  L  L N+ L  N L G IP   GN+  
Sbjct  527  GPISLAIGNLKAVVGIDLSRNNLSGNIPTTLEGLKSLQNISLAYNRLEGPIPESFGNMTS  586

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN + G+IP +   +S L  +N++ N
Sbjct  587  LESLDLSNNKISGSIPVSFEKLSYLKELNLSFN  619


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP +      +    +  N L+G +   IGNL  +  + L+ N+LSG IP  +  L  LQ
Sbjct  505  IPSTFWNLKDILSFDISSNLLDGPISLAIGNLKAVVGIDLSRNNLSGNIPTTLEGLKSLQ  564

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             + L  N LEG IPE+  N+++L  ++++NN
Sbjct  565  NISLAYNRLEGPIPESFGNMTSLESLDLSNN  595


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 6/99 (6%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P  I     +LE+L +  N  +G++P  I N + L  L++  NS SG IP  IGNL 
Sbjct  280  GSLPSRIDLALPNLEFLNLGINSFSGTIPSSITNASKLILLEMGSNSFSGFIPSAIGNLR  339

Query  104  MLQILRLDNNNLEGTIPETIF-----NISTLTYINMANN  3
             L++  +  NNL  + PE  F     N   L Y+ +  N
Sbjct  340  NLKLFDIFFNNLTSSTPELGFLSSLANCKKLRYLGLGGN  378



>ref|XP_004231674.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=1088

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++ +CS+L+ L +  N+  G +PRE+GNLTML  L L EN L GE+P EIGNL+ 
Sbjct  259  GRIPPNLQKCSNLQLLTLSGNEFTGPIPRELGNLTMLTILHLGENHLEGELPAEIGNLHN  318

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L NN L G+IP  IFNIS L  + M  N
Sbjct  319  LQVLGLRNNKLNGSIPAEIFNISALQILTMYGN  351


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +    +L++LY+ +NQ +G +P  + NLT L  L++  N L G+IP EIGNL  
Sbjct  138  GAIPSFLSSLPNLQFLYLSNNQYSGEIPSSLSNLTNLQELRIQRNFLQGKIPPEIGNLRY  197

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP +IFN+++LT + + +N
Sbjct  198  LTFLDLQGNRLTGSIPPSIFNMTSLTRLAIIHN  230


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G  S+L YL++  N+L  +LP  + +L  L  L  + N LSG IP E+GNL  
Sbjct  556  GSIPACLGNVSTLRYLHLAYNRLTSTLPETLWSLQDLLELNASANLLSGSIPPEVGNLKA  615

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              ++ L  N+  G IP TI  +  L  ++MA+N
Sbjct  616  ASVIDLSRNDFSGNIPSTIGGLQKLISLSMAHN  648


 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  S L  L +  N   GS+P ++ ++  L    L  NSLSG IP +I +L  
Sbjct  484  GTIPEEIGNLSGLGVLALSHNDFTGSIPDKLRSMKNLQEFYLENNSLSGTIPDDICSLRN  543

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L  N + G+IP  + N+STL Y+++A N
Sbjct  544  LGALKLTGNRISGSIPACLGNVSTLRYLHLAYN  576


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + L  L++ +N L G LP EIGNL  L  L L  N L+G IP EI N++ 
Sbjct  283  GPIPRELGNLTMLTILHLGENHLEGELPAEIGNLHNLQVLGLRNNKLNGSIPAEIFNISA  342

Query  101  LQILRLDNNNLEGTIP  54
            LQIL +  N L G++P
Sbjct  343  LQILTMYGNQLCGSLP  358


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +    +L+  Y+ +N L+G++P +I +L  L  L+LT N +SG IP  +GN++ 
Sbjct  508  GSIPDKLRSMKNLQEFYLENNSLSGTIPDDICSLRNLGALKLTGNRISGSIPACLGNVST  567

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L  T+PET++++  L  +N + N
Sbjct  568  LRYLHLAYNRLTSTLPETLWSLQDLLELNASAN  600


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  S S         +L G++P EIGNL+ L  L L+ N  +G IP ++ ++ 
Sbjct  459  GFLPSSIGNFSDSFRMFVARRTKLKGTIPEEIGNLSGLGVLALSHNDFTGSIPDKLRSMK  518

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ   L+NN+L GTIP+ I ++  L  + +  N
Sbjct  519  NLQEFYLENNSLSGTIPDDICSLRNLGALKLTGN  552


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-GNLN  105
            G IP  IG    L +L +  N+L GS+P  I N+T L  L +  N L G++P +I  NL 
Sbjct  186  GKIPPEIGNLRYLTFLDLQGNRLTGSIPPSIFNMTSLTRLAIIHNRLVGKLPVDICDNLP  245

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ+L L +NNL+G IP  +   S L  + ++ N
Sbjct  246  NLQVLLLSSNNLDGRIPPNLQKCSNLQLLTLSGN  279


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P  I +   +L+ L +  N L+G +P  +   + L  L L+ N  +G IPRE+GNL 
Sbjct  234  GKLPVDICDNLPNLQVLLLSSNNLDGRIPPNLQKCSNLQLLTLSGNEFTGPIPRELGNLT  293

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ML IL L  N+LEG +P  I N+  L  + + NN
Sbjct  294  MLTILHLGENHLEGELPAEIGNLHNLQVLGLRNN  327


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G   +   + +  N  +G++P  IG L  L +L +  N L G IP   G +  
Sbjct  604  GSIPPEVGNLKAASVIDLSRNDFSGNIPSTIGGLQKLISLSMAHNKLEGPIPSSFGKMVG  663

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L    NNL   IP+++  +S L Y N++ N
Sbjct  664  LEFLDFSYNNLTSEIPKSLEALSHLNYFNISFN  696


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLT-MLNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+  C  L  + + DN LNG LP  IGN +            L G IP EIGNL+ L +L
Sbjct  440  SLTNCRYLREVVIEDNSLNGFLPSSIGNFSDSFRMFVARRTKLKGTIPEEIGNLSGLGVL  499

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +N+  G+IP+ + ++  L    + NN
Sbjct  500  ALSHNDFTGSIPDKLRSMKNLQEFYLENN  528


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++ + +     L+ + +  N  +G++P  + +L  L  L L+ N  SGEIP  + NL  
Sbjct  114  GHLSQELTHLRRLKLIDVTRNNFSGAIPSFLSSLPNLQFLYLSNNQYSGEIPSSLSNLTN  173

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ LR+  N L+G IP  I N+  LT++++  N
Sbjct  174  LQELRIQRNFLQGKIPPEIGNLRYLTFLDLQGN  206


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G +P  IG   +L+ L + +N+LNGS+P EI N++ L  L +  N L G +P ++G    
Sbjct  307  GELPAEIGNLHNLQVLGLRNNKLNGSIPAEIFNISALQILTMYGNQLCGSLPLDLGVGTP  366

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ + L  N L G I  TI N S LT + + +N
Sbjct  367  NLEEVYLGLNELSGRIAPTISNSSKLTLLGLTDN  400


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLN  105
            G+IP  I   S+L+ L M+ NQL GSLP ++G  T  L  + L  N LSG I   I N +
Sbjct  331  GSIPAEIFNISALQILTMYGNQLCGSLPLDLGVGTPNLEEVYLGLNELSGRIAPTISNSS  390

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +L L +N   G IP+++ ++  L  + +  N
Sbjct  391  KLTLLGLTDNKFTGPIPDSLGSLEFLQVLFLGGN  424


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -1

Query  218  QLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFN  39
            QL+G++P  +GNL+ L +L ++ N+  G + +E+ +L  L+++ +  NN  G IP  + +
Sbjct  87   QLHGTIPPHLGNLSFLVSLDISNNTFHGHLSQELTHLRRLKLIDVTRNNFSGAIPSFLSS  146

Query  38   ISTLTYINMANN  3
            +  L ++ ++NN
Sbjct  147  LPNLQFLYLSNN  158



>ref|XP_006449526.1| hypothetical protein CICLE_v10017696mg [Citrus clementina]
 gb|ESR62766.1| hypothetical protein CICLE_v10017696mg [Citrus clementina]
Length=413

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++ EC  L  L +  N   GS+PREIGN+TML  L L   +L+GEIP EIGNL  
Sbjct  257  GQIPSTLFECKQLNILSLSVNNFIGSIPREIGNITMLKGLYLVYTNLTGEIPGEIGNLQG  316

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L +N L G IP  IFNIS+LT +++  N
Sbjct  317  LQVLALSSNRLTGVIPPEIFNISSLTVLSLTAN  349


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR IG  + L+ LY+    L G +P EIGNL  L  L L+ N L+G IP EI N++ 
Sbjct  281  GSIPREIGNITMLKGLYLVYTNLTGEIPGEIGNLQGLQVLALSSNRLTGVIPPEIFNISS  340

Query  101  LQILRLDNNNLEGTIPETI  45
            L +L L  N L G +P  I
Sbjct  341  LTVLSLTANKLLGNLPSNI  359



>ref|XP_007213080.1| hypothetical protein PRUPE_ppa021211mg [Prunus persica]
 gb|EMJ14279.1| hypothetical protein PRUPE_ppa021211mg [Prunus persica]
Length=1294

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 72/117 (62%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNL------------------------TM  174
            G+IPRS+G+ +SL YLY++ NQ++GS+P+EIGNL                        T 
Sbjct  190  GSIPRSLGDLTSLTYLYLFGNQVSGSIPKEIGNLKYLVQLRLGNNQLNGSIPRSLAELTS  249

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N LSG IP+EIGNL  L  LRL NN L G+IP ++  +++LTY+++ +N
Sbjct  250  LTHLSLRHNQLSGSIPKEIGNLKYLVELRLGNNQLNGSIPRSLAELTSLTYLSLHHN  306


 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG    L  L + +NQLNGS+PR +  LT L +L L  N LSG IP+EIGNL  
Sbjct  406  GSIPKEIGNLKYLVLLRLGNNQLNGSIPRSLAKLTSLTHLSLRHNQLSGSIPKEIGNLKY  465

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL +N L G+IP ++ ++++LTY++   N
Sbjct  466  LVYLRLGSNQLSGSIPRSLADLTSLTYVSFDQN  498


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  LY+  NQL GS+PR +G+LT L  L L  N +SG IP+EIGNL  
Sbjct  166  GDIPHKIGNLKSLVELYLSKNQLKGSIPRSLGDLTSLTYLYLFGNQVSGSIPKEIGNLKY  225

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL NN L G+IP ++  +++LT++++ +N
Sbjct  226  LVQLRLGNNQLNGSIPRSLAELTSLTHLSLRHN  258


 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG    L  L + +NQLNGS+PR +  LT L  L L  N LSG IP+EIGNL  
Sbjct  358  GSIPKEIGNLKYLVELRLGNNQLNGSIPRSLAELTSLTYLSLRHNQLSGSIPKEIGNLKY  417

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +LRL NN L G+IP ++  +++LT++++ +N
Sbjct  418  LVLLRLGNNQLNGSIPRSLAKLTSLTHLSLRHN  450


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 68/117 (58%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQL------------------  156
            G+IPRS+ E +SL YL +  NQL+GS+P+EIGNL  L  L+L                  
Sbjct  286  GSIPRSLAELTSLTYLSLHHNQLSGSIPKEIGNLKYLVELRLGNNQLNGSIPRSLAEPKS  345

Query  155  ------TENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                    N LSG IP+EIGNL  L  LRL NN L G+IP ++  +++LTY+++ +N
Sbjct  346  LTHFFLHHNQLSGSIPKEIGNLKYLVELRLGNNQLNGSIPRSLAELTSLTYLSLRHN  402


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+ + +SL +L +  NQL+GS+P+EIGNL  L  L+L  N LSG IPR + +L  
Sbjct  430  GSIPRSLAKLTSLTHLSLRHNQLSGSIPKEIGNLKYLVYLRLGSNQLSGSIPRSLADLTS  489

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  +  D N L G+IP+ I N+  L ++ + NN
Sbjct  490  LTYVSFDQNQLSGSIPKEIGNLKFLVHLRLGNN  522


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG    L YL +  NQL+GS+PR + +LT L  +   +N LSG IP+EIGNL  
Sbjct  454  GSIPKEIGNLKYLVYLRLGSNQLSGSIPRSLADLTSLTYVSFDQNQLSGSIPKEIGNLKF  513

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L  LRL NN L G+IP ++ ++++LT++
Sbjct  514  LVHLRLGNNTLNGSIPRSLADLTSLTHL  541


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+ E +SL +L +  NQL+GS+P+EIGNL  L  L+L  N L+G IPR +  L  
Sbjct  238  GSIPRSLAELTSLTHLSLRHNQLSGSIPKEIGNLKYLVELRLGNNQLNGSIPRSLAELTS  297

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G+IP+ I N+  L  + + NN
Sbjct  298  LTYLSLHHNQLSGSIPKEIGNLKYLVELRLGNN  330


 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG    L  L + +NQLNGS+PR +  LT L  L L  N LSG IP+EIGNL  
Sbjct  262  GSIPKEIGNLKYLVELRLGNNQLNGSIPRSLAELTSLTYLSLHHNQLSGSIPKEIGNLKY  321

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL NN L G+IP ++    +LT+  + +N
Sbjct  322  LVELRLGNNQLNGSIPRSLAEPKSLTHFFLHHN  354


 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+ + +SL Y+    NQL+GS+P+EIGNL  L +L+L  N+L+G IPR + +L  
Sbjct  478  GSIPRSLADLTSLTYVSFDQNQLSGSIPKEIGNLKFLVHLRLGNNTLNGSIPRSLADLTS  537

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP+ I N+ +L  + + +N
Sbjct  538  LTHLFLHLNQLSGSIPKEIGNLKSLAQLFLGDN  570


 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+ + +SL +L++  NQL+GS+P+EIGNL  L  L L +N L+  IP   G L+ 
Sbjct  526  GSIPRSLADLTSLTHLFLHLNQLSGSIPKEIGNLKSLAQLFLGDNQLNCSIPVSFGKLSN  585

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L+IL L NN+L G IP+ I N+  L+ +
Sbjct  586  LEILYLRNNSLSGPIPQEIENLKKLSVL  613


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG   SL  L++ DNQLN S+P   G L+ L  L L  NSLSG IP+EI NL  
Sbjct  550  GSIPKEIGNLKSLAQLFLGDNQLNCSIPVSFGKLSNLEILYLRNNSLSGPIPQEIENLKK  609

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L LD N   G +P+ I     L     +NN
Sbjct  610  LSVLVLDVNQFSGYLPQNICQGGKLENFTASNN  642


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG    L +L + +N LNGS+PR + +LT L +L L  N LSG IP+EIGNL  
Sbjct  502  GSIPKEIGNLKFLVHLRLGNNTLNGSIPRSLADLTSLTHLFLHLNQLSGSIPKEIGNLKS  561

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L  +IP +   +S L  + + NN
Sbjct  562  LAQLFLGDNQLNCSIPVSFGKLSNLEILYLRNN  594


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP  I   S L YL +  NQ +G +P EIG L  L  L L+ N+  G+IP +IGNL  L 
Sbjct  120  IPPQISYLSKLNYLDLSQNQFSGRIPPEIGLLRNLTFLSLSRNTFVGDIPHKIGNLKSLV  179

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L  N L+G+IP ++ ++++LTY+ +  N
Sbjct  180  ELYLSKNQLKGSIPRSLGDLTSLTYLYLFGN  210


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I R+ G+C  L  L M  N + GS+P EIGN T ++ L L+ N L G IP+E G L  
Sbjct  694  GEISRNWGQCPRLTTLQMAGNNITGSIPLEIGNATQIHVLDLSSNHLVGVIPKEFGRLAS  753

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N L G IP    +++ L +++++ N
Sbjct  754  LVKLMLNGNQLSGRIPSEFGSMTDLGHLDLSTN  786


 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +L +L +  N   G +P +IGNL  L  L L++N L G IPR +G+L  
Sbjct  142  GRIPPEIGLLRNLTFLSLSRNTFVGDIPHKIGNLKSLVELYLSKNQLKGSIPRSLGDLTS  201

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N + G+IP+ I N+  L  + + NN
Sbjct  202  LTYLYLFGNQVSGSIPKEIGNLKYLVQLRLGNN  234


 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  +G+   L +L + +N+L+  +P  +GNL  L +L  + NSL G IP E+ N+  L
Sbjct  791  SIPSILGDLLKLYHLNLSNNKLSQPIPLHLGNLVQLTDLDFSHNSLEGRIPSEMSNMQSL  850

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +L L +NNL G+IP T   +  L+ ++++ N
Sbjct  851  VMLNLSHNNLSGSIPSTFEEMRGLSNVDISYN  882


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  + L +L +  N+ N S+P  +G+L  L +L L+ N LS  IP  +GNL  
Sbjct  766  GRIPSEFGSMTDLGHLDLSTNKFNESIPSILGDLLKLYHLNLSNNKLSQPIPLHLGNLVQ  825

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L   +N+LEG IP  + N+ +L  +N+++N
Sbjct  826  LTDLDFSHNSLEGRIPSEMSNMQSLVMLNLSHN  858


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  + +  L +  N L G +P+E G L  L  L L  N LSG IP E G++  
Sbjct  718  GSIPLEIGNATQIHVLDLSSNHLVGVIPKEFGRLASLVKLMLNGNQLSGRIPSEFGSMTD  777

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N    +IP  + ++  L ++N++NN
Sbjct  778  LGHLDLSTNKFNESIPSILGDLLKLYHLNLSNN  810


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+  G  +SL  L +  NQL+G +P E G++T L +L L+ N  +  IP  +G+L  
Sbjct  742  GVIPKEFGRLASLVKLMLNGNQLSGRIPSEFGSMTDLGHLDLSTNKFNESIPSILGDLLK  801

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L   IP  + N+  LT ++ ++N
Sbjct  802  LYHLNLSNNKLSQPIPLHLGNLVQLTDLDFSHN  834


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP S G+ S+LE LY+ +N L+G +P+EI NL  L+ L L  N  SG +P+ I     L
Sbjct  575  SIPVSFGKLSNLEILYLRNNSLSGPIPQEIENLKKLSVLVLDVNQFSGYLPQNICQGGKL  634

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +     NN   G IP+++    +L  + +  N
Sbjct  635  ENFTASNNLFTGPIPKSLKTCMSLARLRLQRN  666


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+  C SL  L +  NQL  ++  + G    LN + ++ N++ GEI R  G    
Sbjct  646  GPIPKSLKTCMSLARLRLQRNQLTSNISEDFGVYPNLNFIDVSYNNMYGEISRNWGQCPR  705

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L++  NN+ G+IP  I N + +  +++++N
Sbjct  706  LTTLQMAGNNITGSIPLEIGNATQIHVLDLSSN  738



>gb|KDP42121.1| hypothetical protein JCGZ_01909 [Jatropha curcas]
Length=830

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G C+SL+ + +  N L G++PREIGN+T+L  + +  N+L+G IP+EIGNL  
Sbjct  185  GSIPGDVGNCTSLKQILINRNFLTGTIPREIGNITLLQIISMDRNNLTGTIPQEIGNLQN  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQI+ L  N L+G+IP +IFNIST+ +I + +N
Sbjct  245  LQIVHLSFNKLKGSIPSSIFNISTMNWIALTSN  277


 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +LE L +  N LNGS+P ++GN T L  + +  N L+G IPREIGN+ +
Sbjct  161  GEIPEEIGNLFNLEILALQVNSLNGSIPGDVGNCTSLKQILINRNFLTGTIPREIGNITL  220

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQI+ +D NNL GTIP+ I N+  L  ++++ N
Sbjct  221  LQIISMDRNNLTGTIPQEIGNLQNLQIVHLSFN  253


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ +G   +L Y+ + +N   G +P E+  L +L ++ L  NSL+GEIP EIGNL  
Sbjct  113  GPLPKELGNLRNLRYINLSNNSFYGDIPSELTMLPLLQDMILANNSLTGEIPEEIGNLFN  172

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L+IL L  N+L G+IP  + N ++L  I
Sbjct  173  LEILALQVNSLNGSIPGDVGNCTSLKQI  200


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N L+G LP+E+GNL  L  + L+ NS  G+IP E+  L +
Sbjct  89   GTIPSQVGNLSCLVRLDLSYNSLHGPLPKELGNLRNLRYINLSNNSFYGDIPSELTMLPL  148

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ + L NN+L G IPE I N+  L  + +  N
Sbjct  149  LQDMILANNSLTGEIPEEIGNLFNLEILALQVN  181


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG  + L+ + M  N L G++P+EIGNL  L  + L+ N L G IP  I N++ 
Sbjct  209  GTIPREIGNITLLQIISMDRNNLTGTIPQEIGNLQNLQIVHLSFNKLKGSIPSSIFNIST  268

Query  101  LQILRLDNNNLEGTIPETI  45
            +  + L +NNL G +P T+
Sbjct  269  MNWIALTSNNLSGNLPSTL  287


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTI  57
            L ++   LNG++P ++GNL+ L  L L+ NSL G +P+E+GNL  L+ + L NN+  G I
Sbjct  80   LDLYSMHLNGTIPSQVGNLSCLVRLDLSYNSLHGPLPKELGNLRNLRYINLSNNSFYGDI  139

Query  56   PETIFNISTLTYINMANN  3
            P  +  +  L  + +ANN
Sbjct  140  PSELTMLPLLQDMILANN  157


 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G IP+ IG   +L+ +++  N+L GS+P  I N++ +N + LT N+LSG +P  +G +L 
Sbjct  233  GTIPQEIGNLQNLQIVHLSFNKLKGSIPSSIFNISTMNWIALTSNNLSGNLPSTLGLSLP  292

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +  L L  N L G IP +I N S L  + +A N
Sbjct  293  NIIWLYLSINELTGPIPPSICNASKLEILELAQN  326


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 8/101 (8%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GN+P ++G    ++ +LY+  N+L G +P  I N + L  L+L +NS  G IP   G L 
Sbjct  281  GNLPSTLGLSLPNIIWLYLSINELTGPIPPSICNASKLEILELAQNSFFGSIPECFGTLK  340

Query  104  MLQILRLDNNNLEGTIP-------ETIFNISTLTYINMANN  3
             L+ L+L +N L    P        ++ N   L Y+  A+N
Sbjct  341  YLETLKLAHNLLATKNPFGELSFLSSLTNCQNLVYLWFAHN  381



>ref|XP_009760562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
Length=1153

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +I + SSL  LYM +N+L G LPRE+GNLT+L+ L L  N L+G IP EIG+L  
Sbjct  329  GSIPLTIFDISSLGLLYMRNNKLEGPLPREVGNLTLLSVLDLGNNKLTGAIPDEIGSLQQ  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L+LD NN  G+IP  IFN+S+L  I++A N
Sbjct  389  MTQLQLDLNNFSGSIPVGIFNMSSLVRISLAQN  421


 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL +L+ L L  N L G IPR+I ECS L++L++ +N   G++P E+GNL +L  L
Sbjct  238  DLCRRLPRLQILDLESNMLSGQIPRTISECSELQFLWLSENDFVGTIPGEVGNLQLLKGL  297

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N+L G IP EIG+LN L  L + NN L G+IP TIF+IS+L  + M NN
Sbjct  298  DLGHNTLEGRIPDEIGHLN-LDYLVVQNNKLTGSIPLTIFDISSLGLLYMRNN  349


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP S+G+   +  L +  N  NGSLP E GNL    ++ L+ N +SG IP  +G L  L 
Sbjct  646  IPSSLGKLKDILKLNLSSNFFNGSLPLEFGNLKSAIHVDLSWNQISGNIPSTLGGLQKLT  705

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +N ++G+IPET   +  L  ++++ N
Sbjct  706  QLSLAHNRIKGSIPETFGKLINLEALDLSYN  736


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLN  105
            G+IP  I   SSL  + +  N ++G++P  IG+    +  + L +N+++G +P  I NL+
Sbjct  401  GSIPVGIFNMSSLVRISLAQNHISGNIPSTIGHWPPNIEQIHLLDNNINGVLPSSISNLS  460

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ML +L+L  N LEG+IP ++ N++ L  +++  N
Sbjct  461  MLTVLKLGGNKLEGSIPNSLGNLTILGVVDLYGN  494


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-GNLN  105
            GNIP  I    SL+ L +  N+LNGS    I N++ L NL L  ++L+G++P ++   L 
Sbjct  185  GNIPAGIATLQSLKLLSLGFNKLNGSNVLSILNISSLENLDLGGSALTGDLPSDLCRRLP  244

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQIL L++N L G IP TI   S L ++ ++ N
Sbjct  245  RLQILDLESNMLSGQIPRTISECSELQFLWLSEN  278


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G+ +SL  +Y+  N  +  +P  +G L  +  L L+ N  +G +P E GNL  
Sbjct  620  GSIPSCLGDVTSLREVYLDSNNFSAIIPSSLGKLKDILKLNLSSNFFNGSLPLEFGNLKS  679

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               + L  N + G IP T+  +  LT +++A+N
Sbjct  680  AIHVDLSWNQISGNIPSTLGGLQKLTQLSLAHN  712


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSIGECSS-LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GNIP +IG     +E +++ DN +NG LP  I NL+ML  L+L  N L G IP  +GNL 
Sbjct  425  GNIPSTIGHWPPNIEQIHLLDNNINGVLPSSISNLSMLTVLKLGGNKLEGSIPNSLGNLT  484

Query  104  MLQILRLDNNNL  69
            +L ++ L  N+ 
Sbjct  485  ILGVVDLYGNSF  496


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  SSL+        L G +P EIGNL  L++L+L +N  +G +PR I +L  LQ
Sbjct  526  LPKSIGNISSLQTFSADGCNLRGHIPVEIGNLRDLSSLKLEDNEFTGIVPRTISSLKSLQ  585

Query  95   ILRLDNNNLEGTIPETI  45
               L  N + G  P+ +
Sbjct  586  QFSLGANRITGPFPKEL  602


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N   G LP E  +L  L  + L+ N   G+IP  +G+   
Sbjct  89   GTIPPQLGNLSFLVSLDLSVNNFYGELPLEFSHLRKLRAINLSFNRFFGQIPPFLGDFKD  148

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L ++ N+ +G IP +I N+  L  +NM  N
Sbjct  149  LRMLSVETNDFKGFIPSSISNMKNLEILNMRFN  181


 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            L  L +  N LN  LP+ IGN++ L        +L G IP EIGNL  L  L+L++N   
Sbjct  512  LRELILSFNPLNAMLPKSIGNISSLQTFSADGCNLRGHIPVEIGNLRDLSSLKLEDNEFT  571

Query  65   GTIPETIFNISTLTYINMANN  3
            G +P TI ++ +L   ++  N
Sbjct  572  GIVPRTISSLKSLQQFSLGAN  592


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE----------  132
            G +P SI   S L  L +  N+L GS+P  +GNLT+L  + L  NS + +          
Sbjct  450  GVLPSSISNLSMLTVLKLGGNKLEGSIPNSLGNLTILGVVDLYGNSFTSDLSFITPLANS  509

Query  131  ----------------IPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                            +P+ IGN++ LQ    D  NL G IP  I N+  L+ + + +N
Sbjct  510  KFLRELILSFNPLNAMLPKSIGNISSLQTFSADGCNLRGHIPVEIGNLRDLSSLKLEDN  568


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG    L  L + DN+  G +PR I +L  L    L  N ++G  P+E+  L+ 
Sbjct  548  GHIPVEIGNLRDLSSLKLEDNEFTGIVPRTISSLKSLQQFSLGANRITGPFPKELCELSN  607

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N ++G+IP  + ++++L  + + +N
Sbjct  608  LGLLNLSQNQMQGSIPSCLGDVTSLREVYLDSN  640


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR+I    SL+   +  N++ G  P+E+  L+ L  L L++N + G IP  +G++  
Sbjct  572  GIVPRTISSLKSLQQFSLGANRITGPFPKELCELSNLGLLNLSQNQMQGSIPSCLGDVTS  631

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + LD+NN    IP ++  +  +  +N+++N
Sbjct  632  LREVYLDSNNFSAIIPSSLGKLKDILKLNLSSN  664


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (51%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    L  L +  N++ GS+P   G L  L  L L+ N++SG IP  +  L  
Sbjct  692  GNIPSTLGGLQKLTQLSLAHNRIKGSIPETFGKLINLEALDLSYNNISGVIPMSLEELKQ  751

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N L G IP
Sbjct  752  LGSFNVSFNRLHGEIP  767



>ref|XP_007212588.1| hypothetical protein PRUPE_ppa015971mg, partial [Prunus persica]
 gb|EMJ13787.1| hypothetical protein PRUPE_ppa015971mg, partial [Prunus persica]
Length=1057

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+G+ ++L YLY+++N+L+G++P EIGNL  L +L+L+ N+LSG IP  IGNLN 
Sbjct  241  GSIPRSLGDLTNLSYLYLFENKLSGTVPIEIGNLKSLVDLELSYNTLSGPIPPNIGNLNQ  300

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L LD+N L G+IP+ I N+ ++  ++++ N
Sbjct  301  LNTLYLDDNQLSGSIPKEIENLKSIVELSLSVN  333


 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+G+ + L +LY++ NQL+GS+P EIGNL  L  L  +EN L+G IPR +GNL+ 
Sbjct  97   GSIPRSLGDLTRLTHLYLYGNQLSGSIPEEIGNLKSLVKLIFSENKLNGSIPRSLGNLSS  156

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L GTIP  I N+ +L  + +++N
Sbjct  157  LTYLYLYGNKLSGTIPNEIGNLKSLVDLELSSN  189


 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+G  SSL YLY++ N+L+G++P EIGNL  L +L+L+ N LSG IP+ I NL  
Sbjct  145  GSIPRSLGNLSSLTYLYLYGNKLSGTIPNEIGNLKSLVDLELSSNILSGCIPQNIMNLER  204

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IPE I N+ +L  + ++ N
Sbjct  205  LNTLYLHTNQLSGLIPEEIGNLQSLVDLELSAN  237


 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+ P  IG   SL  LY+ +N+LNGS+PR +G+LT L +L L  N LSG IP EIGNL  
Sbjct  73   GDTPNEIGNLKSLVELYLNENKLNGSIPRSLGDLTRLTHLYLYGNQLSGSIPEEIGNLKS  132

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L    N L G+IP ++ N+S+LTY+ +  N
Sbjct  133  LVKLIFSENKLNGSIPRSLGNLSSLTYLYLYGN  165


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L   +N+LNGS+PR +GNL+ L  L L  N LSG IP EIGNL  
Sbjct  121  GSIPEEIGNLKSLVKLIFSENKLNGSIPRSLGNLSSLTYLYLYGNKLSGTIPNEIGNLKS  180

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G IP+ I N+  L  + +  N
Sbjct  181  LVDLELSSNILSGCIPQNIMNLERLNTLYLHTN  213


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I R  G+C  L+ L +  N L G++P EIGN T ++ L L+ N+L+G IP+E G L  
Sbjct  457  GEISRKWGQCPLLKTLRLAGNNLTGTIPTEIGNATQIHELDLSSNNLAGTIPKEFGRLTS  516

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L+ N+L G IP    +++ L Y++++ N
Sbjct  517  LEKLMLNRNHLSGRIPSEFRSLTNLEYLDLSTN  549


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   SL  L +  NQLNGS+PR +G+LT L+ L L EN LSG +P EIGNL  
Sbjct  217  GLIPEEIGNLQSLVDLELSANQLNGSIPRSLGDLTNLSYLYLFENKLSGTVPIEIGNLKS  276

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP  I N++ L  + + +N
Sbjct  277  LVDLELSYNTLSGPIPPNIGNLNQLNTLYLDDN  309


 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP++I     L  LY+  NQL+G +P EIGNL  L +L+L+ N L+G IPR +G+L  
Sbjct  193  GCIPQNIMNLERLNTLYLHTNQLSGLIPEEIGNLQSLVDLELSANQLNGSIPRSLGDLTN  252

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L GT+P  I N+ +L  + ++ N
Sbjct  253  LSYLYLFENKLSGTVPIEIGNLKSLVDLELSYN  285


 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP  I   S L YL + +N+L+G +P EIG L  L  LQL EN+  G+ P EIGNL  L 
Sbjct  27   IPPEISYLSKLYYLDLSENKLSGRIPPEIGLLKNLTFLQLAENAFWGDTPNEIGNLKSLV  86

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L+ N L G+IP ++ +++ LT++ +  N
Sbjct  87   ELYLNENKLNGSIPRSLGDLTRLTHLYLYGN  117


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +L +L + +N   G  P EIGNL  L  L L EN L+G IPR +G+L  
Sbjct  49   GRIPPEIGLLKNLTFLQLAENAFWGDTPNEIGNLKSLVELYLNENKLNGSIPRSLGDLTR  108

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IPE I N+ +L  +  + N
Sbjct  109  LTHLYLYGNQLSGSIPEEIGNLKSLVKLIFSEN  141


 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + +  L +  N L G++P+E G LT L  L L  N LSG IP E  +L  
Sbjct  481  GTIPTEIGNATQIHELDLSSNNLAGTIPKEFGRLTSLEKLMLNRNHLSGRIPSEFRSLTN  540

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N    +IP  + ++  L Y+N++NN
Sbjct  541  LEYLDLSTNKFHESIPGILGDLFRLHYLNLSNN  573


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  +G+   L YL + +N+L   +P E+G L  L +L L+ NSL G+IP ++ N+  L
Sbjct  554  SIPGILGDLFRLHYLNLSNNKLAQEVPLELGALVQLTDLDLSHNSLEGKIPSKMSNMESL  613

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +L + +NNL G IP +  ++  L Y++++ N
Sbjct  614  VMLNVSHNNLSGFIPTSFQDMHGLLYVDISYN  645


 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP      ++LEYL +  N+ + S+P  +G+L  L+ L L+ N L+ E+P E+G L  
Sbjct  529  GRIPSEFRSLTNLEYLDLSTNKFHESIPGILGDLFRLHYLNLSNNKLAQEVPLELGALVQ  588

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N+LEG IP  + N+ +L  +N+++N
Sbjct  589  LTDLDLSHNSLEGKIPSKMSNMESLVMLNVSHN  621


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 51/103 (50%), Gaps = 24/103 (23%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLT-----------------  153
            G IP +IG  + L  LY+ DNQL+GS+P+EI NL  +  L L+                 
Sbjct  289  GPIPPNIGNLNQLNTLYLDDNQLSGSIPKEIENLKSIVELSLSVNQLNGSILASFGNLSN  348

Query  152  -------ENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
                   +N LSG IP+EI NL  L +L LD N   G +P  I
Sbjct  349  LENLNLRDNQLSGPIPQEIENLKKLTMLYLDTNQFSGHLPHNI  391


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+  C SL  + +  NQL  ++  + G    ++ + ++ N+L GEI R+ G   +
Sbjct  409  GPIPKSLKTCRSLFRVRLERNQLTSNISEDFGVYPNVDFIDISHNNLYGEISRKWGQCPL  468

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ LRL  NNL GTIP  I N + +  +++++N
Sbjct  469  LKTLRLAGNNLTGTIPTEIGNATQIHELDLSSN  501


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            NI    G   +++++ +  N L G + R+ G   +L  L+L  N+L+G IP EIGN   +
Sbjct  434  NISEDFGVYPNVDFIDISHNNLYGEISRKWGQCPLLKTLRLAGNNLTGTIPTEIGNATQI  493

Query  98   QILRLDNNNLEGTIPETIFNISTL  27
              L L +NNL GTIP+    +++L
Sbjct  494  HELDLSSNNLAGTIPKEFGRLTSL  517


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE++ +  N+L  ++P EI  L+ L  L L+EN LSG IP EIG L  L  L+L  N   
Sbjct  13   LEHIDLNMNKLFDAIPPEISYLSKLYYLDLSENKLSGRIPPEIGLLKNLTFLQLAENAFW  72

Query  65   GTIPETIFNISTLT--YIN  15
            G  P  I N+ +L   Y+N
Sbjct  73   GDTPNEIGNLKSLVELYLN  91



>ref|XP_006428344.1| hypothetical protein CICLE_v100136771mg, partial [Citrus clementina]
 gb|ESR41584.1| hypothetical protein CICLE_v100136771mg, partial [Citrus clementina]
Length=187

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  LY+  NQ  G++P+EIG LT L+ L L +N   GEIP+E+GNL  
Sbjct  92   GEIPSTLSNCRQLRKLYLSLNQFTGAIPKEIGKLTRLSVLSLRDNKFQGEIPQELGNLAK  151

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L GTIP  IF  S L Y+ ++NN
Sbjct  152  LEQLWLQSNFLNGTIPSLIFKFSFLLYLELSNN  184


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG+ + L  L + DN+  G +P+E+GNL  L  L L  N L+G IP  I   + 
Sbjct  116  GAIPKEIGKLTRLSVLSLRDNKFQGEIPQELGNLAKLEQLWLQSNFLNGTIPSLIFKFSF  175

Query  101  LQILRLDNNNLE  66
            L  L L NN+L 
Sbjct  176  LLYLELSNNSLR  187


 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE L + +N   G +P  + N   L  L L+ N  +G IP+EIG L  L +L L +N  +
Sbjct  80   LESLLLKNNTFYGEIPSTLSNCRQLRKLYLSLNQFTGAIPKEIGKLTRLSVLSLRDNKFQ  139

Query  65   GTIPETIFNISTLTYINMANN  3
            G IP+ + N++ L  + + +N
Sbjct  140  GEIPQELGNLAKLEQLWLQSN  160



>ref|XP_007019765.1| Leucine-rich receptor protein kinase family protein [Theobroma 
cacao]
 gb|EOY16990.1| Leucine-rich receptor protein kinase family protein [Theobroma 
cacao]
Length=436

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  251  SSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNN  72
            S+LE L +W N L+G++PR IGNLT L +L+L  NSL GEIP EIGNL  L+I   D  +
Sbjct  35   SNLEVLRLWGNHLSGNIPRSIGNLTRLEDLELDYNSLEGEIPSEIGNLITLEIFYADEMH  94

Query  71   LEGTIPETIFNISTLTYINMANN  3
            L G IP +IFNIS+L YI + NN
Sbjct  95   LSGQIPPSIFNISSLKYIGVQNN  117


 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  251  SSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNN  72
            S+L+ L +W N L+G++PR IGNLT L +L+L  NSL GEIP EIGNL  L+I    + +
Sbjct  130  SNLKVLRLWGNHLSGNIPRSIGNLTRLEDLELNYNSLEGEIPSEIGNLIKLEIFYAADMH  189

Query  71   LEGTIPETIFNISTLTYINMANN  3
            L G IP +IFNIS+L YI + NN
Sbjct  190  LSGQIPPSIFNISSLKYIGVQNN  212


 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP  I     L+ L++  N  +G LPR IGNLT L  L L ENSL G IP EIGNL  
Sbjct  334  GNIPDCISNARKLKILHLNQNLFSGLLPRSIGNLTRLKELLLGENSLEGGIPSEIGNLIK  393

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L   + +L G IP +IFNIS+L  I + NN
Sbjct  394  LEVLHAPHMHLSGQIPPSIFNISSLKVILLQNN  426


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -1

Query  251  SSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNN  72
            S+L+ L +  N L+G++PR IGNLT L  L L  N+L GEIP EIGNL  L+I    + +
Sbjct  225  SNLKVLQLRGNYLSGNIPRSIGNLTRLEELDLDYNNLEGEIPSEIGNLIKLEIFYAADMH  284

Query  71   LEGTIPETIFNISTLTYINMANN  3
            L G IP +IFNIS+L YI + NN
Sbjct  285  LSGQIPPSIFNISSLKYIGVQNN  307


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIPRSIG  + LE L +  N L G +P EIGNL  L      E  LSG+IP  I N++ 
Sbjct  49   GNIPRSIGNLTRLEDLELDYNSLEGEIPSEIGNLITLEIFYADEMHLSGQIPPSIFNISS  108

Query  101  LQILRLDNNNLEGTIP  54
            L+ + + NN+L G +P
Sbjct  109  LKYIGVQNNSLSGKLP  124


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIPRSIG  + LE L +  N L G +P EIGNL  L      +  LSG+IP  I N++ 
Sbjct  239  GNIPRSIGNLTRLEELDLDYNNLEGEIPSEIGNLIKLEIFYAADMHLSGQIPPSIFNISS  298

Query  101  LQILRLDNNNLEGTIPETIFN  39
            L+ + + NN+L G +P   F+
Sbjct  299  LKYIGVQNNSLSGKLPCMSFH  319


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -1

Query  251  SSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNN  72
            S+LE L +W N L+G++P  I N   L  L L +N  SG +PR IGNL  L+ L L  N+
Sbjct  320  SNLEVLQLWGNYLSGNIPDCISNARKLKILHLNQNLFSGLLPRSIGNLTRLKELLLGENS  379

Query  71   LEGTIPETIFNISTLTYINMAN  6
            LEG IP  I N+  L  ++  +
Sbjct  380  LEGGIPSEIGNLIKLEVLHAPH  401


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PRSIG  + L+ L + +N L G +P EIGNL  L  L      LSG+IP  I N++ 
Sbjct  358  GLLPRSIGNLTRLKELLLGENSLEGGIPSEIGNLIKLEVLHAPHMHLSGQIPPSIFNISS  417

Query  101  LQILRLDNNNLEGTI  57
            L+++ L NN+L G +
Sbjct  418  LKVILLQNNSLSGNL  432


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 52/93 (56%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI   SSL+Y+ + +N L+G LP  +   + L  LQL  N LSG IP  I N   
Sbjct  287  GQIPPSIFNISSLKYIGVQNNSLSGKLPC-MSFHSNLEVLQLWGNYLSGNIPDCISNARK  345

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L+ N   G +P +I N++ L  + +  N
Sbjct  346  LKILHLNQNLFSGLLPRSIGNLTRLKELLLGEN  378



>ref|XP_010260175.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Nelumbo nucifera]
Length=1112

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+PR +G  S L +L + +N L+G++P  IGN++ML  L+L+ ++L+G IP+E+GNL  
Sbjct  137  GNVPRELGMLSKLLWLSLHNNSLSGAIPPSIGNISMLAALELSSDNLAGPIPKELGNLVN  196

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L++N L G IP TIFNIS L Y+ + +N
Sbjct  197  LQLLSLEHNQLTGVIPSTIFNISVLRYLLLQDN  229


 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR IG  S+L  LY+  N L G++P  IGNL+ L  L +  N+  G IP+EIG+L  
Sbjct  282  GGLPREIGNLSNLVGLYVHHNALTGTIPPSIGNLSNLLELDMGNNNFVGVIPKEIGHLEN  341

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ +   +NNL+G++PE IFNISTL  + + +N
Sbjct  342  LRFMSFQDNNLKGSVPEEIFNISTLGVMALTDN  374


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 56/118 (47%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN---  111
            G IP+ IG   +L ++   DN L GS+P EI N++ L  + LT+NS SG +P  IGN   
Sbjct  330  GVIPKEIGHLENLRFMSFQDNNLKGSVPEEIFNISTLGVMALTDNSFSGNLPAGIGNWLP  389

Query  110  ----------------------LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                                   + L  L L NN+  G IP +I N+  L  +N+A N
Sbjct  390  RITILYLGNNHFSGKFPASISNASQLTSLELANNSFSGPIPTSIGNLRNLQILNLAGN  447


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I   +   S L+ L + +N  +G LP  +G+L  L  L L  N  +G +PRE+G L+ 
Sbjct  89   GTIEPQLSNLSFLQVLDLSNNSFHGQLPYGLGHLHRLKYLHLEYNQFTGNVPRELGMLSK  148

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN+L G IP +I NIS L  + ++++
Sbjct  149  LLWLSLHNNSLSGAIPPSIGNISMLAALELSSD  181


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P  IG +   L++L ++ NQ +G +P  +     L  + L  N+  G +PREIGNL+
Sbjct  233  GSLPMDIGRQLPELQWLLLFKNQFSGYIPSSLCQCGKLLKISLGRNNFIGGLPREIGNLS  292

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L + +N L GTIP +I N+S L  ++M NN
Sbjct  293  NLVGLYVHHNALTGTIPPSIGNLSNLLELDMGNN  326


 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            N+P+ +G+   LE L M  N L+G++   IG L  L  L L+ NSL G +P+  GNL  L
Sbjct  628  NLPQEVGDMDFLELLDMSWNHLSGNISSTIGGLQRLKYLILSRNSLQGSLPQSFGNLLSL  687

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              + L  NNL G IP+++  +  L+++N++ N
Sbjct  688  ISMDLSFNNLSGNIPKSLEKLPFLSFLNLSYN  719


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNI  +IG    L+YL +  N L GSLP+  GNL  L ++ L+ N+LSG IP+ +  L  
Sbjct  651  GNISSTIGGLQRLKYLILSRNSLQGSLPQSFGNLLSLISMDLSFNNLSGNIPKSLEKLPF  710

Query  101  LQILRLDNNNLEGTIPE  51
            L  L L  N  EG IP 
Sbjct  711  LSFLNLSYNKFEGEIPS  727


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP+ +G  S++  L +  N+L+G++P  IG L  L  L L  N + G I  ++ +LN 
Sbjct  507  GNIPKGLGNLSNIITLNLGSNELSGTIPSTIGGLGKLQRLYLGHNKIHGSIGNDLCSLNQ  566

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G +P  I N+S L  +++++N
Sbjct  567  LGELYLHGNNLSGQLPNCIGNLSRLEVLDLSSN  599


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG  S+L  L M +N   G +P+EIG+L  L  +   +N+L G +P EI N++ 
Sbjct  306  GTIPPSIGNLSNLLELDMGNNNFVGVIPKEIGHLENLRFMSFQDNNLKGSVPEEIFNIST  365

Query  101  LQILRLDNNNLEGTIPETIFN-ISTLTYINMANN  3
            L ++ L +N+  G +P  I N +  +T + + NN
Sbjct  366  LGVMALTDNSFSGNLPAGIGNWLPRITILYLGNN  399


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG  S L  L +  + L G +P+E+GNL  L  L L  N L+G IP  I N+++
Sbjct  161  GAIPPSIGNISMLAALELSSDNLAGPIPKELGNLVNLQLLSLEHNQLTGVIPSTIFNISV  220

Query  101  LQILRLDNNNLEGTIPETI  45
            L+ L L +N++ G++P  I
Sbjct  221  LRYLLLQDNSISGSLPMDI  239


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G IP+ +G   +L+ L +  NQL G +P  I N+++L  L L +NS+SG +P +IG  L 
Sbjct  185  GPIPKELGNLVNLQLLSLEHNQLTGVIPSTIFNISVLRYLLLQDNSISGSLPMDIGRQLP  244

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L  N   G IP ++     L  I++  N
Sbjct  245  ELQWLLLFKNQFSGYIPSSLCQCGKLLKISLGRN  278


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG    L+ LY+  N+++GS+  ++ +L  L  L L  N+LSG++P  IGNL+ 
Sbjct  531  GTIPSTIGGLGKLQRLYLGHNKIHGSIGNDLCSLNQLGELYLHGNNLSGQLPNCIGNLSR  590

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L +N L   IP +++++S L  +N+++N
Sbjct  591  LEVLDLSSNILTSHIPLSLWSLSDLLTLNLSHN  623


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GN+P  IG     +  LY+ +N  +G  P  I N + L +L+L  NS SG IP  IGNL 
Sbjct  378  GNLPAGIGNWLPRITILYLGNNHFSGKFPASISNASQLTSLELANNSFSGPIPTSIGNLR  437

Query  104  MLQILRLDNNNLE  66
             LQIL L  N LE
Sbjct  438  NLQILNLAGNLLE  450


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  S SL        Q+ G++P+ +GNL+ +  L L  N LSG IP  IG L 
Sbjct  482  GFLPDSIGNLSTSLTIFTGASCQIRGNIPKGLGNLSNIITLNLGSNELSGTIPSTIGGLG  541

Query  104  MLQILRLDNNNLEGTI  57
             LQ L L +N + G+I
Sbjct  542  KLQRLYLGHNKIHGSI  557


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (53%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNL-TMLNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+  C  LE + +  N LNG LP  IGNL T L         + G IP+ +GNL+ +  L
Sbjct  463  SLTNCRFLEQIEIDSNPLNGFLPDSIGNLSTSLTIFTGASCQIRGNIPKGLGNLSNIITL  522

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +N L GTIP TI  +  L  + + +N
Sbjct  523  NLGSNELSGTIPSTIGGLGKLQRLYLGHN  551


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  IG  S LE L +  N L   +P  + +L+ L  L L+ NSL   +P+E+G+++ 
Sbjct  579  GQLPNCIGNLSRLEVLDLSSNILTSHIPLSLWSLSDLLTLNLSHNSLYDNLPQEVGDMDF  638

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L +  N+L G I  TI  +  L Y+ ++ N
Sbjct  639  LELLDMSWNHLSGNISSTIGGLQRLKYLILSRN  671


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  DNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
             N L  +LP+E+G++  L  L ++ N LSG I   IG L  L+ L L  N+L+G++P++ 
Sbjct  622  HNSLYDNLPQEVGDMDFLELLDMSWNHLSGNISSTIGGLQRLKYLILSRNSLQGSLPQSF  681

Query  44   FNISTLTYINMANN  3
             N+ +L  ++++ N
Sbjct  682  GNLLSLISMDLSFN  695



>ref|XP_006427090.1| hypothetical protein CICLE_v10026978mg [Citrus clementina]
 gb|ESR40330.1| hypothetical protein CICLE_v10026978mg [Citrus clementina]
Length=1139

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C R+  L+  Y+  N   G+IP ++ +C  L  + +  NQL GS+PR+IGNLT L  L
Sbjct  283  DLCQRIPLLQRFYMTNNHFTGSIPHNLWQCKDLSVVSLSLNQLTGSIPRDIGNLTSLKKL  342

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ N+L GEIP EIGNL  ++IL +D N+L G +P TIFN+STL  +++ NN
Sbjct  343  YLSFNNLIGEIPHEIGNLPNVEILGIDENHLVGDVPNTIFNMSTLKALSLLNN  395


 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L+ L +  N   G++P+EIGNLT L  L L  N L GEIP+++GNL  
Sbjct  182  GQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAE  241

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  + L GTIP +IFN+++L  ++ +NN
Sbjct  242  LEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNN  274


 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG    +LE +Y+ + ++ G++P+EIGNL  L  L L  N LSG IP  +G LN
Sbjct  503  GVLPSSIGSLPITLEEIYLQNCKIRGNIPKEIGNLVNLITLHLGNNQLSGSIPITVGRLN  562

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L+NN LEG IP+ +  +  L+ +++ +N
Sbjct  563  TLQGLGLENNKLEGPIPDDLCQLVRLSELHVDHN  596


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR IG  +SL+ LY+  N L G +P EIGNL  +  L + EN L G++P  I N++ 
Sbjct  327  GSIPRDIGNLTSLKKLYLSFNNLIGEIPHEIGNLPNVEILGIDENHLVGDVPNTIFNMST  386

Query  101  LQILRLDNNNLEGTIPET  48
            L+ L L NN L G++P +
Sbjct  387  LKALSLLNNTLSGSLPSS  404


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP+ IG   +L  L++ +NQL+GS+P  +G L  L  L L  N L G IP ++  L  
Sbjct  528  GNIPKEIGNLVNLITLHLGNNQLSGSIPITVGRLNTLQGLGLENNKLEGPIPDDLCQLVR  587

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L +D+N L G IP    N+++L  +++ +N
Sbjct  588  LSELHVDHNKLSGPIPACFGNLNSLRNLSLGSN  620


 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            N LNGSLP +IGN+ ++  + L+ N L+G+IP  IG L  LQ+L L+NN L G IPE+  
Sbjct  644  NSLNGSLPLDIGNMKVVVEINLSRNYLTGDIPTTIGGLTNLQLLSLENNRLHGPIPESFG  703

Query  41   NISTLTYINMANN  3
             +++L  ++++ N
Sbjct  704  ALTSLESLDLSVN  716


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G  ++L+ L + +N+L G +P ++  L  L+ L +  N LSG IP   GNLN 
Sbjct  552  GSIPITVGRLNTLQGLGLENNKLEGPIPDDLCQLVRLSELHVDHNKLSGPIPACFGNLNS  611

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L   IP T +N++ +   + ++N
Sbjct  612  LRNLSLGSNELSSFIPSTFWNLNNILSFDFSSN  644


 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG  ++L+ L + +N+L+G +P   G LT L +L L+ N+LSG IP  +  L  
Sbjct  672  GDIPTTIGGLTNLQLLSLENNRLHGPIPESFGALTSLESLDLSVNNLSGVIPISLEKLVY  731

Query  101  LQILRLDNNNLEGTIP  54
            L+ L L  N LEG IP
Sbjct  732  LKDLNLSFNRLEGEIP  747


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L  LY+  N+L G +P+++GNL  L  L L ++ L+G IP  I NL  
Sbjct  206  GAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTS  265

Query  101  LQILRLDNNNLEGTIPETIFN-ISTLTYINMANN  3
            L  L   NN+L G+  + +   I  L    M NN
Sbjct  266  LLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNN  299


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -1

Query  242  EYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            +Y+ + +N LNG LP  IG+L + L  + L    + G IP+EIGNL  L  L L NN L 
Sbjct  492  KYIVLAENPLNGVLPSSIGSLPITLEEIYLQNCKIRGNIPKEIGNLVNLITLHLGNNQLS  551

Query  65   GTIPETIFNISTLTYINMANN  3
            G+IP T+  ++TL  + + NN
Sbjct  552  GSIPITVGRLNTLQGLGLENN  572


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 54/119 (45%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREI--------------------------GNL  180
            G IP SI   S+L+ L + DNQL+GS P  I                            L
Sbjct  108  GTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYL  167

Query  179  TMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L +L L+ N+  G+IP  + N   LQ+L L  N+  G IP+ I N++ LT + +  N
Sbjct  168  PFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYN  226


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQ---LTENSLSGEIPREIGN  111
            G++P +I   S+L+ L + +N L+GSLP    NL  L N++   L  N+LSG IP  I N
Sbjct  375  GDVPNTIFNMSTLKALSLLNNTLSGSLPSSSKNLIGLPNIERLNLGLNNLSGRIPGFIFN  434

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             + L +L L  N+  G IP+T+ N+  L ++ +  N
Sbjct  435  ASKLFLLELTGNSFSGFIPDTLVNLRNLEHLGLGYN  470


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  + +   L  L++  N+L+G +P   GNL  L NL L  N LS  IP    NLN 
Sbjct  576  GPIPDDLCQLVRLSELHVDHNKLSGPIPACFGNLNSLRNLSLGSNELSSFIPSTFWNLNN  635

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +      +N+L G++P  I N+  +  IN++ N
Sbjct  636  ILSFDFSSNSLNGSLPLDIGNMKVVVEINLSRN  668


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            L+ L +  N  +G +P  + N   L  L L+ N  +G IP+EIGNL  L  L L  N L+
Sbjct  170  LKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQ  229

Query  65   GTIPETIFNISTLTYINM  12
            G IP+ + N++ L ++++
Sbjct  230  GEIPQDLGNLAELEWLSL  247


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  +SL  L +  N+L+  +P    NL  + +   + NSL+G +P +IGN+ +
Sbjct  600  GPIPACFGNLNSLRNLSLGSNELSSFIPSTFWNLNNILSFDFSSNSLNGSLPLDIGNMKV  659

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  + L  N L G IP TI  ++ L  +++ NN
Sbjct  660  VVEINLSRNYLTGDIPTTIGGLTNLQLLSLENN  692


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPRE-IGNLN  105
            G I   +G  SSL+ L +  NQ +G++P  I +++ L  L L +N LSG  P   I N++
Sbjct  84   GTISSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMS  143

Query  104  MLQILRLDNNNLEGTIPETIFN  39
             ++ +  + N+L G +P  IF+
Sbjct  144  SIRAIDCNYNSLSGELPANIFS  165



>ref|XP_011078429.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1216

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            +MCS   +L+E++ + N+L G +P  IGECS+L+   +  N + G +PR +GNLTML N 
Sbjct  357  DMCSGSSRLQEVFFHVNELVGELPERIGECSALQMWSLSYNNITGVIPRGVGNLTMLQNF  416

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +  N+L G IP+EIGNL  L++L L  NNL GTIP  IFNISTL  I+++ N
Sbjct  417  YVGYNNLIGTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMN  469


 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I +CS L  L +  N+ +GS+P  IGNLT L  L L  N L+G+IP E+G+L  
Sbjct  256  GQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRN  315

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            L+ L + +N L+G+IP TIFNIS+L YIN+AN
Sbjct  316  LKELGMGDNFLKGSIPSTIFNISSLQYINIAN  347


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P   G    L++L + +N  +G  P  I N++ L  L L+ N L G+IP EIGNL+ 
Sbjct  135  GDVPSWFGFLGELQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYNPLQGKIPDEIGNLHN  194

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N  +G IP TIFNIS+L  + +  N
Sbjct  195  LKRLSLQFNKFDGLIPTTIFNISSLESLALTGN  227


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 60/118 (51%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + L+  Y+  N L G++P+EIGNL  L  L L  N+L G IP EI N++ 
Sbjct  401  GVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIFNIST  460

Query  101  LQI-------------------------LRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ                          L L+NNNL G IP++I N S LT IN A N
Sbjct  461  LQSISVSMNQLSGQLPSNFGHGLPNIEELYLNNNNLSGEIPDSISNSSKLTVINFAGN  518


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG  ++LE LY+  N L G +P E+G+L  L  L + +N L G IP  I N++ 
Sbjct  280  GSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISS  339

Query  101  LQILRLDNNNLEGTIP  54
            LQ + + N NL G +P
Sbjct  340  LQYINIANCNLTGALP  355


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG   +   L +  NQ +G++P  +G++  L NL L  N   G IP  IG L  
Sbjct  720  GSLPPDIGNLKTATVLDLSMNQFSGTIPPSLGDIHDLINLSLAHNKFEGSIPESIGQLVN  779

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L L +NNL G IP ++  I  LTY N++ N
Sbjct  780  IAELDLSHNNLSGNIPRSLERILYLTYFNVSFN  812


 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L  LY+ +N L+  +P  +  L  L  L LT N L G +P +IGNL  
Sbjct  672  GAIPDCIGNLTALRTLYIGNNNLSSGIPPSLWRLNDLLQLNLTSNVLVGSLPPDIGNLKT  731

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N   GTIP ++ +I  L  +++A+N
Sbjct  732  ATVLDLSMNQFSGTIPPSLGDIHDLINLSLAHN  764


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP   G  ++L  L ++DNQL GS+P+ + NL  L  L L  N +SG IP  +  L  
Sbjct  600  GSIPDEFGNLTNLFLLSLFDNQLTGSIPKTLVNLQTLQGLALMRNKISGPIPENLCGLQN  659

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N + G IP+ I N++ L  + + NN
Sbjct  660  LNGLLLHQNQISGAIPDCIGNLTALRTLYIGNN  692


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = -1

Query  275  IPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +P S+G  S +LE  Y ++  L GS+P E GNLT L  L L +N L+G IP+ + NL  L
Sbjct  577  LPVSVGNLSNTLENFYGYNCGLYGSIPDEFGNLTNLFLLSLFDNQLTGSIPKTLVNLQTL  636

Query  98   QILRLDNNNLEGTIPE  51
            Q L L  N + G IPE
Sbjct  637  QGLALMRNKISGPIPE  652


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P  +G  + L  L +  N  +GSLP+E+  L  L  +    N   G++P   G L  
Sbjct  87   GNLPPDMGNLTFLVSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWFGFLGE  146

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L NN+  G  P +I N+S L  ++++ N
Sbjct  147  LQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYN  179


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP S+   + L  L +  N L GSLP +IGNL     L L+ N  SG IP  +G+++ L 
Sbjct  698  IPPSLWRLNDLLQLNLTSNVLVGSLPPDIGNLKTATVLDLSMNQFSGTIPPSLGDIHDLI  757

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +N  EG+IPE+I  +  +  +++++N
Sbjct  758  NLSLAHNKFEGSIPESIGQLVNIAELDLSHN  788


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 54/118 (46%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNN---------------------  165
            G IP+ IG   SLE LY+  N L G++P EI N++ L +                     
Sbjct  425  GTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMNQLSGQLPSNFGHGLP  484

Query  164  ----LQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                L L  N+LSGEIP  I N + L ++    NN  G +P ++  +S L  I +  N
Sbjct  485  NIEELYLNNNNLSGEIPDSISNSSKLTVINFAGNNFTGLVPNSLGELSFLQDIYLGEN  542


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G+   L  L +  N+  GS+P  IG L  +  L L+ N+LSG IPR +  +  
Sbjct  744  GTIPPSLGDIHDLINLSLAHNKFEGSIPESIGQLVNIAELDLSHNNLSGNIPRSLERILY  803

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N+L G IP
Sbjct  804  LTYFNVSFNDLSGEIP  819


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G+LP ++GNLT L +L L+ NS  G +P+E+  L  L+++    N+  G +P     +
Sbjct  85   LAGNLPPDMGNLTFLVSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWFGFL  144

Query  35   STLTYINMANN  3
              L ++N+ NN
Sbjct  145  GELQFLNLRNN  155


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P+ + +   LE +    N   G +P   G L  L  L L  NS SG  P  I N++ 
Sbjct  111  GSLPQELAQLRRLEVIDFRFNDFGGDVPSWFGFLGELQFLNLRNNSFSGFGPTSIANMSK  170

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N L+G IP+ I N+  L  +++  N
Sbjct  171  LEMLDLSYNPLQGKIPDEIGNLHNLKRLSLQFN  203


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++    +L  L +  NQ++G++P  IGNLT L  L +  N+LS  IP  +  LN 
Sbjct  648  GPIPENLCGLQNLNGLLLHQNQISGAIPDCIGNLTALRTLYIGNNNLSSGIPPSLWRLND  707

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G++P  I N+ T T ++++ N
Sbjct  708  LLQLNLTSNVLVGSLPPDIGNLKTATVLDLSMN  740



>ref|XP_002280075.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Vitis vinifera]
Length=1160

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             +IP  I +C  L  LY+++N+L GS+P+ IGNL+ L  L L  N L+GEIPREI +L  
Sbjct  114  ASIPNEIAKCRELRQLYLFNNRLTGSIPQAIGNLSKLEQLYLGGNQLTGEIPREISHLLS  173

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL   +NNL  +IP  IFNIS+L YI +  N
Sbjct  174  LKILSFRSNNLTASIPSAIFNISSLQYIGLTYN  206


 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  S +E +Y+  N L G++P   GNL+ L  L L +N + G IP+E+G+L+ 
Sbjct  356  GRIPSGIGNLSGIEKIYLGGNNLMGTIPSSFGNLSALKTLYLEKNKIQGNIPKELGHLSE  415

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +N L G++PE IFNIS L +I +A+N
Sbjct  416  LQYLSLASNILTGSVPEAIFNISNLQFIVLADN  448


 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            L  LY+  NQL+G +P  +G    L  + L+ N   G IPR IG+L++L++L L +NNLE
Sbjct  223  LRGLYLSGNQLSGKIPTSLGKCGRLEEISLSFNEFMGSIPRGIGSLSVLEVLYLGSNNLE  282

Query  65   GTIPETIFNISTLTYINMANN  3
            G IP+T+FN+S+L    + +N
Sbjct  283  GEIPQTLFNLSSLRNFELGSN  303


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+  C  L+ L +  N+  G +P  IGNL+ +  + L  N+L G IP   GNL+ 
Sbjct  332  GEIPPSLSNCGELQVLGLSINEFIGRIPSGIGNLSGIEKIYLGGNNLMGTIPSSFGNLSA  391

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L+ N ++G IP+ + ++S L Y+++A+N
Sbjct  392  LKTLYLEKNKIQGNIPKELGHLSELQYLSLASN  424


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G+C  LE + +  N+  GS+PR IG+L++L  L L  N+L GEIP+ + NL+ 
Sbjct  235  GKIPTSLGKCGRLEEISLSFNEFMGSIPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSS  294

Query  101  LQILRLDNNNLEGTIPETI-FNISTLTYINMANN  3
            L+   L +NNL G +P  + +++  L  IN++ N
Sbjct  295  LRNFELGSNNLGGILPADMCYSLPRLQVINLSQN  328


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            GNIP+ +G  S L+YL +  N L GS+P  I N++ L  + L +N LSG +P  IG +L 
Sbjct  404  GNIPKELGHLSELQYLSLASNILTGSVPEAIFNISNLQFIVLADNHLSGNLPSSIGTSLP  463

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L +  N L G IP +I NI+ LT ++++ N
Sbjct  464  QLEELLIGGNYLSGIIPASISNITKLTRLDLSYN  497


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S G  S+L+ LY+  N++ G++P+E+G+L+ L  L L  N L+G +P  I N++ 
Sbjct  380  GTIPSSFGNLSALKTLYLEKNKIQGNIPKELGHLSELQYLSLASNILTGSVPEAIFNISN  439

Query  101  LQILRLDNNNLEGTIPETI  45
            LQ + L +N+L G +P +I
Sbjct  440  LQFIVLADNHLSGNLPSSI  458


 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP++IG  S LE LY+  NQL G +PREI +L  L  L    N+L+  IP  I N++ 
Sbjct  138  GSIPQAIGNLSKLEQLYLGGNQLTGEIPREISHLLSLKILSFRSNNLTASIPSAIFNISS  197

Query  101  LQILRLDNNNLEGTIP  54
            LQ + L  N+L GT+P
Sbjct  198  LQYIGLTYNSLSGTLP  213


 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++G+   L+ LY+  N+++GS+P  IG+L  L  L L+ N LSG +P  + +LN 
Sbjct  605  GMIPTTLGQLKKLQRLYIAGNRIHGSVPNGIGHLANLVYLFLSSNQLSGLVPSSLWSLNR  664

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L ++ L +N L G +P  + ++ T+T ++++ N
Sbjct  665  LLVVNLSSNFLTGDLPVEVGSMKTITKLDLSQN  697


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G   ++  L +  NQ +G +P  +G L  L  L L++N L G IPRE GNL  
Sbjct  677  GDLPVEVGSMKTITKLDLSQNQFSGHIPSTMGQLGGLVELSLSKNRLQGPIPREFGNLLS  736

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NNL G IP ++  + +L Y+N++ N
Sbjct  737  LESLDLSWNNLSGAIPRSLEALVSLKYLNVSFN  769


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG  ++L YL++  NQL+G +P  + +L  L  + L+ N L+G++P E+G++  
Sbjct  629  GSVPNGIGHLANLVYLFLSSNQLSGLVPSSLWSLNRLLVVNLSSNFLTGDLPVEVGSMKT  688

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L L  N   G IP T+  +  L  ++++ N
Sbjct  689  ITKLDLSQNQFSGHIPSTMGQLGGLVELSLSKN  721


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 54/118 (46%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQL------------------  156
            G+IPR IG  S LE LY+  N L G +P+ + NL+ L N +L                  
Sbjct  259  GSIPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSSLRNFELGSNNLGGILPADMCYSLP  318

Query  155  -------TENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                   ++N L GEIP  + N   LQ+L L  N   G IP  I N+S +  I +  N
Sbjct  319  RLQVINLSQNQLKGEIPPSLSNCGELQVLGLSINEFIGRIPSGIGNLSGIEKIYLGGN  376


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L  L +  N+L G +PRE GNL  L +L L+ N+LSG IPR +  L  
Sbjct  701  GHIPSTMGQLGGLVELSLSKNRLQGPIPREFGNLLSLESLDLSWNNLSGAIPRSLEALVS  760

Query  101  LQILRLDNNNLEGTIPET--IFNISTLTYINMA  9
            L+ L +  N LEG IP+     N +T ++I+ A
Sbjct  761  LKYLNVSFNKLEGEIPDKGPFANFTTESFISNA  793


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GN+P SIG     LE L +  N L+G +P  I N+T L  L L+ N L+G +P+++GNL 
Sbjct  452  GNLPSSIGTSLPQLEELLIGGNYLSGIIPASISNITKLTRLDLSYNLLTGFVPKDLGNLR  511

Query  104  MLQILRLDNNNLEG  63
             LQ L   NN L G
Sbjct  512  SLQHLGFGNNQLSG  525


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+  C  L  L++ DN L G+LP  +GNL++ L ++  +     G IP  IGNL  L  L
Sbjct  537  SLSNCKFLRNLWIQDNPLKGTLPNSLGNLSLSLQSINASACQFKGVIPAGIGNLTNLIEL  596

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +N+L G IP T+  +  L  + +A N
Sbjct  597  GLGDNDLTGMIPTTLGQLKKLQRLYIAGN  625


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++  ++GNL+ L  L L+ NS    IP EI     L+ L L NN L G+IP+ I N+
Sbjct  88   LEGTIAPQVGNLSFLVTLDLSNNSFHASIPNEIAKCRELRQLYLFNNRLTGSIPQAIGNL  147

Query  35   STLTYINMANN  3
            S L  + +  N
Sbjct  148  SKLEQLYLGGN  158



>ref|XP_009772557.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
Length=1084

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++ +CS L+ L +  NQ  G++PRE+GNLTML  L L EN L GEIP EIGNL  
Sbjct  252  GLIPPNLEKCSKLKNLTLSGNQFTGTIPRELGNLTMLTVLHLGENLLEGEIPVEIGNLQN  311

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  NNL G+IP  IFNIS L  + +  N
Sbjct  312  LQMLGLKANNLSGSIPANIFNISALKILTIYGN  344


 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G+ S+L YL++  N+LN +LP  + +L  L  L  + N LSG IP EIGNL +
Sbjct  549  GSVPACLGKVSTLRYLHLGFNRLNSTLPESLWSLQDLLELSASSNLLSGRIPPEIGNLKV  608

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + ++ L  N+L G IP TI  +  L  ++MA+N
Sbjct  609  VTLIDLSKNDLSGNIPSTIGGLEKLISLSMAHN  641


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +    +L +LY+  N+ +G +P    NLT L  L++  NSL G+IP EIG+L  
Sbjct  131  GPIPSVLSLLPNLRFLYLSSNKFSGEIPSSFSNLTNLQQLRVQRNSLQGKIPPEIGDLRY  190

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G IP +IFN+++L  + +  N
Sbjct  191  LTMLDLQGNRLTGFIPPSIFNMTSLRQLALIRN  223


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  S +L  +    ++L G++P E+GNL+ L  L L+ N+L G IP ++  + 
Sbjct  452  GFLPASIGNFSDTLRIIIARRSKLKGTIPEEVGNLSGLRVLALSHNNLIGSIPEKLRTMQ  511

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ   L+NN+L GTIP+ I  +  L  +++ +N
Sbjct  512  NLQEFYLENNSLRGTIPDDICRLQNLGALDLTSN  545


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + L  L++ +N L G +P EIGNL  L  L L  N+LSG IP  I N++ 
Sbjct  276  GTIPRELGNLTMLTVLHLGENLLEGEIPVEIGNLQNLQMLGLKANNLSGSIPANIFNISA  335

Query  101  LQILRLDNNNLEGTIPETI  45
            L+IL +  N + G++P  +
Sbjct  336  LKILTIYGNQISGSLPSDL  354


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE L++  N L+G +P  +   + L NL L+ N  +G IPRE+GNL ML +L L  N LE
Sbjct  240  LEVLFLSSNILDGLIPPNLEKCSKLKNLTLSGNQFTGTIPRELGNLTMLTVLHLGENLLE  299

Query  65   GTIPETIFNISTLTYINMANN  3
            G IP  I N+  L  + +  N
Sbjct  300  GEIPVEIGNLQNLQMLGLKAN  320


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N L GS+P ++  +  L    L  NSL G IP +I  L  
Sbjct  477  GTIPEEVGNLSGLRVLALSHNNLIGSIPEKLRTMQNLQEFYLENNSLRGTIPDDICRLQN  536

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N + G++P  +  +STL Y+++  N
Sbjct  537  LGALDLTSNQISGSVPACLGKVSTLRYLHLGFN  569


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +    +L+  Y+ +N L G++P +I  L  L  L LT N +SG +P  +G ++ 
Sbjct  501  GSIPEKLRTMQNLQEFYLENNSLRGTIPDDICRLQNLGALDLTSNQISGSVPACLGKVST  560

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L  T+PE+++++  L  ++ ++N
Sbjct  561  LRYLHLGFNRLNSTLPESLWSLQDLLELSASSN  593


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG    +  + +  N L+G++P  IG L  L +L +  N L G IP   G +  
Sbjct  597  GRIPPEIGNLKVVTLIDLSKNDLSGNIPSTIGGLEKLISLSMAHNKLEGPIPSSFGKMVG  656

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L    NNL   IP+++  +S L Y N + N
Sbjct  657  LEFLDFSYNNLTSEIPKSLEALSHLNYFNFSFN  689


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLT-MLNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+  C  L  + + +N LNG LP  IGN +  L  +    + L G IP E+GNL+ L++L
Sbjct  433  SLTNCRYLREVVIEENPLNGFLPASIGNFSDTLRIIIARRSKLKGTIPEEVGNLSGLRVL  492

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +NNL G+IPE +  +  L    + NN
Sbjct  493  ALSHNNLIGSIPEKLRTMQNLQEFYLENN  521


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-GNLN  105
            G IP  IG+   L  L +  N+L G +P  I N+T L  L L  N L+G++P +I  NL 
Sbjct  179  GKIPPEIGDLRYLTMLDLQGNRLTGFIPPSIFNMTSLRQLALIRNRLTGKLPVDICNNLP  238

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L++L L +N L+G IP  +   S L  + ++ N
Sbjct  239  NLEVLFLSSNILDGLIPPNLEKCSKLKNLTLSGN  272


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLN  105
            G+IP +I   S+L+ L ++ NQ++GSLP ++G  T+ L  + L  N LSG +   I N +
Sbjct  324  GSIPANIFNISALKILTIYGNQISGSLPSDLGLRTLNLEEVYLGSNDLSGRLAPTISNAS  383

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L I+ L NN   G IP++   +  L  + +  N
Sbjct  384  RLIIIDLANNKCTGPIPDSFGTLEFLEGLYLGGN  417


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P+ +     L+ + + +N  +G +P  +  L  L  L L+ N  SGEIP    NL  
Sbjct  107  GDLPQELSLLLRLKLIDVTENNFSGPIPSVLSLLPNLRFLYLSSNKFSGEIPSSFSNLTN  166

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ LR+  N+L+G IP  I ++  LT +++  N
Sbjct  167  LQQLRVQRNSLQGKIPPEIGDLRYLTMLDLQGN  199


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L + +N   G LP+E+  L  L  + +TEN+ SG IP  +  L  
Sbjct  83   GTIPPHLGNLSFLVSLDISNNSFRGDLPQELSLLLRLKLIDVTENNFSGPIPSVLSLLPN  142

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N   G IP +  N++ L  + +  N
Sbjct  143  LRFLYLSSNKFSGEIPSSFSNLTNLQQLRVQRN  175



>ref|XP_011078427.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Sesamum indicum]
Length=1021

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            +MCS   +L+E++ + N+L G +P  IGECS+L+   +  N + G +PR +GNLTML N 
Sbjct  335  DMCSGSSRLQEVFFHVNELVGELPERIGECSALQMWSLSYNNITGVIPRGVGNLTMLQNF  394

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +  N+L G IP+EIGNL  L++L L  NNL GTIP  IFNISTL  I+++ N
Sbjct  395  YVGYNNLIGTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMN  447


 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I +CS L  L +  N+ +GS+P  IGNLT L  L L  N L+G+IP E+G+L  
Sbjct  234  GQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRN  293

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            L+ L + +N L+G+IP TIFNIS+L YIN+AN
Sbjct  294  LKELGMGDNFLKGSIPSTIFNISSLQYINIAN  325


 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P   G    L++L + +N  +G  P  I N++ L  L L+ NSL G+IP EIGNL+ 
Sbjct  113  GDVPSWFGFLGELQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYNSLQGKIPDEIGNLHN  172

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N  +G IP TIFNIS+L  + +  N
Sbjct  173  LKRLSLQFNKFDGLIPTTIFNISSLESLALTGN  205


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 60/118 (51%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + L+  Y+  N L G++P+EIGNL  L  L L  N+L G IP EI N++ 
Sbjct  379  GVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIFNIST  438

Query  101  LQI-------------------------LRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ                          L L+NNNL G IP++I N S LT IN A N
Sbjct  439  LQSISVSMNQLSGQLPSNFGHGLPNIEELYLNNNNLSGEIPDSISNSSKLTVINFAGN  496


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG  ++LE LY+  N L G +P E+G+L  L  L + +N L G IP  I N++ 
Sbjct  258  GSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISS  317

Query  101  LQILRLDNNNLEGTIPETI  45
            LQ + + N NL G +P  +
Sbjct  318  LQYINIANCNLTGALPADM  336


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = -1

Query  275  IPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +P S+G  S SLEY Y ++  L GS+P E GNLT L  L L  N L+G IP+ + NL  L
Sbjct  555  LPVSVGNLSNSLEYFYGYNCGLYGSIPDEFGNLTNLFLLSLYGNQLTGSIPKALVNLQKL  614

Query  98   QILRLDNNNLEGTIPETI  45
            Q L L  N + G IPE +
Sbjct  615  QGLALMRNRISGPIPENL  632


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++   IG   +   L +  NQ +G++P  +G++  L NL L  N   G IP  IG L  
Sbjct  698  GSLSPDIGNLKTATVLDLSMNQFSGTIPPSVGDMFDLINLSLAHNKFEGSIPESIGQLVN  757

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +NNL G IP ++  I  LTY N++ N
Sbjct  758  LAELDLSHNNLSGNIPRSLERILYLTYFNVSFN  790


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P  +G  S +  L +  N  +GSLP+E+  L  L  +    N   G++P   G L  
Sbjct  65   GNLPPDMGNLSCVMSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWFGFLGE  124

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L NN+  G  P +I N+S L  ++++ N
Sbjct  125  LQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYN  157


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L  LY+ +N L+  +P  +  L  L  L LT N L G +  +IGNL  
Sbjct  650  GAIPDCIGNLTALRSLYIGNNNLSSGIPPSLWRLNDLLQLNLTSNVLVGSLSPDIGNLKT  709

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N   GTIP ++ ++  L  +++A+N
Sbjct  710  ATVLDLSMNQFSGTIPPSVGDMFDLINLSLAHN  742


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 55/118 (47%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNN---------------------  165
            G IP+ IG   SLE LY+  N L G++P EI N++ L +                     
Sbjct  403  GTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMNQLSGQLPSNFGHGLP  462

Query  164  ----LQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                L L  N+LSGEIP  I N + L ++    NN  G +P ++  +S L  +N+  N
Sbjct  463  NIEELYLNNNNLSGEIPDSISNSSKLTVINFAGNNFTGLVPNSLGELSFLQDMNLGEN  520


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 57/117 (49%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLT-----------------  153
            G+IP   G  ++L  L ++ NQL GS+P+ + NL  L  L L                  
Sbjct  578  GSIPDEFGNLTNLFLLSLYGNQLTGSIPKALVNLQKLQGLALMRNRISGPIPENLCGLQN  637

Query  152  -------ENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                   +N +SG IP  IGNL  L+ L + NNNL   IP +++ ++ L  +N+ +N
Sbjct  638  LNGLLLYQNQISGAIPDCIGNLTALRSLYIGNNNLSSGIPPSLWRLNDLLQLNLTSN  694


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G+   L  L +  N+  GS+P  IG L  L  L L+ N+LSG IPR +  +  
Sbjct  722  GTIPPSVGDMFDLINLSLAHNKFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSLERILY  781

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N+L G IP
Sbjct  782  LTYFNVSFNDLSGEIP  797


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP S+   + L  L +  N L GSL  +IGNL     L L+ N  SG IP  +G++  L 
Sbjct  676  IPPSLWRLNDLLQLNLTSNVLVGSLSPDIGNLKTATVLDLSMNQFSGTIPPSVGDMFDLI  735

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +N  EG+IPE+I  +  L  +++++N
Sbjct  736  NLSLAHNKFEGSIPESIGQLVNLAELDLSHN  766


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P+ + +   LE +    N   G +P   G L  L  L L  NS SG  P  I N++ 
Sbjct  89   GSLPQELAQLRRLEVIDFRFNDFGGDVPSWFGFLGELQFLNLRNNSFSGFGPTSIANMSK  148

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N+L+G IP+ I N+  L  +++  N
Sbjct  149  LEMLDLSYNSLQGKIPDEIGNLHNLKRLSLQFN  181


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G+LP ++GNL+ + +L L+ NS  G +P+E+  L  L+++    N+  G +P     +
Sbjct  63   LAGNLPPDMGNLSCVMSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWFGFL  122

Query  35   STLTYINMANN  3
              L ++N+ NN
Sbjct  123  GELQFLNLRNN  133


 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++    +L  L ++ NQ++G++P  IGNLT L +L +  N+LS  IP  +  LN 
Sbjct  626  GPIPENLCGLQNLNGLLLYQNQISGAIPDCIGNLTALRSLYIGNNNLSSGIPPSLWRLND  685

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G++   I N+ T T ++++ N
Sbjct  686  LLQLNLTSNVLVGSLSPDIGNLKTATVLDLSMN  718



>ref|XP_011078428.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1153

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            +MCS   +L+E++ + N+L G +P  IGECS+L+   +  N + G +PR +GNLTML N 
Sbjct  335  DMCSGSSRLQEVFFHVNELVGELPERIGECSALQTWSLSYNNITGVIPRGVGNLTMLQNF  394

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINM  12
             +  N+L G IP+EIGNL  LQ+L L  NNL G+IP  IFNISTL  I +
Sbjct  395  YVGYNNLIGTIPKEIGNLQSLQVLYLGVNNLRGSIPTEIFNISTLQSITV  444


 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I +CS L  L +  N+ +GS+P  IGNLT L  L L  N L+G+IP E+G+L  
Sbjct  234  GQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRN  293

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            L+ L + +N L+G+IP TIFNIS+L YIN+AN
Sbjct  294  LKELGMGDNFLKGSIPSTIFNISSLQYINIAN  325


 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P   G    L++L + +N  +G  P  I N++ L  L L+ NSL G+IP EIGNL+ 
Sbjct  113  GDVPSWFGFLGELQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYNSLQGKIPDEIGNLHN  172

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N  +G IP TIFNIS+L  + +  N
Sbjct  173  LKRLSLQFNKFDGLIPTTIFNISSLESLALTGN  205


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 60/118 (51%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + L+  Y+  N L G++P+EIGNL  L  L L  N+L G IP EI N++ 
Sbjct  379  GVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNLQSLQVLYLGVNNLRGSIPTEIFNIST  438

Query  101  LQILR-------------------------LDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ +                          L++NNL G IP++I N S LT I+ + N
Sbjct  439  LQSITVLMNQLSGQLPSNFGHGLPNIEEIYLNDNNLSGEIPDSIANSSKLTIISFSGN  496


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG  ++LE LY+  N L G +P E+G+L  L  L + +N L G IP  I N++ 
Sbjct  258  GSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISS  317

Query  101  LQILRLDNNNLEGTIP  54
            LQ + + N NL G +P
Sbjct  318  LQYINIANCNLTGALP  333


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = -1

Query  275  IPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +P S+G  S SLEY Y ++  L GS+P E GNLT L  L L  N L+G IP+ + NL  L
Sbjct  555  LPVSVGNLSNSLEYFYGYNCGLYGSIPDEFGNLTNLFLLSLYGNQLTGSIPKTLVNLQKL  614

Query  98   QILRLDNNNLEGTIPETI  45
            Q L L  N + G IPE +
Sbjct  615  QGLALMRNRISGPIPEDL  632


 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++   IG   +   L +  NQ +G++P  +G++  L NL L  N   G IP  IG L  
Sbjct  697  GSLSPDIGNLKTATVLDLSMNQFSGTIPPSVGDMHDLINLSLAHNKFEGSIPESIGQLVN  756

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +NNL G IP ++  I  LTY N++ N
Sbjct  757  LAELDLSHNNLSGNIPRSLERILYLTYFNVSFN  789


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P  +G  + L  L +  N  +GSLP+E+  L  L  +    N   G++P   G L  
Sbjct  65   GNLPPDMGNLTFLVSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWFGFLGE  124

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L NN+  G  P +I N+S L  ++++ N
Sbjct  125  LQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYN  157


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 55/118 (47%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQ-------------------  159
            G IP+ IG   SL+ LY+  N L GS+P EI N++ L ++                    
Sbjct  403  GTIPKEIGNLQSLQVLYLGVNNLRGSIPTEIFNISTLQSITVLMNQLSGQLPSNFGHGLP  462

Query  158  ------LTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                  L +N+LSGEIP  I N + L I+    NN  G +P ++  +S L  I +  N
Sbjct  463  NIEEIYLNDNNLSGEIPDSIANSSKLTIISFSGNNFTGLVPNSLGELSFLQDIYLGEN  520


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP   G  ++L  L ++ NQL GS+P+ + NL  L  L L  N +SG IP ++  L  
Sbjct  578  GSIPDEFGNLTNLFLLSLYGNQLTGSIPKTLVNLQKLQGLALMRNRISGPIPEDLCGLQN  637

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N + G IP+ I N++ L  + + NN
Sbjct  638  LNGLLLHQNQISGAIPDCIGNLTALRSLYIGNN  670


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 58/116 (50%), Gaps = 23/116 (20%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDN----------------QLN-------GSLPREIGNLTML  171
            G IP  IG  ++L  LY+ +N                QLN       GSL  +IGNL   
Sbjct  650  GAIPDCIGNLTALRSLYIGNNNLSSVSPSLWRLNDLLQLNLTSNVLVGSLSPDIGNLKTA  709

Query  170  NNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L+ N  SG IP  +G+++ L  L L +N  EG+IPE+I  +  L  +++++N
Sbjct  710  TVLDLSMNQFSGTIPPSVGDMHDLINLSLAHNKFEGSIPESIGQLVNLAELDLSHN  765


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G+   L  L +  N+  GS+P  IG L  L  L L+ N+LSG IPR +  +  
Sbjct  721  GTIPPSVGDMHDLINLSLAHNKFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSLERILY  780

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N+L G IP
Sbjct  781  LTYFNVSFNDLSGEIP  796


 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-GNLN  105
            G IP  IG   +L+ L +  N+ +G +P  I N++ L +L LT NSLSG++  ++ G+L 
Sbjct  161  GKIPDEIGNLHNLKRLSLQFNKFDGLIPTTIFNISSLESLALTGNSLSGDLQGDLCGSLP  220

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L L +N L+G IP  I   S L  +++++N
Sbjct  221  RLIELYLSSNELDGQIPSNISQCSQLRLLSLSHN  254


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P+ + +   LE +    N   G +P   G L  L  L L  NS SG  P  I N++ 
Sbjct  89   GSLPQELAQLRRLEVIDFRFNDFGGDVPSWFGFLGELQFLNLRNNSFSGFGPTSIANMSK  148

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N+L+G IP+ I N+  L  +++  N
Sbjct  149  LEMLDLSYNSLQGKIPDEIGNLHNLKRLSLQFN  181


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G+LP ++GNLT L +L L+ NS  G +P+E+  L  L+++    N+  G +P     +
Sbjct  63   LAGNLPPDMGNLTFLVSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWFGFL  122

Query  35   STLTYINMANN  3
              L ++N+ NN
Sbjct  123  GELQFLNLRNN  133



>ref|XP_007019777.1| Leucine-rich receptor protein kinase family protein [Theobroma 
cacao]
 gb|EOY17002.1| Leucine-rich receptor protein kinase family protein [Theobroma 
cacao]
Length=247

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P S+   S+++ L +W N L+G++PR IGNLT L +L+L  NSL GEIP EIGNL  
Sbjct  34   GKVP-SMSLDSNIKVLQLWGNHLSGNIPRSIGNLTRLEDLELDYNSLEGEIPSEIGNLIK  92

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+I    + +L G IP +IFNIS+L YI + NN
Sbjct  93   LEIFYAADMHLSGQIPPSIFNISSLKYIGVQNN  125


 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIPRSIG  + LE L +  N L G +P EIGNL  L      +  LSG+IP  I N++ 
Sbjct  57   GNIPRSIGNLTRLEDLELDYNSLEGEIPSEIGNLIKLEIFYAADMHLSGQIPPSIFNISS  116

Query  101  LQILRLDNNNLEGTIP  54
            L+ + + NN+L G +P
Sbjct  117  LKYIGVQNNSLSGKLP  132


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  251  SSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNN  72
            S+LE L +W N L G++P  I N   L  L L +NS SG IPR IGNL  ++ L L+ N+
Sbjct  138  SNLEVLRLWGNYLCGNIPDCIFNAWKLKILSLNQNSFSGLIPRSIGNLTKIKELYLEENS  197

Query  71   LEG  63
             EG
Sbjct  198  FEG  200



>ref|XP_002527075.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF35319.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=1089

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  + +C  L  L +  N+  GS+PR IGNLT L  L L  N+L+G IP EIGNL  
Sbjct  254  GQIPSDLYKCKELRSLALHANKFTGSIPRTIGNLTKLKWLSLGRNNLTGRIPLEIGNLQN  313

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQI+ L  NNL G+IP  +FNIST+ +I M +N
Sbjct  314  LQIVHLSFNNLNGSIPHALFNISTMKWIAMTSN  346


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG    L+ LY+  N L+GS+P E+ +L  L NL+LT N LSG IP    NL  
Sbjct  503  GRIPTTIGTLKHLQGLYLHGNDLDGSIPSELCDLRTLYNLELTGNKLSGSIPTCFSNLTS  562

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N    TI  T++ +  +  +N+A+N
Sbjct  563  LRNLFLASNRFVSTISSTLWTLKDILQVNLASN  595


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  I    ++  + +  NQL+G +P  IG L  L  L L+ N L G IP+ +G++  
Sbjct  599  GSLPSEIENLRAVYMINISKNQLSGEIPISIGGLQDLAQLYLSGNKLQGPIPQSVGDIKS  658

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +NNL G IP+++ N+  L Y N++ N
Sbjct  659  LEFLDLSSNNLSGMIPKSLDNLLYLKYFNVSFN  691


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P S+G  S SLE     D  + GS+   IGNL+ L  L L  N L+G IP  IG L 
Sbjct  454  GYLPHSVGNLSNSLESFLASDGLIKGSVHESIGNLSSLTRLNLGNNDLTGRIPTTIGTLK  513

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L  N+L+G+IP  + ++ TL  + +  N
Sbjct  514  HLQGLYLHGNDLDGSIPSELCDLRTLYNLELTGN  547


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG    L  LY+  N+L G +P+ +G++  L  L L+ N+LSG IP+ + NL  
Sbjct  623  GEIPISIGGLQDLAQLYLSGNKLQGPIPQSVGDIKSLEFLDLSSNNLSGMIPKSLDNLLY  682

Query  101  LQILRLDNNNLEGTIPE--TIFNISTLTYI  18
            L+   +  N L+G IPE  +  N S  ++I
Sbjct  683  LKYFNVSFNYLQGEIPEGGSFSNFSAQSFI  712


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            N L GSLP EI NL  +  + +++N LSGEIP  IG L  L  L L  N L+G IP+++ 
Sbjct  595  NYLTGSLPSEIENLRAVYMINISKNQLSGEIPISIGGLQDLAQLYLSGNKLQGPIPQSVG  654

Query  41   NISTLTYINMANN  3
            +I +L ++++++N
Sbjct  655  DIKSLEFLDLSSN  667


 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++  SIG  SSL  L + +N L G +P  IG L  L  L L  N L G IP E+ +L  
Sbjct  479  GSVHESIGNLSSLTRLNLGNNDLTGRIPTTIGTLKHLQGLYLHGNDLDGSIPSELCDLRT  538

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP    N+++L  + +A+N
Sbjct  539  LYNLELTGNKLSGSIPTCFSNLTSLRNLFLASN  571


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR+IG  + L++L +  N L G +P EIGNL  L  + L+ N+L+G IP  + N++ 
Sbjct  278  GSIPRTIGNLTKLKWLSLGRNNLTGRIPLEIGNLQNLQIVHLSFNNLNGSIPHALFNIST  337

Query  101  LQILRLDNNNLEGTIPETI  45
            ++ + + +NNL G +P ++
Sbjct  338  MKWIAMTSNNLLGNLPTSL  356


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  IG  S L ++ M +N  +G LP E+GNL  L  +  + NS  GEIP  +  L  
Sbjct  85   GIVPPHIGNLSFLVHIDMSNNSYSGHLPNELGNLHRLKFMNFSNNSFVGEIPSSLAMLPK  144

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L NN+L      +IFNI+TL  +++ +N
Sbjct  145  LQHLLLANNSLTAG-RSSIFNITTLNTLDLNDN  176


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            + G +P  IGNL+ L ++ ++ NS SG +P E+GNL+ L+ +   NN+  G IP ++  +
Sbjct  83   IKGIVPPHIGNLSFLVHIDMSNNSYSGHLPNELGNLHRLKFMNFSNNSFVGEIPSSLAML  142

Query  35   STLTYINMANN  3
              L ++ +ANN
Sbjct  143  PKLQHLLLANN  153


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G IP  IG   +L+ +++  N LNGS+P  + N++ +  + +T N+L G +P  +G +L 
Sbjct  302  GRIPLEIGNLQNLQIVHLSFNNLNGSIPHALFNISTMKWIAMTSNNLLGNLPTSLGLHLP  361

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L L  N L G IP  I N S LT + + +N
Sbjct  362  NLIWLYLGINKLSGPIPSYISNASKLTILELPSN  395


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIG-NLTMLNNLQLTENSLSGEIPREIGNLN  105
            G+IP ++   S+++++ M  N L G+LP  +G +L  L  L L  N LSG IP  I N +
Sbjct  326  GSIPHALFNISTMKWIAMTSNNLLGNLPTSLGLHLPNLIWLYLGINKLSGPIPSYISNAS  385

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L IL L +N+  G IP+++ ++  L  + +  N
Sbjct  386  KLTILELPSNSFTGFIPDSLGDLRNLQTLKLGAN  419


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNL-TMLNNLQLTENSLSGEIPREIGNLN  105
            G+ P  I +  SL+++Y+  N L+G+L   + N  + L  L L  N L G+IP ++    
Sbjct  205  GSFPPKILDLPSLKFIYLQVNNLSGNLKEILCNQNSKLQLLNLAGNQLYGQIPSDLYKCK  264

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L  N   G+IP TI N++ L ++++  N
Sbjct  265  ELRSLALHANKFTGSIPRTIGNLTKLKWLSLGRN  298



>ref|XP_006494781.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Citrus sinensis]
Length=463

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR  G  + LE + +W+N L G++PRE+GNLT L  L+L EN L+GEIP EIGNL  
Sbjct  124  GEIPREFGNLADLEQMSLWENNLRGAIPRELGNLTGLGFLELGENFLTGEIPLEIGNLQN  183

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L+ L L  N L G +P  IFN+STL
Sbjct  184  LEELDLRQNKLVGIVPAAIFNVSTL  208


 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I R +G  + LE L ++ N L G++P+EIGNLT L  L L  N L GEIPRE GNL  
Sbjct  76   GGIQRELGNLTKLEGLQLFQNNLIGAIPKEIGNLTKLKELSLGGNRLQGEIPREFGNLAD  135

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L  NNL G IP  + N++ L ++ +  N
Sbjct  136  LEQMSLWENNLRGAIPRELGNLTGLGFLELGEN  168


 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR IG  + L+ LY+  N+L G  PRE  NL  L ++ L  N+L G I RE+GNL  
Sbjct  28   GAVPREIGNLTKLKELYLGVNRLQGETPREFSNLADLEHMSLAGNNLQGGIQRELGNLTK  87

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L+L  NNL G IP+ I N++ L  +++  N
Sbjct  88   LEGLQLFQNNLIGAIPKEIGNLTKLKELSLGGN  120


 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ L +  N+L G +PRE GNL  L  + L EN+L G IPRE+GNL  
Sbjct  100  GAIPKEIGNLTKLKELSLGGNRLQGEIPREFGNLADLEQMSLWENNLRGAIPRELGNLTG  159

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP  I N+  L  +++  N
Sbjct  160  LGFLELGENFLTGEIPLEIGNLQNLEELDLRQN  192


 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G  PR     + LE++ +  N L G + RE+GNLT L  LQL +N+L G IP+EIGNL  
Sbjct  52   GETPREFSNLADLEHMSLAGNNLQGGIQRELGNLTKLEGLQLFQNNLIGAIPKEIGNLTK  111

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L+G IP    N++ L  +++  N
Sbjct  112  LKELSLGGNRLQGEIPREFGNLADLEQMSLWEN  144


 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C+ L  L +  N  +G++PREIGNLT L  L L  N L GE PRE  NL  
Sbjct  4    GGIPSTLSNCTYLRILSLAYNDFSGAVPREIGNLTKLKELYLGVNRLQGETPREFSNLAD  63

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L  NNL+G I   + N++ L  + +  N
Sbjct  64   LEHMSLAGNNLQGGIQRELGNLTKLEGLQLFQN  96


 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+YL + DN+L GS+P +I  L  L  L+L  N LSG IP   GNL  
Sbjct  372  GSIPIALGKLQKLQYLGLEDNKLEGSIPDDICRLDELYELELGGNKLSGSIPACFGNLIA  431

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L  +IP T +N+  +  +N+++N
Sbjct  432  LRILSLGSNELT-SIPLTFWNLKDILQLNISSN  463


 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 57/118 (48%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + L +L + +N L G +P EIGNL  L  L L +N L G +P  I N++ 
Sbjct  148  GAIPRELGNLTGLGFLELGENFLTGEIPLEIGNLQNLEELDLRQNKLVGIVPAAIFNVST  207

Query  101  LQI-----------------LRLDN--------NNLEGTIPETIFNISTLTYINMANN  3
            L++                 +RL N        NN  GTIP  IFN S L+ + +  N
Sbjct  208  LKLLQLQNNSLLGCLSSIADVRLPNLEELSLWGNNFNGTIPRFIFNASKLSILELVGN  265


 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 49/86 (57%), Gaps = 5/86 (6%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE L +W N  NG++PR I N + L+ L+L  NS SG IP   GNL  L+ L L +N L 
Sbjct  233  LEELSLWGNNFNGTIPRFIFNASKLSILELVGNSFSGFIPNTFGNLRNLERLNLQDNYLT  292

Query  65   GTIPETIF-----NISTLTYINMANN  3
             + PE  F     N  +LT I ++NN
Sbjct  293  SSTPELSFLSSLSNCKSLTLIALSNN  318


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPR-SIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            GN+ + S+G  S SLE   M++  ++G +  EI NLT L  + L  N L+G IP  +G L
Sbjct  322  GNLRKTSVGNLSHSLEIFLMYNCNISGGISEEISNLTNLTTINLGGNKLNGSIPIALGKL  381

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              LQ L L++N LEG+IP+ I  +  L  + +  N
Sbjct  382  QKLQYLGLEDNKLEGSIPDDICRLDELYELELGGN  416


 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I   I   ++L  + +  N+LNGS+P  +G L  L  L L +N L G IP +I  L+ 
Sbjct  348  GGISEEISNLTNLTTINLGGNKLNGSIPIALGKLQKLQYLGLEDNKLEGSIPDDICRLDE  407

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP    N+  L  +++ +N
Sbjct  408  LYELELGGNKLSGSIPACFGNLIALRILSLGSN  440


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G +P  + N T L  L L  N  SG +PREIGNL  L+ L L  N L+G  P    N+
Sbjct  2    LYGGIPSTLSNCTYLRILSLAYNDFSGAVPREIGNLTKLKELYLGVNRLQGETPREFSNL  61

Query  35   STLTYINMANN  3
            + L ++++A N
Sbjct  62   ADLEHMSLAGN  72



>emb|CBI31777.3| unnamed protein product [Vitis vinifera]
Length=628

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             +IP  I +C  L  LY+++N+L GS+P+ IGNL+ L  L L  N L+GEIPREI +L  
Sbjct  114  ASIPNEIAKCRELRQLYLFNNRLTGSIPQAIGNLSKLEQLYLGGNQLTGEIPREISHLLS  173

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L+IL   +NNL  +IP  IFNIS+L YI
Sbjct  174  LKILSFRSNNLTASIPSAIFNISSLQYI  201


 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQ---LTENSLSGEIPREIGN  111
            G+IPR IG  S LE LY+  N L G +P+ + NL+ L  LQ   L++N L GEIP  + N
Sbjct  219  GSIPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSSLPRLQVINLSQNQLKGEIPPSLSN  278

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               LQ L L+ N ++G IP+ + ++S L Y+++A+N
Sbjct  279  CGELQTLYLEKNKIQGNIPKELGHLSELQYLSLASN  314


 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 66/125 (53%), Gaps = 33/125 (26%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLS------------  138
            G+IP++IG  S LE LY+  NQL G +PREI +L  L  L    N+L+            
Sbjct  138  GSIPQAIGNLSKLEQLYLGGNQLTGEIPREISHLLSLKILSFRSNNLTASIPSAIFNISS  197

Query  137  ---------------------GEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTY  21
                                 G IPR IG+L++L++L L +NNLEG IP+T+FN+S+L  
Sbjct  198  LQYIGKCGRLEEISLSFNEFMGSIPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSSLPR  257

Query  20   INMAN  6
            + + N
Sbjct  258  LQVIN  262


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 19/112 (17%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE-IPREIGNLN  105
            G IP S+  C  L+ LY+  N++ G++P+E+G+L+ L  L L  N L+G  IP  I N+ 
Sbjct  270  GEIPPSLSNCGELQTLYLEKNKIQGNIPKELGHLSELQYLSLASNILTGGIIPASISNIT  329

Query  104  MLQILRLDNN------------------NLEGTIPETIFNISTLTYINMANN  3
             L  L L  N                    +G IP  I N++ L  + + +N
Sbjct  330  KLTRLDLSYNLLTGFLGFLTSFINASACQFKGVIPAGIGNLTNLIELGLGDN  381


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++  ++GNL+ L  L L+ NS    IP EI     L+ L L NN L G+IP+ I N+
Sbjct  88   LEGTIAPQVGNLSFLVTLDLSNNSFHASIPNEIAKCRELRQLYLFNNRLTGSIPQAIGNL  147

Query  35   STLTYINMANN  3
            S L  + +  N
Sbjct  148  SKLEQLYLGGN  158



>ref|XP_006480346.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X4 [Citrus sinensis]
Length=1238

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  ++L+ L +++N+  G++P+EIGN T L  L L+ N L GEIP EIGNL  
Sbjct  405  GTIPKEIGNLTNLKELSLYNNRFKGTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRD  464

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G +P TIFN+STL    ++NN
Sbjct  465  LEWLELSDNKLVGVVPATIFNLSTLKVFAVSNN  497


 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  LY+  NQ  G++P+EIG LT L+ L L +N   GEIP+E+GNL  
Sbjct  185  GEIPSTLSNCRQLRKLYLSLNQFTGAIPKEIGKLTRLSVLSLRDNKFQGEIPQELGNLAK  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L GTIP +IF  S L Y++++NN
Sbjct  245  LEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNN  277


 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L++  N LNG++P  I   + L  L L+ NSL GEIP E+GNL  
Sbjct  233  GEIPQELGNLAKLEQLWLQSNFLNGTIPSSIFKFSFLLYLDLSNNSLRGEIPHELGNLAE  292

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y++ +NN
Sbjct  293  LETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNN  325


 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + LE L + +N L G++P  I  L+ L  L  + N+L GEIP E+GNL  
Sbjct  281  GEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAE  340

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L GTIP +IF +S+L Y+  +NN
Sbjct  341  LETLSLQNNSLTGTIPSSIFKLSSLLYLGFSNN  373


 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 59/121 (49%), Gaps = 28/121 (23%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYL----------------------YMWDN------QLNGSLPREIG  186
            G IP SI + SSL YL                      Y W N        NG++P+EIG
Sbjct  353  GTIPSSIFKLSSLLYLGFSNNSLRGKLEGKVENLESLCYRWRNLKGNYFTGNGTIPKEIG  412

Query  185  NLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            NLT L  L L  N   G IP+EIGN   L+ L L NN LEG IP  I N+  L ++ +++
Sbjct  413  NLTNLKELSLYNNRFKGTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRDLEWLELSD  472

Query  5    N  3
            N
Sbjct  473  N  473


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ L + +N+L G +P EIGNL  L  L+L++N L G +P  I NL+ 
Sbjct  429  GTIPKEIGNFTKLKELILSNNRLEGEIPHEIGNLRDLEWLELSDNKLVGVVPATIFNLST  488

Query  101  LQILRLDN-------------------------NNLEGTIPETIFNISTLTYINMANN  3
            L++  + N                         NN  GTIP  IFN S L+ + + +N
Sbjct  489  LKVFAVSNNSLSGSLQSSADVQLPNLEGIYLWGNNFSGTIPSFIFNASKLSTLALGDN  546


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI + SSL YL   +N L G +P E+GNL  L  L L  NSL+G IP  I  L+ 
Sbjct  305  GTIPSSIFKLSSLLYLDFSNNNLRGEIPHELGNLAELETLSLQNNSLTGTIPSSIFKLSS  364

Query  101  LQILRLDNNNLEGTIPETIFNISTLTY  21
            L  L   NN+L G +   + N+ +L Y
Sbjct  365  LLYLGFSNNSLRGKLEGKVENLESLCY  391


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = -1

Query  245  LEY---LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNN  75
            LEY   L    N L G LP EIGNL +L  +  + N+ SG IP  IG L  LQ L L +N
Sbjct  734  LEYIMNLNFSSNFLTGPLPLEIGNLKVLVGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  793

Query  74   NLEGTIPETIFNISTLTYINMANN  3
             LEG+IP  I ++ +L Y++++NN
Sbjct  794  KLEGSIPNPIGDLISLEYLDLSNN  817


 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG  + L+YL +  N+L GS+P  IG+L  L  L L+ N+LSG IP  +  L  
Sbjct  773  GAIPTTIGGLAYLQYLLLGHNKLEGSIPNPIGDLISLEYLDLSNNNLSGPIPVSLEKLLY  832

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  NNLEG IP+
Sbjct  833  LKDLNLSFNNLEGEIPK  849


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG  +SL  L +  N+L   +P  + NL  + NL  + N L+G +P EIGNL +L
Sbjct  702  SIPTCIGNLTSLRTLSLGSNELISVIPSTLWNLEYIMNLNFSSNFLTGPLPLEIGNLKVL  761

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +    NN  G IP TI  ++ L Y+ + +N
Sbjct  762  VGIDFSMNNFSGAIPTTIGGLAYLQYLLLGHN  793


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L +L L+ N LSG IP  I ++N LQIL L +N L G+ P +I N+
Sbjct  86   LTGTIPSQLGNLSSLQSLNLSHNRLSGAIPSSIFSINSLQILDLSDNQLSGSFPSSISNM  145

Query  35   STLTYINMANN  3
            S+LT+I+ ++N
Sbjct  146  SSLTFIDFSSN  156


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L   DN+L GS+P ++ +L  L  L L  N LS  IP  IGNL  
Sbjct  653  GSIPITLGKLQKLQLLSFRDNKLEGSIPEDVCSLAELYQLHLGGNKLSRSIPTCIGNLTS  712

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L   IP T++N+  +  +N ++N
Sbjct  713  LRTLSLGSNELISVIPSTLWNLEYIMNLNFSSN  745


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE +Y+W N  +G++P  I N + L+ L L +NS  G IP   GNL  L+   ++NN L 
Sbjct  514  LEGIYLWGNNFSGTIPSFIFNASKLSTLALGDNSFFGFIPNTFGNLGNLRRFNIENNYLT  573

Query  65   GTIPETIF  42
             + PE  F
Sbjct  574  SSTPELNF  581



>ref|XP_011091709.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1195

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +   CS L+ L + DN+  G +PREIGNLTML  L+L  N L+GEIPRE+G L  
Sbjct  362  GPIPSTWDGCSRLQDLSLRDNKFTGFIPREIGNLTMLRTLRLFHNRLTGEIPRELGKLQQ  421

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G+IPE I NISTLT + +  N
Sbjct  422  LEQLHLAANLLNGSIPEEIANISTLTLLALTAN  454


 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 0/111 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL  L+ + L  N L G IP S  EC  L  L + +N   G +PREIGN+TML  L
Sbjct  221  DICGRLPGLQTISLSWNALSGRIPVSFPECRRLTLLSLSNNAFAGPIPREIGNVTMLETL  280

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMA  9
             L  N+L+G++P EIGNL  LQ L +  N   G+IP +IFNIS+L  +N+A
Sbjct  281  YLGANNLTGDVPEEIGNLRRLQQLGMGKNIFSGSIPLSIFNISSLVLLNLA  331


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 59/118 (50%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG  + L  L ++ N+L G +PRE+G L  L  L L  N L+G IP EI N++ 
Sbjct  386  GFIPREIGNLTMLRTLRLFHNRLTGEIPRELGKLQQLEQLHLAANLLNGSIPEEIANIST  445

Query  101  LQILRLDNNNLEGT-------------------------IPETIFNISTLTYINMANN  3
            L +L L  N L G+                         IP++I N S LTYIN+ NN
Sbjct  446  LTLLALTANRLSGSLPKSIGSRLPDLDLISLETNLLSGHIPDSIANSSKLTYINLGNN  503


 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  S ++ L + +N  +G +P  I NL+ L  L L+ NSL G++P +IG L  
Sbjct  120  GHIPASLGFLSKIQGLSLRNNNFSGFIPATIFNLSKLEMLDLSFNSLGGKLPEQIGKLQN  179

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L + NN L G+IP  ++N+S L  + +  N
Sbjct  180  LMVLSIQNNQLTGSIPFELYNVSKLEMLALTRN  212


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  + M  N   G+LP E+  L  L  L L+ N+ +G IP  +G L+ 
Sbjct  72   GTIPPHLGNLSFLVSIDMKGNSFQGNLPVELAQLRRLRFLDLSSNNFTGHIPASLGFLSK  131

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +Q L L NNN  G IP TIFN+S L  ++++ N
Sbjct  132  IQGLSLRNNNFSGFIPATIFNLSKLEMLDLSFN  164


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -1

Query  275  IPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +P SIG  S SL     W++ + GS+P EI NLT L  L L+ N LSG +P  +G+L +L
Sbjct  558  LPPSIGNLSTSLRVFLAWNSTIKGSIPNEISNLTSLVELDLSSNDLSGFLPSGLGSLALL  617

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            Q L L +N + G+IP  I  ++ L  + ++NN
Sbjct  618  QGLSLSDNRISGSIPAGICELTNLGELRLSNN  649


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG  + LE LY+  N L G +P EIGNL  L  L + +N  SG IP  I N++ 
Sbjct  265  GPIPREIGNVTMLETLYLGANNLTGDVPEEIGNLRRLQQLGMGKNIFSGSIPLSIFNISS  324

Query  101  LQILRLDNNNLEGTIPETIF-NISTLTYINMANN  3
            L +L L  + L GT+P  +  ++  L ++N+ NN
Sbjct  325  LVLLNLAWSGLSGTLPSHMCSHLPNLQFLNLYNN  358


 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-GNLN  105
            G +P  IG+  +L  L + +NQL GS+P E+ N++ L  L LT N LSGE+P +I G L 
Sbjct  168  GKLPEQIGKLQNLMVLSIQNNQLTGSIPFELYNVSKLEMLALTRNRLSGELPDDICGRLP  227

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ + L  N L G IP +      LT ++++NN
Sbjct  228  GLQTISLSWNALSGRIPVSFPECRRLTLLSLSNN  261


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSI-GECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P  I G    L+ + +  N L+G +P        L  L L+ N+ +G IPREIGN+ 
Sbjct  216  GELPDDICGRLPGLQTISLSWNALSGRIPVSFPECRRLTLLSLSNNAFAGPIPREIGNVT  275

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ML+ L L  NNL G +PE I N+  L  + M  N
Sbjct  276  MLETLYLGANNLTGDVPEEIGNLRRLQQLGMGKN  309


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 56/118 (47%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG----  114
            G IPR +G+   LE L++  N LNGS+P EI N++ L  L LT N LSG +P+ IG    
Sbjct  410  GEIPRELGKLQQLEQLHLAANLLNGSIPEEIANISTLTLLALTANRLSGSLPKSIGSRLP  469

Query  113  ---------------------NLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                                 N + L  + L NN+  GTIP  + ++  L  + +  N
Sbjct  470  DLDLISLETNLLSGHIPDSIANSSKLTYINLGNNHFSGTIPSKLGSLRLLQRLFVHGN  527


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I   +SL  L +  N L+G LP  +G+L +L  L L++N +SG IP  I  L  
Sbjct  581  GSIPNEISNLTSLVELDLSSNDLSGFLPSGLGSLALLQGLSLSDNRISGSIPAGICELTN  640

Query  101  LQILRLDNNNLEGTIPETIFN  39
            L  LRL NN +   IP  I N
Sbjct  641  LGELRLSNNQISSQIPGCIGN  661


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +G  + L+ L + DN+++GS+P  I  LT L  L+L+ N +S +IP  IGN   
Sbjct  605  GFLPSGLGSLALLQGLSLSDNRISGSIPAGICELTNLGELRLSNNQISSQIPGCIGNGIS  664

Query  101  LQILRLDNNNLEGTIPETIFNI  36
            L+ L LD N L   IP +++++
Sbjct  665  LRQLYLDTNRLSWGIPSSLWSL  686


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            NIP ++G  ++L    +  N+L GS+P   GN+  L  L L  N+LSG IP+ +  L  L
Sbjct  726  NIPITVGGLNNLINFSLSHNRLLGSIPNTTGNMISLEVLDLAHNNLSGSIPKSLEALKHL  785

Query  98   QILRLDNNNLEGTIP  54
            +I  +  N+L G IP
Sbjct  786  EIFNVSYNSLSGEIP  800


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            NQ   ++P  +G L  L N  L+ N L G IP   GN+  L++L L +NNL G+IP+++ 
Sbjct  721  NQFTQNIPITVGGLNNLINFSLSHNRLLGSIPNTTGNMISLEVLDLAHNNLSGSIPKSLE  780

Query  41   NISTLTYINMANN  3
             +  L   N++ N
Sbjct  781  ALKHLEIFNVSYN  793


 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSG-EIPREIGNLN  105
            G+IP SI   S L Y+ + +N  +G++P ++G+L +L  L +  N+L+G      + N  
Sbjct  483  GHIPDSIANSSKLTYINLGNNHFSGTIPSKLGSLRLLQRLFVHGNNLTGLSFITSLANCR  542

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L    + NN  +  +P +I N+ST   + +A N
Sbjct  543  FLTDFWMHNNRADDFLPPSIGNLSTSLRVFLAWN  576



>emb|CDP09585.1| unnamed protein product [Coffea canephora]
Length=1101

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L  LY +DN+L G +P EIGNL ML +L  + N L+G IP +IGNL+ 
Sbjct  407  GAIPNEIGNLTMLTILYFYDNKLTGVIPAEIGNLAMLMDLDFSNNKLTGGIPEKIGNLHR  466

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN L G+IP  IFNIS+L +I +  N
Sbjct  467  LEELYLYNNALSGSIPAAIFNISSLQHIGLDQN  499


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SI   S+LE L +  N + G++P E  NL  L NL +  N LSG +P  + NL+ 
Sbjct  160  GSIPPSISNMSNLETLLLSFNFIEGTVPIEFQNLHNLKNLLIEYNQLSGPLPLHVFNLSS  219

Query  101  LQILRLDNNNLEGTIPE  51
            LQI+   +N+L G +P+
Sbjct  220  LQIISFMSNSLSGILPD  236


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 53/107 (50%), Gaps = 14/107 (13%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGN-----------LTMLNNLQ---LTENS  144
            GNIP  I   SSL  L    N+L GS+PR I N           L  + +LQ   L+ N 
Sbjct  603  GNIPDGISNLSSLVELEFSGNELIGSVPRTIHNSNRLTSMIPTNLLSMKDLQILNLSSNF  662

Query  143  LSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LSG +P EIGNL     L +  N L   IP TI  +  L  +++ANN
Sbjct  663  LSGSLPLEIGNLKAAYSLDISFNQLSDKIPTTIGELQALQSLSLANN  709


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP ++     L+ L +  N L+GSLP EIGNL    +L ++ N LS +IP  IG L  LQ
Sbjct  643  IPTNLLSMKDLQILNLSSNFLSGSLPLEIGNLKAAYSLDISFNQLSDKIPTTIGELQALQ  702

Query  95   ILRLDNNNLEGTI  57
             L L NNNL+G +
Sbjct  703  SLSLANNNLQGQL  715


 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 54/95 (57%), Gaps = 6/95 (6%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN--L  108
            G IP  IG    LE LY+++N L+GS+P  I N++ L ++ L +N  SG IP  + N  L
Sbjct  455  GGIPEKIGNLHRLEELYLYNNALSGSIPAAIFNISSLQHIGLDQNKFSGTIPLTVSNNKL  514

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + L+ L L+      +IP ++ ++  L Y+ +  N
Sbjct  515  SNLESLFLE----RSSIPTSLASLRNLKYLYLDYN  545


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +G  S L  L +  N  +G LP E+ +L  L  L    N+L GE+P   G L  
Sbjct  88   GTLPPQLGNLSFLVSLNISRNNFHGELPGELVHLRRLRYLDFGINNLGGELPSWFGFLYK  147

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            LQ L L NN+  G+IP +I N+S L
Sbjct  148  LQFLSLGNNSFMGSIPPSISNMSNL  172


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIP--------  126
            G IP ++ +CS L YL   +N+L+G +P  I NLTML  L L  N+L+G+I         
Sbjct  257  GRIPSTVSQCSLLRYLASSENRLSGPIPMGIANLTMLEELYLESNNLTGKIYLISLCFCS  316

Query  125  ---REIGNLNMLQILRLDNN---------------NLEGTIPETIFNISTLTYINMANN  3
               R   N      + +D++               N  G IP  I N++ LT ++  NN
Sbjct  317  SIWRFQRNRTFFLAVLIDSDEKAQPLSLSLSLSLCNFAGAIPNEIGNLTMLTALDFHNN  375


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G+LP ++GNL+ L +L ++ N+  GE+P E+ +L  L+ L    NNL G +P     +
Sbjct  86   LTGTLPPQLGNLSFLVSLNISRNNFHGELPGELVHLRRLRYLDFGINNLGGELPSWFGFL  145

Query  35   STLTYINMANN  3
              L ++++ NN
Sbjct  146  YKLQFLSLGNN  156


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 37/76 (49%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +     L YL    N L G LP   G L  L  L L  NS  G IP  I N++ 
Sbjct  112  GELPGELVHLRRLRYLDFGINNLGGELPSWFGFLYKLQFLSLGNNSFMGSIPPSISNMSN  171

Query  101  LQILRLDNNNLEGTIP  54
            L+ L L  N +EGT+P
Sbjct  172  LETLLLSFNFIEGTVP  187



>ref|XP_006442746.1| hypothetical protein CICLE_v100193952mg, partial [Citrus clementina]
 gb|ESR55986.1| hypothetical protein CICLE_v100193952mg, partial [Citrus clementina]
Length=365

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  SSL+ LY+W NQL+G +PRE+G+L+ L  L L EN LSG +P E+G L+ 
Sbjct  182  GKIPPSLGRLSSLQILYLWSNQLSGEIPRELGDLSQLVILYLPENGLSGTLPPELGKLSN  241

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +NNL G +P+   N+  LT   +A N
Sbjct  242  LQQLWLTSNNLRGDLPKDYENLKNLTIFEVAGN  274


 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G+ S L  LY+ +N L+G+LP E+G L+ L  L LT N+L G++P++  NL  
Sbjct  206  GEIPRELGDLSQLVILYLPENGLSGTLPPELGKLSNLQQLWLTSNNLRGDLPKDYENLKN  265

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L I  +  NNL G IP  I     L  +N+  N
Sbjct  266  LTIFEVAGNNLSGPIPRFIAKWVNLYSLNLMGN  298


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G   +LE L +  N L G +P  +G L+ L  L L  N LSGEIPRE+G+L+ 
Sbjct  158  GIIPTSLGNLRNLEILDLGQNLLTGKIPPSLGRLSSLQILYLWSNQLSGEIPRELGDLSQ  217

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL L  N L GT+P  +  +S L  + + +N
Sbjct  218  LVILYLPENGLSGTLPPELGKLSNLQQLWLTSN  250


 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +   + L+ L + DN ++GS+P +IG L  L  L L++N L+G IP  +GNL  
Sbjct  110  GKIPEHVAALTYLQTLDLSDNTVHGSIPYQIGYLFQLVTLDLSKNQLTGIIPTSLGNLRN  169

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L  N L G IP ++  +S+L  + + +N
Sbjct  170  LEILDLGQNLLTGKIPPSLGRLSSLQILYLWSN  202


 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG    L  L +  NQL G +P  +GNL  L  L L +N L+G+IP  +G L+ 
Sbjct  134  GSIPYQIGYLFQLVTLDLSKNQLTGIIPTSLGNLRNLEILDLGQNLLTGKIPPSLGRLSS  193

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQIL L +N L G IP  + ++S L  + +  N
Sbjct  194  LQILYLWSNQLSGEIPRELGDLSQLVILYLPEN  226



>ref|XP_008232234.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Prunus mume]
Length=1236

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  +SL YLY+++NQL+GS+P EIGNL  L +LQL+ N+LSG IP  IGNL  
Sbjct  323  GRIPPEIGHLTSLAYLYLYNNQLSGSIPNEIGNLKSLVDLQLSSNTLSGHIPPNIGNLQK  382

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP+ I N+ +L  +++ +N
Sbjct  383  LNTLYLHTNELSGYIPKEIGNLKSLMDLHLGDN  415


 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR +   S+L  L+++ NQL+G +P EIGNL  L +LQL+ N+LSG IP  IGNL  
Sbjct  419  GSIPRFLANISTLTNLFLFGNQLSGIIPNEIGNLKSLVDLQLSSNTLSGPIPLSIGNLKK  478

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L   NN L G IP+ I NI +L  + ++ N
Sbjct  479  LNTLYFHNNTLSGLIPKEIGNIKSLVNLGLSGN  511


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL  L++ DNQL GS+PR + N++ L NL L  N LSG IP EIGNL  
Sbjct  395  GYIPKEIGNLKSLMDLHLGDNQLRGSIPRFLANISTLTNLFLFGNQLSGIIPNEIGNLKS  454

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L +N L G IP +I N+  L  +   NN
Sbjct  455  LVDLQLSSNTLSGPIPLSIGNLKKLNTLYFHNN  487


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG    L  LY  +N L+G +P+EIGN+  L NL L+ N L   IP   GNL+ 
Sbjct  467  GPIPLSIGNLKKLNTLYFHNNTLSGLIPKEIGNIKSLVNLGLSGNQLHDSIPTSFGNLSN  526

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L G+IP+ + N+  L  +++  N
Sbjct  527  LEILHLRDNRLSGSIPQELENLKNLIQLHLDTN  559


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I  + G+C  L  L M  N L GS+P EIGN T ++ L L+ N L G IP+E G L+ 
Sbjct  635  GEISHNWGQCPKLTTLLMAGNNLTGSIPLEIGNATQIHVLDLSSNHLVGLIPKEFGKLSS  694

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N L G+IP    ++S L Y++++ N
Sbjct  695  LVRLILNGNQLSGSIPSEFGSLSDLEYLDLSTN  727


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG    L  LY+  N+L+G +P+EIGNL  L +L L +N L G IPR + N++ 
Sbjct  371  GHIPPNIGNLQKLNTLYLHTNELSGYIPKEIGNLKSLMDLHLGDNQLRGSIPRFLANIST  430

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP  I N+ +L  + +++N
Sbjct  431  LTNLFLFGNQLSGIIPNEIGNLKSLVDLQLSSN  463


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG+   L YL + +N+L  ++P ++G L  LN+L L+ NSL G IP E+G++  L
Sbjct  732  SIPSVIGDLVKLHYLNLSNNKLAQTIPFKLGKLVXLNDLDLSHNSLKGRIPSEMGSMQSL  791

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L +NNL G+IP +   +  L Y++++ N
Sbjct  792  VKLDLSHNNLSGSIPSSFEEMLGLLYVDISFN  823


 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP  I   S L+YL +  NQL+G +P EIG+LT L  L L  N LSG IP EIGNL  L 
Sbjct  301  IPPQISYLSKLDYLDLSLNQLSGRIPPEIGHLTSLAYLYLYNNQLSGSIPNEIGNLKSLV  360

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+L +N L G IP  I N+  L  + +  N
Sbjct  361  DLQLSSNTLSGHIPPNIGNLQKLNTLYLHTN  391


 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  + +  L +  N L G +P+E G L+ L  L L  N LSG IP E G+L+ 
Sbjct  659  GSIPLEIGNATQIHVLDLSSNHLVGLIPKEFGKLSSLVRLILNGNQLSGSIPSEFGSLSD  718

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N    +IP  I ++  L Y+N++NN
Sbjct  719  LEYLDLSTNKFNESIPSVIGDLVKLHYLNLSNN  751


 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   SL  L +  N L+G +P  IGNL  LN L    N+LSG IP+EIGN+  
Sbjct  443  GIIPNEIGNLKSLVDLQLSSNTLSGPIPLSIGNLKKLNTLYFHNNTLSGLIPKEIGNIKS  502

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L  +IP +  N+S L  +++ +N
Sbjct  503  LVNLGLSGNQLHDSIPTSFGNLSNLEILHLRDN  535


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP   G  S LEYL +  N+ N S+P  IG+L  L+ L L+ N L+  IP ++G L  
Sbjct  707  GSIPSEFGSLSDLEYLDLSTNKFNESIPSVIGDLVKLHYLNLSNNKLAQTIPFKLGKLVX  766

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N+L+G IP  + ++ +L  +++++N
Sbjct  767  LNDLDLSHNSLKGRIPSEMGSMQSLVKLDLSHN  799


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+  G+ SSL  L +  NQL+GS+P E G+L+ L  L L+ N  +  IP  IG+L  
Sbjct  683  GLIPKEFGKLSSLVRLILNGNQLSGSIPSEFGSLSDLEYLDLSTNKFNESIPSVIGDLVK  742

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L  TIP  +  +  L  +++++N
Sbjct  743  LHYLNLSNNKLAQTIPFKLGKLVXLNDLDLSHN  775


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL  L +  NQL+ S+P   GNL+ L  L L +N LSG IP+E+ NL  
Sbjct  491  GLIPKEIGNIKSLVNLGLSGNQLHDSIPTSFGNLSNLEILHLRDNRLSGSIPQELENLKN  550

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L LD N L G +P  I     LT  ++  N
Sbjct  551  LIQLHLDTNQLSGYLPPNICQGGKLTNFSVFRN  583


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LEYL +  N+L   +P +I  L+ L+ L L+ N LSG IP EIG+L  L  L L NN L 
Sbjct  287  LEYLDLRMNELFDVIPPQISYLSKLDYLDLSLNQLSGRIPPEIGHLTSLAYLYLYNNQLS  346

Query  65   GTIPETIFNISTLTYINMANN  3
            G+IP  I N+ +L  + +++N
Sbjct  347  GSIPNEIGNLKSLVDLQLSSN  367


 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 55/95 (58%), Gaps = 6/95 (6%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI---GNL  108
            +IP S G  S+LE L++ DN+L+GS+P+E+ NL  L  L L  N LSG +P  I   G L
Sbjct  516  SIPTSFGNLSNLEILHLRDNRLSGSIPQELENLKNLIQLHLDTNQLSGYLPPNICQGGKL  575

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                + R   N L G IP+++ N + L  +++  N
Sbjct  576  TNFSVFR---NYLTGPIPKSLKNCTGLIRVHLEQN  607


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNI    G   +L+++ + +N L G +    G    L  L +  N+L+G IP EIGN   
Sbjct  611  GNISEDFGVYPNLDFMNISNNNLYGEISHNWGQCPKLTTLLMAGNNLTGSIPLEIGNATQ  670

Query  101  LQILRLDNNNLEGTIPETIFNISTLT  24
            + +L L +N+L G IP+    +S+L 
Sbjct  671  IHVLDLSSNHLVGLIPKEFGKLSSLV  696


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+  C+ L  +++  NQ  G++  + G    L+ + ++ N+L GEI    G    
Sbjct  587  GPIPKSLKNCTGLIRVHLEQNQFTGNISEDFGVYPNLDFMNISNNNLYGEISHNWGQCPK  646

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L +  NNL G+IP  I N + +  +++++N
Sbjct  647  LTTLLMAGNNLTGSIPLEIGNATQIHVLDLSSN  679



>ref|XP_006442747.1| hypothetical protein CICLE_v100193952mg, partial [Citrus clementina]
 gb|ESR55987.1| hypothetical protein CICLE_v100193952mg, partial [Citrus clementina]
Length=366

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  SSL+ LY+W NQL+G +PRE+G+L+ L  L L EN LSG +P E+G L+ 
Sbjct  183  GKIPPSLGRLSSLQILYLWSNQLSGEIPRELGDLSQLVILYLPENGLSGTLPPELGKLSN  242

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +NNL G +P+   N+  LT   +A N
Sbjct  243  LQQLWLTSNNLRGDLPKDYENLKNLTIFEVAGN  275


 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G+ S L  LY+ +N L+G+LP E+G L+ L  L LT N+L G++P++  NL  
Sbjct  207  GEIPRELGDLSQLVILYLPENGLSGTLPPELGKLSNLQQLWLTSNNLRGDLPKDYENLKN  266

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L I  +  NNL G IP  I     L  +N+  N
Sbjct  267  LTIFEVAGNNLSGPIPRFIAKWVNLYSLNLMGN  299


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G   +LE L +  N L G +P  +G L+ L  L L  N LSGEIPRE+G+L+ 
Sbjct  159  GIIPTSLGNLRNLEILDLGQNLLTGKIPPSLGRLSSLQILYLWSNQLSGEIPRELGDLSQ  218

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL L  N L GT+P  +  +S L  + + +N
Sbjct  219  LVILYLPENGLSGTLPPELGKLSNLQQLWLTSN  251


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQ-LTENSLSGEIPREIGNLN  105
            G IP  +   + L+ L + DN ++GS+P +IG L  L  L+ L++N L+G IP  +GNL 
Sbjct  110  GKIPEHVAALTYLQTLDLSDNTVHGSIPYQIGYLFQLVTLRDLSKNQLTGIIPTSLGNLR  169

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+IL L  N L G IP ++  +S+L  + + +N
Sbjct  170  NLEILDLGQNLLTGKIPPSLGRLSSLQILYLWSN  203


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLY-MWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G+IP  IG    L  L  +  NQL G +P  +GNL  L  L L +N L+G+IP  +G L+
Sbjct  134  GSIPYQIGYLFQLVTLRDLSKNQLTGIIPTSLGNLRNLEILDLGQNLLTGKIPPSLGRLS  193

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQIL L +N L G IP  + ++S L  + +  N
Sbjct  194  SLQILYLWSNQLSGEIPRELGDLSQLVILYLPEN  227



>ref|XP_010657055.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Vitis vinifera]
Length=875

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR IG  S LE +Y   +   G++P   GNLT L +L L EN++ G IP+E+GNL  
Sbjct  46   GSIPREIGNLSKLEQIYFRRSSFTGTIPPSFGNLTALQHLDLGENNIQGNIPKELGNLVN  105

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L+ NNL G +PE IFNIS L  +++A N
Sbjct  106  LQFLSLNVNNLTGIVPEAIFNISKLQVLSLAGN  138


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP S+G  S SLE +Y  D QL G++P  I NLT L  L+L +N L+G IP   G L 
Sbjct  246  GMIPNSLGNLSISLEIIYASDCQLRGTIPTGISNLTNLIGLRLDDNDLTGLIPTPFGRLQ  305

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ+L +  N + G+IP  + +++ L ++++++N
Sbjct  306  KLQMLSISQNRIHGSIPSGLCHLTNLAFLDLSSN  339


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S G  ++L++L + +N + G++P+E+GNL  L  L L  N+L+G +P  I N++ 
Sbjct  70   GTIPPSFGNLTALQHLDLGENNIQGNIPKELGNLVNLQFLSLNVNNLTGIVPEAIFNISK  129

Query  101  LQILRLDNNNLEGTIPETI  45
            LQ+L L  N+L G++P +I
Sbjct  130  LQVLSLAGNHLSGSLPSSI  148


 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +   ++L +L +  N+L+G++P   GNLT L N+ L  N L+ EIP  + NL  
Sbjct  319  GSIPSGLCHLTNLAFLDLSSNKLSGTIPSCSGNLTGLRNVYLHSNGLASEIPSSLCNLRG  378

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L +N L   +P  + N+ +L  ++++ N
Sbjct  379  LLVLNLSSNFLNSQLPLQVGNMKSLVALDLSKN  411


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G    L+ L +  N+++GS+P  + +LT L  L L+ N LSG IP   GNL  
Sbjct  295  GLIPTPFGRLQKLQMLSISQNRIHGSIPSGLCHLTNLAFLDLSSNKLSGTIPSCSGNLTG  354

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L +N L   IP ++ N+  L  +N+++N
Sbjct  355  LRNVYLHSNGLASEIPSSLCNLRGLLVLNLSSN  387


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  +G   SL  L +  NQ +G++P  I  L  L  L L+ N L G IP   G+L  L+
Sbjct  393  LPLQVGNMKSLVALDLSKNQFSGNIPSTISLLQNLLQLYLSHNKLQGHIPPNFGDLVSLE  452

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L  NNL GTIP+++ ++  L Y+N++ N
Sbjct  453  SLDLSGNNLSGTIPKSLEHLKYLEYLNVSFN  483


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            L++L +  NQL+G LP  +     L  L L  N+ +G IPREIGNL+ L+ +    ++  
Sbjct  10   LQWLLLSLNQLSGQLPTTLSLCGELLTLTLAYNNFTGSIPREIGNLSKLEQIYFRRSSFT  69

Query  65   GTIPETIFNISTLTYINMANN  3
            GTIP +  N++ L ++++  N
Sbjct  70   GTIPPSFGNLTALQHLDLGEN  90


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP +I    +L  LY+  N+L G +P   G+L  L +L L+ N+LSG IP+ + +L  
Sbjct  415  GNIPSTISLLQNLLQLYLSHNKLQGHIPPNFGDLVSLESLDLSGNNLSGTIPKSLEHLKY  474

Query  101  LQILRLDNNNLEGTIP  54
            L+ L +  N L+G IP
Sbjct  475  LEYLNVSFNKLQGEIP  490


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P SIG    +LE L +  N+ +G +P  I N++ L +L +++N   G +P+++GNL 
Sbjct  142  GSLPSSIGSWLPNLEQLLIGGNEFSGIIPMSISNMSNLISLDISDNFFIGNVPKDLGNLR  201

Query  104  MLQILRLDNNNL--EGTIPETIF  42
             LQ+L L +N L  E +  E  F
Sbjct  202  QLQLLGLSHNQLTNEHSASELAF  224


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 40/79 (51%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  + L  +Y+  N L   +P  + NL  L  L L+ N L+ ++P ++GN+  
Sbjct  343  GTIPSCSGNLTGLRNVYLHSNGLASEIPSSLCNLRGLLVLNLSSNFLNSQLPLQVGNMKS  402

Query  101  LQILRLDNNNLEGTIPETI  45
            L  L L  N   G IP TI
Sbjct  403  LVALDLSKNQFSGNIPSTI  421



>ref|XP_009784945.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nicotiana sylvestris]
Length=779

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ LY+WDN LNGS+P  +GNLT L+ L L  N LSG IP EIGNL  
Sbjct  131  GAIPSQIGSLAKLQILYIWDNHLNGSIPALLGNLTNLSFLYLYSNHLSGPIPEEIGNLRS  190

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L  N L G+IP ++ N+++L+++++A N
Sbjct  191  LTHLQLGANFLNGSIPASLGNLTSLSFLSLAGN  223


 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G  ++L +LY++ N L+G +P EIGNL  L +LQL  N L+G IP  +GNL  
Sbjct  155  GSIPALLGNLTNLSFLYLYSNHLSGPIPEEIGNLRSLTHLQLGANFLNGSIPASLGNLTS  214

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N+L G IPE I ++ +LT++ ++ N
Sbjct  215  LSFLSLAGNHLYGLIPEEIGSLRSLTWLQLSYN  247


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  +SL +L +  N L G +P EIG+L  L  LQL+ N+L G IP  +GNL  
Sbjct  203  GSIPASLGNLTSLSFLSLAGNHLYGLIPEEIGSLRSLTWLQLSYNTLDGFIPASLGNLTN  262

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL L +N+L G IPE I  + +L  ++++NN
Sbjct  263  LSILFLGDNHLSGPIPEEIGKLRSLVALDLSNN  295


 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG+ ++L YL +  NQL+G++P +IG+L  L  L + +N L+G IP  +GNL  
Sbjct  107  GTIPPEIGKLTNLVYLDLSVNQLSGAIPSQIGSLAKLQILYIWDNHLNGSIPALLGNLTN  166

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N+L G IPE I N+ +LT++ +  N
Sbjct  167  LSFLYLYSNHLSGPIPEEIGNLRSLTHLQLGAN  199


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   SL +L +  N L+G +P  +GNLT L+ L L +N LSG IP EIG L  
Sbjct  227  GLIPEEIGSLRSLTWLQLSYNTLDGFIPASLGNLTNLSILFLGDNHLSGPIPEEIGKLRS  286

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L+G IP ++ N+  L Y+ + NN
Sbjct  287  LVALDLSNNILDGFIPSSLGNLRNLQYLILLNN  319


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   SL +L +  N LNGS+P  +GNLT L+ L L  N L G IP EIG+L  
Sbjct  179  GPIPEEIGNLRSLTHLQLGANFLNGSIPASLGNLTSLSFLSLAGNHLYGLIPEEIGSLRS  238

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L  N L+G IP ++ N++ L+ + + +N
Sbjct  239  LTWLQLSYNTLDGFIPASLGNLTNLSILFLGDN  271


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  ++L  L++ DN L+G +P EIG L  L  L L+ N L G IP  +GNL  
Sbjct  251  GFIPASLGNLTNLSILFLGDNHLSGPIPEEIGKLRSLVALDLSNNILDGFIPSSLGNLRN  310

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L NNNL   IP +I N++ L  +++  N
Sbjct  311  LQYLILLNNNLTEEIPSSICNLTLLKNLSLERN  343


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LEY+ +  N ++G++P EIG LT L  L L+ N LSG IP +IG+L  LQIL + +N+L 
Sbjct  95   LEYVDLHMNNISGTIPPEIGKLTNLVYLDLSVNQLSGAIPSQIGSLAKLQILYIWDNHLN  154

Query  65   GTIPETIFNISTLTYINMANN  3
            G+IP  + N++ L+++ + +N
Sbjct  155  GSIPALLGNLTNLSFLYLYSN  175


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G   +L+YL + +N L   +P  I NLT+L NL L  N+L G I   + N++ 
Sbjct  299  GFIPSSLGNLRNLQYLILLNNNLTEEIPSSICNLTLLKNLSLERNNLKGNILHCLSNISG  358

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L +  NNL G IP +I N+++L ++++  N
Sbjct  359  LYVLLMSQNNLSGEIPLSICNLTSLEFLDLGRN  391


 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG+ ++L  L +  N+L G +P  +GNL+++ ++ L+ N LSG IP+++ +L  
Sbjct  583  GHIPNIIGDLTALRVLNLSHNRLQGHIPNSLGNLSVVESMDLSFNQLSGAIPQQLSSLTS  642

Query  101  LQILRLDNNNLEGTIPE  51
            L  L L +N+L+G IP+
Sbjct  643  LAFLNLSHNHLQGCIPQ  659


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG+  SL  L + +N L+G +P  +GNL  L  L L  N+L+ EIP  I NL +
Sbjct  275  GPIPEEIGKLRSLVALDLSNNILDGFIPSSLGNLRNLQYLILLNNNLTEEIPSSICNLTL  334

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L+ NNL+G I   + NIS L  + M+ N
Sbjct  335  LKNLSLERNNLKGNILHCLSNISGLYVLLMSQN  367


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  DNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
             N+  G +P  IG+LT L  L L+ N L G IP  +GNL++++ + L  N L G IP+ +
Sbjct  578  SNKFVGHIPNIIGDLTALRVLNLSHNRLQGHIPNSLGNLSVVESMDLSFNQLSGAIPQQL  637

Query  44   FNISTLTYINMANN  3
             ++++L ++N+++N
Sbjct  638  SSLTSLAFLNLSHN  651


 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL-N  105
            GNI   +   S L  L M  N L+G +P  I NLT L  L L  N+L GEIP+  GN+ +
Sbjct  347  GNILHCLSNISGLYVLLMSQNNLSGEIPLSICNLTSLEFLDLGRNNLKGEIPQCFGNMSD  406

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L++L +  NNL G +P T    S L   N+  N
Sbjct  407  YLKVLDMQYNNLSGYLPTTFSTRSVLRSFNLCGN  440


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 40/77 (52%), Gaps = 1/77 (1%)
 Frame = -1

Query  281  GNIPRSIGECSS-LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP+  G  S  L+ L M  N L+G LP      ++L +  L  N L GEIPR + N  
Sbjct  395  GEIPQCFGNMSDYLKVLDMQYNNLSGYLPTTFSTRSVLRSFNLCGNELEGEIPRSLANCK  454

Query  104  MLQILRLDNNNLEGTIP  54
             LQ+L L +N L  T P
Sbjct  455  ELQVLDLGDNYLNDTSP  471



>ref|WP_012022692.1| two component regulator [Flavobacterium johnsoniae]
 ref|YP_001192956.1| two component regulator [Flavobacterium johnsoniae UW101]
 gb|ABQ03637.1| Two component regulator three Y domain protein [Flavobacterium 
johnsoniae UW101]
Length=2491

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  +++E+ ++ +N+L GS+P EIGNL+ + +L L  N LSG IP +IGNL+ 
Sbjct  234  GSIPSSLGNLNNVEFFFIGNNELTGSIPPEIGNLSKVTHLYLYHNQLSGSIPTQIGNLSK  293

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +Q L L+ NNL G+IP  I N+S+L + N++NN
Sbjct  294  VQALFLEYNNLSGSIPNEISNLSSLKFFNLSNN  326


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   SL+ LY+ DN+L GS+P ++GNL  L+   L+ N LSG IP  +GNLN 
Sbjct  186  GAIPNEIGNLLSLKILYLNDNKLAGSIPTQMGNLVNLSQFALSFNKLSGSIPSSLGNLNN  245

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ++   + NN L G+IP  I N+S +T++ + +N
Sbjct  246  VEFFFIGNNELTGSIPPEIGNLSKVTHLYLYHN  278


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  S + +LY++ NQL+GS+P +IGNL+ +  L L  N+LSG IP EI NL+ 
Sbjct  258  GSIPPEIGNLSKVTHLYLYHNQLSGSIPTQIGNLSKVQALFLEYNNLSGSIPNEISNLSS  317

Query  101  LQILRLDNNNLEGTIPETIFNI  36
            L+   L NN L G IP  I N+
Sbjct  318  LKFFNLSNNQLTGPIPTGIGNL  339


 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +   IG  ++L+ LY+ DN+L+G++P EIGNL  L  L L +N L+G IP ++GNL  
Sbjct  162  GTLASEIGSLTNLQQLYLQDNELSGAIPNEIGNLLSLKILYLNDNKLAGSIPTQMGNLVN  221

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L    L  N L G+IP ++ N++ + +  + NN
Sbjct  222  LSQFALSFNKLSGSIPSSLGNLNNVEFFFIGNN  254


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG      +L + +NQL G++P E+G L+ +  L L+ N L+G IP EIGNL  
Sbjct  402  GTIPANIGNLPEAIHLNLSNNQLTGTIPPELGGLSKVQMLDLSFNQLTGSIPLEIGNLTS  461

Query  101  LQILRLDNNNLEGTIP  54
            ++ L L+NN   GTIP
Sbjct  462  IRNLFLNNNEFSGTIP  477


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI    ++  LY+  NQ  G++P  IGNL    +L L+ N L+G IP E+G L+ 
Sbjct  378  GPIPSSINRLRNIGLLYLDHNQFTGTIPANIGNLPEAIHLNLSNNQLTGTIPPELGGLSK  437

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            +Q+L L  N L G+IP  I N++++
Sbjct  438  VQMLDLSFNQLTGSIPLEIGNLTSI  462


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            N L G+L  EIG+LT L  L L +N LSG IP EIGNL  L+IL L++N L G+IP  + 
Sbjct  158  NNLTGTLASEIGSLTNLQQLYLQDNELSGAIPNEIGNLLSLKILYLNDNKLAGSIPTQMG  217

Query  41   NISTLTYINMANN  3
            N+  L+   ++ N
Sbjct  218  NLVNLSQFALSFN  230


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTI  57
            LY+ +NQL+G +P  I  L  +  L L  N  +G IP  IGNL     L L NN L GTI
Sbjct  369  LYLDNNQLSGPIPSSINRLRNIGLLYLDHNQFTGTIPANIGNLPEAIHLNLSNNQLTGTI  428

Query  56   PETIFNISTLTYINMANN  3
            P  +  +S +  ++++ N
Sbjct  429  PPELGGLSKVQMLDLSFN  446



>gb|KDO49849.1| hypothetical protein CISIN_1g001838mg [Citrus sinensis]
Length=1007

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++ +C  LE LY+  N L+G++P+EIGNLT L ++ L +N L GEIP+E+GNL  
Sbjct  179  GKIPSTLSKCKQLEGLYLRFNNLSGAIPKEIGNLTKLKDIILNDNELRGEIPQEMGNLPY  238

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G +P TIFN+STL  +++  N
Sbjct  239  LVRLTLATNNLVGVVPFTIFNMSTLKKLSLLEN  271


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P +I     + +  +  N L+G L  +IGNL ++  L L+ N+LSG+IP  IG L  LQ
Sbjct  500  LPSTIWNLKDILFFDVSSNSLDGPLSLDIGNLKVVIELNLSRNNLSGDIPITIGGLKNLQ  559

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L NN LEG IPE+   +S+L  ++++ N
Sbjct  560  KLFLANNRLEGPIPESFSGLSSLEILDLSKN  590


 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ + + DN+L G +P+E+GNL  L  L L  N+L G +P  I N++ 
Sbjct  203  GAIPKEIGNLTKLKDIILNDNELRGEIPQEMGNLPYLVRLTLATNNLVGVVPFTIFNMST  262

Query  101  LQILRLDNNNLEGTIPETI-FNISTLTYINMANN  3
            L+ L L  N L G++P  I  ++  + ++N+  N
Sbjct  263  LKKLSLLENTLWGSLPSRIDLSLPNVEFLNLGTN  296


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  +SL  LY+  N+   +LP  I NL  +    ++ NSL G +  +IGNL +
Sbjct  474  GAIPSCSGNLTSLRALYLGSNRFTSALPSTIWNLKDILFFDVSSNSLDGPLSLDIGNLKV  533

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L L  NNL G IP TI  +  L  + +ANN
Sbjct  534  VIELNLSRNNLSGDIPITIGGLKNLQKLFLANN  566


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +     +L+ L +  N+L  S+P EI +L  L+ L L  N  SG IP   GNL  
Sbjct  426  GSIPVTFSRLLNLQGLGLAFNKLARSIPDEICHLAKLDKLILHGNKFSGAIPSCSGNLTS  485

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N     +P TI+N+  + + ++++N
Sbjct  486  LRALYLGSNRFTSALPSTIWNLKDILFFDVSSN  518


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L  L L+ N LSG IP  I N++ L++L   +N L G++   IFN+
Sbjct  80   LQGTIPPQLGNLSSLETLDLSHNKLSGNIPSSIFNMHTLKLLDFRDNQLFGSLSSFIFNM  139

Query  35   STLTYINMANN  3
            S++  I+++ N
Sbjct  140  SSMLGIDLSIN  150


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG   +L+ L++ +N+L G +P     L+ L  L L++N +SG IP  +  L  
Sbjct  546  GDIPITIGGLKNLQKLFLANNRLEGPIPESFSGLSSLEILDLSKNKISGVIPTSLEKLLY  605

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  N LEG IP 
Sbjct  606  LKKLNLSFNKLEGEIPR  622



>ref|XP_009606161.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Nicotiana 
tomentosiformis]
Length=1170

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +I   SSL+ L MWDN+L G LPRE+GNL MLN L L  N+L+G +P EIGNL  
Sbjct  349  GSIPFTIFNISSLQVLSMWDNKLEGPLPREVGNLNMLNVLDLGVNNLTGVLPDEIGNLQQ  408

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+LD N   G+IP +IFNISTL  I++  N
Sbjct  409  LLKLKLDFNTFSGSIPVSIFNISTLVSISLTQN  441


 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPRSI ECS L+ L +  N L G++PRE+G L +L  L L  N L G IP EIG+L  
Sbjct  277  GEIPRSISECSELQVLLLLQNNLIGAIPRELGKLQLLQILALGFNKLQGTIPDEIGHLYN  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L ++ N L G+IP TIFNIS+L  ++M +N
Sbjct  337  LKQLGMEKNKLTGSIPFTIFNISSLQVLSMWDN  369


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G+   L+ L +  N+L G++P EIG+L  L  L + +N L+G IP  I N++ 
Sbjct  301  GAIPRELGKLQLLQILALGFNKLQGTIPDEIGHLYNLKQLGMEKNKLTGSIPFTIFNISS  360

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L + +N LEG +P  + N++ L  +++  N
Sbjct  361  LQVLSMWDNKLEGPLPREVGNLNMLNVLDLGVN  393


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR +G+ +SL  +Y+  N     +P  + NL  +  L L+ N  +G +P E+GNL  
Sbjct  643  GSIPRCLGDVTSLREVYLDSNNFTAGIPSSLWNLKDILKLNLSSNIFNGSLPLEVGNLKA  702

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              IL L  N + G IP T+ ++  LT ++ A+N
Sbjct  703  AIILDLSWNQISGNIPNTLGSLQKLTQLSFAHN  735


 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N   G LP E+  L  L  + L+ N+L+GEIP+ +G+L  
Sbjct  108  GTIPPQLGNLSFLVSLDLSYNNFQGELPPELSRLQKLRAINLSFNNLTGEIPKFLGDLQD  167

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++  ++NN+  G IP +I N+  L ++N+  N
Sbjct  168  LEMFAVENNSFSGFIPSSISNMKNLGFLNLRYN  200


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G+   LE   + +N  +G +P  I N+  L  L L  N L G IP  I  L  
Sbjct  156  GEIPKFLGDLQDLEMFAVENNSFSGFIPSSISNMKNLGFLNLRYNDLEGNIPIGIATLQS  215

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            L+ L +  N L G+   +IFNISTL Y+++ N
Sbjct  216  LKWLSVGFNKLNGSNVLSIFNISTLEYLDLRN  247


 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = -1

Query  263  IGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRL  84
            +  C  L  L +  N LN  LP+ IGNL+ L   +    ++ G +P EIGNL  L  L+L
Sbjct  529  LANCKHLRELILSLNPLNAMLPKSIGNLSSLQIFEADGCNIRGHVPIEIGNLRNLSYLKL  588

Query  83   DNNNLEGTIPETIFNISTLTYINMANN  3
            ++N+L G +P TI ++  L   ++  N
Sbjct  589  EDNDLTGIVPRTISSLKKLQQFSLGAN  615


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GN+P +IG    +LE +++  N +NG LP  I NL+ L  L+L+ N L+G +P  +GNL 
Sbjct  445  GNLPSTIGHGLPNLERIFLGANNINGFLPSSISNLSKLTILELSANELTGSVPDSLGNLR  504

Query  104  MLQILRLDNNNL  69
            +++IL L  N+ 
Sbjct  505  LIEILNLQGNSF  516


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 57/117 (49%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQL------------------  156
            G++P  IG   +L YL + DN L G +PR I +L  L    L                  
Sbjct  571  GHVPIEIGNLRNLSYLKLEDNDLTGIVPRTISSLKKLQQFSLGANRISGPFPNGLCELSN  630

Query  155  ------TENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                  ++N + G IPR +G++  L+ + LD+NN    IP +++N+  +  +N+++N
Sbjct  631  LGLLNLSQNQMQGSIPRCLGDVTSLREVYLDSNNFTAGIPSSLWNLKDILKLNLSSN  687


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  SSL+        + G +P EIGNL  L+ L+L +N L+G +PR I +L  LQ
Sbjct  549  LPKSIGNLSSLQIFEADGCNIRGHVPIEIGNLRNLSYLKLEDNDLTGIVPRTISSLKKLQ  608

Query  95   ILRLDNNNLEGTIP  54
               L  N + G  P
Sbjct  609  QFSLGANRISGPFP  622


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G   +   L +  NQ++G++P  +G+L  L  L    N + G IP  +G L  
Sbjct  691  GSLPLEVGNLKAAIILDLSWNQISGNIPNTLGSLQKLTQLSFAHNRIEGSIPDTLGELIN  750

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN+ G IP+++  +  L + N++ N
Sbjct  751  LEALDLSYNNISGVIPKSLEALKQLNFFNVSFN  783


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 55/122 (45%), Gaps = 29/122 (24%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE----------  132
            G +P SI   S L  L +  N+L GS+P  +GNL ++  L L  NS + E          
Sbjct  470  GFLPSSISNLSKLTILELSANELTGSVPDSLGNLRLIEILNLQGNSFTSESSPLSFITPL  529

Query  131  -------------------IPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMA  9
                               +P+ IGNL+ LQI   D  N+ G +P  I N+  L+Y+ + 
Sbjct  530  ANCKHLRELILSLNPLNAMLPKSIGNLSSLQIFEADGCNIRGHVPIEIGNLRNLSYLKLE  589

Query  8    NN  3
            +N
Sbjct  590  DN  591


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    L  L    N++ GS+P  +G L  L  L L+ N++SG IP+ +  L  
Sbjct  715  GNIPNTLGSLQKLTQLSFAHNRIEGSIPDTLGELINLEALDLSYNNISGVIPKSLEALKQ  774

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N L G IP
Sbjct  775  LNFFNVSFNRLHGEIP  790


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  DNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
            D   +G++P ++GNL+ L +L L+ N+  GE+P E+  L  L+ + L  NNL G IP+ +
Sbjct  103  DMGFSGTIPPQLGNLSFLVSLDLSYNNFQGELPPELSRLQKLRAINLSFNNLTGEIPKFL  162

Query  44   FNISTLTYINMANN  3
             ++  L    + NN
Sbjct  163  GDLQDLEMFAVENN  176



>ref|XP_006489970.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like [Citrus sinensis]
Length=662

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++ +C  LE LY+  N L+G++P+EIGNLT L ++ L +N L GEIP+E+GNL  
Sbjct  187  GKIPSTLSKCKQLEGLYLRFNNLSGAIPKEIGNLTKLKDIILNDNELRGEIPQEMGNLPY  246

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G +P TIFN+STL  +++  N
Sbjct  247  LVRLTLATNNLVGVVPFTIFNMSTLKKLSLLEN  279


 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P +I     + +  +  N L+G L  +IGNL ++  L L+ N+LSG+IP  IG L  LQ
Sbjct  508  LPSTIWNLKDILFFDVSSNSLDGPLSLDIGNLKVVIELNLSRNNLSGDIPITIGGLKNLQ  567

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L NN LEG IPE+   +S+L  ++++ N
Sbjct  568  KLFLANNRLEGPIPESFSGLSSLEILDLSKN  598


 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ + + DN+L G +P+E+GNL  L  L L  N+L G +P  I N++ 
Sbjct  211  GAIPKEIGNLTKLKDIILNDNELRGEIPQEMGNLPYLVRLTLATNNLVGVVPFTIFNMST  270

Query  101  LQILRLDNNNLEGTIPETI-FNISTLTYINMANN  3
            L+ L L  N L G++P  I  ++  + ++N+  N
Sbjct  271  LKKLSLLENTLWGSLPSRIDLSLPNVEFLNLGTN  304


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  +SL  LY+  N+   +LP  I NL  +    ++ NSL G +  +IGNL +
Sbjct  482  GAIPSCSGNLTSLRALYLGSNRFTSALPSTIWNLKDILFFDVSSNSLDGPLSLDIGNLKV  541

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L L  NNL G IP TI  +  L  + +ANN
Sbjct  542  VIELNLSRNNLSGDIPITIGGLKNLQKLFLANN  574


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +     +L+ L +  N+L  S+P EI +L  L+ L L  N  SG IP   GNL  
Sbjct  434  GSIPVTFSRLLNLQGLGLAFNKLARSIPDEICHLAKLDKLILHGNKFSGAIPSCSGNLTS  493

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N     +P TI+N+  + + ++++N
Sbjct  494  LRALYLGSNRFTSALPSTIWNLKDILFFDVSSN  526


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L  L L+ N LSG IP  I N++ L++L   +N L G++   IFN+
Sbjct  88   LQGTIPPQLGNLSSLETLDLSHNKLSGNIPSSIFNMHTLKLLDFRDNQLFGSLSSFIFNM  147

Query  35   STLTYINMANN  3
            S++  I+++ N
Sbjct  148  SSMLGIDLSIN  158



>ref|XP_010932810.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=519

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP  IG+   L+ LY+ DN+L G+LP  +GNLT LN L L  N+  G IP  +GNL  
Sbjct  25   GNIPEDIGKLQMLQLLYLRDNRLTGTLPSSLGNLTRLNELDLDSNAFEGPIPSSLGNLQH  84

Query  101  LQILRLDNNNLEGTIPETIFNISTLT-YINMANN  3
            L  L L  N+L G+IP+ IFN+STL+ Y++ ++N
Sbjct  85   LADLNLSQNSLSGSIPKEIFNLSTLSNYMDFSHN  118


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  IG   +   LY+  N+L+G +P  +GN  +L NL +  N L G IP+ + ++  
Sbjct  122  GKLPSDIGSMQNFRALYLSGNKLSGEIPPTLGNCGVLENLFIHNNFLQGTIPQSLSDIRA  181

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +NNL   IP+ + N+  L Y+N++ N
Sbjct  182  LQNLDLSHNNLSRPIPQLLANLYFLAYLNLSFN  214


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLE-YLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G+IP+ I   S+L  Y+    N L G LP +IG++     L L+ N LSGEIP  +GN  
Sbjct  97   GSIPKEIFNLSTLSNYMDFSHNYLIGKLPSDIGSMQNFRALYLSGNKLSGEIPPTLGNCG  156

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +L+ L + NN L+GTIP+++ +I  L  +++++N
Sbjct  157  VLENLFIHNNFLQGTIPQSLSDIRALQNLDLSHN  190


 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++G C  LE L++ +N L G++P+ + ++  L NL L+ N+LS  IP+ + NL  
Sbjct  146  GEIPPTLGNCGVLENLFIHNNFLQGTIPQSLSDIRALQNLDLSHNNLSRPIPQLLANLYF  205

Query  101  LQILRLDNNNLEGTIP-ETIFNIST  30
            L  L L  N+L+G +P + IFN +T
Sbjct  206  LAYLNLSFNHLDGVVPTKEIFNHAT  230


 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -1

Query  272  PRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQI  93
            P S G   S    +  +N L G++P +IG L ML  L L +N L+G +P  +GNL  L  
Sbjct  4    PISAGGRESRVASWFENNLLTGNIPEDIGKLQMLQLLYLRDNRLTGTLPSSLGNLTRLNE  63

Query  92   LRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L LD+N  EG IP ++ N+  L  +N++ N
Sbjct  64   LDLDSNAFEGPIPSSLGNLQHLADLNLSQN  93



>emb|CDP11244.1| unnamed protein product [Coffea canephora]
Length=1088

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG+CS L+ L +  N+L+G++PREIGNLT +  L L      G IP EIGNL  
Sbjct  254  GRIPPSIGKCSQLQVLSLTANRLSGTIPREIGNLTQIQQLFLGGPGFEGSIPNEIGNLQR  313

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +  LD+  L G+IP +IFNISTL       N
Sbjct  314  LAVFGLDSGRLSGSIPASIFNISTLRIFTCVEN  346


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP + G  + L +LY+  NQL+G +P  + N++ L  L L  N L G IP E+G+L  
Sbjct  133  GPIPTTFGSLAKLHFLYLSYNQLSGGIPSSLSNISRLEKLDLRMNFLQGSIPEELGDLRY  192

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N L G IP +IFN+ +L  I   NN
Sbjct  193  LTSLILEINQLTGPIPASIFNMRSLEVIAFTNN  225


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREI-GNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP SI    SLE +   +N+L+GSLP +I  NL  L  L L+   L G IP  IG  +
Sbjct  205  GPIPASIFNMRSLEVIAFTNNKLSGSLPTDICSNLPKLKGLYLSIGELVGRIPPSIGKCS  264

Query  104  MLQILRLDNNNLEGTIPETIFNISTL  27
             LQ+L L  N L GTIP  I N++ +
Sbjct  265  QLQVLSLTANRLSGTIPREIGNLTQI  290


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP S+   S SL+        ++G +P EIGNL+ L  + L+EN L+G IP  +  L 
Sbjct  454  GTIPASVANFSNSLQSFSARRCNISGKIPEEIGNLSSLALINLSENDLTGFIPTTVDGLQ  513

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L LDNN + G++P  I N+  L  + ++ N
Sbjct  514  SLQRLYLDNNKVSGSLPNNICNLPKLGEMELSRN  547


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+   S LE L +  N L GS+P E+G+L  L +L L  N L+G IP  I N+  
Sbjct  157  GGIPSSLSNISRLEKLDLRMNFLQGSIPEELGDLRYLTSLILEINQLTGPIPASIFNMRS  216

Query  101  LQILRLDNNNLEGTIPETI  45
            L+++   NN L G++P  I
Sbjct  217  LEVIAFTNNKLSGSLPTDI  235


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++    SL+ LY+ +N+++GSLP  I NL  L  ++L+ N +SG +P  IG L  
Sbjct  503  GFIPTTVDGLQSLQRLYLDNNKVSGSLPNNICNLPKLGEMELSRNQISGSVPSCIGYLTS  562

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            +Q L L +NN    +P +++ +  L
Sbjct  563  MQNLFLSSNNFSSNLPPSLWTMKNL  587


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGN-LTMLNNLQLTENSLSGEIPREIGNLN  105
            G+IP SI   S+L      +N L+G+LP  +G  +  L  + +  N+LSG IP  I N  
Sbjct  326  GSIPASIFNISTLRIFTCVENLLSGNLPSTMGKGMPNLEEIYIGTNNLSGNIPASISNAT  385

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +L L +NN  G IP ++ N+ +L+ +N+A N
Sbjct  386  KLTVLDLSHNNFNGPIPSSVANLVSLSILNLAVN  419


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 55/118 (47%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG  + ++ L++      GS+P EIGNL  L    L    LSG IP  I N++ 
Sbjct  278  GTIPREIGNLTQIQQLFLGGPGFEGSIPNEIGNLQRLAVFGLDSGRLSGSIPASIFNIST  337

Query  101  LQI-------------------------LRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+I                         + +  NNL G IP +I N + LT +++++N
Sbjct  338  LRIFTCVENLLSGNLPSTMGKGMPNLEEIYIGTNNLSGNIPASISNATKLTVLDLSHN  395


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG  +S++ L++  N  + +LP  +  +  L   +   NSLSG +P E+GNL  
Sbjct  551  GSVPSCIGYLTSMQNLFLSSNNFSSNLPPSLWTMKNLLRFEAFSNSLSGLLPPELGNLKA  610

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + ++ L  NN  G IP ++  +  L  +++A+N
Sbjct  611  ITLIDLSRNNFSGNIPSSVDGLENLIDLSLAHN  643


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   S L  L + DN  +G+LP+E+  L  L  L L +N+ +G IP   G+L  
Sbjct  85   GVIPPHIANLSFLISLDLSDNSFHGNLPKELAQLRRLRLLDLRQNNFTGPIPTTFGSLAK  144

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP ++ NIS L  +++  N
Sbjct  145  LHFLYLSYNQLSGGIPSSLSNISRLEKLDLRMN  177


 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            N+P S+    +L     + N L+G LP E+GNL  +  + L+ N+ SG IP  +  L  L
Sbjct  576  NLPPSLWTMKNLLRFEAFSNSLSGLLPPELGNLKAITLIDLSRNNFSGNIPSSVDGLENL  635

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L +N LEG IP++   + +L  +++++N
Sbjct  636  IDLSLAHNALEGPIPDSFGKLISLEALDLSHN  667


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P+ + +   L  L +  N   G +P   G+L  L+ L L+ N LSG IP  + N++ 
Sbjct  109  GNLPKELAQLRRLRLLDLRQNNFTGPIPTTFGSLAKLHFLYLSYNQLSGGIPSSLSNISR  168

Query  101  LQILRLDNNNLEGTIPETIFNISTLT  24
            L+ L L  N L+G+IPE + ++  LT
Sbjct  169  LEKLDLRMNFLQGSIPEELGDLRYLT  194


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 39/76 (51%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP S+    +L  L +  N L G +P   G L  L  L L+ N LSG IP+ + +L  
Sbjct  623  GNIPSSVDGLENLIDLSLAHNALEGPIPDSFGKLISLEALDLSHNRLSGVIPQSLESLVY  682

Query  101  LQILRLDNNNLEGTIP  54
            L+   +  N L G IP
Sbjct  683  LKQFNVSFNQLSGQIP  698


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 50/125 (40%), Gaps = 32/125 (26%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLN----------------------  168
            GNIP SI   + L  L +  N  NG +P  + NL  L+                      
Sbjct  375  GNIPASISNATKLTVLDLSHNNFNGPIPSSVANLVSLSILNLAVNSLVLESSSSLSKFLT  434

Query  167  ---------NLQLTENSLSGEIPREIGNL-NMLQILRLDNNNLEGTIPETIFNISTLTYI  18
                      L ++ N L G IP  + N  N LQ       N+ G IPE I N+S+L  I
Sbjct  435  SLTNSRNLKELSVSGNPLGGTIPASVANFSNSLQSFSARRCNISGKIPEEIGNLSSLALI  494

Query  17   NMANN  3
            N++ N
Sbjct  495  NLSEN  499



>ref|XP_006427088.1| hypothetical protein CICLE_v10027419mg, partial [Citrus clementina]
 gb|ESR40328.1| hypothetical protein CICLE_v10027419mg, partial [Citrus clementina]
Length=1056

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI   S+L+ L +  N L+G++P+EIGNLTML  L L  N L GEIP+E+GNL  
Sbjct  94   GTIPSSIFTISTLKMLSLSFNDLSGAIPKEIGNLTMLKKLGLGYNKLRGEIPQELGNLAE  153

Query  101  LQILRLDNNNLEGTIPETIFNISTL-TYINMANN  3
            L+++ L NN L GTIP TIFN+S+L T ++ +NN
Sbjct  154  LELVSLTNNFLSGTIPSTIFNLSSLSTGMDFSNN  187


 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  SSLE L +  NQL+G++P  I  ++ L  L L+ N LSG IP+EIGNL M
Sbjct  70   GTIPYQIGNLSSLETLDLSHNQLSGTIPSSIFTISTLKMLSLSFNDLSGAIPKEIGNLTM  129

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G IP+ + N++ L  +++ NN
Sbjct  130  LKKLGLGYNKLRGEIPQELGNLAELELVSLTNN  162


 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            +MC RL  ++ LY+  NKL G IP +I +C  L  + +  NQ    +PR +GNLT L +L
Sbjct  196  DMCRRLPLIKGLYMSNNKLTGPIPNNIWQCKELIVVSLAYNQFTERIPRGLGNLTSLKSL  255

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N+L+GEIP E+GNL  L+IL L  N L G +P +IFN+S +  + + +N
Sbjct  256  YLGFNNLTGEIPYEMGNLRNLEILGLQLNKLVGFVPTSIFNLSAMKTLALPSN  308


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   +L  L +W N+L GS+P   G L  L  L L  N L G IP  +  L  
Sbjct  440  GTIPKEIGNLINLRELGLWGNELIGSIPITFGKLQNLQGLDLVNNKLEGPIPNGLCQLAR  499

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L +D N L G IP  I ++++L  +++A+N
Sbjct  500  LSVLYMDGNKLSGPIPPCIGDLTSLRLLSLASN  532


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 64/117 (55%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLN------------------------GSLPREIGNLTM  174
            G IP  IG+ +SL  L +  N+LN                        GSLP +IGNL +
Sbjct  512  GPIPPCIGDLTSLRLLSLASNELNSVIPFTFWNLKDILSLNFSSNFLNGSLPEDIGNLKV  571

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  + L+ N+LSG+IP  IG L  LQ L L +N L+G+IP++I  + +L  ++++NN
Sbjct  572  VVIIDLSRNNLSGDIPTAIGGLMNLQDLSLRDNGLQGSIPKSIGGLVSLESLDLSNN  628


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG   +L+ L + DN L GS+P+ IG L  L +L L+ NSLSG IP  +  L  
Sbjct  584  GDIPTAIGGLMNLQDLSLRDNGLQGSIPKSIGGLVSLESLDLSNNSLSGNIPTSMEKLLY  643

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  N LEG IP 
Sbjct  644  LKDLNLSFNKLEGEIPR  660


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IPR +G  +SL+ LY+  N L G +P E+GNL  L  L L  N L G +P  I NL+ ++
Sbjct  242  IPRGLGNLTSLKSLYLGFNNLTGEIPYEMGNLRNLEILGLQLNKLVGFVPTSIFNLSAMK  301

Query  95   ILRLDNNNLEGTIPETI--FNISTLTYINMANN  3
             L L +N L G++P +I    +  L  I++A N
Sbjct  302  TLALPSNALSGSLPSSIDLVRLPNLEIISLAGN  334


 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  S SL  +++ +  + G++P+EIGNL  L  L L  N L G IP   G L 
Sbjct  415  GVLPSSIGNLSLSLSRIFISNCSIRGTIPKEIGNLINLRELGLWGNELIGSIPITFGKLQ  474

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L NN LEG IP  +  ++ L+ + M  N
Sbjct  475  NLQGLDLVNNKLEGPIPNGLCQLARLSVLYMDGN  508


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG    +  + +  N L+G +P  IG L  L +L L +N L G IP+ IG L  
Sbjct  560  GSLPEDIGNLKVVVIIDLSRNNLSGDIPTAIGGLMNLQDLSLRDNGLQGSIPKSIGGLVS  619

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L G IP ++  +  L  +N++ N
Sbjct  620  LESLDLSNNSLSGNIPTSMEKLLYLKDLNLSFN  652


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P +IGNL+ L  L L+ N LSG IP  I  ++ L++L L  N+L G IP+ I N+
Sbjct  68   LGGTIPYQIGNLSSLETLDLSHNQLSGTIPSSIFTISTLKMLSLSFNDLSGAIPKEIGNL  127

Query  35   STLTYINMANN  3
            + L  + +  N
Sbjct  128  TMLKKLGLGYN  138


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S   C +L+ L + +N +NG LP  IGNL++ L+ + ++  S+ G IP+EIGNL  L+ L
Sbjct  396  SWANCKNLKLLDLSNNPINGVLPSSIGNLSLSLSRIFISNCSIRGTIPKEIGNLINLREL  455

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L G+IP T   +  L  +++ NN
Sbjct  456  GLWGNELIGSIPITFGKLQNLQGLDLVNN  484


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 7/100 (7%)
 Frame = -1

Query  281  GNIPRSIG--ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            G++P SI      +LE + +  N  +G +P  I N + L+ L+L ENS SG IP  +GNL
Sbjct  312  GSLPSSIDLVRLPNLEIISLAGNNFSGIIPSFIFNASKLSVLELGENSFSGFIPNTLGNL  371

Query  107  NMLQILRLDNNNLEGTIPETIF-----NISTLTYINMANN  3
              L+ LRL  N L  +  E  F     N   L  ++++NN
Sbjct  372  RKLEWLRLSYNFLTSSTSELSFLSSWANCKNLKLLDLSNN  411



>gb|EYU30656.1| hypothetical protein MIMGU_mgv1a025198mg, partial [Erythranthe 
guttata]
Length=1013

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I +CS L  L +  N+ +G +PR IGNLT L  L L  N+L+GEIP E+GNL  
Sbjct  207  GQIPSTISKCSQLRLLSLSYNKFSGFVPRGIGNLTSLEILYLGSNALTGEIPEELGNLRN  266

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            L+ L + +N L G+IP  IFNIS+L YIN+AN
Sbjct  267  LKELGMGDNFLIGSIPSAIFNISSLQYINIAN  298


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P S+G  S SLEY Y ++ +++G++P E GNL  L  L L  N L+G IP  + NL 
Sbjct  402  GTLPVSVGNLSTSLEYFYAYECRIHGAIPHEFGNLINLIILSLFGNQLTGSIPNTLVNLR  461

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L  N + GTIP T+  + +L  I +  N
Sbjct  462  NLQGLALSRNRISGTIPYTLCGLRSLNGILLHQN  495


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR IG  +SLE LY+  N L G +P E+GNL  L  L + +N L G IP  I N++ 
Sbjct  231  GFVPRGIGNLTSLEILYLGSNALTGEIPEELGNLRNLKELGMGDNFLIGSIPSAIFNISS  290

Query  101  LQILRLDNNNLEGTIPE  51
            LQ + + N NL G +P 
Sbjct  291  LQYINIANCNLTGALPR  307


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G   +L  L ++ NQL GS+P  + NL  L  L L+ N +SG IP  +  L  
Sbjct  427  GAIPHEFGNLINLIILSLFGNQLTGSIPNTLVNLRNLQGLALSRNRISGTIPYTLCGLRS  486

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L  N + G IPE I N++ L  +NM NN
Sbjct  487  LNGILLHQNQITGVIPECIGNLTALREVNMGNN  519


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L  + M +N+LN  +P  +  L  L  L L+ N L+G +P +IGNL  
Sbjct  499  GVIPECIGNLTALREVNMGNNKLNSGIPTSLWQLNDLLKLNLSSNFLTGPLPPDIGNLKA  558

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              +L L  N L GTIP ++ ++  +  +++A+N
Sbjct  559  ATLLDLSTNRLSGTIPTSVEDLHNMINLSLAHN  591


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  IG   +   L +  N+L+G++P  + +L  + NL L  NS  G IP  IG +  
Sbjct  547  GPLPPDIGNLKAATLLDLSTNRLSGTIPTSVEDLHNMINLSLAHNSFRGAIPELIGKMMN  606

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +NNL G IP ++  +  LTY +++ N
Sbjct  607  LEELDLSHNNLSGNIPISLEGLLYLTYFDVSFN  639


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 61/106 (58%), Gaps = 2/106 (2%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            +MCSR  +LE +Y + N+L G +P  +GEC +L+ + +  N + G +PR +GNLTML   
Sbjct  308  DMCSRTSQLESVYFHVNELVGELPEKLGECEALQIVSLSYNNMTGVIPRGVGNLTMLEMF  367

Query  161  QLTENSL--SGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNIST  30
             +  N+L     +   + N   L  L L +N   GT+P ++ N+ST
Sbjct  368  YVGYNNLIEISSLITALTNCRHLTKLGLGSNLFNGTLPVSVGNLST  413


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 5/93 (5%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P  +G  + L  L +  N  +G+LP+E+  L  L ++ L+ N+ +     EIGNL  
Sbjct  91   GNLPSEMGNLAFLVSLNLSSNSFHGNLPQELSYLRRLKDVDLSFNNFT-----EIGNLYN  145

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L    N L+G IP +IFN+S L  + +  N
Sbjct  146  LKMLSFQFNKLDGLIPISIFNMSNLESLALTGN  178


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSI-GECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +PR +    S LE +Y   N+L G LP ++G    L  + L+ N+++G IPR +GNL 
Sbjct  303  GALPRDMCSRTSQLESVYFHVNELVGELPEKLGECEALQIVSLSYNNMTGVIPRGVGNLT  362

Query  104  MLQILRLDNNNL  69
            ML++  +  NNL
Sbjct  363  MLEMFYVGYNNL  374


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++    +L+ L +  N+++G++P  +  L  LN + L +N ++G IP  IGNL  
Sbjct  451  GSIPNTLVNLRNLQGLALSRNRISGTIPYTLCGLRSLNGILLHQNQITGVIPECIGNLTA  510

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + + NN L   IP +++ ++ L  +N+++N
Sbjct  511  LREVNMGNNKLNSGIPTSLWQLNDLLKLNLSSN  543


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP S+ + + L  L +  N L G LP +IGNL     L L+ N LSG IP  + +L+ + 
Sbjct  525  IPTSLWQLNDLLKLNLSSNFLTGPLPPDIGNLKAATLLDLSTNRLSGTIPTSVEDLHNMI  584

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +N+  G IPE I  +  L  +++++N
Sbjct  585  NLSLAHNSFRGAIPELIGKMMNLEELDLSHN  615


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 51/118 (43%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNL-------------------------T  177
            G IP  +G   +L+ L M DN L GS+P  I N+                         +
Sbjct  255  GEIPEELGNLRNLKELGMGDNFLIGSIPSAIFNISSLQYINIANCNLTGALPRDMCSRTS  314

Query  176  MLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L ++    N L GE+P ++G    LQI+ L  NN+ G IP  + N++ L    +  N
Sbjct  315  QLESVYFHVNELVGELPEKLGECEALQIVSLSYNNMTGVIPRGVGNLTMLEMFYVGYN  372



>emb|CDO96827.1| unnamed protein product [Coffea canephora]
Length=1058

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -1

Query  338  MCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQ  159
            +C+RLQ L  L L  N+L G IP S+ ECS L+ L ++DN  +G +P   GNLT L  L 
Sbjct  205  ICARLQGLSWLDLSSNELSGMIPASLSECSKLQVLRLFDNNFSGVIPEGFGNLTALKQLY  264

Query  158  LTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L EN+L G IP E+G L  L+ LRL  N+L G+IP  IFNISTL  ++++NN
Sbjct  265  LNENNLIGSIPLELGCLKHLEKLRLGLNSLTGSIPAQIFNISTLQVLDLSNN  316


 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  ++L+ LY+ +N L GS+P E+G L  L  L+L  NSL+G IP +I N++ 
Sbjct  248  GVIPEGFGNLTALKQLYLNENNLIGSIPLELGCLKHLEKLRLGLNSLTGSIPAQIFNIST  307

Query  101  LQILRLDNNNLEGTIPETI  45
            LQ+L L NN L G +P ++
Sbjct  308  LQVLDLSNNTLSGRLPSSM  326


 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P S+G  S SLE  Y +   + GS+P  IGNL+ L  L L  N LSG IP  +  L 
Sbjct  424  GFLPMSVGNLSTSLERFYAYGCGIKGSIPDAIGNLSNLMLLTLEGNHLSGPIPSTMKYLQ  483

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L LD+N L G+IP+ I  +  L  I +  N
Sbjct  484  NLQALDLDDNQLSGSIPDCICKLKRLYLIYLGQN  517


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +   SSL  +    N LN S+P  + NLT L  L L+ NSLSG +P E GNL +
Sbjct  521  GSMPSCLNNISSLREIDFAGNLLNSSIPGSLWNLTDLLRLNLSYNSLSGLLPYETGNLKV  580

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + +L L  N+L G IP ++ ++ +L  +++A N
Sbjct  581  VTLLDLSGNHLNGNIPSSLGDLQSLATLSLAQN  613


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP S+   + L  L +  N L+G LP E GNL ++  L L+ N L+G IP  +G+L  L
Sbjct  546  SIPGSLWNLTDLLRLNLSYNSLSGLLPYETGNLKVVTLLDLSGNHLNGNIPSSLGDLQSL  605

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L  N L+G IP+++ ++ +L +++++NN
Sbjct  606  ATLSLAQNKLQGPIPDSLSHVLSLQFLDLSNN  637


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P   G    +  L +  N LNG++P  +G+L  L  L L +N L G IP  + ++  
Sbjct  569  GLLPYETGNLKVVTLLDLSGNHLNGNIPSSLGDLQSLATLSLAQNKLQGPIPDSLSHVLS  628

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L NNNL G IP+++  +  L +IN++ N
Sbjct  629  LQFLDLSNNNLSGPIPKSLETLLYLKHINLSFN  661


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG  S+L  L +  N L+G +P  +  L  L  L L +N LSG IP  I  L  
Sbjct  449  GSIPDAIGNLSNLMLLTLEGNHLSGPIPSTMKYLQNLQALDLDDNQLSGSIPDCICKLKR  508

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L ++ L  N   G++P  + NIS+L  I+ A N
Sbjct  509  LYLIYLGQNQFRGSMPSCLNNISSLREIDFAGN  541


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 47/93 (51%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L M  N   G LP E+  L+ L  L L  N LSG IP  +G+   
Sbjct  89   GTIPPQLGNLSFLMSLDMSGNNFYGELPHELIRLSRLRVLSLGINMLSGNIPSWVGSFQQ  148

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+   L NN+  G IP +I N+S L   N+  N
Sbjct  149  LRHFSLKNNSFTGFIPPSISNMSKLETFNLQFN  181


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G+IP  +G    LE L +  N L GS+P +I N++ L  L L+ N+LSG +P  +G  L 
Sbjct  272  GSIPLELGCLKHLEKLRLGLNSLTGSIPAQIFNISTLQVLDLSNNTLSGRLPSSMGCGLI  331

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L  N  +G IP +I N S +T + +  N
Sbjct  332  NLEELYLFWNEFDGVIPASISNASKVTILELIGN  365


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP S+G+  SL  L +  N+L G +P  + ++  L  L L+ N+LSG IP+ +  L  
Sbjct  593  GNIPSSLGDLQSLATLSLAQNKLQGPIPDSLSHVLSLQFLDLSNNNLSGPIPKSLETLLY  652

Query  101  LQILRLDNNNLEGTIPET  48
            L+ + L  N L G IP +
Sbjct  653  LKHINLSFNRLRGEIPSS  670


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 47/108 (44%), Gaps = 15/108 (14%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN---  111
            GNIP  +G    L +  + +N   G +P  I N++ L    L  NSL G IP EIG    
Sbjct  137  GNIPSWVGSFQQLRHFSLKNNSFTGFIPPSISNMSKLETFNLQFNSLQGAIPMEIGKLNN  196

Query  110  ------------LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                        L  L  L L +N L G IP ++   S L  + + +N
Sbjct  197  LSGSLSSSICARLQGLSWLDLSSNELSGMIPASLSECSKLQVLRLFDN  244


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GNL+ L +L ++ N+  GE+P E+  L+ L++L L  N L G IP  + + 
Sbjct  87   LTGTIPPQLGNLSFLMSLDMSGNNFYGELPHELIRLSRLRVLSLGINMLSGNIPSWVGSF  146

Query  35   STLTYINMANN  3
              L + ++ NN
Sbjct  147  QQLRHFSLKNN  157


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++    +L+ L + DNQL+GS+P  I  L  L  + L +N   G +P  + N++ 
Sbjct  473  GPIPSTMKYLQNLQALDLDDNQLSGSIPDCICKLKRLYLIYLGQNQFRGSMPSCLNNISS  532

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ +    N L  +IP +++N++ L  +N++ N
Sbjct  533  LREIDFAGNLLNSSIPGSLWNLTDLLRLNLSYN  565



>ref|XP_006465517.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like [Citrus sinensis]
Length=1069

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI   S+L+ L +  N L+G++P+EIGNLTML  L L  N L GEIP+E+GNL  
Sbjct  107  GTIPSSIFTISTLKMLSLSFNDLSGAIPKEIGNLTMLKKLGLGYNKLRGEIPQELGNLAE  166

Query  101  LQILRLDNNNLEGTIPETIFNISTL-TYINMANN  3
            L+++ L NN L GTIP TIFN+S+L T ++ +NN
Sbjct  167  LELVSLTNNFLSGTIPSTIFNLSSLSTGMDFSNN  200


 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  SSLE L +  NQL+G++P  I  ++ L  L L+ N LSG IP+EIGNL M
Sbjct  83   GTIPSQIGNLSSLETLDLSHNQLSGTIPSSIFTISTLKMLSLSFNDLSGAIPKEIGNLTM  142

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G IP+ + N++ L  +++ NN
Sbjct  143  LKKLGLGYNKLRGEIPQELGNLAELELVSLTNN  175


 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            +MC RL  ++ LY+  NKL G IP +I +C  L  + +  NQ    +PR +GNLT L  L
Sbjct  209  DMCRRLPLIKGLYMSNNKLTGPIPNNIWQCKELIVISLAYNQFTERIPRGLGNLTSLKTL  268

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N+L+GEIP E+GNL  L+IL L  N L G +P +IFN+S +  + + +N
Sbjct  269  YLGFNNLTGEIPYEMGNLRNLEILGLQLNKLVGFVPTSIFNLSAMKTLALPSN  321


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   +L  L +W N+L GS+P   G L  L  L L  N L G IP  +  L  
Sbjct  453  GTIPKEIGNLINLRELGLWGNELIGSIPITFGKLQNLQGLDLVNNKLEGPIPNGLCQLAR  512

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L +D N L G IP  I ++++L  +++A+N
Sbjct  513  LSVLYMDGNKLSGPIPPCIGDLTSLRLLSLASN  545


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 64/117 (55%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLN------------------------GSLPREIGNLTM  174
            G IP  IG+ +SL  L +  N+LN                        GSLP +IGNL +
Sbjct  525  GPIPPCIGDLTSLRLLSLASNELNSVIPSTFWNLKDILSLNFSSNFLNGSLPEDIGNLKV  584

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  + L+ N+LSG+IP  IG L  LQ L L +N L+G+IP++I  + +L  ++++NN
Sbjct  585  VVIIDLSRNNLSGDIPTAIGGLMNLQDLSLRDNGLQGSIPKSIGGLVSLESLDLSNN  641


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG   +L+ L + DN L GS+P+ IG L  L +L L+ NSLSG IP  +  L  
Sbjct  597  GDIPTAIGGLMNLQDLSLRDNGLQGSIPKSIGGLVSLESLDLSNNSLSGNIPTSMEKLLY  656

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  N LEG IP 
Sbjct  657  LKDLNLSFNKLEGEIPR  673


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IPR +G  +SL+ LY+  N L G +P E+GNL  L  L L  N L G +P  I NL+ ++
Sbjct  255  IPRGLGNLTSLKTLYLGFNNLTGEIPYEMGNLRNLEILGLQLNKLVGFVPTSIFNLSAMK  314

Query  95   ILRLDNNNLEGTIPETI--FNISTLTYINMANN  3
             L L +N L G++P +I    +  L  I++A N
Sbjct  315  TLALPSNALSGSLPSSIDLVRLPNLEIISLAGN  347


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  S SL  +++ +  + G++P+EIGNL  L  L L  N L G IP   G L 
Sbjct  428  GVLPSSIGNLSLSLSRIFISNCSIRGTIPKEIGNLINLRELGLWGNELIGSIPITFGKLQ  487

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L NN LEG IP  +  ++ L+ + M  N
Sbjct  488  NLQGLDLVNNKLEGPIPNGLCQLARLSVLYMDGN  521


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG    +  + +  N L+G +P  IG L  L +L L +N L G IP+ IG L  
Sbjct  573  GSLPEDIGNLKVVVIIDLSRNNLSGDIPTAIGGLMNLQDLSLRDNGLQGSIPKSIGGLVS  632

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L G IP ++  +  L  +N++ N
Sbjct  633  LESLDLSNNSLSGNIPTSMEKLLYLKDLNLSFN  665


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP + G+  +L+ L + +N+L G +P  +  L  L+ L +  N LSG IP  IG+L  
Sbjct  477  GSIPITFGKLQNLQGLDLVNNKLEGPIPNGLCQLARLSVLYMDGNKLSGPIPPCIGDLTS  536

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L +N L   IP T +N+  +  +N ++N
Sbjct  537  LRLLSLASNELNSVIPSTFWNLKDILSLNFSSN  569


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P +IGNL+ L  L L+ N LSG IP  I  ++ L++L L  N+L G IP+ I N+
Sbjct  81   LGGTIPSQIGNLSSLETLDLSHNQLSGTIPSSIFTISTLKMLSLSFNDLSGAIPKEIGNL  140

Query  35   STLTYINMANN  3
            + L  + +  N
Sbjct  141  TMLKKLGLGYN  151


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S   C +L+ L + +N +NG LP  IGNL++ L+ + ++  S+ G IP+EIGNL  L+ L
Sbjct  409  SWANCKNLKLLDLSNNPINGVLPSSIGNLSLSLSRIFISNCSIRGTIPKEIGNLINLREL  468

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L G+IP T   +  L  +++ NN
Sbjct  469  GLWGNELIGSIPITFGKLQNLQGLDLVNN  497


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 7/100 (7%)
 Frame = -1

Query  281  GNIPRSIG--ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            G++P SI      +LE + +  N  +G +P  I N + L+ L+L ENS SG IP  +GNL
Sbjct  325  GSLPSSIDLVRLPNLEIISLAGNNFSGIIPSFIFNASKLSVLELGENSFSGIIPNTLGNL  384

Query  107  NMLQILRLDNNNLEGTIPETIF-----NISTLTYINMANN  3
              L+ LRL  N L  + PE  F     N   L  ++++NN
Sbjct  385  RKLEWLRLSYNFLTSSTPELSFLSSWANCKNLKLLDLSNN  424


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPRE  120
            G+IP+SIG   SLE L + +N L+G++P  +  L  L +L L+ N L GEIPRE
Sbjct  621  GSIPKSIGGLVSLESLDLSNNSLSGNIPTSMEKLLYLKDLNLSFNKLEGEIPRE  674


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L ++   L G IP +IGNL+ L+ L L +N L GTIP +IF ISTL  ++++ N
Sbjct  71   VTGLNISYFGLGGTIPSQIGNLSSLETLDLSHNQLSGTIPSSIFTISTLKMLSLSFN  127



>ref|XP_011091710.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1217

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            NMCS L  L+ L L+ N LYG IP +   CS L+ L + D+   G +PREIGNLTML  L
Sbjct  360  NMCSHLPNLQYLELHYNDLYGPIPSTWDGCSRLQDLSLRDSNFTGFIPREIGNLTMLRTL  419

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +L  N L+GEIPRE+G L  L+ L L  N L G+IPE I NISTLT + +  N
Sbjct  420  RLFHNRLTGEIPRELGKLQQLEQLHLAVNLLTGSIPEEIANISTLTLLALTAN  472


 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL  LE +YL  N + G IP S  EC  L  L + +N   G +PREIGN+TML  +
Sbjct  239  DICGRLPGLEAIYLSWNAISGRIPVSFPECRRLTLLSLSNNAFAGPIPREIGNVTMLEAV  298

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L+GEIP EIGNL  LQ+L ++ N   G+IP +IFNIS+L  +++A +
Sbjct  299  YLGGNYLTGEIPEEIGNLRRLQLLSMELNIFSGSIPLSIFNISSLVLLDLARS  351


 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 59/118 (50%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG  + L  L ++ N+L G +PRE+G L  L  L L  N L+G IP EI N++ 
Sbjct  404  GFIPREIGNLTMLRTLRLFHNRLTGEIPRELGKLQQLEQLHLAVNLLTGSIPEEIANIST  463

Query  101  LQILRLDNNNLEGT-------------------------IPETIFNISTLTYINMANN  3
            L +L L  N L G+                         IP++I N S LTYIN+ NN
Sbjct  464  LTLLALTANRLSGSLPKSIGSRLPDLDLISLETNLLSGHIPDSIGNSSKLTYINLGNN  521


 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  S ++ L + +N+ +G +P  I NL+ L  L+L+ NSL G++P +IG L  
Sbjct  138  GQIPASLGFLSEIQSLSLKNNKFSGFIPATIFNLSKLEMLELSFNSLGGKLPEQIGKLQN  197

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L +  N L G+IP  ++N+S+L  + + NN
Sbjct  198  LMVLSIQYNRLTGSIPFELYNVSSLETLALTNN  230


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  + M  N   G+LP E+  L  L  L L+ N+ +G+IP  +G L+ 
Sbjct  90   GTIPPHLGNLSFLVSIDMKGNSFQGNLPVELAQLRRLRFLDLSSNNFTGQIPASLGFLSE  149

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +Q L L NN   G IP TIFN+S L  + ++ N
Sbjct  150  IQSLSLKNNKFSGFIPATIFNLSKLEMLELSFN  182


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG  + LE +Y+  N L G +P EIGNL  L  L +  N  SG IP  I N++ 
Sbjct  283  GPIPREIGNVTMLEAVYLGGNYLTGEIPEEIGNLRRLQLLSMELNIFSGSIPLSIFNISS  342

Query  101  LQILRLDNNNLEGTIP  54
            L +L L  + L GT+P
Sbjct  343  LVLLDLARSGLSGTLP  358


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 1/92 (1%)
 Frame = -1

Query  275  IPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +P SIG  S SL      ++ + GS+P EI NLT L  L L+ N LSG +P  +G+L +L
Sbjct  576  LPPSIGNLSTSLRVFRARNSTIKGSIPNEISNLTSLVELDLSSNDLSGFLPSGLGSLALL  635

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            Q L L +N + G+IP  I  ++ L  + ++NN
Sbjct  636  QGLSLSDNRISGSIPTGICELTNLGELRLSNN  667


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I   S LE L +  N L G LP +IG L  L  L +  N L+G IP E+ N++ 
Sbjct  162  GFIPATIFNLSKLEMLELSFNSLGGKLPEQIGKLQNLMVLSIQYNRLTGSIPFELYNVSS  221

Query  101  LQILRLDNNNLEGTIPETI  45
            L+ L L NN+L G +P+ I
Sbjct  222  LETLALTNNSLSGELPDDI  240


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I   +SL  L +  N L+G LP  +G+L +L  L L++N +SG IP  I  L  
Sbjct  599  GSIPNEISNLTSLVELDLSSNDLSGFLPSGLGSLALLQGLSLSDNRISGSIPTGICELTN  658

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL NN +   IP  I N  +L  + + +N
Sbjct  659  LGELRLSNNQISSQIPGCIGNGISLRQLYLDSN  691


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +G  + L+ L + DN+++GS+P  I  LT L  L+L+ N +S +IP  IGN   
Sbjct  623  GFLPSGLGSLALLQGLSLSDNRISGSIPTGICELTNLGELRLSNNQISSQIPGCIGNGIS  682

Query  101  LQILRLDNNNLEGTIPETIFNI  36
            L+ L LD+N L   IP +++++
Sbjct  683  LRQLYLDSNRLSWGIPSSLWSL  704


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 52/95 (55%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P+SIG     L+ + +  N L+G +P  IGN + L  + L  N  SG IP  +G+L 
Sbjct  476  GSLPKSIGSRLPDLDLISLETNLLSGHIPDSIGNSSKLTYINLGNNHFSGTIPSSLGSLR  535

Query  104  MLQILRLDNNNLEG-TIPETIFNISTLTYINMANN  3
            +LQ L +  NNL G +   ++ N   LT   M NN
Sbjct  536  LLQHLYVHGNNLTGLSFITSLANCRFLTDFWMHNN  570


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  DNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
            D  L G++P  +GNL+ L ++ +  NS  G +P E+  L  L+ L L +NN  G IP ++
Sbjct  85   DMGLKGTIPPHLGNLSFLVSIDMKGNSFQGNLPVELAQLRRLRFLDLSSNNFTGQIPASL  144

Query  44   FNISTLTYINMANN  3
              +S +  +++ NN
Sbjct  145  GFLSEIQSLSLKNN  158


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSG-EIPREIGNLN  105
            G+IP SIG  S L Y+ + +N  +G++P  +G+L +L +L +  N+L+G      + N  
Sbjct  501  GHIPDSIGNSSKLTYINLGNNHFSGTIPSSLGSLRLLQHLYVHGNNLTGLSFITSLANCR  560

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L    + NN  +  +P +I N+ST   +  A N
Sbjct  561  FLTDFWMHNNRADDFLPPSIGNLSTSLRVFRARN  594


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            NIP ++G  ++L    +  N+L GS+P   GN+  L  L L  N+LSG IP+ +  L  L
Sbjct  744  NIPITVGGLNNLINFSLSHNRLLGSIPNTTGNMISLEVLDLAHNNLSGSIPKSLEALKHL  803

Query  98   QILRLDNNNLEGTIP  54
            +I  +  N+L G IP
Sbjct  804  KIFNVSYNSLSGEIP  818


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            NQ   ++P  +G L  L N  L+ N L G IP   GN+  L++L L +NNL G+IP+++ 
Sbjct  739  NQFTQNIPITVGGLNNLINFSLSHNRLLGSIPNTTGNMISLEVLDLAHNNLSGSIPKSLE  798

Query  41   NISTLTYINMANN  3
             +  L   N++ N
Sbjct  799  ALKHLKIFNVSYN  811



>emb|CDP15116.1| unnamed protein product [Coffea canephora]
Length=1134

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG+ + L+ L +  N L G +PREIGNLTML +L  +EN+L+G IP+E+GNL+ 
Sbjct  304  GDIPGEIGKLTMLKGLSITTNHLTGKIPREIGNLTMLESLSASENNLTGLIPQELGNLHN  363

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL++ NN+L G+IP  IFN+S L  ++ + N
Sbjct  364  LEILQIQNNSLSGSIPVRIFNLSRLIALSFSAN  396


 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ LY+  N L G +P EIG LTML  L +T N L+G+IPREIGNL M
Sbjct  280  GIIPNEIGNLTELQLLYLGSNNLEGDIPGEIGKLTMLKGLSITTNHLTGKIPREIGNLTM  339

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L    NNL G IP+ + N+  L  + + NN
Sbjct  340  LESLSASENNLTGLIPQELGNLHNLEILQIQNN  372


 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG  + LE L   +N L G +P+E+GNL  L  LQ+  NSLSG IP  I NL+ 
Sbjct  328  GKIPREIGNLTMLESLSASENNLTGLIPQELGNLHNLEILQIQNNSLSGSIPVRIFNLSR  387

Query  101  LQILRLDNNNLEGTIPETI  45
            L  L    N L G +PE I
Sbjct  388  LIALSFSANGLSGNLPENI  406


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = -1

Query  263  IGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRL  84
             G   +  Y+ +  N L G+LP  +G+L  L NL L  N+  G IP  IGN+  L++L L
Sbjct  654  FGNLKAARYIDLSINSLTGALPTTLGDLQSLQNLVLAHNTFQGSIPESIGNILSLELLDL  713

Query  83   DNNNLEGTIPETIFNISTLTYINMANN  3
             +N L G IP  +  +  LT  N++ N
Sbjct  714  SHNYLSGLIPPILVKLQYLTRFNVSFN  740


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I     L+ LY  +N+L+  +P ++ +L  L  L L++N  SG IP  +GN+  
Sbjct  552  GPIPDTISHLQKLQALYANNNKLSKVMPDKLCSLQSLAYLILSQNQFSGLIPECLGNITS  611

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + LD+N    +IP T+ N+  +  +N++ N
Sbjct  612  LRAVYLDSNRFHSSIPATLLNLKYILELNLSTN  644


 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG   SSLE   +    + G +P  IGNL+ L NL +  N L G IP  I +L 
Sbjct  503  GYLPESIGNFSSSLESFLISGCNIKGMIPSGIGNLSGLINLAIDSNQLIGPIPDTISHLQ  562

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L  +NN L   +P+ + ++ +L Y+ ++ N
Sbjct  563  KLQALYANNNKLSKVMPDKLCSLQSLAYLILSQN  596


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREI------------------GNL-------T  177
            G++P  I   SSLE + + DN L+GSLP ++                  GN+       +
Sbjct  207  GSLPSEIFNISSLEMIALRDNHLSGSLPGDMCRRLQRLFWLNLSENKFSGNIPSTLSQCS  266

Query  176  MLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L L+ N+ +G IP EIGNL  LQ+L L +NNLEG IP  I  ++ L  +++  N
Sbjct  267  ALQMLSLSINNFTGIIPNEIGNLTELQLLYLGSNNLEGDIPGEIGKLTMLKGLSITTN  324


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 52/95 (55%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G +P ++G  S L  L +  N  +G LP E+  L  L  L L  N LSGEIP   G +  
Sbjct  85   GIMPPTLGNLSFLVSLDLSGNNFHGQLPHELAYLRRLRFLNLGINDLSGEIPSWFGYSFP  144

Query  104  MLQILRLDNNNLEGTIPETIF-NISTLTYINMANN  3
             LQ L L NN+  G+IP  IF NISTL  + ++ N
Sbjct  145  KLQYLNLANNSFLGSIPPLIFYNISTLEQLRLSFN  179


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  +SL  +Y+  N+ + S+P  + NL  +  L L+ NSLSG +  E GNL  
Sbjct  600  GLIPECLGNITSLRAVYLDSNRFHSSIPATLLNLKYILELNLSTNSLSGIMGLEFGNLKA  659

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             + + L  N+L G +P T+ ++ +L  + +A+N
Sbjct  660  ARYIDLSINSLTGALPTTLGDLQSLQNLVLAHN  692


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G+IP  I    S+LE L +  N L G++P EIG L  L  L    N LSG +P EI N++
Sbjct  158  GSIPPLIFYNISTLEQLRLSFNNLEGTIPNEIGKLQNLKKLICERNQLSGSLPSEIFNIS  217

Query  104  MLQILRLDNNNLEGTIP-ETIFNISTLTYINMANN  3
             L+++ L +N+L G++P +    +  L ++N++ N
Sbjct  218  SLEMIALRDNHLSGSLPGDMCRRLQRLFWLNLSEN  252


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P ++G+  SL+ L +  N   GS+P  IGN+  L  L L+ N LSG IP  +  L  
Sbjct  672  GALPTTLGDLQSLQNLVLAHNTFQGSIPESIGNILSLELLDLSHNYLSGLIPPILVKLQY  731

Query  101  LQILRLDNNNLEGTIP-ETIF-NISTLTYIN  15
            L    +  NNL G IP E  F N + +++I+
Sbjct  732  LTRFNVSFNNLSGEIPSEGPFKNFTEMSFIS  762


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI-FN  39
            L G +P  +GNL+ L +L L+ N+  G++P E+  L  L+ L L  N+L G IP    ++
Sbjct  83   LTGIMPPTLGNLSFLVSLDLSGNNFHGQLPHELAYLRRLRFLNLGINDLSGEIPSWFGYS  142

Query  38   ISTLTYINMANN  3
               L Y+N+ANN
Sbjct  143  FPKLQYLNLANN  154



>ref|XP_006442663.1| hypothetical protein CICLE_v10024465mg, partial [Citrus clementina]
 gb|ESR55903.1| hypothetical protein CICLE_v10024465mg, partial [Citrus clementina]
Length=290

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  + +  NQ  G LPR++GN T L +L L  N+L+GEIP+EIGNL  
Sbjct  147  GPIPNNLWHCKELSSVSLSYNQFTGRLPRDLGNSTKLKSLDLGFNNLNGEIPQEIGNLRN  206

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL +D +NL G +P+TIFNISTL  +++ NN
Sbjct  207  LEILGIDQSNLVGFVPDTIFNISTLKILSLFNN  239


 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  SSL+ L +  N  +G++P+EIGNLT L  L L  N L GEIP E+GNL  
Sbjct  25   GTIPSHLGNLSSLQTLVLSRNWFSGTIPKEIGNLTKLKELHLDYNKLQGEIPEELGNLAE  84

Query  101  LQILRLDNNNLEGTIPETIFNISTL-TYINMANN  3
            L++L L+NN L GTIP +IFN+S + T ++ ++N
Sbjct  85   LEMLVLNNNLLTGTIPASIFNLSFISTALDFSDN  118


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTI  57
            L + D  L G++P  +GNL+ L  L L+ N  SG IP+EIGNL  L+ L LD N L+G I
Sbjct  16   LTISDLGLAGTIPSHLGNLSSLQTLVLSRNWFSGTIPKEIGNLTKLKELHLDYNKLQGEI  75

Query  56   PETIFNISTLTYINMANN  3
            PE + N++ L  + + NN
Sbjct  76   PEELGNLAELEMLVLNNN  93


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G  + L+ L +  N LNG +P+EIGNL  L  L + +++L G +P  I N++ 
Sbjct  171  GRLPRDLGNSTKLKSLDLGFNNLNGEIPQEIGNLRNLEILGIDQSNLVGFVPDTIFNIST  230

Query  101  LQILRLDNNNLEGTIPET  48
            L+IL L NN L G +P +
Sbjct  231  LKILSLFNNTLSGNLPSS  248



>gb|KCW70971.1| hypothetical protein EUGRSUZ_F040812, partial [Eucalyptus grandis]
Length=265

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S+L+++    NQL GS+P  IGNL+ L  +   +N LSG IP+ +G+LN 
Sbjct  140  GGIPAELGSLSNLQFVNFAANQLTGSIPSSIGNLSSLEAIYCYQNGLSGIIPQSLGHLNK  199

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L +N L GTIP TIFN+S+LT I++  N
Sbjct  200  LKVLTLASNGLSGTIPPTIFNLSSLTEIDIREN  232


 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  SSLE +Y + N L+G +P+ +G+L  L  L L  N LSG IP  I NL+ 
Sbjct  164  GSIPSSIGNLSSLEAIYCYQNGLSGIIPQSLGHLNKLKVLTLASNGLSGTIPPTIFNLSS  223

Query  101  LQILRLDNNNLEGTIPETI-FNISTLTYINMANN  3
            L  + +  N + G +PE I F +  L  + +A+N
Sbjct  224  LTEIDIRENQIRGNLPEDIGFTLPNLQVLIIASN  257


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 49/91 (54%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP  IG+   L+ LY+ +N L G + + I     L  L L  N L G IP E+G+L+ LQ
Sbjct  94   IPTQIGQLHHLQMLYLSNNSLTGEISKNISACLNLVFLHLEYNQLVGGIPAELGSLSNLQ  153

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +    N L G+IP +I N+S+L  I    N
Sbjct  154  FVNFAANQLTGSIPSSIGNLSSLEAIYCYQN  184


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+I   IG  S L  L++ +N  +  +P +IG L  L  L L+ NSL+GEI + I     
Sbjct  68   GSISPHIGNLSFLRKLWLQNNSFSLEIPTQIGQLHHLQMLYLSNNSLTGEISKNISACLN  127

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N L G IP  + ++S L ++N A N
Sbjct  128  LVFLHLEYNQLVGGIPAELGSLSNLQFVNFAAN  160


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L+GS+   IGNL+ L  L L  NS S EIP +IG L+ LQ+L L NN+L G I + I   
Sbjct  66   LSGSISPHIGNLSFLRKLWLQNNSFSLEIPTQIGQLHHLQMLYLSNNSLTGEISKNISAC  125

Query  35   STLTYINMANN  3
              L ++++  N
Sbjct  126  LNLVFLHLEYN  136



>ref|XP_010657052.1| PREDICTED: putative receptor-like protein kinase At3g47110 isoform 
X1 [Vitis vinifera]
Length=1522

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P ++  C  L+ L +W N+  G++P   GNLT L  L+L EN++ G IP E+GNL  
Sbjct  451  GQLPSTLSLCGQLQSLSLWGNRFTGNIPPSFGNLTALQVLELAENNIPGNIPSELGNLIN  510

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L+L  NNL G IPE IFNIS+L  I+ +NN
Sbjct  511  LQYLKLSANNLTGIIPEAIFNISSLQEIDFSNN  543


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P ++  C  L+ L +W N+  G++P   GNLT L +L+L +N++ G IP E+GNL  
Sbjct  696  GQLPSTLSLCGQLQSLSLWGNRFTGNIPPSFGNLTALQDLELGDNNIQGNIPNELGNLIN  755

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L+L  NNL G IPE IFNIS L  +++A N
Sbjct  756  LQNLKLSENNLTGIIPEAIFNISKLQSLSLAQN  788


 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             ++P+ IG+C  L+ L +++N+L GS+P  I NL+ L  L L  N L+GEIP+   +L  
Sbjct  112  ASLPKDIGKCKELQQLNLFNNKLVGSIPEAICNLSKLEELYLGNNQLTGEIPKTFSHLRN  171

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L  NNL G+IP TIFNIS+L  I+++ N
Sbjct  172  LKILSLRMNNLTGSIPATIFNISSLLNISLSYN  204


 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G+C+ L+ + +  N+L GS+PR IGNL  L  L L  NSL+GEIP+ + N++ 
Sbjct  233  GKIPTSLGQCTKLQVISLSYNELTGSMPRAIGNLVELQRLSLLNNSLTGEIPQSLLNISS  292

Query  101  LQILRLDNNNLEGTIPETI-FNISTLTYINMANN  3
            L+ LRL  NNL G +P ++ +++  L +I++++N
Sbjct  293  LRFLRLGENNLVGILPTSMGYDLPKLEFIDLSSN  326


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+  C  L  L +  N L G +P+ IG+L+ L  L L  N+L+G IPREIGNL+ 
Sbjct  330  GEIPSSLLHCRQLRVLSLSVNHLTGGIPKAIGSLSNLEELYLDYNNLAGGIPREIGNLSN  389

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL   ++ + G IP  IFNIS+L  I++ +N
Sbjct  390  LNILDFGSSGISGPIPPEIFNISSLQIIDLTDN  422


 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+  C  L  L +  NQ  G +P+ IG+L+ L  L L  N+L G IPREIGNL+ 
Sbjct  575  GEIPSSLSHCPHLRGLSLSLNQFTGGIPQAIGSLSNLEELYLAYNNLVGGIPREIGNLSN  634

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL   ++ + G IP  IFNIS+L   ++ +N
Sbjct  635  LNILDFGSSGISGPIPPEIFNISSLQIFDLTDN  667


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP++IG  S+LE LY+  N L G +PREIGNL+ LN L    + +SG IP EI N++ 
Sbjct  354  GGIPKAIGSLSNLEELYLDYNNLAGGIPREIGNLSNLNILDFGSSGISGPIPPEIFNISS  413

Query  101  LQILRLDNNNLEGTIPETI  45
            LQI+ L +N+L G++P  I
Sbjct  414  LQIIDLTDNSLPGSLPMDI  432


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP++IG  S+LE LY+  N L G +PREIGNL+ LN L    + +SG IP EI N++ 
Sbjct  599  GGIPQAIGSLSNLEELYLAYNNLVGGIPREIGNLSNLNILDFGSSGISGPIPPEIFNISS  658

Query  101  LQILRLDNNNLEGTIPETIFN  39
            LQI  L +N+L G++P  I+ 
Sbjct  659  LQIFDLTDNSLLGSLPMDIYK  679


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281   GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             G++P  +G   S+  L +  NQ++G +PR +G L  L +L L++N L G IP E G+L  
Sbjct  1041  GHLPPEVGNIKSIRTLDLSKNQVSGHIPRTLGELQNLEDLSLSQNRLQGPIPLEFGDLLS  1100

Query  101   LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L  NNL G IP+++  ++ L Y+N++ N
Sbjct  1101  LKFLDLSQNNLSGVIPKSLKALTYLKYLNVSFN  1133


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP S G  ++L+ L + DN + G++P E+GNL  L NL+L+EN+L+G IP  I N++ 
Sbjct  720  GNIPPSFGNLTALQDLELGDNNIQGNIPNELGNLINLQNLKLSENNLTGIIPEAIFNISK  779

Query  101  LQILRLDNNNLEGTIPETI  45
            LQ L L  N+  G++P ++
Sbjct  780  LQSLSLAQNHFSGSLPSSL  798


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -1

Query  281   GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             G+IPR++GE  +LE L +  N+L G +P E G+L  L  L L++N+LSG IP+ +  L  
Sbjct  1065  GHIPRTLGELQNLEDLSLSQNRLQGPIPLEFGDLLSLKFLDLSQNNLSGVIPKSLKALTY  1124

Query  101   LQILRLDNNNLEGTIPE  51
             L+ L +  N L+G IP+
Sbjct  1125  LKYLNVSFNKLQGEIPD  1141


 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP S G  ++L+ L + +N + G++P E+GNL  L  L+L+ N+L+G IP  I N++ 
Sbjct  475  GNIPPSFGNLTALQVLELAENNIPGNIPSELGNLINLQYLKLSANNLTGIIPEAIFNISS  534

Query  101  LQILRLDNNNLEGTIPETIF----NISTLTYINMANN  3
            LQ +   NN+L G +P  I     ++  L +I++++N
Sbjct  535  LQEIDFSNNSLSGCLPMDICKHLPDLPKLEFIDLSSN  571


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = -1

Query  278   NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
             NIP S+     L  L +  N L G LP E+GN+  +  L L++N +SG IPR +G L  L
Sbjct  1018  NIPPSLWTLRGLLVLNLSSNFLTGHLPPEVGNIKSIRTLDLSKNQVSGHIPRTLGELQNL  1077

Query  98    QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             + L L  N L+G IP    ++ +L +++++ N
Sbjct  1078  EDLSLSQNRLQGPIPLEFGDLLSLKFLDLSQN  1109


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P S+G +   LE++ +  NQL G +P  + +   L  L L+ N L+G IP+ IG+L+
Sbjct  305  GILPTSMGYDLPKLEFIDLSSNQLKGEIPSSLLHCRQLRVLSLSVNHLTGGIPKAIGSLS  364

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L LD NNL G IP  I N+S L  ++  ++
Sbjct  365  NLEELYLDYNNLAGGIPREIGNLSNLNILDFGSS  398


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281   GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             G+IP  +    +L YL++  NQL GS+P  +G L  L  L L  N+L+  IP  +  L  
Sbjct  969   GSIPNDLCRLKNLGYLFLSSNQLTGSIPSCLGYLPPLRELYLHSNALASNIPPSLWTLRG  1028

Query  101   LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +L L +N L G +P  + NI ++  ++++ N
Sbjct  1029  LLVLNLSSNFLTGHLPPEVGNIKSIRTLDLSKN  1061


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I   +G  S L  L + +N  + SLP++IG    L  L L  N L G IP  I NL+ 
Sbjct  88   GTIVSQVGNLSFLVSLDLSNNYFHASLPKDIGKCKELQQLNLFNNKLVGSIPEAICNLSK  147

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN L G IP+T  ++  L  +++  N
Sbjct  148  LEELYLGNNQLTGEIPKTFSHLRNLKILSLRMN  180


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++  ++GNL+ L +L L+ N     +P++IG    LQ L L NN L G+IPE I N+
Sbjct  86   LQGTIVSQVGNLSFLVSLDLSNNYFHASLPKDIGKCKELQQLNLFNNKLVGSIPEAICNL  145

Query  35   STLTYINMANN  3
            S L  + + NN
Sbjct  146  SKLEELYLGNN  156


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +I + + +   LE++ +  NQL G +P  + +   L  L L+ N  +G IP+ IG+L+ L
Sbjct  552  DICKHLPDLPKLEFIDLSSNQLKGEIPSSLSHCPHLRGLSLSLNQFTGGIPQAIGSLSNL  611

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + L L  NNL G IP  I N+S L  ++  ++
Sbjct  612  EELYLAYNNLVGGIPREIGNLSNLNILDFGSS  643


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281   GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             G+IP  +G    L  LY+  N L  ++P  +  L  L  L L+ N L+G +P E+GN+  
Sbjct  993   GSIPSCLGYLPPLRELYLHSNALASNIPPSLWTLRGLLVLNLSSNFLTGHLPPEVGNIKS  1052

Query  101   LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             ++ L L  N + G IP T+  +  L  ++++ N
Sbjct  1053  IRTLDLSKNQVSGHIPRTLGELQNLEDLSLSQN  1085


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE-IPREIG---  114
            G IP SI   S L  L +WDN   G +P+++GNL  L  L L  N L+ E    E+G   
Sbjct  817  GIIPMSISNMSELTELDIWDNFFTGDVPKDLGNLRRLEFLNLGSNQLTDEHSASEVGFLT  876

Query  113  ---NLNMLQILRLDNNNLEGTIPETIFNIS  33
               N N L+ L +++N L+G +P ++ N+S
Sbjct  877  SLTNCNFLRTLWIEDNPLKGILPNSLGNLS  906


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P S+G +   LE L +  N+ +G +P  I N++ L  L + +N  +G++P+++GNL 
Sbjct  792  GSLPSSLGTQLPDLEGLAIGRNEFSGIIPMSISNMSELTELDIWDNFFTGDVPKDLGNLR  851

Query  104  MLQILRLDNNNL  69
             L+ L L +N L
Sbjct  852  RLEFLNLGSNQL  863



>ref|XP_002325932.2| hypothetical protein POPTR_0019s08830g [Populus trichocarpa]
 gb|EEF00314.2| hypothetical protein POPTR_0019s08830g [Populus trichocarpa]
Length=1020

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG   SL  LY+WDNQL+GS+P  IGN+TML  L L +N+L+G IP  IGNL  
Sbjct  153  GSIPSSIGNLKSLSVLYLWDNQLSGSIPFSIGNMTMLTGLALYQNNLTGSIPSFIGNLTS  212

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP+ I  + +L  +++A+N
Sbjct  213  LSELNLWGNKLSGSIPQEIGLLESLNILDLADN  245


 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG+  +L +L +  NQL+GS+P  IGNL  L+ L L +N LSG IP  IGN+ M
Sbjct  129  GTIPHEIGKLRNLSFLALSWNQLSGSIPSSIGNLKSLSVLYLWDNQLSGSIPFSIGNMTM  188

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G+IP  I N+++L+ +N+  N
Sbjct  189  LTGLALYQNNLTGSIPSFIGNLTSLSELNLWGN  221


 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  +SL  L +W N+L+GS+P+EIG L  LN L L +N L+G IP  IG L  
Sbjct  201  GSIPSFIGNLTSLSELNLWGNKLSGSIPQEIGLLESLNILDLADNVLTGRIPYSIGKLRN  260

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP +I N+++++   +  N
Sbjct  261  LFFLGLSYNQLSGLIPSSIKNLTSVSEFYLEKN  293


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            L +L + +N L+G++P EIG L  L+ L L+ N LSG IP  IGNL  L +L L +N L 
Sbjct  117  LLFLVLPNNSLSGTIPHEIGKLRNLSFLALSWNQLSGSIPSSIGNLKSLSVLYLWDNQLS  176

Query  65   GTIPETIFNISTLTYINMANN  3
            G+IP +I N++ LT + +  N
Sbjct  177  GSIPFSIGNMTMLTGLALYQN  197


 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG+  +L +L +  NQL+G +P  I NLT ++   L +N LS  IP+EIG L  
Sbjct  249  GRIPYSIGKLRNLFFLGLSYNQLSGLIPSSIKNLTSVSEFYLEKNKLSSPIPQEIGLLES  308

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N   G +P  + N++ L  + +  N
Sbjct  309  LHVLALAGNKFHGPLPSEMNNLTHLHGLALDGN  341


 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP+ IG   SL  L +  N+ +G LP E+ NLT L+ L L  N  +G +P ++ +  +L+
Sbjct  299  IPQEIGLLESLHVLALAGNKFHGPLPSEMNNLTHLHGLALDGNEFTGHLPVDLCHGGVLK  358

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            I    NN   G+IPE++ N + L  + +  N
Sbjct  359  ICTASNNYFSGSIPESLKNCTGLYRVRLDRN  389


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +GECS+L  L +  N+   S+P EIG L  L +L L+ N L+ +IPRE+G L  
Sbjct  513  GLIPKQLGECSNLLLLNLSGNKFRESIPGEIGFLLSLQDLDLSCNFLTRDIPRELGQLQK  572

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +N L G IP T  ++ +LT +++++N
Sbjct  573  LETLNVSHNMLSGRIPSTFKDMLSLTTVDISSN  605


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI   +S+   Y+  N+L+  +P+EIG L  L+ L L  N   G +P E+ NL  
Sbjct  273  GLIPSSIKNLTSVSEFYLEKNKLSSPIPQEIGLLESLHVLALAGNKFHGPLPSEMNNLTH  332

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L LD N   G +P  + +   L     +NN
Sbjct  333  LHGLALDGNEFTGHLPVDLCHGGVLKICTASNN  365


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +    G+C ++  L +  N ++G +P E+G  T L+ + L+ N L G IP+++G L +
Sbjct  417  GELSSKWGDCRNMTSLQISKNNVSGEIPPELGKATQLHLIDLSSNQLKGGIPKDLGGLKL  476

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+NN+L G IP  I  +S L  +N+A+N
Sbjct  477  LYKLILNNNHLSGAIPLDIKMLSNLQILNLASN  509


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G+ + L  + +  NQL G +P+++G L +L  L L  N LSG IP +I  L+ 
Sbjct  441  GEIPPELGKATQLHLIDLSSNQLKGGIPKDLGGLKLLYKLILNNNHLSGAIPLDIKMLSN  500

Query  101  LQILRLDNNNLEGTIPETI  45
            LQIL L +NNL G IP+ +
Sbjct  501  LQILNLASNNLSGLIPKQL  519


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNI    G    L Y+ +  N   G L  + G+   + +LQ+++N++SGEIP E+G    
Sbjct  393  GNISEVFGIYPHLNYIDLSYNNFYGELSSKWGDCRNMTSLQISKNNVSGEIPPELGKATQ  452

Query  101  LQILRLDNNNLEGTIPE  51
            L ++ L +N L+G IP+
Sbjct  453  LHLIDLSSNQLKGGIPK  469



>ref|XP_009596314.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=1218

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P SI   SSL+Y  +  N L GSLPREIGNLT L  L LTEN  +GEIP+EI NL  
Sbjct  294  GYVPISIFNISSLQYFTLRKNNLKGSLPREIGNLTKLQVLHLTENMFTGEIPKEISNLVY  353

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L++NN  G++   IFNIS+L  ++++ N
Sbjct  354  LEEVALESNNFSGSLAMEIFNISSLRLVDLSAN  386


 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P   G    L+ + + +N   GS+P    NL+ L  L LT NSL G+IP+EIGNL  
Sbjct  53   GEVPSWFGVLHQLQVVTLRNNSFTGSIPSSFFNLSKLETLSLTLNSLEGQIPKEIGNLEN  112

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L  N L G+IP T+ N S L  + +++N
Sbjct  113  LRILDLTGNKLIGSIPLTLSNASRLETLTISHN  145


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            NIP S+G    L  L +  N + GSLP EIGNL +   + L+ N  S  IPREIG L  L
Sbjct  614  NIPTSLGNLKDLMILDLLSNNMGGSLPPEIGNLKVAIRIDLSMNQFSNSIPREIGGLQNL  673

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L +N L+G+IP+++ N+  L +I+ ++N
Sbjct  674  VNLSLRHNKLQGSIPDSMSNMVGLEFIDFSHN  705


 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   +L  L +  N+L GS+P  + N + L  L ++ N L G IP  IGNL+ 
Sbjct  101  GQIPKEIGNLENLRILDLTGNKLIGSIPLTLSNASRLETLTISHNFLQGNIPEGIGNLHN  160

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L +++N L G+IP ++FNIS +  I   NN
Sbjct  161  LNLLGIEDNRLTGSIPLSVFNISRIEAIGFTNN  193


 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +  CS L+ L + +N+ +G +   IG+L+ L  L L  N  +G IP+EIGNL  
Sbjct  222  GHMPTCLSNCSKLQILSLSENEFDGPIHSGIGSLSNLQFLYLGSNHFTGIIPQEIGNLIN  281

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L ++ N + G +P +IFNIS+L Y  +  N
Sbjct  282  LALLGMELNQITGYVPISIFNISSLQYFTLRKN  314


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I   IG  S+L++LY+  N   G +P+EIGNL  L  L +  N ++G +P  I N++ 
Sbjct  246  GPIHSGIGSLSNLQFLYLGSNHFTGIIPQEIGNLINLALLGMELNQITGYVPISIFNISS  305

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ   L  NNL+G++P  I N++ L  +++  N
Sbjct  306  LQYFTLRKNNLKGSLPREIGNLTKLQVLHLTEN  338


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   +L  L M  NQ+ G +P  I N++ L    L +N+L G +PREIGNL  
Sbjct  270  GIIPQEIGNLINLALLGMELNQITGYVPISIFNISSLQYFTLRKNNLKGSLPREIGNLTK  329

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  N   G IP+ I N+  L  + + +N
Sbjct  330  LQVLHLTENMFTGEIPKEISNLVYLEEVALESN  362


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+  G  + L YL +  N   G+LP+E+  L  L  L L  N+ SGE+P   G L+ 
Sbjct  5    GRIPQDFGNLTFLVYLDLGSNNFYGNLPQEMTRLRRLRFLNLNSNNFSGEVPSWFGVLHQ  64

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ++ L NN+  G+IP + FN+S L  +++  N
Sbjct  65   LQVVTLRNNSFTGSIPSSFFNLSKLETLSLTLN  97


 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG       + +  NQ + S+PREIG L  L NL L  N L G IP  + N+  
Sbjct  637  GSLPPEIGNLKVAIRIDLSMNQFSNSIPREIGGLQNLVNLSLRHNKLQGSIPDSMSNMVG  696

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ +   +NN+ G IP+++  +  L Y N++ N
Sbjct  697  LEFIDFSHNNISGIIPKSLEKLKNLKYFNVSVN  729


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P S+G  S SL  +   D ++ G +P E+GNL+ L    ++ N L G IPR IGNL 
Sbjct  492  GMLPPSVGNLSTSLTKVSARDCKIKGRIPNEVGNLSSLFEFDISGNDLVGSIPRSIGNLR  551

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L+L NN L G   + +     L  I + +N
Sbjct  552  NLQRLKLSNNKLTGITGDNLCKFHHLGAIYLGHN  585


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 58/117 (50%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYL------------------------YMWDNQLNGSLPREIGNLTM  174
            G+IPRSIG   +L+ L                        Y+  NQL+G LP  +GN+T 
Sbjct  541  GSIPRSIGNLRNLQRLKLSNNKLTGITGDNLCKFHHLGAIYLGHNQLSGPLPNCLGNVTS  600

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L  N LS  IP  +GNL  L IL L +NN+ G++P  I N+     I+++ N
Sbjct  601  LREIYLGFNKLSSNIPTSLGNLKDLMILDLLSNNMGGSLPPEIGNLKVAIRIDLSMN  657


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++   S LE L +  N L G++P  IGNL  LN L + +N L+G IP  + N++ 
Sbjct  125  GSIPLTLSNASRLETLTISHNFLQGNIPEGIGNLHNLNLLGIEDNRLTGSIPLSVFNISR  184

Query  101  LQILRLDNNNLEGTIPETIFN-ISTLTYINMANN  3
            ++ +   NN+L G++P  + N +S L  ++++ N
Sbjct  185  IEAIGFTNNSLSGSLPNDLCNGLSLLKELDLSGN  218


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  SSL    +  N L GS+PR IGNL  L  L+L+ N L+G     +   + 
Sbjct  517  GRIPNEVGNLSSLFEFDISGNDLVGSIPRSIGNLRNLQRLKLSNNKLTGITGDNLCKFHH  576

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L +N L G +P  + N+++L  I +  N
Sbjct  577  LGAIYLGHNQLSGPLPNCLGNVTSLREIYLGFN  609


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P+ +     L +L +  N  +G +P   G L  L  + L  NS +G IP    NL+ 
Sbjct  29   GNLPQEMTRLRRLRFLNLNSNNFSGEVPSWFGVLHQLQVVTLRNNSFTGSIPSSFFNLSK  88

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N+LEG IP+ I N+  L  +++  N
Sbjct  89   LETLSLTLNSLEGQIPKEIGNLENLRILDLTGN  121


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 5/93 (5%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWD---NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN  111
            G++P  +  C+ L  L   D   N+L G +P  + N + L  L L+EN   G I   IG+
Sbjct  197  GSLPNDL--CNGLSLLKELDLSGNKLQGHMPTCLSNCSKLQILSLSENEFDGPIHSGIGS  254

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINM  12
            L+ LQ L L +N+  G IP+ I N+  L  + M
Sbjct  255  LSNLQFLYLGSNHFTGIIPQEIGNLINLALLGM  287


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IPR IG   +L  L +  N+L GS+P  + N+  L  +  + N++SG IP+ +  L  L
Sbjct  662  SIPREIGGLQNLVNLSLRHNKLQGSIPDSMSNMVGLEFIDFSHNNISGIIPKSLEKLKNL  721

Query  98   QILRLDNNNLEGTIPE  51
            +   +  N L G IP 
Sbjct  722  KYFNVSVNKLYGEIPS  737



>ref|XP_010657053.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Vitis vinifera]
Length=1457

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P ++  C  L+ L +W N+  G++P   GNLT L  L+L EN++ G IP E+GNL  
Sbjct  386  GQLPSTLSLCGQLQSLSLWGNRFTGNIPPSFGNLTALQVLELAENNIPGNIPSELGNLIN  445

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L+L  NNL G IPE IFNIS+L  I+ +NN
Sbjct  446  LQYLKLSANNLTGIIPEAIFNISSLQEIDFSNN  478


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P ++  C  L+ L +W N+  G++P   GNLT L +L+L +N++ G IP E+GNL  
Sbjct  631  GQLPSTLSLCGQLQSLSLWGNRFTGNIPPSFGNLTALQDLELGDNNIQGNIPNELGNLIN  690

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L+L  NNL G IPE IFNIS L  +++A N
Sbjct  691  LQNLKLSENNLTGIIPEAIFNISKLQSLSLAQN  723


 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G+C+ L+ + +  N+L GS+PR IGNL  L  L L  NSL+GEIP+ + N++ 
Sbjct  168  GKIPTSLGQCTKLQVISLSYNELTGSMPRAIGNLVELQRLSLLNNSLTGEIPQSLLNISS  227

Query  101  LQILRLDNNNLEGTIPETI-FNISTLTYINMANN  3
            L+ LRL  NNL G +P ++ +++  L +I++++N
Sbjct  228  LRFLRLGENNLVGILPTSMGYDLPKLEFIDLSSN  261


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+  C  L  L +  N L G +P+ IG+L+ L  L L  N+L+G IPREIGNL+ 
Sbjct  265  GEIPSSLLHCRQLRVLSLSVNHLTGGIPKAIGSLSNLEELYLDYNNLAGGIPREIGNLSN  324

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL   ++ + G IP  IFNIS+L  I++ +N
Sbjct  325  LNILDFGSSGISGPIPPEIFNISSLQIIDLTDN  357


 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+  C  L  L +  NQ  G +P+ IG+L+ L  L L  N+L G IPREIGNL+ 
Sbjct  510  GEIPSSLSHCPHLRGLSLSLNQFTGGIPQAIGSLSNLEELYLAYNNLVGGIPREIGNLSN  569

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL   ++ + G IP  IFNIS+L   ++ +N
Sbjct  570  LNILDFGSSGISGPIPPEIFNISSLQIFDLTDN  602


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP++IG  S+LE LY+  N L G +PREIGNL+ LN L    + +SG IP EI N++ 
Sbjct  289  GGIPKAIGSLSNLEELYLDYNNLAGGIPREIGNLSNLNILDFGSSGISGPIPPEIFNISS  348

Query  101  LQILRLDNNNLEGTIPETI  45
            LQI+ L +N+L G++P  I
Sbjct  349  LQIIDLTDNSLPGSLPMDI  367


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP++IG  S+LE LY+  N L G +PREIGNL+ LN L    + +SG IP EI N++ 
Sbjct  534  GGIPQAIGSLSNLEELYLAYNNLVGGIPREIGNLSNLNILDFGSSGISGPIPPEIFNISS  593

Query  101  LQILRLDNNNLEGTIPETIFN  39
            LQI  L +N+L G++P  I+ 
Sbjct  594  LQIFDLTDNSLLGSLPMDIYK  614


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281   GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             G++P  +G   S+  L +  NQ++G +PR +G L  L +L L++N L G IP E G+L  
Sbjct  976   GHLPPEVGNIKSIRTLDLSKNQVSGHIPRTLGELQNLEDLSLSQNRLQGPIPLEFGDLLS  1035

Query  101   LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L  NNL G IP+++  ++ L Y+N++ N
Sbjct  1036  LKFLDLSQNNLSGVIPKSLKALTYLKYLNVSFN  1068


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP S G  ++L+ L + DN + G++P E+GNL  L NL+L+EN+L+G IP  I N++ 
Sbjct  655  GNIPPSFGNLTALQDLELGDNNIQGNIPNELGNLINLQNLKLSENNLTGIIPEAIFNISK  714

Query  101  LQILRLDNNNLEGTIPETI  45
            LQ L L  N+  G++P ++
Sbjct  715  LQSLSLAQNHFSGSLPSSL  733


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -1

Query  281   GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             G+IPR++GE  +LE L +  N+L G +P E G+L  L  L L++N+LSG IP+ +  L  
Sbjct  1000  GHIPRTLGELQNLEDLSLSQNRLQGPIPLEFGDLLSLKFLDLSQNNLSGVIPKSLKALTY  1059

Query  101   LQILRLDNNNLEGTIPE  51
             L+ L +  N L+G IP+
Sbjct  1060  LKYLNVSFNKLQGEIPD  1076


 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP S G  ++L+ L + +N + G++P E+GNL  L  L+L+ N+L+G IP  I N++ 
Sbjct  410  GNIPPSFGNLTALQVLELAENNIPGNIPSELGNLINLQYLKLSANNLTGIIPEAIFNISS  469

Query  101  LQILRLDNNNLEGTIPETIF----NISTLTYINMANN  3
            LQ +   NN+L G +P  I     ++  L +I++++N
Sbjct  470  LQEIDFSNNSLSGCLPMDICKHLPDLPKLEFIDLSSN  506


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = -1

Query  278   NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
             NIP S+     L  L +  N L G LP E+GN+  +  L L++N +SG IPR +G L  L
Sbjct  953   NIPPSLWTLRGLLVLNLSSNFLTGHLPPEVGNIKSIRTLDLSKNQVSGHIPRTLGELQNL  1012

Query  98    QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             + L L  N L+G IP    ++ +L +++++ N
Sbjct  1013  EDLSLSQNRLQGPIPLEFGDLLSLKFLDLSQN  1044


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P S+G +   LE++ +  NQL G +P  + +   L  L L+ N L+G IP+ IG+L+
Sbjct  240  GILPTSMGYDLPKLEFIDLSSNQLKGEIPSSLLHCRQLRVLSLSVNHLTGGIPKAIGSLS  299

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L LD NNL G IP  I N+S L  ++  ++
Sbjct  300  NLEELYLDYNNLAGGIPREIGNLSNLNILDFGSS  333


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +    +L YL++  NQL GS+P  +G L  L  L L  N+L+  IP  +  L  
Sbjct  904  GSIPNDLCRLKNLGYLFLSSNQLTGSIPSCLGYLPPLRELYLHSNALASNIPPSLWTLRG  963

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L +N L G +P  + NI ++  ++++ N
Sbjct  964  LLVLNLSSNFLTGHLPPEVGNIKSIRTLDLSKN  996


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +I + + +   LE++ +  NQL G +P  + +   L  L L+ N  +G IP+ IG+L+ L
Sbjct  487  DICKHLPDLPKLEFIDLSSNQLKGEIPSSLSHCPHLRGLSLSLNQFTGGIPQAIGSLSNL  546

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + L L  NNL G IP  I N+S L  ++  ++
Sbjct  547  EELYLAYNNLVGGIPREIGNLSNLNILDFGSS  578


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281   GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
             G+IP  +G    L  LY+  N L  ++P  +  L  L  L L+ N L+G +P E+GN+  
Sbjct  928   GSIPSCLGYLPPLRELYLHSNALASNIPPSLWTLRGLLVLNLSSNFLTGHLPPEVGNIKS  987

Query  101   LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             ++ L L  N + G IP T+  +  L  ++++ N
Sbjct  988   IRTLDLSKNQVSGHIPRTLGELQNLEDLSLSQN  1020


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE-IPREIG---  114
            G IP SI   S L  L +WDN   G +P+++GNL  L  L L  N L+ E    E+G   
Sbjct  752  GIIPMSISNMSELTELDIWDNFFTGDVPKDLGNLRRLEFLNLGSNQLTDEHSASEVGFLT  811

Query  113  ---NLNMLQILRLDNNNLEGTIPETIFNIS  33
               N N L+ L +++N L+G +P ++ N+S
Sbjct  812  SLTNCNFLRTLWIEDNPLKGILPNSLGNLS  841


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 57/101 (56%), Gaps = 8/101 (8%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIG-------NLTMLNNLQLTENSLSGEIPR  123
            G I   +G  S L  L + +N  + SLP++IG       N++ L N+ L+ NSLSG +P 
Sbjct  88   GTIVSQVGNLSFLVSLDLSNNYFHASLPKDIGSIPATIFNISSLLNISLSYNSLSGSLPM  147

Query  122  EIGNLNM-LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ++ N N  L+ L L +NNL G IP ++   + L  I+++ N
Sbjct  148  DMCNTNPNLKELNLTSNNLSGKIPTSLGQCTKLQVISLSYN  188


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P S+G +   LE L +  N+ +G +P  I N++ L  L + +N  +G++P+++GNL 
Sbjct  727  GSLPSSLGTQLPDLEGLAIGRNEFSGIIPMSISNMSELTELDIWDNFFTGDVPKDLGNLR  786

Query  104  MLQILRLDNNNL  69
             L+ L L +N L
Sbjct  787  RLEFLNLGSNQL  798



>ref|WP_035091656.1| hypothetical protein, partial [Aquimarina macrocephali]
Length=273

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ I + +SL YLY+ DN L GS+P EIGNL  LN L L  N L+G IP+EIG L  
Sbjct  90   GSIPKKIDKLTSLGYLYLNDNNLTGSIPEEIGNLISLNVLNLQFNELTGSIPKEIGKLTS  149

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IP+ I  +++L Y+++  N
Sbjct  150  LVGLYLYNNKLTGSIPKEIDKLTSLDYLDLGAN  182


 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG+ +SL  LY+++N+L GS+P+EI  LT L+ L L  N L+G IP+EIG L  
Sbjct  138  GSIPKEIGKLTSLVGLYLYNNKLTGSIPKEIDKLTSLDYLDLGANELTGPIPKEIGKLTS  197

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL  N L G+IP+ I  +++L  +++  N
Sbjct  198  LDFLRLSYNKLTGSIPKEIGKLTSLETLHLPIN  230


 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG+ +SL++L +  N+L GS+P+EIG LT L  L L  N L+G IP+EIGNL  
Sbjct  186  GPIPKEIGKLTSLDFLRLSYNKLTGSIPKEIGKLTSLETLHLPINELTGSIPKEIGNLTS  245

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L  L L +N L G+IP+ I +I TL
Sbjct  246  LVGLYLYSNKLTGSIPKEIASIKTL  270


 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ I + +SL+YL +  N+L G +P+EIG LT L+ L+L+ N L+G IP+EIG L  
Sbjct  162  GSIPKEIDKLTSLDYLDLGANELTGPIPKEIGKLTSLDFLRLSYNKLTGSIPKEIGKLTS  221

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G+IP+ I N+++L  + + +N
Sbjct  222  LETLHLPINELTGSIPKEIGNLTSLVGLYLYSN  254


 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP+ IG  +SLE L +  N+L GS+P+EI NLT L  L+L  N L+G IP+EIG+L  L
Sbjct  19   SIPKEIGNLTSLETLQLSHNKLTGSIPKEISNLTSLETLRLNHNELTGAIPKEIGSLISL  78

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L  N L G+IP+ I  +++L Y+ + +N
Sbjct  79   DYLNLGANELTGSIPKKIDKLTSLGYLYLNDN  110


 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL+YL +  N+L GS+P++I  LT L  L L +N+L+G IP EIGNL  
Sbjct  66   GAIPKEIGSLISLDYLNLGANELTGSIPKKIDKLTSLGYLYLNDNNLTGSIPEEIGNLIS  125

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G+IP+ I  +++L  + + NN
Sbjct  126  LNVLNLQFNELTGSIPKEIGKLTSLVGLYLYNN  158


 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ I   +SLE L +  N+L G++P+EIG+L  L+ L L  N L+G IP++I  L  
Sbjct  42   GSIPKEISNLTSLETLRLNHNELTGAIPKEIGSLISLDYLNLGANELTGSIPKKIDKLTS  101

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L++NNL G+IPE I N+ +L  +N+  N
Sbjct  102  LGYLYLNDNNLTGSIPEEIGNLISLNVLNLQFN  134


 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTI  57
            L +  N+L  S+P+EIGNLT L  LQL+ N L+G IP+EI NL  L+ LRL++N L G I
Sbjct  9    LNLAANELTRSIPKEIGNLTSLETLQLSHNKLTGSIPKEISNLTSLETLRLNHNELTGAI  68

Query  56   PETIFNISTLTYINMANN  3
            P+ I ++ +L Y+N+  N
Sbjct  69   PKEIGSLISLDYLNLGAN  86


 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L +  N+L GS+P+EIG LT L  L L  N L+G IP+EI  L  
Sbjct  114  GSIPEEIGNLISLNVLNLQFNELTGSIPKEIGKLTSLVGLYLYNNKLTGSIPKEIDKLTS  173

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP+ I  +++L ++ ++ N
Sbjct  174  LDYLDLGANELTGPIPKEIGKLTSLDFLRLSYN  206


 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG+ +SLE L++  N+L GS+P+EIGNLT L  L L  N L+G IP+EI ++  
Sbjct  210  GSIPKEIGKLTSLETLHLPINELTGSIPKEIGNLTSLVGLYLYSNKLTGSIPKEIASIKT  269

Query  101  LQIL  90
            L  L
Sbjct  270  LDDL  273


 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +N+L L  N L+  IP+EIGNL  L+ L+L +N L G+IP+ I N+++L  + + +N
Sbjct  6    VNSLNLAANELTRSIPKEIGNLTSLETLQLSHNKLTGSIPKEISNLTSLETLRLNHN  62



>emb|CDP20095.1| unnamed protein product [Coffea canephora]
Length=694

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L + D+ L+GS+PREIGNLTML  +  + NSL+G IP EIGNL  
Sbjct  277  GSIPEEIGNLQSLRVLSIIDSNLSGSIPREIGNLTMLEEVDFSSNSLTGPIPNEIGNLLK  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N+L G+IP  IFN+STL  + +A+N
Sbjct  337  LESLVLRWNSLSGSIPVAIFNMSTLRELYLADN  369


 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI  CS L  +Y+ DN+ +G +P  IGNL  L  L L+ N+L+  +  E+G L  
Sbjct  398  GAIPASISNCSKLTGIYLGDNKFSGPMPNSIGNLRRLEILYLSANNLTRPLAPEMGELKD  457

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN   G IP TI+++ ++ ++++ANN
Sbjct  458  LTRLDLSNNQFSGKIPSTIWSLESMDHLSLANN  490


 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR IG  + LE +    N L G +P EIGNL  L +L L  NSLSG IP  I N++ 
Sbjct  301  GSIPREIGNLTMLEEVDFSSNSLTGPIPNEIGNLLKLESLVLRWNSLSGSIPVAIFNMST  360

Query  101  LQILRLDNNNLEGTIPETI  45
            L+ L L +N+L G +P ++
Sbjct  361  LRELYLADNHLSGALPSSM  379


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P SIG    LE LY+  N L   L  E+G L  L  L L+ N  SG+IP  I +L  
Sbjct  422  GPMPNSIGNLRRLEILYLSANNLTRPLAPEMGELKDLTRLDLSNNQFSGKIPSTIWSLES  481

Query  101  LQILRLDNNNLE-GTIPETIFNISTLTYI  18
            +  L L NN+L+ G IP  I N+S L Y+
Sbjct  482  MDHLSLANNSLQGGKIPTEILNLSKLKYL  510


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 5/96 (5%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWD---NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN  111
            G IP +I  C +L  L   D   N+L+G +   + N + L +L L+ N  +G IP EIGN
Sbjct  228  GEIPANI--CDNLLNLKELDLSWNRLSGQILSGLSNCSGLKSLDLSSNHFAGSIPEEIGN  285

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L++L + ++NL G+IP  I N++ L  ++ ++N
Sbjct  286  LQSLRVLSIIDSNLSGSIPREIGNLTMLEEVDFSSN  321



>gb|KDO44560.1| hypothetical protein CISIN_1g0022142mg, partial [Citrus sinensis]
Length=345

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  + +  NQ  G LPR++GN T L +L L  N+L+GEIP+EIGNL  
Sbjct  169  GPIPNNLWHCKELSSVSLSYNQFTGRLPRDLGNSTKLKSLDLGFNNLNGEIPQEIGNLRN  228

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL +D +NL G +P+TIFNISTL  +++ NN
Sbjct  229  LEILGIDQSNLVGFVPDTIFNISTLKILSLFNN  261


 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  SSL+ L +  N  +G++P+EIGNLT L  L L  N L GEIP E+GNL  
Sbjct  47   GTIPSHLGNLSSLQTLVLSRNWFSGTIPKEIGNLTKLKELHLDYNKLQGEIPEELGNLAE  106

Query  101  LQILRLDNNNLEGTIPETIFNISTL-TYINMANN  3
            L++L L+NN L GTIP +IFN+S + T ++ ++N
Sbjct  107  LEMLVLNNNLLTGTIPASIFNLSFISTALDFSDN  140


 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTI  57
            L + D  L G++P  +GNL+ L  L L+ N  SG IP+EIGNL  L+ L LD N L+G I
Sbjct  38   LTISDLGLAGTIPSHLGNLSSLQTLVLSRNWFSGTIPKEIGNLTKLKELHLDYNKLQGEI  97

Query  56   PETIFNISTLTYINMANN  3
            PE + N++ L  + + NN
Sbjct  98   PEELGNLAELEMLVLNNN  115


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G  + L+ L +  N LNG +P+EIGNL  L  L + +++L G +P  I N++ 
Sbjct  193  GRLPRDLGNSTKLKSLDLGFNNLNGEIPQEIGNLRNLEILGIDQSNLVGFVPDTIFNIST  252

Query  101  LQILRLDNNNLEGTIPET  48
            L+IL L NN L G +P +
Sbjct  253  LKILSLFNNTLSGNLPSS  270



>ref|XP_009765991.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Nicotiana 
sylvestris]
Length=1153

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +I   SSL+ L MWDN+L G LPRE+GNLTMLN L L  N+L+G +P EIGNL  
Sbjct  329  GSIPLTIFNISSLQVLSMWDNKLEGPLPREVGNLTMLNVLDLGVNNLTGVLPDEIGNLQQ  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+LD N   G+IP +IFN+S+L   ++  N
Sbjct  389  LLQLKLDFNTFSGSIPASIFNMSSLVSFSLTQN  421


 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPRSI ECS L+ L +  N L G++PR++G L +L  L L  N L G IP EIG+L  
Sbjct  257  GEIPRSISECSELQVLLLLQNNLIGAIPRQLGKLQLLQILALGFNKLQGTIPDEIGHLYN  316

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L ++ N L G+IP TIFNIS+L  ++M +N
Sbjct  317  LKRLGMEKNKLTGSIPLTIFNISSLQVLSMWDN  349


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +L+ L M  N+L GS+P  I N++ L  L + +N L G +PRE+GNL M
Sbjct  305  GTIPDEIGHLYNLKRLGMEKNKLTGSIPLTIFNISSLQVLSMWDNKLEGPLPREVGNLTM  364

Query  101  LQILRLDNNNLEGTIPETIFN  39
            L +L L  NNL G +P+ I N
Sbjct  365  LNVLDLGVNNLTGVLPDEIGN  385


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G+   L+ L +  N+L G++P EIG+L  L  L + +N L+G IP  I N++ 
Sbjct  281  GAIPRQLGKLQLLQILALGFNKLQGTIPDEIGHLYNLKRLGMEKNKLTGSIPLTIFNISS  340

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L + +N LEG +P  + N++ L  +++  N
Sbjct  341  LQVLSMWDNKLEGPLPREVGNLTMLNVLDLGVN  373


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR +G+ +SL  +Y+  N     +P  + NL  +  L L+ N  +G +P E+GNL  
Sbjct  623  GSIPRCLGDVTSLREVYLDSNSFTAGIPSSLWNLKDILKLNLSSNIFNGSLPLEVGNLKA  682

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              IL L  N + G IP T+ ++  LT +++A+N
Sbjct  683  AIILDLSWNQISGNIPNTLGSLQKLTQLSLAHN  715


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N   G LP E   L  L  + L+ N+ +GEIP+ +G+L  
Sbjct  88   GTIPPQLGNLSFLISLDLSYNNFQGELPPEFTRLEKLRTINLSFNNFTGEIPKFLGDLQD  147

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+  + NN+  G IP +I N+  L ++N+  N
Sbjct  148  LQMFAIKNNSFSGFIPSSIANMKNLGFLNLRYN  180


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G+   L+   + +N  +G +P  I N+  L  L L  N+L G IP  I  L  
Sbjct  136  GEIPKFLGDLQDLQMFAIKNNSFSGFIPSSIANMKNLGFLNLRYNNLEGNIPLGIATLQS  195

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            L+ L    N L G+   +IFNISTL Y+++ N
Sbjct  196  LKWLSFGFNKLNGSNVLSIFNISTLEYLDLRN  227


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GN+P +IG     LE +++  N +NG LP  I NL+ L  L+L+ N L+G +P  +GNL 
Sbjct  425  GNLPSTIGHRLPDLERIFLGANNINGFLPSSISNLSKLTILELSANELTGSVPDSLGNLR  484

Query  104  MLQILRLDNNNL  69
             ++IL L +N+ 
Sbjct  485  FIEILNLQDNSF  496


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = -1

Query  263  IGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRL  84
            +  C  L  L +  N LN  LP+ IGNL+ L   +    +L G +P EIG L  L  L+L
Sbjct  509  LANCKHLRELILSLNPLNAMLPKSIGNLSSLQIFEADGCNLRGHVPIEIGYLRNLSYLKL  568

Query  83   DNNNLEGTIPETIFNISTLTYINMANN  3
            ++N+L G +P TI ++  L   ++  N
Sbjct  569  EDNDLTGIVPRTISSLKKLQQFSLGAN  595


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (48%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLS------------  138
            G++P  IG   +L YL + DN L G +PR I +L  L    L  N +S            
Sbjct  551  GHVPIEIGYLRNLSYLKLEDNDLTGIVPRTISSLKKLQQFSLGANKISGPFPNGLCELSN  610

Query  137  ------------GEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                        G IPR +G++  L+ + LD+N+    IP +++N+  +  +N+++N
Sbjct  611  LGLLNLSQNQMQGSIPRCLGDVTSLREVYLDSNSFTAGIPSSLWNLKDILKLNLSSN  667


 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 29/122 (24%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE----------  132
            G +P SI   S L  L +  N+L GS+P  +GNL  +  L L +NS + E          
Sbjct  450  GFLPSSISNLSKLTILELSANELTGSVPDSLGNLRFIEILNLQDNSFTSESSPLSFITPL  509

Query  131  -------------------IPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMA  9
                               +P+ IGNL+ LQI   D  NL G +P  I  +  L+Y+ + 
Sbjct  510  ANCKHLRELILSLNPLNAMLPKSIGNLSSLQIFEADGCNLRGHVPIEIGYLRNLSYLKLE  569

Query  8    NN  3
            +N
Sbjct  570  DN  571


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G   +   L +  NQ++G++P  +G+L  L  L L  N + G IP   G L  
Sbjct  671  GSLPLEVGNLKAAIILDLSWNQISGNIPNTLGSLQKLTQLSLAHNRIEGSIPETFGELIN  730

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NN+ G IP+++  +  L   N++ N
Sbjct  731  LEALDLSYNNMSGVIPKSLEALKQLDSFNVSFN  763


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P+SIG  SSL+        L G +P EIG L  L+ L+L +N L+G +PR I +L  LQ
Sbjct  529  LPKSIGNLSSLQIFEADGCNLRGHVPIEIGYLRNLSYLKLEDNDLTGIVPRTISSLKKLQ  588

Query  95   ILRLDNNNLEGTIP  54
               L  N + G  P
Sbjct  589  QFSLGANKISGPFP  602


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP ++G    L  L +  N++ GS+P   G L  L  L L+ N++SG IP+ +  L  
Sbjct  695  GNIPNTLGSLQKLTQLSLAHNRIEGSIPETFGELINLEALDLSYNNMSGVIPKSLEALKQ  754

Query  101  LQILRLDNNNLEGTIP  54
            L    +  N L G IP
Sbjct  755  LDSFNVSFNRLHGEIP  770


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  DNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
            D    G++P ++GNL+ L +L L+ N+  GE+P E   L  L+ + L  NN  G IP+ +
Sbjct  83   DMGFTGTIPPQLGNLSFLISLDLSYNNFQGELPPEFTRLEKLRTINLSFNNFTGEIPKFL  142

Query  44   FNISTLTYINMANN  3
             ++  L    + NN
Sbjct  143  GDLQDLQMFAIKNN  156



>emb|CDP19284.1| unnamed protein product [Coffea canephora]
Length=635

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  SSL++LY++ N L G++P+ +GNLT L  L L+EN LSG IP  IGNL+ 
Sbjct  51   GPIPPVIGNLSSLQFLYLYQNNLTGAIPKSLGNLTNLIKLDLSENQLSGSIPASIGNLST  110

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L NN   G+IP T  N++ L  +++A N
Sbjct  111  LKVLYLYNNQFSGSIPATFGNLNRLVKLDLAFN  143


 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  S+L+ LY+++NQ +GS+P   GNL  L  L L  N LSG IP  IGNL+ 
Sbjct  99   GSIPASIGNLSTLKVLYLYNNQFSGSIPATFGNLNRLVKLDLAFNQLSGSIPVSIGNLSD  158

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L  N   GTIP+ + N++ L  + + +N
Sbjct  159  LEILALAENQFSGTIPQELGNLNKLVDLRLFSN  191


 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G  ++L  L + +NQL+GS+P  IGNL+ L  L L  N  SG IP   GNLN 
Sbjct  75   GAIPKSLGNLTNLIKLDLSENQLSGSIPASIGNLSTLKVLYLYNNQFSGSIPATFGNLNR  134

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP +I N+S L  + +A N
Sbjct  135  LVKLDLAFNQLSGSIPVSIGNLSDLEILALAEN  167


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTI  57
            LY+ +NQ +GS+P   GNL  L NL L +N LSG IP  IGNL+ LQ L L  NNL G I
Sbjct  18   LYLQNNQFSGSIPVTFGNLNRLVNLSLDQNHLSGPIPPVIGNLSSLQFLYLYQNNLTGAI  77

Query  56   PETIFNISTLTYINMANN  3
            P+++ N++ L  ++++ N
Sbjct  78   PKSLGNLTNLIKLDLSEN  95


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP + G  + L  L +  N L+G +P  IGNL+ L  L L +N+L+G IP+ +GNL  
Sbjct  27   GSIPVTFGNLNRLVNLSLDQNHLSGPIPPVIGNLSSLQFLYLYQNNLTGAIPKSLGNLTN  86

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP +I N+STL  + + NN
Sbjct  87   LIKLDLSENQLSGSIPASIGNLSTLKVLYLYNN  119


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 61/115 (53%), Gaps = 22/115 (19%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPR--------------EIGNLTMLNNLQLTENS  144
            G IP+ +G  + L  L ++ N  +G LP               EIGNLT L+ L L+ N 
Sbjct  171  GTIPQELGNLNKLVDLRLFSNHFSGPLPELLFAKNNITGGIPPEIGNLTQLHKLDLSSNY  230

Query  143  LSGEIPREIGNLNML--------QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LSGEIPRE+  L  +        Q+  L  N+L GT+PE + ++  L ++N++NN
Sbjct  231  LSGEIPREVVKLTSMLTLDLHDNQLTDLSTNSLIGTLPELLGDLKHLFHMNLSNN  285


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +G+   L ++ + +N     +P +IG LT L+ L L++N  +GEIP E  NL  
Sbjct  265  GTLPELLGDLKHLFHMNLSNNVFGQKIPSQIGKLTQLSELDLSQNLFTGEIPSEFQNLQS  324

Query  101  LQILRLDNNNLEGTIP  54
            L  + L  NNLEG IP
Sbjct  325  LLHINLSFNNLEGPIP  340


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 8/101 (8%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLN--------GSLPREIGNLTMLNNLQLTENSLSGEIP  126
            G IPR + + +S+  L + DNQL         G+LP  +G+L  L ++ L+ N    +IP
Sbjct  233  GEIPREVVKLTSMLTLDLHDNQLTDLSTNSLIGTLPELLGDLKHLFHMNLSNNVFGQKIP  292

Query  125  REIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +IG L  L  L L  N   G IP    N+ +L +IN++ N
Sbjct  293  SQIGKLTQLSELDLSQNLFTGEIPSEFQNLQSLLHINLSFN  333


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = -1

Query  185  NLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMAN  6
            NLT L  L L  N  SG IP   GNLN L  L LD N+L G IP  I N+S+L ++ +  
Sbjct  11   NLTNLIKLYLQNNQFSGSIPVTFGNLNRLVNLSLDQNHLSGPIPPVIGNLSSLQFLYLYQ  70

Query  5    N  3
            N
Sbjct  71   N  71



>gb|KCW56179.1| hypothetical protein EUGRSUZ_I01928 [Eucalyptus grandis]
Length=652

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQ-LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP SIG  S+L YLY+  NQ L+GS+P EIGNL  L  L L+ N+ SGEIP E G L 
Sbjct  309  GTIPPSIGNLSNLTYLYLQGNQFLSGSVPSEIGNLKSLAVLDLSLNNFSGEIPVEFGRLT  368

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L L NN+L GTIP +I N+STLTY+ +  N
Sbjct  369  ALYHLDLHNNSLSGTIPPSIGNLSTLTYLYLQGN  402


 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQ-LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP SIG  S+L YL++  NQ L+ S+P EIGNL  L +L L+ N+ SGEIP E G+L 
Sbjct  163  GTIPSSIGNLSNLTYLHLSGNQFLSESVPSEIGNLKSLAHLDLSSNNFSGEIPVEFGHLT  222

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L L NN+L GTIP +I N+S LTY+N+  N
Sbjct  223  ALIYLDLYNNSLSGTIPPSIGNLSNLTYLNLRGN  256


 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQ-LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP SIG  S+L YL +  NQ L+GS+P EIGN   L  L L+ N+ SGEIP E G+L 
Sbjct  236  GTIPPSIGNLSNLTYLNLRGNQFLSGSVPSEIGNSKSLAILDLSLNNFSGEIPVEFGHLT  295

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L L NN+L GTIP +I N+S LTY+ +  N
Sbjct  296  ALIELYLYNNSLSGTIPPSIGNLSNLTYLYLQGN  329


 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   S L  L +  N L+G LP  +GNLTML  L+L  N L G IP E+G L  
Sbjct  91   GRIPLQICALSRLALLDLSYNFLSGELPPCLGNLTMLETLELEGNELRGPIPPELGTLKR  150

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NNNL GTIP +I N+S LTY++++ N
Sbjct  151  LVWLFLGNNNLNGTIPSSIGNLSNLTYLHLSGN  183


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G   +L YL + +N L+G++P  IGNL  L  L L+ N+ SGEIP E G L  
Sbjct  431  GEIPVEFGRLIALYYLDLHNNSLSGTIPPSIGNLKSLAELDLSLNNFSGEIPVEFGRLPA  490

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN+L GTI  ++     L  IN++ N
Sbjct  491  LDHLDLHNNSLSGTILGSLIEHLHLRSINLSYN  523


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 57/118 (48%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQ-LNGSLPREIGNLTMLNNLQLT----------------  153
            G IP SIG  S+L YLY+  NQ L+GS+P EIGNL  L  L L+                
Sbjct  382  GTIPPSIGNLSTLTYLYLQGNQFLSGSVPSEIGNLKSLAVLDLSLNNFSGEIPVEFGRLI  441

Query  152  --------ENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                     NSLSG IP  IGNL  L  L L  NN  G IP     +  L ++++ NN
Sbjct  442  ALYYLDLHNNSLSGTIPPSIGNLKSLAELDLSLNNFSGEIPVEFGRLPALDHLDLHNN  499



>ref|XP_007214055.1| hypothetical protein PRUPE_ppa017509mg, partial [Prunus persica]
 gb|EMJ15254.1| hypothetical protein PRUPE_ppa017509mg, partial [Prunus persica]
Length=1010

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+   + L YLY++ NQL+GS+P EIGNL  L +LQL+ N+LSG IP  IGNL  
Sbjct  97   GSIPRSLCNLTRLAYLYLYKNQLSGSIPNEIGNLKSLVDLQLSSNTLSGHIPPNIGNLQK  156

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP  I N+ +L  +N+ +N
Sbjct  157  LNTLYLHTNKLSGYIPNEIGNLKSLMDLNLGDN  189


 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG   S+E LY++ N++NGS+PR + NLT L  L L +N LSG IP EIGNL  
Sbjct  73   GDIPKEIGNMKSIEELYLYKNKVNGSIPRSLCNLTRLAYLYLYKNQLSGSIPNEIGNLKS  132

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L +N L G IP  I N+  L  + +  N
Sbjct  133  LVDLQLSSNTLSGHIPPNIGNLQKLNTLYLHTN  165


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR +   S+L  L ++ NQL+G +P EIGNL  L +LQL+ N+LSG IP  IGNL  
Sbjct  193  GSIPRFLANISTLTNLSVFGNQLSGIIPNEIGNLKSLVDLQLSSNTLSGPIPLSIGNLKK  252

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L   NN L G IP+ I +I +L  + ++ N
Sbjct  253  LNTLYFHNNTLSGLIPKEIGSIKSLVNLGLSGN  285


 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   SL  L + DNQL GS+PR + N++ L NL +  N LSG IP EIGNL  
Sbjct  169  GYIPNEIGNLKSLMDLNLGDNQLRGSIPRFLANISTLTNLSVFGNQLSGIIPNEIGNLKS  228

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L +N L G IP +I N+  L  +   NN
Sbjct  229  LVDLQLSSNTLSGPIPLSIGNLKKLNTLYFHNN  261


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG+   L YL + +N+L  ++P ++G L  LN+L L+ NSL G IP E+G++  L
Sbjct  506  SIPSVIGDLVKLHYLNLSNNKLAQTIPFKLGKLVQLNDLDLSHNSLEGRIPSEMGSMQSL  565

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L +NNL G+IP +   +  L Y++++ N
Sbjct  566  VKLDLSHNNLSGSIPSSFEEMHGLLYVDISYN  597


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG    L  LY  +N L+G +P+EIG++  L NL L+ N L   IP   GNL+ 
Sbjct  241  GPIPLSIGNLKKLNTLYFHNNTLSGLIPKEIGSIKSLVNLGLSGNQLHDSIPTSFGNLSN  300

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L G+IP+ + N+  L  +++  N
Sbjct  301  LEILHLRDNRLSGSIPQELENLKNLIQLHLDTN  333


 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  + +  L +  N L G +P+E G L+ L  L L  N LSG IP E G+LN 
Sbjct  433  GSIPPEIGNATQIHVLDLSSNHLVGLIPKEFGKLSSLVRLILNGNQLSGRIPSEFGSLND  492

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N    +IP  I ++  L Y+N++NN
Sbjct  493  LEYLDLSTNKFNESIPSVIGDLVKLHYLNLSNN  525


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I  + G+C  L  L M  N L GS+P EIGN T ++ L L+ N L G IP+E G L+ 
Sbjct  409  GEISHNWGQCPKLTTLLMAGNNLTGSIPPEIGNATQIHVLDLSSNHLVGLIPKEFGKLSS  468

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N L G IP    +++ L Y++++ N
Sbjct  469  LVRLILNGNQLSGRIPSEFGSLNDLEYLDLSTN  501


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG    L  LY+  N+L+G +P EIGNL  L +L L +N L G IPR + N++ 
Sbjct  145  GHIPPNIGNLQKLNTLYLHTNKLSGYIPNEIGNLKSLMDLNLGDNQLRGSIPRFLANIST  204

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L +  N L G IP  I N+ +L  + +++N
Sbjct  205  LTNLSVFGNQLSGIIPNEIGNLKSLVDLQLSSN  237


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP  I   S L+YL +  NQL+G +P EIG L  L  L L EN+  G+IP+EIGN+  ++
Sbjct  27   IPPQISYLSKLDYLDLSLNQLSGRIPPEIGLLKNLTLLDLHENTFFGDIPKEIGNMKSIE  86

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L  N + G+IP ++ N++ L Y+ +  N
Sbjct  87   ELYLYKNKVNGSIPRSLCNLTRLAYLYLYKN  117


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  + LEYL +  N+ N S+P  IG+L  L+ L L+ N L+  IP ++G L  
Sbjct  481  GRIPSEFGSLNDLEYLDLSTNKFNESIPSVIGDLVKLHYLNLSNNKLAQTIPFKLGKLVQ  540

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N+LEG IP  + ++ +L  +++++N
Sbjct  541  LNDLDLSHNSLEGRIPSEMGSMQSLVKLDLSHN  573


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   SL  L +  N L+G +P  IGNL  LN L    N+LSG IP+EIG++  
Sbjct  217  GIIPNEIGNLKSLVDLQLSSNTLSGPIPLSIGNLKKLNTLYFHNNTLSGLIPKEIGSIKS  276

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L  +IP +  N+S L  +++ +N
Sbjct  277  LVNLGLSGNQLHDSIPTSFGNLSNLEILHLRDN  309


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL  L +  NQL+ S+P   GNL+ L  L L +N LSG IP+E+ NL  
Sbjct  265  GLIPKEIGSIKSLVNLGLSGNQLHDSIPTSFGNLSNLEILHLRDNRLSGSIPQELENLKN  324

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L LD N L G +P  I     LT  ++  N
Sbjct  325  LIQLHLDTNQLSGYLPPNICQGGKLTNFSVFRN  357


 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +L  L + +N   G +P+EIGN+  +  L L +N ++G IPR + NL  
Sbjct  49   GRIPPEIGLLKNLTLLDLHENTFFGDIPKEIGNMKSIEELYLYKNKVNGSIPRSLCNLTR  108

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP  I N+ +L  + +++N
Sbjct  109  LAYLYLYKNQLSGSIPNEIGNLKSLVDLQLSSN  141


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+  G+ SSL  L +  NQL+G +P E G+L  L  L L+ N  +  IP  IG+L  
Sbjct  457  GLIPKEFGKLSSLVRLILNGNQLSGRIPSEFGSLNDLEYLDLSTNKFNESIPSVIGDLVK  516

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L  TIP  +  +  L  +++++N
Sbjct  517  LHYLNLSNNKLAQTIPFKLGKLVQLNDLDLSHN  549


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 54/95 (57%), Gaps = 6/95 (6%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI---GNL  108
            +IP S G  S+LE L++ DN+L+GS+P+E+ NL  L  L L  N LSG +P  I   G L
Sbjct  290  SIPTSFGNLSNLEILHLRDNRLSGSIPQELENLKNLIQLHLDTNQLSGYLPPNICQGGKL  349

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                + R   N L G IP+++ N + L  + +  N
Sbjct  350  TNFSVFR---NYLTGPIPKSLKNCTGLIRVRLDQN  381


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNI    G   +L+++ + +N L G +    G    L  L +  N+L+G IP EIGN   
Sbjct  385  GNISEDFGVYPNLDFMNISNNNLYGEISHNWGQCPKLTTLLMAGNNLTGSIPPEIGNATQ  444

Query  101  LQILRLDNNNLEGTIPETIFNISTLT  24
            + +L L +N+L G IP+    +S+L 
Sbjct  445  IHVLDLSSNHLVGLIPKEFGKLSSLV  470


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ +    +L  L++  NQL+G LP  I     L N  +  N L+G IP+ + N   
Sbjct  313  GSIPQELENLKNLIQLHLDTNQLSGYLPPNICQGGKLTNFSVFRNYLTGPIPKSLKNCTG  372

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  +RLD N   G I E       L ++N++NN
Sbjct  373  LIRVRLDQNQFTGNISEDFGVYPNLDFMNISNN  405


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+  C+ L  + +  NQ  G++  + G    L+ + ++ N+L GEI    G    
Sbjct  361  GPIPKSLKNCTGLIRVRLDQNQFTGNISEDFGVYPNLDFMNISNNNLYGEISHNWGQCPK  420

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L +  NNL G+IP  I N + +  +++++N
Sbjct  421  LTTLLMAGNNLTGSIPPEIGNATQIHVLDLSSN  453


 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP  +G+   L  L +  N L G +P E+G++  L  L L+ N+LSG IP     ++ L 
Sbjct  531  IPFKLGKLVQLNDLDLSHNSLEGRIPSEMGSMQSLVKLDLSHNNLSGSIPSSFEEMHGLL  590

Query  95   ILRLDNNNLEGTIP  54
             + +  N+LEG +P
Sbjct  591  YVDISYNHLEGPLP  604



>ref|XP_006465462.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like [Citrus sinensis]
Length=1094

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + LE L ++ N L G++PRE+GNLT L  L+L+EN L+GEIP EIGNL  
Sbjct  256  GGIPRELGNLTKLEILQLFRNNLTGAIPRELGNLTGLGVLELSENFLTGEIPLEIGNLQN  315

Query  101  LQILRLDNNNLEGTIPETIFNIST  30
            L+ L L +N L GT+P  IFN+ST
Sbjct  316  LEELELGHNKLIGTVPVAIFNVST  339


 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ LY+  N+L G +PRE GNL  L  + L+EN+L G IPRE+GNL  
Sbjct  208  GAIPKEIGNLTKLKILYLGGNRLQGEIPREFGNLADLERMSLSENNLQGGIPRELGNLTK  267

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL+L  NNL G IP  + N++ L  + ++ N
Sbjct  268  LEILQLFRNNLTGAIPRELGNLTGLGVLELSEN  300


 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR  G  + LE + + +N L G +PRE+GNLT L  LQL  N+L+G IPRE+GNL  
Sbjct  232  GEIPREFGNLADLERMSLSENNLQGGIPRELGNLTKLEILQLFRNNLTGAIPRELGNLTG  291

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G IP  I N+  L  + + +N
Sbjct  292  LGVLELSENFLTGEIPLEIGNLQNLEELELGHN  324


 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            N+CS L  L+ L L +N L+G IP ++  C+ L+ L +  N  +G++P+EIGNLT L  L
Sbjct  164  NICSSLPFLDFLSLQENMLHGGIPSTLSNCTYLQKLGLVYNNFSGAIPKEIGNLTKLKIL  223

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L GEIPRE GNL  L+ + L  NNL+G IP  + N++ L  + +  N
Sbjct  224  YLGGNRLQGEIPREFGNLADLERMSLSENNLQGGIPRELGNLTKLEILQLFRN  276


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPR-SIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNL  108
            G +PR S+G  S SL+Y  M +  ++G +P EI NLT L  + L  N L+G IP  +G L
Sbjct  455  GILPRTSVGNLSHSLKYFKMHNCNISGGIPEEISNLTNLMTIDLGGNKLNGSIPITLGKL  514

Query  107  NMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              LQ L LD+N LEG+IP+ I  ++ L  + +  N
Sbjct  515  QKLQWLSLDDNKLEGSIPDDICRLAELYLLELGGN  549


 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP +      + +LY   N   G LP EIGNL +L  +  + N+ SG IP EIG L  L
Sbjct  577  SIPLTFWNLKDILHLYFSLNFFTGPLPLEIGNLKVLIGIDFSMNNFSGVIPTEIGGLKNL  636

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + L L  N L G+IP++  ++ +L ++N++NN
Sbjct  637  ESLFLGYNRLRGSIPDSFGDLISLKFLNLSNN  668


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +LE L++  N+L GS+P   G+L  L  L L+ N+LSG IP  +  L+ 
Sbjct  624  GVIPTEIGGLKNLESLFLGYNRLRGSIPDSFGDLISLKFLNLSNNNLSGAIPTSLEKLSY  683

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  N LEG IP 
Sbjct  684  LEDLNLSFNKLEGEIPR  700


 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L++L + DN+L GS+P +I  L  L  L+L  N L G IP   GNL  
Sbjct  505  GSIPITLGKLQKLQWLSLDDNKLEGSIPDDICRLAELYLLELGGNKLYGLIPACFGNLAS  564

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L  +IP T +N+  + ++  + N
Sbjct  565  LRILSLCSNELT-SIPLTFWNLKDILHLYFSLN  596


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   ++L  + +  N+LNGS+P  +G L  L  L L +N L G IP +I  L  
Sbjct  481  GGIPEEISNLTNLMTIDLGGNKLNGSIPITLGKLQKLQWLSLDDNKLEGSIPDDICRLAE  540

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G IP    N+++L  +++ +N
Sbjct  541  LYLLELGGNKLYGLIPACFGNLASLRILSLCSN  573


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  IG    L  +    N  +G +P EIG L  L +L L  N L G IP   G+L  
Sbjct  600  GPLPLEIGNLKVLIGIDFSMNNFSGVIPTEIGGLKNLESLFLGYNRLRGSIPDSFGDLIS  659

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NNNL G IP ++  +S L  +N++ N
Sbjct  660  LKFLNLSNNNLSGAIPTSLEKLSYLEDLNLSFN  692


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = -1

Query  281  GNIPRSIGECSS-LEYLYMWDNQLNGSLPREIGNLTM--LNNLQLTENSLSGEIPREIGN  111
            G +P +I   S+ L+ L + DN L+G L   I N+ +  L  L L  N+ SG IPR I N
Sbjct  328  GTVPVAIFNVSTTLKLLGLQDNSLSGGL-SSIANVRLPNLEELYLWGNNFSGTIPRFIFN  386

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             + L IL LD N+  G IP T  N+  L Y+++  N
Sbjct  387  ASKLSILDLDKNSFSGFIPNTFGNLRNLEYLDLQYN  422


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 5/86 (6%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE LY+W N  +G++PR I N + L+ L L +NS SG IP   GNL  L+ L L  N L 
Sbjct  366  LEELYLWGNNFSGTIPRFIFNASKLSILDLDKNSFSGFIPNTFGNLRNLEYLDLQYNYLT  425

Query  65   -----GTIPETIFNISTLTYINMANN  3
                  +   ++ N  +LT I ++NN
Sbjct  426  SLTLELSFLSSLSNCKSLTLIGLSNN  451



>ref|XP_006367139.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Solanum tuberosum]
Length=415

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP SI   SSL+++ +W N L GSLPREIGNLT +  L L EN  +GEIP+E+ NL  L
Sbjct  247  SIPISIFNISSLQFVSLWSNNLKGSLPREIGNLTKMQFLYLEENRFTGEIPKEMRNLVEL  306

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ++L L+ N+  G++P  IFNIS L  I ++ N
Sbjct  307  EVLNLEFNSFSGSLPMEIFNISRLRNIALSGN  338


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P S+  CS L+ L +++N  +G +  EIG L+ L  L L  N  +G IP+EIGNL  
Sbjct  174  GHMPTSLSNCSQLQILSLFENDFDGPIHSEIGRLSNLQILYLGSNHFTGIIPQEIGNLVN  233

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L ++ N +  +IP +IFNIS+L ++++ +N
Sbjct  234  LMKLAVEINQITSSIPISIFNISSLQFVSLWSN  266


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G    L+ L +  N   G +P  + N + L  L +++N L G IP EIGNL+ 
Sbjct  53   GEIPSWFGFLEQLQVLNLQRNSFTGFIPPSLSNASRLETLVISDNLLEGNIPEEIGNLHN  112

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L +  N L G+IP TIFNIS++  I   NN
Sbjct  113  LKLLSIQYNMLTGSIPFTIFNISSIQVIAFTNN  145


 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I   IG  S+L+ LY+  N   G +P+EIGNL  L  L +  N ++  IP  I N++ 
Sbjct  198  GPIHSEIGRLSNLQILYLGSNHFTGIIPQEIGNLVNLMKLAVEINQITSSIPISIFNISS  257

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ + L +NNL+G++P  I N++ + ++ +  N
Sbjct  258  LQFVSLWSNNLKGSLPREIGNLTKMQFLYLEEN  290


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   +L  L +  NQ+  S+P  I N++ L  + L  N+L G +PREIGNL  
Sbjct  222  GIIPQEIGNLVNLMKLAVEINQITSSIPISIFNISSLQFVSLWSNNLKGSLPREIGNLTK  281

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +Q L L+ N   G IP+ + N+  L  +N+  N
Sbjct  282  MQFLYLEENRFTGEIPKEMRNLVELEVLNLEFN  314


 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN-LN  105
            G IP+ +     LE L +  N  +GSLP EI N++ L N+ L+ N+LSG +P  IG+ L 
Sbjct  294  GEIPKEMRNLVELEVLNLEFNSFSGSLPMEIFNISRLRNIALSGNNLSGTLPPNIGSTLP  353

Query  104  MLQILRLDN-NNLEGTIPETIFNISTLTYINMANN  3
             ++IL L++  NL GTIP +I N S LT ++++ N
Sbjct  354  NIEILYLNSLTNLVGTIPHSISNCSKLTRLDLSRN  388


 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR  G  + L  L +  N  +G+LP+E+  L  L  L+L+ N   GEIP   G L  
Sbjct  5    GRIPRDFGNLTFLVSLDLGRNNFHGNLPQEMVRLRRLKFLKLSLNKFRGEIPSWFGFLEQ  64

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  N+  G IP ++ N S L  + +++N
Sbjct  65   LQVLNLQRNSFTGFIPPSLSNASRLETLVISDN  97


 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+   S LE L + DN L G++P EIGNL  L  L +  N L+G IP  I N++ 
Sbjct  77   GFIPPSLSNASRLETLVISDNLLEGNIPEEIGNLHNLKLLSIQYNMLTGSIPFTIFNISS  136

Query  101  LQILRLDNNNLEGTIP  54
            +Q++   NN+L G +P
Sbjct  137  IQVIAFTNNSLSGNLP  152


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 5/88 (6%)
 Frame = -1

Query  281  GNIPRSIGECSSL---EYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN  111
            GN+P   G C+ L   + LY+  N+L+G +P  + N + L  L L EN   G I  EIG 
Sbjct  149  GNLPN--GLCNGLPILKKLYLSGNKLHGHMPTSLSNCSQLQILSLFENDFDGPIHSEIGR  206

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTL  27
            L+ LQIL L +N+  G IP+ I N+  L
Sbjct  207  LSNLQILYLGSNHFTGIIPQEIGNLVNL  234


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P+ +     L++L +  N+  G +P   G L  L  L L  NS +G IP  + N + 
Sbjct  29   GNLPQEMVRLRRLKFLKLSLNKFRGEIPSWFGFLEQLQVLNLQRNSFTGFIPPSLSNASR  88

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +N LEG IPE I N+  L  +++  N
Sbjct  89   LETLVISDNLLEGNIPEEIGNLHNLKLLSIQYN  121


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G +PR+ GNLT L +L L  N+  G +P+E+  L  L+ L+L  N   G IP     +
Sbjct  3    LTGRIPRDFGNLTFLVSLDLGRNNFHGNLPQEMVRLRRLKFLKLSLNKFRGEIPSWFGFL  62

Query  35   STLTYINMANN  3
              L  +N+  N
Sbjct  63   EQLQVLNLQRN  73



>ref|XP_006436338.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
 gb|ESR49578.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
Length=1028

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L+ LY+  N  +G +P+EIGNLT L  L L +N L GEIP EIGNL+ 
Sbjct  307  GKIPSTLSRCKLLQKLYLSVNDFSGDIPKEIGNLTKLKYLSLYQNRLQGEIPHEIGNLHN  366

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ +    N L G +P TIFN+STL  +++ +N
Sbjct  367  LEWMAFSFNKLVGVVPTTIFNVSTLKSLHLQSN  399


 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  + +  N  +G++P+EIGN+T L  L L  N L GEIP E+GNL  
Sbjct  186  GKIPLTLSNCKRLRNISLSLNDFSGTIPKEIGNVTKLIGLYLRGNQLQGEIPEELGNLAE  245

Query  101  LQILRLDNNNLEGTIPETIFN  39
            L+ L L NN L GTIP +IFN
Sbjct  246  LEELWLQNNFLTGTIPSSIFN  266


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG  + L+YL ++ N+L G +P EIGNL  L  +  + N L G +P  I N++ 
Sbjct  331  GDIPKEIGNLTKLKYLSLYQNRLQGEIPHEIGNLHNLEWMAFSFNKLVGVVPTTIFNVST  390

Query  101  LQILRLDNNNLEGTIPET  48
            L+ L L +N+L G +P +
Sbjct  391  LKSLHLQSNSLSGRLPSS  408


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -1

Query  272  PRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQI  93
            P      S+LE L++  N  +G +P  + N   L N+ L+ N  SG IP+EIGN+  L  
Sbjct  165  PNFCNHLSNLESLFLKSNMFHGKIPLTLSNCKRLRNISLSLNDFSGTIPKEIGNVTKLIG  224

Query  92   LRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L L  N L+G IPE + N++ L  + + NN
Sbjct  225  LYLRGNQLQGEIPEELGNLAELEELWLQNN  254


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG    L  + +  N  +G++P  IG L  L NL L  N L G IP  IG L  
Sbjct  649  GSLPLGIGNLKVLVQIDLSMNNFSGAIPTTIGGLKDLQNLFLECNRLQGLIPDSIGGLIN  708

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NNNL G IP ++  +  L YIN++ N
Sbjct  709  LKSLDLSNNNLSGAIPTSLEKLLDLQYINVSFN  741


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  239  YLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGT  60
            YL +  N   GSLP  IGNL +L  + L+ N+ SG IP  IG L  LQ L L+ N L+G 
Sbjct  639  YLNLSSNSFTGSLPLGIGNLKVLVQIDLSMNNFSGAIPTTIGGLKDLQNLFLECNRLQGL  698

Query  59   IPETIFNISTLTYINMANN  3
            IP++I  +  L  ++++NN
Sbjct  699  IPDSIGGLINLKSLDLSNN  717


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L  LY+  NQL G +P E+GNL  L  L L  N L+G IP  I NL+ 
Sbjct  210  GTIPKEIGNVTKLIGLYLRGNQLQGEIPEELGNLAELEELWLQNNFLTGTIPSSIFNLSS  269

Query  101  LQILRLDNNNLEGTIPETIFN  39
            L IL L  NNL G +P  I N
Sbjct  270  LSILDLSVNNLTGELPANICN  290


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG    L+ L++  N+L G +P  IG L  L +L L+ N+LSG IP  +  L  
Sbjct  673  GAIPTTIGGLKDLQNLFLECNRLQGLIPDSIGGLINLKSLDLSNNNLSGAIPTSLEKLLD  732

Query  101  LQILRLDNNNLEGTIPET  48
            LQ + +  N LEG IP  
Sbjct  733  LQYINVSFNKLEGEIPRA  750


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 5/86 (6%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE L++W N  NG++P  I N + L+ L+L  NS SG IP    NL  L+ L L++N L 
Sbjct  416  LEELHLWGNNFNGTIPNFIFNASKLSGLELEINSFSGFIPNTFVNLRNLKWLGLNDNYLT  475

Query  65   GTIPETIF-----NISTLTYINMANN  3
             + PE  F     N   L Y +++NN
Sbjct  476  SSTPELSFLSSLSNCKYLKYFSLSNN  501


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++G+   L+ L   DNQL GS+P ++  L  L  L L  N LSG IP   GNL  
Sbjct  554  GTIPITLGKLQKLQLLSFEDNQLEGSIPNDLCRLAALFQLDLGGNMLSGFIPACFGNLTY  613

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L  T   T++NI  + Y+N+++N
Sbjct  614  LKKLNLGSNQLTST-SSTLWNIKYILYLNLSSN  645


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+  C  L+Y  + +N L+G LPR IGNL+  +    +   ++SG IP EI NL  L  +
Sbjct  486  SLSNCKYLKYFSLSNNLLDGILPRAIGNLSQSIEEFWIVSCNISGGIPEEISNLTNLIAI  545

Query  89   RLDNNNLEGTIPET  48
             L  N L GTIP T
Sbjct  546  YLGGNKLNGTIPIT  559


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN-LN  105
            G IP  +G  SSL+ L +  N  +GS+P  I N++ L +++ T N+L GE+P    N L+
Sbjct  113  GTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFCNHLS  172

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L +N   G IP T+ N   L  I+++ N
Sbjct  173  NLESLFLKSNMFHGKIPLTLSNCKRLRNISLSLN  206


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +PR+IG  S S+E  ++    ++G +P EI NLT L  + L  N L+G IP  +G L 
Sbjct  505  GILPRAIGNLSQSIEEFWIVSCNISGGIPEEISNLTNLIAIYLGGNKLNGTIPITLGKLQ  564

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ+L  ++N LEG+IP  +  ++ L  +++  N
Sbjct  565  KLQLLSFEDNQLEGSIPNDLCRLAALFQLDLGGN  598



>ref|XP_006436336.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
 gb|ESR49576.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
Length=1137

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L+ LY+  N  +G +P+EIGNLT L  L L +N L GEIP EIGNL+ 
Sbjct  307  GKIPSTLSRCKLLQKLYLSVNDFSGDIPKEIGNLTKLKYLSLYQNRLQGEIPHEIGNLHN  366

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ +    N L G +P TIFN+STL  +++ +N
Sbjct  367  LEWMAFSFNKLVGVVPTTIFNVSTLKSLHLQSN  399


 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  + +  N  +G++P+EIGN+T L  L L  N L GEIP E+GNL  
Sbjct  186  GKIPLTLSNCKRLRNISLSLNDFSGTIPKEIGNVTKLIGLYLRGNQLQGEIPEELGNLAE  245

Query  101  LQILRLDNNNLEGTIPETIFN  39
            L+ L L NN L GTIP +IFN
Sbjct  246  LEELWLQNNFLTGTIPSSIFN  266


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG  + L+YL ++ N+L G +P EIGNL  L  +  + N L G +P  I N++ 
Sbjct  331  GDIPKEIGNLTKLKYLSLYQNRLQGEIPHEIGNLHNLEWMAFSFNKLVGVVPTTIFNVST  390

Query  101  LQILRLDNNNLEGTIPET  48
            L+ L L +N+L G +P +
Sbjct  391  LKSLHLQSNSLSGRLPSS  408


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -1

Query  272  PRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQI  93
            P      S+LE L++  N  +G +P  + N   L N+ L+ N  SG IP+EIGN+  L  
Sbjct  165  PNFCNHLSNLESLFLKSNMFHGKIPLTLSNCKRLRNISLSLNDFSGTIPKEIGNVTKLIG  224

Query  92   LRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L L  N L+G IPE + N++ L  + + NN
Sbjct  225  LYLRGNQLQGEIPEELGNLAELEELWLQNN  254


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG    L  + +  N  +G++P  IG L  L NL L  N L G IP  IG L  
Sbjct  649  GSLPLGIGNLKVLVQIDLSMNNFSGAIPTTIGGLKDLQNLFLECNRLQGLIPDSIGGLIN  708

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NNNL G IP ++  +  L YIN++ N
Sbjct  709  LKSLDLSNNNLSGAIPTSLEKLLDLQYINVSFN  741


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  239  YLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGT  60
            YL +  N   GSLP  IGNL +L  + L+ N+ SG IP  IG L  LQ L L+ N L+G 
Sbjct  639  YLNLSSNSFTGSLPLGIGNLKVLVQIDLSMNNFSGAIPTTIGGLKDLQNLFLECNRLQGL  698

Query  59   IPETIFNISTLTYINMANN  3
            IP++I  +  L  ++++NN
Sbjct  699  IPDSIGGLINLKSLDLSNN  717


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L  LY+  NQL G +P E+GNL  L  L L  N L+G IP  I NL+ 
Sbjct  210  GTIPKEIGNVTKLIGLYLRGNQLQGEIPEELGNLAELEELWLQNNFLTGTIPSSIFNLSS  269

Query  101  LQILRLDNNNLEGTIPETIFN  39
            L IL L  NNL G +P  I N
Sbjct  270  LSILDLSVNNLTGELPANICN  290


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG    L+ L++  N+L G +P  IG L  L +L L+ N+LSG IP  +  L  
Sbjct  673  GAIPTTIGGLKDLQNLFLECNRLQGLIPDSIGGLINLKSLDLSNNNLSGAIPTSLEKLLD  732

Query  101  LQILRLDNNNLEGTIPET  48
            LQ + +  N LEG IP  
Sbjct  733  LQYINVSFNKLEGEIPRA  750


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 5/86 (6%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE L++W N  NG++P  I N + L+ L+L  NS SG IP    NL  L+ L L++N L 
Sbjct  416  LEELHLWGNNFNGTIPNFIFNASKLSGLELEINSFSGFIPNTFVNLRNLKWLGLNDNYLT  475

Query  65   GTIPETIF-----NISTLTYINMANN  3
             + PE  F     N   L Y +++NN
Sbjct  476  SSTPELSFLSSLSNCKYLKYFSLSNN  501


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++G+   L+ L   DNQL GS+P ++  L  L  L L  N LSG IP   GNL  
Sbjct  554  GTIPITLGKLQKLQLLSFEDNQLEGSIPNDLCRLAALFQLDLGGNMLSGFIPACFGNLTY  613

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L  T   T++NI  + Y+N+++N
Sbjct  614  LKKLNLGSNQLTST-SSTLWNIKYILYLNLSSN  645


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+  C  L+Y  + +N L+G LPR IGNL+  +    +   ++SG IP EI NL  L  +
Sbjct  486  SLSNCKYLKYFSLSNNLLDGILPRAIGNLSQSIEEFWIVSCNISGGIPEEISNLTNLIAI  545

Query  89   RLDNNNLEGTIPET  48
             L  N L GTIP T
Sbjct  546  YLGGNKLNGTIPIT  559


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN-LN  105
            G IP  +G  SSL+ L +  N  +GS+P  I N++ L +++ T N+L GE+P    N L+
Sbjct  113  GTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFCNHLS  172

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L +N   G IP T+ N   L  I+++ N
Sbjct  173  NLESLFLKSNMFHGKIPLTLSNCKRLRNISLSLN  206


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +PR+IG  S S+E  ++    ++G +P EI NLT L  + L  N L+G IP  +G L 
Sbjct  505  GILPRAIGNLSQSIEEFWIVSCNISGGIPEEISNLTNLIAIYLGGNKLNGTIPITLGKLQ  564

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ+L  ++N LEG+IP  +  ++ L  +++  N
Sbjct  565  KLQLLSFEDNQLEGSIPNDLCRLAALFQLDLGGN  598



>gb|KDO44559.1| hypothetical protein CISIN_1g043347mg, partial [Citrus sinensis]
Length=385

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  + +  NQ  G +PR++GN T L  L L+ N+L GEIP+EIG+L  
Sbjct  71   GPIPNNLWHCKELSRVSLSFNQFTGRIPRDLGNSTKLKLLYLSFNNLIGEIPQEIGSLRN  130

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ILR+D NNL G IP+TIFN+STL  +++ NN
Sbjct  131  LEILRIDQNNLVGFIPDTIFNMSTLKTLSLLNN  163


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  S S+E +YM+   ++G +P+EIGNL  L  L L  N+LSG +P  +G L 
Sbjct  271  GVLPSSIGNLSVSVEEIYMYKCNIHGRIPKEIGNLINLTKLSLGYNNLSGSLPITLGRLK  330

Query  104  MLQILRLDNNNLEGTIPETIFNISTL  27
             LQ L L NN  EG IP    + S L
Sbjct  331  KLQGLDLQNNKFEGPIPHEFCHFSRL  356


 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 58/119 (49%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + L+ LY+  N L G +P+EIG+L  L  L++ +N+L G IP  I N++ 
Sbjct  95   GRIPRDLGNSTKLKLLYLSFNNLIGEIPQEIGSLRNLEILRIDQNNLVGFIPDTIFNMST  154

Query  101  LQILRLDN--------------------------NNLEGTIPETIFNISTLTYINMANN  3
            L+ L L N                          NN  G+IP   FN S L Y+ +A N
Sbjct  155  LKTLSLLNNTLSGNLPSSKKLIGLPNLEGLILGLNNFSGSIPSFFFNASKLYYLELAYN  213


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = -1

Query  254  CSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQILRLDN  78
            C SL+ + + +N ++G LP  IGNL++ +  + + + ++ G IP+EIGNL  L  L L  
Sbjct  256  CKSLKVIVLAENPVDGVLPSSIGNLSVSVEEIYMYKCNIHGRIPKEIGNLINLTKLSLGY  315

Query  77   NNLEGTIPETIFNISTLTYINMANN  3
            NNL G++P T+  +  L  +++ NN
Sbjct  316  NNLSGSLPITLGRLKKLQGLDLQNN  340


 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   +L  L +  N L+GSLP  +G L  L  L L  N   G IP E  + + 
Sbjct  296  GRIPKEIGNLINLTKLSLGYNNLSGSLPITLGRLKKLQGLDLQNNKFEGPIPHEFCHFSR  355

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINM  12
            L    L+ N L G+IP  + ++++L  +++
Sbjct  356  LYKFYLNRNKLSGSIPSCLGDLNSLRILSL  385



>ref|XP_010039052.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=877

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG+   L++LY+W N+L+GS+P EIG LT L  L+L++N+LSG IP  IG++  
Sbjct  104  GPIPREIGDLRRLKFLYLWGNKLSGSIPSEIGRLTNLIELRLSDNTLSGSIPASIGSVAN  163

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L +NN  GT+P  I  I  L+ ++++NN
Sbjct  164  LNVLALGDNNFLGTLPPEINKIVHLSALDLSNN  196


 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G+  +L  L +  N L+G +PREIG+L  L  L L  N LSG IP EIG L  
Sbjct  80   GSIPPSLGKLGNLRNLSIAANNLSGPIPREIGDLRRLKFLYLWGNKLSGSIPSEIGRLTN  139

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL +N L G+IP +I +++ L  + + +N
Sbjct  140  LIELRLSDNTLSGSIPASIGSVANLNVLALGDN  172


 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +  C++   L +  N++  S+P EI N+  L  L L++N L+G IP  +G L +
Sbjct  368  GAIPSQLSLCTNFLSLNLSQNKIERSIPPEIRNVQFLRVLDLSQNLLTGRIPLALGKLRV  427

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +N L  +IP++  N+  LT+++++ N
Sbjct  428  LETLNISHNGLSSSIPQSFANLWALTFVDVSYN  460


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  ++L  L + DN   G+LP EI  +  L+ L L+ N L G++P  I    +
Sbjct  152  GSIPASIGSVANLNVLALGDNNFLGTLPPEINKIVHLSALDLSNNELQGQLPENICLGGL  211

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ   + NN+  G IP+++ N ++L  + +  N
Sbjct  212  LQKFTVMNNHFIGHIPKSLRNCTSLVRVRLEGN  244


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -1

Query  218  QLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFN  39
            Q  GS+P  +G L  L NL +  N+LSG IPREIG+L  L+ L L  N L G+IP  I  
Sbjct  77   QDQGSIPPSLGKLGNLRNLSIAANNLSGPIPREIGDLRRLKFLYLWGNKLSGSIPSEIGR  136

Query  38   ISTLTYINMANN  3
            ++ L  + +++N
Sbjct  137  LTNLIELRLSDN  148


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+S+  C+SL  + +  N+L G++    G    LN + L+ N L G++  + G+ + 
Sbjct  224  GHIPKSLRNCTSLVRVRLEGNKLTGNIKEAFGVYPQLNFMDLSRNYLHGQLSWKWGHCHN  283

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LR+ NNN+   IP     ++ L  ++++ N
Sbjct  284  LTSLRILNNNISSEIPPIFGRMAQLQVLDLSAN  316


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +    G C +L  L + +N ++  +P   G +  L  L L+ N+L G+IPRE+G+L +
Sbjct  272  GQLSWKWGHCHNLTSLRILNNNISSEIPPIFGRMAQLQVLDLSANNLRGKIPRELGSLKL  331

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+N+ + G IP  I  +S L ++N+A+N
Sbjct  332  LLDLILNNSGITGDIPHQIGFLSRLEHLNLASN  364


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNI  + G    L ++ +  N L+G L  + G+   L +L++  N++S EIP   G +  
Sbjct  248  GNIKEAFGVYPQLNFMDLSRNYLHGQLSWKWGHCHNLTSLRILNNNISSEIPPIFGRMAQ  307

Query  101  LQILRLDNNNLEGTIPE  51
            LQ+L L  NNL G IP 
Sbjct  308  LQVLDLSANNLRGKIPR  324


 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP   G  + L+ L +  N L G +PRE+G+L +L +L L  + ++G+IP +IG L+ L+
Sbjct  298  IPPIFGRMAQLQVLDLSANNLRGKIPRELGSLKLLLDLILNNSGITGDIPHQIGFLSRLE  357

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +NNL G IP  +   +    +N++ N
Sbjct  358  HLNLASNNLSGAIPSQLSLCTNFLSLNLSQN  388



>ref|XP_009599479.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Nicotiana tomentosiformis]
Length=1097

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP+ IG  SSL+ L +WDNQL+G +P+E+GN T L    L +N+L GEIP EIG L  
Sbjct  235  GNIPKEIGMLSSLKQLVLWDNQLSGYIPKELGNCTKLELFALYQNNLVGEIPVEIGKLKF  294

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L GTIP  I N+S+   I+ + N
Sbjct  295  LKRLYLYWNGLNGTIPRVIGNLSSAIEIDFSEN  327


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG+C +L+ L +  N L G++P+EIG L+ L  L L +N LSG IP+E+GN   
Sbjct  211  GSLPAEIGDCLNLQVLGLAQNNLGGNIPKEIGMLSSLKQLVLWDNQLSGYIPKELGNCTK  270

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L++  L  NNL G IP  I  +  L
Sbjct  271  LELFALYQNNLVGEIPVEIGKLKFL  295


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG+   L+ LY++ N LNG++PR IGNL+    +  +EN L GEIP E   +  
Sbjct  283  GEIPVEIGKLKFLKRLYLYWNGLNGTIPRVIGNLSSAIEIDFSENYLIGEIPTEFSQIMG  342

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N L+G IP+ + ++  L  ++++ N
Sbjct  343  LKLLYLFQNQLKGVIPQELTSLKNLERLDLSIN  375


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I    G+ SSL     + N L G LPR +GNL  L   ++ +NSL+G +P EIG+   
Sbjct  163  GPISEEFGKLSSLVSFVAYTNNLIGPLPRSLGNLKKLITFRVGQNSLTGSLPAEIGDCLN  222

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  NNL G IP+ I  +S+L  + + +N
Sbjct  223  LQVLGLAQNNLGGNIPKEIGMLSSLKQLVLWDN  255


 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR I +C +L+ L +  N   G++P EIG L  L  L ++EN  SG++P  +G L+ 
Sbjct  547  GQVPRKILQCKALQRLDLSKNSFIGAIPDEIGKLAQLERLLVSENKFSGKLPAALGRLSR  606

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L  L++  N+  G IP  + N++ L
Sbjct  607  LTELQMGGNSYSGEIPSELGNLTGL  631


 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PRS+G    L    +  N L GSLP EIG+   L  L L +N+L G IP+EIG L+ 
Sbjct  187  GPLPRSLGNLKKLITFRVGQNSLTGSLPAEIGDCLNLQVLGLAQNNLGGNIPKEIGMLSS  246

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G IP+ + N + L    +  N
Sbjct  247  LKQLVLWDNQLSGYIPKELGNCTKLELFALYQN  279


 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 58/118 (49%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG+ + LE L + +N+ +G LP  +G L+ L  LQ+  NS SGEIP E+GNL  
Sbjct  571  GAIPDEIGKLAQLERLLVSENKFSGKLPAALGRLSRLTELQMGGNSYSGEIPSELGNLTG  630

Query  101  LQI-------------------------LRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQI                         L L+NN+L G IP T   ++ L   N + N
Sbjct  631  LQIAMNLSYNNLSGTMPPKLGNLILLEHLYLNNNHLTGEIPITFQYLTGLMGCNFSYN  688


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP+ IG CS L+ L + DN   G +P E+  L+ L  L L  N +SG I  E G L+ 
Sbjct  115  GNIPKEIGNCSKLQSLQLNDNDFYGQIPAELYKLSHLKELNLFNNMISGPISEEFGKLSS  174

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L       NNL G +P ++ N+  L    +  N
Sbjct  175  LVSFVAYTNNLIGPLPRSLGNLKKLITFRVGQN  207


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (50%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNL------------------------TM  174
            G IP    +   L+ LY++ NQL G +P+E+ +L                        T 
Sbjct  331  GEIPTEFSQIMGLKLLYLFQNQLKGVIPQELTSLKNLERLDLSINYLTGPIPFAFQYFTE  390

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LQL +NSLSG IP+ +G  + L ++ L NN L GTIP  I   S L ++N+ +N
Sbjct  391  LVQLQLFQNSLSGSIPQLLGIYSRLWVVDLSNNYLTGTIPPNICRNSNLIWLNLGSN  447


 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L+G+L   IG+L  L  L L+ N  +G IP+EIGN + LQ L+L++N+  G IP  ++ +
Sbjct  89   LSGTLSSSIGSLVCLTILDLSYNEFTGNIPKEIGNCSKLQSLQLNDNDFYGQIPAELYKL  148

Query  35   STLTYINMANN  3
            S L  +N+ NN
Sbjct  149  SHLKELNLFNN  159


 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +  SIG    L  L +  N+  G++P+EIGN + L +LQL +N   G+IP E+  L+ 
Sbjct  91   GTLSSSIGSLVCLTILDLSYNEFTGNIPKEIGNCSKLQSLQLNDNDFYGQIPAELYKLSH  150

Query  101  LQILRLDNNNLEGTIPETIFNISTL-TYINMANN  3
            L+ L L NN + G I E    +S+L +++   NN
Sbjct  151  LKELNLFNNMISGPISEEFGKLSSLVSFVAYTNN  184


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP  IG C +L+ L +  N     LP EIGNL  L    ++ N L+G++PR+I     LQ
Sbjct  501  IPPEIGNCQNLQRLDLSGNYFTHELPNEIGNLQKLVTFNVSSNLLTGQVPRKILQCKALQ  560

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L  N+  G IP+ I  ++ L  + ++ N
Sbjct  561  RLDLSKNSFIGAIPDEIGKLAQLERLLVSEN  591


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 44/91 (48%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  IG    L    +  N L G +PR+I     L  L L++NS  G IP EIG L  L+
Sbjct  525  LPNEIGNLQKLVTFNVSSNLLTGQVPRKILQCKALQRLDLSKNSFIGAIPDEIGKLAQLE  584

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +  N   G +P  +  +S LT + M  N
Sbjct  585  RLLVSENKFSGKLPAALGRLSRLTELQMGGN  615


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G  P  + +  +L  L +  N     +P EIGN   L  L L+ N  + E+P EIGNL  
Sbjct  475  GKFPSDVCKLRNLSALELGQNTFGSLIPPEIGNCQNLQRLDLSGNYFTHELPNEIGNLQK  534

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L    + +N L G +P  I     L  ++++ N
Sbjct  535  LVTFNVSSNLLTGQVPRKILQCKALQRLDLSKN  567



>emb|CAN61202.1| hypothetical protein VITISV_009745 [Vitis vinifera]
Length=838

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG   SL+++Y+  N L+G +P+EIG LT LN+L L  N+L+GEIP  +GNL+ 
Sbjct  202  GEIPREIGRMKSLKWIYLGYNNLSGGIPKEIGELTSLNHLDLVYNNLTGEIPSSLGNLSD  261

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP +IF++  L  +++++N
Sbjct  262  LHFLFLYQNKLSGSIPPSIFDLKKLISLDLSDN  294


 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI   +SLE+L +  NQL G +PREIG +  L  + L  N+LSG IP+EIG L  
Sbjct  178  GKIPNSIANITSLEFLTLASNQLVGEIPREIGRMKSLKWIYLGYNNLSGGIPKEIGELTS  237

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G IP ++ N+S L ++ +  N
Sbjct  238  LNHLDLVYNNLTGEIPSSLGNLSDLHFLFLYQN  270


 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  S L +L+++ N+L+GS+P  I +L  L +L L++NSLSGE+P+ + +   
Sbjct  250  GEIPSSLGNLSDLHFLFLYQNKLSGSIPPSIFDLKKLISLDLSDNSLSGEVPKSLSDCRS  309

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ +RL +N+  G +      +  + ++++++N
Sbjct  310  LRRVRLQSNHFSGELSSEFMKLPLVYFLDISDN  342


 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP +I  C SL YL + +N L GS+PR  G+ + L  L L+ N +SGEIP ++G  + L+
Sbjct  110  IPGNISLCYSLRYLNLSNNNLTGSMPR--GSASGLEALDLSNNVISGEIPADMGLFSRLK  167

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +L L  N L G IP +I NI++L ++ +A+N
Sbjct  168  VLDLGGNFLVGKIPNSIANITSLEFLTLASN  198


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P+S G  S LE L + +NQ +G++P   GNL+ L  L+L+EN LSG+IP E+ +   
Sbjct  370  GNLPQSFG-ASKLENLDLSENQFSGAVPSSFGNLSELMQLKLSENMLSGDIPEELSSCKK  428

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G IP +  ++  L  ++++ N
Sbjct  429  LVSLNLSHNQLSGHIPASFSDMPVLGQLDLSQN  461


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L+ L +  N L G +P  I N+T L  L L  N L GEIPREIG +  
Sbjct  154  GEIPADMGLFSRLKVLDLGGNFLVGKIPNSIANITSLEFLTLASNQLVGEIPREIGRMKS  213

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L  NNL G IP+ I  +++L ++++  N
Sbjct  214  LKWIYLGYNNLSGGIPKEIGELTSLNHLDLVYN  246


 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IGE +SL +L +  N L G +P  +GNL+ L+ L L +N LSG IP  I +L  
Sbjct  226  GGIPKEIGELTSLNHLDLVYNNLTGEIPSSLGNLSDLHFLFLYQNKLSGSIPPSIFDLKK  285

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N+L G +P+++ +  +L  + + +N
Sbjct  286  LISLDLSDNSLSGEVPKSLSDCRSLRRVRLQSN  318


 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P S G  S L  L + +N L+G +P E+ +   L +L L+ N LSG IP    ++ +
Sbjct  393  GAVPSSFGNLSELMQLKLSENMLSGDIPEELSSCKKLVSLNLSHNQLSGHIPASFSDMPV  452

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP  +    +L  +N++NN
Sbjct  453  LGQLDLSQNQLSGKIPPNLGRXESLVQVNLSNN  485


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +  C  L  L +  NQL+G +P    ++ +L  L L++N LSG+IP  +G    
Sbjct  417  GDIPEELSSCKKLVSLNLSHNQLSGHIPASFSDMPVLGQLDLSQNQLSGKIPPNLGRXES  476

Query  101  LQILRLDNNNLEGTIPET  48
            L  + L NN+L G++P T
Sbjct  477  LVQVNLSNNHLHGSLPST  494


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SI +   L  L + DN L+G +P+ + +   L  ++L  N  SGE+  E   L +
Sbjct  274  GSIPPSIFDLKKLISLDLSDNSLSGEVPKSLSDCRSLRRVRLQSNHFSGELSSEFMKLPL  333

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L + +NNL G I +  +++ +L  +++A N
Sbjct  334  VYFLDISDNNLTGKISDRRWDMPSLQMLSLARN  366


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 52/93 (56%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+S+ +C SL  + +  N  +G L  E   L ++  L +++N+L+G+I     ++  
Sbjct  298  GEVPKSLSDCRSLRRVRLQSNHFSGELSSEFMKLPLVYFLDISDNNLTGKISDRRWDMPS  357

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  N   G +P++ F  S L  ++++ N
Sbjct  358  LQMLSLARNRFFGNLPQS-FGASKLENLDLSEN  389



>gb|KCW48763.1| hypothetical protein EUGRSUZ_K02407 [Eucalyptus grandis]
Length=925

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG+   L++LY+W N+L+GS+P EIG LT L  L+L++N+LSG IP  IG++  
Sbjct  152  GPIPREIGDLRRLKFLYLWGNKLSGSIPSEIGRLTNLIELRLSDNTLSGSIPASIGSVAN  211

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L +NN  GT+P  I  I  L+ ++++NN
Sbjct  212  LNVLALGDNNFLGTLPPEINKIVHLSALDLSNN  244


 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG+   L++LY+W N+L+ S+P EIG LT L  L  ++N L G IP  +GNL+ 
Sbjct  8    GPIPREIGDLRRLKFLYLWSNKLSRSIPSEIGRLTNLIELGFSDNKLVGRIPASLGNLSS  67

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N   G+IP ++  +  L  +++A N
Sbjct  68   LNVLYLHGNQFSGSIPPSLGKLGNLKKLSLAKN  100


 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  SSL  LY+  NQ +GS+P  +G L  L  L L +N L G IPREIGNL+ 
Sbjct  56   GRIPASLGNLSSLNVLYLHGNQFSGSIPPSLGKLGNLKKLSLAKNDLFGPIPREIGNLSC  115

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L LD N   G+IP ++  +  L  +++A N
Sbjct  116  LNVLYLDGNQFSGSIPPSLGKLGNLRNLSIAAN  148


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG  S L  LY+  NQ +GS+P  +G L  L NL +  N+LSG IPREIG+L  
Sbjct  104  GPIPREIGNLSCLNVLYLDGNQFSGSIPPSLGKLGNLRNLSIAANNLSGPIPREIGDLRR  163

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G+IP  I  ++ L  + +++N
Sbjct  164  LKFLYLWGNKLSGSIPSEIGRLTNLIELRLSDN  196


 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G+  +L  L +  N L+G +PREIG+L  L  L L  N LSG IP EIG L  
Sbjct  128  GSIPPSLGKLGNLRNLSIAANNLSGPIPREIGDLRRLKFLYLWGNKLSGSIPSEIGRLTN  187

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL +N L G+IP +I +++ L  + + +N
Sbjct  188  LIELRLSDNTLSGSIPASIGSVANLNVLALGDN  220


 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G+  +L+ L +  N L G +PREIGNL+ LN L L  N  SG IP  +G L  
Sbjct  80   GSIPPSLGKLGNLKKLSLAKNDLFGPIPREIGNLSCLNVLYLDGNQFSGSIPPSLGKLGN  139

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L +  NNL G IP  I ++  L ++ +  N
Sbjct  140  LRNLSIAANNLSGPIPREIGDLRRLKFLYLWGN  172


 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +  C++   L +  N++  S+P EI N+  L  L L++N L+G IP  +G L +
Sbjct  416  GAIPSQLSLCTNFLSLNLSQNKIERSIPPEIRNVQFLRVLDLSQNLLTGRIPLALGKLRV  475

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +N L  +IP++  N+  LT+++++ N
Sbjct  476  LETLNISHNGLSSSIPQSFANLWALTFVDVSYN  508


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  ++L  L + DN   G+LP EI  +  L+ L L+ N L G++P  I    +
Sbjct  200  GSIPASIGSVANLNVLALGDNNFLGTLPPEINKIVHLSALDLSNNELQGQLPENICLGGL  259

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ   + NN+  G IP+++ N ++L  + +  N
Sbjct  260  LQKFTVMNNHFIGHIPKSLRNCTSLVRVRLEGN  292


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -1

Query  230  MWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPE  51
            M  N L G +PREIG+L  L  L L  N LS  IP EIG L  L  L   +N L G IP 
Sbjct  1    MSQNDLFGPIPREIGDLRRLKFLYLWSNKLSRSIPSEIGRLTNLIELGFSDNKLVGRIPA  60

Query  50   TIFNISTLTYINMANN  3
            ++ N+S+L  + +  N
Sbjct  61   SLGNLSSLNVLYLHGN  76


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+S+  C+SL  + +  N+L G++    G    LN + L+ N L G++  + G+ + 
Sbjct  272  GHIPKSLRNCTSLVRVRLEGNKLTGNIKEAFGVYPQLNFMDLSRNYLHGQLSWKWGHCHN  331

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LR+ NNN+   IP     ++ L  ++++ N
Sbjct  332  LTSLRILNNNISSEIPPIFGRMAQLQVLDLSAN  364


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +    G C +L  L + +N ++  +P   G +  L  L L+ N+L G+IPRE+G+L +
Sbjct  320  GQLSWKWGHCHNLTSLRILNNNISSEIPPIFGRMAQLQVLDLSANNLRGKIPRELGSLKL  379

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+N+ + G IP  I  +S L ++N+A+N
Sbjct  380  LLDLILNNSGITGDIPHQIGFLSRLEHLNLASN  412


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNI  + G    L ++ +  N L+G L  + G+   L +L++  N++S EIP   G +  
Sbjct  296  GNIKEAFGVYPQLNFMDLSRNYLHGQLSWKWGHCHNLTSLRILNNNISSEIPPIFGRMAQ  355

Query  101  LQILRLDNNNLEGTIPE  51
            LQ+L L  NNL G IP 
Sbjct  356  LQVLDLSANNLRGKIPR  372


 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP   G  + L+ L +  N L G +PRE+G+L +L +L L  + ++G+IP +IG L+ L+
Sbjct  346  IPPIFGRMAQLQVLDLSANNLRGKIPRELGSLKLLLDLILNNSGITGDIPHQIGFLSRLE  405

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +NNL G IP  +   +    +N++ N
Sbjct  406  HLNLASNNLSGAIPSQLSLCTNFLSLNLSQN  436



>ref|XP_010317427.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=1148

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+   SSLE + +W N   GSLPREIGNLT L  L L+EN  +GEIP+E+ NL  
Sbjct  325  GSIPISLINISSLETVSLWRNNFKGSLPREIGNLTKLQVLYLSENRFTGEIPKEMSNLVE  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  N+  G +P  IFNIS L  I ++ N
Sbjct  385  LQVLALGLNSFSGLLPMEIFNISRLRIIQLSGN  417


 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G    L+ + +  N   GS+P  + N + L  LQ++ N L G IP EIGNL+ 
Sbjct  132  GEIPSWFGFLHQLQVVNLRSNSFTGSIPPSLSNASRLETLQISANLLQGNIPEEIGNLHN  191

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L +++N L G+IP TIFNIS +  I  +NN
Sbjct  192  LNVLSMEHNQLTGSIPFTIFNISRIELIVFSNN  224


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   +L  LYM  NQ++GS+P  + N++ L  + L  N+  G +PREIGNL  
Sbjct  301  GIIPQEIGNLVNLVELYMEANQISGSIPISLINISSLETVSLWRNNFKGSLPREIGNLTK  360

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  N   G IP+ + N+  L  + +  N
Sbjct  361  LQVLYLSENRFTGEIPKEMSNLVELQVLALGLN  393


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++PR IG  + L+ LY+ +N+  G +P+E+ NL  L  L L  NS SG +P EI N++ 
Sbjct  349  GSLPREIGNLTKLQVLYLSENRFTGEIPKEMSNLVELQVLALGLNSFSGLLPMEIFNISR  408

Query  101  LQILRLDNNNLEGTIPETI  45
            L+I++L  N L  T+P  I
Sbjct  409  LRIIQLSGNTLSATLPPNI  427


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P S+  CS L+ L +  N  +G +  EIG L+ L  L L  N  +G IP+EIGNL  
Sbjct  253  GHLPTSLSNCSQLQVLSLAFNDFDGRIHSEIGRLSNLQGLYLRNNHFTGIIPQEIGNLVN  312

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L ++ N + G+IP ++ NIS+L  +++  N
Sbjct  313  LVELYMEANQISGSIPISLINISSLETVSLWRN  345


 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR  G  + L  L +  N   G+LP+E+ +L  L  L L+ NS  GEIP   G L+ 
Sbjct  84   GRIPRDFGNLTFLVSLDLGSNHFYGNLPQEMAHLRRLKFLDLSLNSFRGEIPSWFGFLHQ  143

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ++ L +N+  G+IP ++ N S L  + ++ N
Sbjct  144  LQVVNLRSNSFTGSIPPSLSNASRLETLQISAN  176


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I   IG  S+L+ LY+ +N   G +P+EIGNL  L  L +  N +SG IP  + N++ 
Sbjct  277  GRIHSEIGRLSNLQGLYLRNNHFTGIIPQEIGNLVNLVELYMEANQISGSIPISLINISS  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L  NN +G++P  I N++ L  + ++ N
Sbjct  337  LETVSLWRNNFKGSLPREIGNLTKLQVLYLSEN  369


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG   +  Y+ +  NQ    +P EIG L  L +L L  N L G IP  + N+  
Sbjct  668  GSLPPEIGYLKAAIYMNLSMNQFTNGIPTEIGGLQNLEHLYLRHNKLQGSIPDSMNNMVS  727

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +NN+ GTIP ++  +  L Y N+++N
Sbjct  728  LEYLDISHNNISGTIPMSLEKLQYLEYFNVSDN  760


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            N+P S+G    L  L +  N + GSLP EIG L     + L+ N  +  IP EIG L  L
Sbjct  645  NLPTSLGNLKDLLVLDLSSNNMVGSLPPEIGYLKAAIYMNLSMNQFTNGIPTEIGGLQNL  704

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + L L +N L+G+IP+++ N+ +L Y+++++N
Sbjct  705  EHLYLRHNKLQGSIPDSMNNMVSLEYLDISHN  736


 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I  +I +   L  +Y+  NQL+GSLP  +GN+T L  + L  N LS  +P  +GNL  
Sbjct  596  GFIGDNICKLQYLSEIYLGQNQLSGSLPNCLGNVTSLRWIYLASNKLSSNLPTSLGNLKD  655

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L +NN+ G++P  I  +    Y+N++ N
Sbjct  656  LLVLDLSSNNMVGSLPPEIGYLKAAIYMNLSMN  688


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP  IG   +LE+LY+  N+L GS+P  + N+  L  L ++ N++SG IP  +  L  L+
Sbjct  694  IPTEIGGLQNLEHLYLRHNKLQGSIPDSMNNMVSLEYLDISHNNISGTIPMSLEKLQYLE  753

Query  95   ILRLDNNNLEGTIPE--TIFNISTLTYIN  15
               + +N L G IP      N+S+L +IN
Sbjct  754  YFNVSDNKLYGEIPSGGPFKNLSSLFFIN  782


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+   S LE L +  N L G++P EIGNL  LN L +  N L+G IP  I N++ 
Sbjct  156  GSIPPSLSNASRLETLQISANLLQGNIPEEIGNLHNLNVLSMEHNQLTGSIPFTIFNISR  215

Query  101  LQILRLDNNNLEGTIPETIFN  39
            ++++   NN+L G +P  + N
Sbjct  216  IELIVFSNNSLSGNLPNGLCN  236


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P+ +     L++L +  N   G +P   G L  L  + L  NS +G IP  + N + 
Sbjct  108  GNLPQEMAHLRRLKFLDLSLNSFRGEIPSWFGFLHQLQVVNLRSNSFTGSIPPSLSNASR  167

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L++  N L+G IPE I N+  L  ++M +N
Sbjct  168  LETLQISANLLQGNIPEEIGNLHNLNVLSMEHN  200


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = -1

Query  281  GNIPRSIGECSSL---EYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN  111
            GN+P   G C+ L   + L++  N+L G LP  + N + L  L L  N   G I  EIG 
Sbjct  228  GNLPN--GLCNGLPILKRLHLSMNELRGHLPTSLSNCSQLQVLSLAFNDFDGRIHSEIGR  285

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ LQ L L NN+  G IP+ I N+  L  + M  N
Sbjct  286  LSNLQGLYLRNNHFTGIIPQEIGNLVNLVELYMEAN  321


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G +PR+ GNLT L +L L  N   G +P+E+ +L  L+ L L  N+  G IP     +
Sbjct  82   LTGRIPRDFGNLTFLVSLDLGSNHFYGNLPQEMAHLRRLKFLDLSLNSFRGEIPSWFGFL  141

Query  35   STLTYINMANN  3
              L  +N+ +N
Sbjct  142  HQLQVVNLRSN  152


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  SSL  L++ DN   GS+P  IGNL  +    L  N+L+G I   I  L  
Sbjct  548  GKIPNEVGNLSSLLDLHLSDNNFIGSIPTSIGNLRNIQYFNLNHNNLTGFIGDNICKLQY  607

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L  N L G++P  + N+++L +I +A+N
Sbjct  608  LSEIYLGQNQLSGSLPNCLGNVTSLRWIYLASN  640



>ref|XP_009780958.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Nicotiana sylvestris]
Length=1097

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP+ +G  SSL+ L +WDNQL+G +P+E+GN T L    L +N+L GEIP EIG L  
Sbjct  235  GNIPKELGMLSSLKQLVLWDNQLSGYIPKELGNCTRLELFALYQNNLVGEIPVEIGKLKF  294

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L GTIP  I N+S+   I+ + N
Sbjct  295  LKRLYLYRNGLSGTIPRVIGNLSSALEIDFSEN  327


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG+   L+ LY++ N L+G++PR IGNL+    +  +EN + GEIP E   +  
Sbjct  283  GEIPVEIGKLKFLKRLYLYRNGLSGTIPRVIGNLSSALEIDFSENYIIGEIPTEFSQIKG  342

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N L+G IP+ + ++  L +++++ N
Sbjct  343  LKLLYLFKNQLKGAIPQELTSLRKLEHLDLSIN  375


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG+C +L+ L +  N + G++P+E+G L+ L  L L +N LSG IP+E+GN   
Sbjct  211  GSLPAEIGDCLNLQVLGLAQNNIGGNIPKELGMLSSLKQLVLWDNQLSGYIPKELGNCTR  270

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++  L  NNL G IP  I  +  L  + +  N
Sbjct  271  LELFALYQNNLVGEIPVEIGKLKFLKRLYLYRN  303


 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLN-NLQLTENSLSGEIPREIGNLN  105
            G IP ++G  S L  L M  N  +G +P E+GNLT L   + L+ N+LSG IP ++GNL 
Sbjct  595  GKIPAALGRLSRLTELQMGGNSYSGEIPPELGNLTGLQIAMNLSYNNLSGTIPPKLGNLI  654

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +L+ L L+NN+L G IP T   ++ L   N + N
Sbjct  655  LLEYLYLNNNHLTGEIPITFQYLTGLMGCNFSYN  688


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP+ IG CS L+ L + DN   G +P E+ NL+ L  L L  N +SG I  E G L+ 
Sbjct  115  GNIPKEIGNCSKLQSLQLNDNDFYGQIPAELYNLSYLEELNLFNNMISGPISEEFGKLSS  174

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L       NN+ G +P ++ N+ T+    +  N
Sbjct  175  LVSFVAYTNNIIGPLPRSLGNLKTMITFRVGQN  207


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 58/118 (49%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTE----------------  150
            G +P  I +C +L+ L +  N   G++P EIG L  L  L ++E                
Sbjct  547  GQVPPKILKCKALQRLDLSKNSFCGTVPDEIGKLAQLERLLVSENKFYGKIPAALGRLSR  606

Query  149  --------NSLSGEIPREIGNLNMLQI-LRLDNNNLEGTIPETIFNISTLTYINMANN  3
                    NS SGEIP E+GNL  LQI + L  NNL GTIP  + N+  L Y+ + NN
Sbjct  607  LTELQMGGNSYSGEIPPELGNLTGLQIAMNLSYNNLSGTIPPKLGNLILLEYLYLNNN  664


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +     LE+L +  N L G +P     LT L  LQL +NSLSG IP+ +G    
Sbjct  355  GAIPQELTSLRKLEHLDLSINYLTGPIPFAFQYLTELVQLQLFQNSLSGSIPQHLGIYGR  414

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L ++ L NN L GTIP  I   S L  +N+ +N
Sbjct  415  LWVVDLSNNYLTGTIPPNICRNSDLILLNLGSN  447


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PRS+G   ++    +  N L+GSLP EIG+   L  L L +N++ G IP+E+G L+ 
Sbjct  187  GPLPRSLGNLKTMITFRVGQNLLSGSLPAEIGDCLNLQVLGLAQNNIGGNIPKELGMLSS  246

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G IP+ + N + L    +  N
Sbjct  247  LKQLVLWDNQLSGYIPKELGNCTRLELFALYQN  279


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I    G+ SSL     + N + G LPR +GNL  +   ++ +N LSG +P EIG+   
Sbjct  163  GPISEEFGKLSSLVSFVAYTNNIIGPLPRSLGNLKTMITFRVGQNLLSGSLPAEIGDCLN  222

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  NN+ G IP+ +  +S+L  + + +N
Sbjct  223  LQVLGLAQNNIGGNIPKELGMLSSLKQLVLWDN  255


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG C +L+ L +  N     LP EIGNL  L    ++ N L+G++P +I     
Sbjct  499  GLIPPEIGNCQNLQRLDLSGNYFTHELPNEIGNLQKLVTFNVSSNLLTGQVPPKILKCKA  558

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L  N+  GT+P+ I  ++ L  + ++ N
Sbjct  559  LQRLDLSKNSFCGTVPDEIGKLAQLERLLVSEN  591


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            N+  G++P+EIGN + L +LQL +N   G+IP E+ NL+ L+ L L NN + G I E   
Sbjct  111  NEFTGNIPKEIGNCSKLQSLQLNDNDFYGQIPAELYNLSYLEELNLFNNMISGPISEEFG  170

Query  41   NISTL-TYINMANN  3
             +S+L +++   NN
Sbjct  171  KLSSLVSFVAYTNN  184


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G  P  + +  +L  L +  N   G +P EIGN   L  L L+ N  + E+P EIGNL  
Sbjct  475  GKFPSDVCKLRNLSALELGQNTFGGLIPPEIGNCQNLQRLDLSGNYFTHELPNEIGNLQK  534

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L    + +N L G +P  I     L  ++++ N
Sbjct  535  LVTFNVSSNLLTGQVPPKILKCKALQRLDLSKN  567


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N  +G IP+EIGN + LQ L+L++N+  G IP  ++N+S L  +N+ NN
Sbjct  103  LTVLDLSYNEFTGNIPKEIGNCSKLQSLQLNDNDFYGQIPAELYNLSYLEELNLFNN  159



>ref|XP_008339463.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=473

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG   SL  L ++ NQLNGS+P  IG LT LN+L+L +N+LSG IP+EIGNL  
Sbjct  299  GSIPKEIGNLKSLMRLSLYKNQLNGSIPTFIGELTNLNHLRLYKNNLSGSIPKEIGNLKS  358

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ +++ LT++N+  N
Sbjct  359  LTSLDLSENQLNGSIPTSVGDLTNLTFLNLFGN  391


 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L YLY+  N  +GS+P++IGNL  L NL L+EN L+G IP  +G+L  
Sbjct  179  GSIPTSVGNLTNLTYLYLSKNNFSGSIPKKIGNLKSLANLNLSENQLNGSIPTSVGDLTN  238

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  NNL G+IP+ I N+ +L  +++  N
Sbjct  239  LTLLSLFENNLSGSIPKEIGNLKSLVGLSLYEN  271


 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G+ ++L  L +++N L+GS+P+EIGNL  L  L L EN LSG IP  IG+L  
Sbjct  227  GSIPTSVGDLTNLTLLSLFENNLSGSIPKEIGNLKSLVGLSLYENQLSGSIPTSIGDLTN  286

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL  NNL G+IP+ I N+ +L  +++  N
Sbjct  287  LTHLRLYKNNLSGSIPKEIGNLKSLMRLSLYKN  319


 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG+ ++L +L ++ N L+GS+P+EIGNL  L  L L +N L+G IP  IG L  
Sbjct  275  GSIPTSIGDLTNLTHLRLYKNNLSGSIPKEIGNLKSLMRLSLYKNQLNGSIPTFIGELTN  334

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL  NNL G+IP+ I N+ +LT ++++ N
Sbjct  335  LNHLRLYKNNLSGSIPKEIGNLKSLTSLDLSEN  367


 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG   SL  L + +NQLNGS+P  +G+LT L  L L EN+LSG IP+EIGNL  
Sbjct  203  GSIPKKIGNLKSLANLNLSENQLNGSIPTSVGDLTNLTLLSLFENNLSGSIPKEIGNLKS  262

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP +I +++ LT++ +  N
Sbjct  263  LVGLSLYENQLSGSIPTSIGDLTNLTHLRLYKN  295


 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IGE ++L +L ++ N L+GS+P+EIGNL  L +L L+EN L+G IP  +G+L  
Sbjct  323  GSIPTFIGELTNLNHLRLYKNNLSGSIPKEIGNLKSLTSLDLSENQLNGSIPTSVGDLTN  382

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G+IP +I N++ L  + ++ N
Sbjct  383  LTFLNLFGNNLSGSIPGSIGNLTNLESLALSVN  415


 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG   SL  L +++NQL+GS+P  IG+LT L +L+L +N+LSG IP+EIGNL  
Sbjct  251  GSIPKEIGNLKSLVGLSLYENQLSGSIPTSIGDLTNLTHLRLYKNNLSGSIPKEIGNLKS  310

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP  I  ++ L ++ +  N
Sbjct  311  LMRLSLYKNQLNGSIPTFIGELTNLNHLRLYKN  343


 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G+ ++L +L ++ N L+GS+P  IGNLT L +L L+ N LSG IP+EI NL  
Sbjct  371  GSIPTSVGDLTNLTFLNLFGNNLSGSIPGSIGNLTNLESLALSVNQLSGPIPQEIENLKN  430

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN+  G +P+ I +   LTY +++NN
Sbjct  431  LTALXLYNNHFSGYLPQNICSGGLLTYFSISNN  463


 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG   SL  L + +NQLNGS+P  +G+LT L  L L  N+LSG IP  IGNL  
Sbjct  347  GSIPKEIGNLKSLTSLDLSENQLNGSIPTSVGDLTNLTFLNLFGNNLSGSIPGSIGNLTN  406

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G IP+ I N+  LT + + NN
Sbjct  407  LESLALSVNQLSGPIPQEIENLKNLTALXLYNN  439


 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG   SL  L + +NQL+GS+P  +GNLT L  L L++N+ SG IP++IGNL  
Sbjct  155  GSIPQEIGNLKSLMDLDLSENQLSGSIPTSVGNLTNLTYLYLSKNNFSGSIPKKIGNLKS  214

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ +++ LT +++  N
Sbjct  215  LANLNLSENQLNGSIPTSVGDLTNLTLLSLFEN  247


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  218  QLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFN  39
            Q  GS+P+EIGNL  L +L L+EN LSG IP  +GNL  L  L L  NN  G+IP+ I N
Sbjct  152  QFFGSIPQEIGNLKSLMDLDLSENQLSGSIPTSVGNLTNLTYLYLSKNNFSGSIPKKIGN  211

Query  38   ISTLTYINMANN  3
            + +L  +N++ N
Sbjct  212  LKSLANLNLSEN  223


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  ++LE L +  NQL+G +P+EI NL  L  L L  N  SG +P+ I +  +
Sbjct  395  GSIPGSIGNLTNLESLALSVNQLSGPIPQEIENLKNLTALXLYNNHFSGYLPQNICSGGL  454

Query  101  LQILRLDNNNLEGTIPE  51
            L    + NN+L G IP+
Sbjct  455  LTYFSISNNHLTGPIPQ  471


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LEYL +  N L  ++P +I +L+ LNNL L+ N   G IP+EIGNL  L  L L  N L 
Sbjct  119  LEYLNLGVNNLFDAIPPQISSLSKLNNLNLSNNQFFGSIPQEIGNLKSLMDLDLSENQLS  178

Query  65   GTIPETIFNISTLTYINMANN  3
            G+IP ++ N++ LTY+ ++ N
Sbjct  179  GSIPTSVGNLTNLTYLYLSKN  199



>ref|XP_006657092.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Oryza brachyantha]
Length=1132

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  LYM  NQ +GS+P  IGNL+ L  L   +N LSG+IP   GNL  
Sbjct  486  GHIPSEIGNLKSLTKLYMDYNQFSGSIPPSIGNLSKLGVLSFAQNKLSGQIPDNTGNLVQ  545

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+LD NNL G+IPE+I N S L  +N+A+N
Sbjct  546  LNSLKLDRNNLSGSIPESIGNCSKLLILNLAHN  578


 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  S L  L    N+L+G +P   GNL  LN+L+L  N+LSG IP  IGN + 
Sbjct  510  GSIPPSIGNLSKLGVLSFAQNKLSGQIPDNTGNLVQLNSLKLDRNNLSGSIPESIGNCSK  569

Query  101  LQILRLDNNNLEGTIPETIFNISTLT  24
            L IL L +N+L+G IPE I  IS+L+
Sbjct  570  LLILNLAHNSLDGGIPEKILRISSLS  595


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP S+G C +LEYL M  N L G++P+   NL  +  + +++N+LSG IP+ + +L  
Sbjct  631  GNIPPSLGHCFALEYLSMQRNSLVGNIPQSFMNLVGIKEMDISQNNLSGNIPQFLASLGS  690

Query  101  LQILRLDNNNLEGTIPE  51
            L  L L  N+LEG IP 
Sbjct  691  LHNLNLSFNSLEGAIPS  707


 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP + G+   L+ L + +N+L+G++P  +G+   L ++ L  N+L+G IP+ + N + 
Sbjct  187  GSIPSAFGDLPELQKLLLANNRLSGNIPPSLGSRVSLTSVDLGRNALTGGIPKALMNSSS  246

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L LD+N+L G +P+ + +IS+LT I +  N
Sbjct  247  LEKLWLDSNSLSGELPQALLSISSLTVIYLQYN  279


 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIG-------NLTMLNNLQLTENSLSGEIPR  123
            G +P+++   SSL  +Y+  N   GS+P           NL+ L  L+LT+N L G IP 
Sbjct  259  GELPQALLSISSLTVIYLQYNNFVGSMPPVTAISPQVKRNLSSLIYLRLTQNDLHGSIPE  318

Query  122  EIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             + ++  LQ L L++N+  G +P  +FN+S+LT++ ++NN
Sbjct  319  SLCHIPTLQKLALNSNSFSGAVPPCLFNMSSLTFLGVSNN  358


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G+IP S+    +L+ L +  N  +G++P  + N++ L  L ++ NSL+G IP +IG  L 
Sbjct  314  GSIPESLCHIPTLQKLALNSNSFSGAVPPCLFNMSSLTFLGVSNNSLTGRIPPDIGYTLP  373

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             ++ L L  N  EG+IP ++ N + L Y+N+A+N
Sbjct  374  NIESLGLSANKFEGSIPTSLLNATQLQYLNLADN  407


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSL-EYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP  I   SSL + L +  N L+GS+P E+GNL  LN L+++ N LSG IP  +G+  
Sbjct  582  GGIPEKILRISSLSQELDLSHNHLSGSIPEEVGNLFNLNILRISNNRLSGNIPPSLGHCF  641

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L +  N+L G IP++  N+  +  ++++ N
Sbjct  642  ALEYLSMQRNSLVGNIPQSFMNLVGIKEMDISQN  675


 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+  C  L  L +  N   G+LP   GNL+  L +L + +N +SG IP EIGNL  L  L
Sbjct  442  SLSNCFRLTELLLDGNNFQGNLPNSFGNLSRSLESLWIRDNKISGHIPSEIGNLKSLTKL  501

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             +D N   G+IP +I N+S L  ++ A N
Sbjct  502  YMDYNQFSGSIPPSIGNLSKLGVLSFAQN  530


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+ +C  L+ + +  N+L GS+P   G+L  L  L L  N LSG IP  +G+   
Sbjct  163  GEIPSSLSQCIHLQKINLGSNKLQGSIPSAFGDLPELQKLLLANNRLSGNIPPSLGSRVS  222

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L  + L  N L G IP+ + N S+L
Sbjct  223  LTSVDLGRNALTGGIPKALMNSSSL  247


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I   I   +SL  L + +N  +G +P E+G L  L NL L+ NSL G IP E+ +   
Sbjct  91   GPISPCIANITSLARLELSNNSFHGMIPSELGLLRQLTNLSLSMNSLEGNIPSELSSCAQ  150

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L  N+L G IP ++     L  IN+ +N
Sbjct  151  LQSLTLQGNSLHGEIPSSLSQCIHLQKINLGSN  183


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP S+G   SL  + +  N L G +P+ + N + L  L L  NSLSGE+P+ + +++ 
Sbjct  211  GNIPPSLGSRVSLTSVDLGRNALTGGIPKALMNSSSLEKLWLDSNSLSGELPQALLSISS  270

Query  101  LQILRLDNNNLEGTI-------PETIFNISTLTYINMANN  3
            L ++ L  NN  G++       P+   N+S+L Y+ +  N
Sbjct  271  LTVIYLQYNNFVGSMPPVTAISPQVKRNLSSLIYLRLTQN  310


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G    L  L +  N L G++P E+ +   L +L L  NSL GEIP  +     
Sbjct  115  GMIPSELGLLRQLTNLSLSMNSLEGNIPSELSSCAQLQSLTLQGNSLHGEIPSSLSQCIH  174

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ + L +N L+G+IP    ++  L  + +ANN
Sbjct  175  LQKINLGSNKLQGSIPSAFGDLPELQKLLLANN  207


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G   +L  L + +N+L+G++P  +G+   L  L +  NSL G IP+   NL  
Sbjct  607  GSIPEEVGNLFNLNILRISNNRLSGNIPPSLGHCFALEYLSMQRNSLVGNIPQSFMNLVG  666

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ++ + +  NNL G IP+ + ++ +L  +N++ N
Sbjct  667  IKEMDISQNNLSGNIPQFLASLGSLHNLNLSFN  699



>ref|XP_006465465.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X3 [Citrus sinensis]
Length=1125

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + LE LY+  N+L G +PRE  NL  L  + L+EN+L GEIP EI NL  
Sbjct  288  GAIPKEIGNLTKLEELYLGINRLQGEIPREFSNLAKLEMMSLSENNLQGEIPHEISNLQN  347

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L GT+P  IFN+STL   +++NN
Sbjct  348  LEELDLGHNKLVGTVPAAIFNVSTLKGFSVSNN  380


 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L ++ N L G++P+EIGNLT L  L L  N L GEIPRE  NL  
Sbjct  264  GGIPQELGNLAKLEMLQLFQNNLTGAIPKEIGNLTKLEELYLGINRLQGEIPREFSNLAK  323

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+++ L  NNL+G IP  I N+  L  +++ +N
Sbjct  324  LEMMSLSENNLQGEIPHEISNLQNLEELDLGHN  356


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            N+CS L  LE + L KN  +G IP ++ +C+ L+ L +  N  +G++P++IGNLT L  L
Sbjct  172  NICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMEL  231

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L GEIPRE G+L  L+++ L  +NL+G IP+ + N++ L  + +  N
Sbjct  232  YLGRNRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQN  284


 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR  G  + LE + + ++ L G +P+E+GNL  L  LQL +N+L+G IP+EIGNL  
Sbjct  240  GEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGAIPKEIGNLTK  299

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L+G IP    N++ L  ++++ N
Sbjct  300  LEELYLGINRLQGEIPREFSNLAKLEMMSLSEN  332


 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L  LY+  N+L G +PRE G+L  L  + L E++L G IP+E+GNL  
Sbjct  216  GAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAK  275

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L++L+L  NNL G IP+ I N++ L
Sbjct  276  LEMLQLFQNNLTGAIPKEIGNLTKL  300


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE LY+W N  +G++PR I N++ L+ L L +NS SG IP   GNL  L+ L L +N L 
Sbjct  397  LEVLYLWGNNFSGTIPRFIFNVSKLSKLSLEKNSFSGFIPNTFGNLRNLKWLILYDNYLT  456

Query  65   GTIPETIF-----NISTLTYINMANN  3
             + P   F     N  +LTYI++++N
Sbjct  457  SSTPGLSFLSSLSNCKSLTYIDLSHN  482


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +LEYL++  N+L GS+P   G+L  L  L L+ N+LSG IP  +  L+ 
Sbjct  655  GVIPTEIGGLKNLEYLFLGYNRLQGSIPNSFGDLINLKFLNLSNNNLSGAIPASLEKLSY  714

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L  N LEG IP 
Sbjct  715  LEDLNLSFNKLEGEIPR  731


 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP +      +  L    N L G LP EIGNL +L  + L+ N+ SG IP EIG L  L
Sbjct  608  SIPLTFWNLKDILQLNFSSNFLTGPLPLEIGNLKVLVGIDLSMNNFSGVIPTEIGGLKNL  667

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + L L  N L+G+IP +  ++  L ++N++NN
Sbjct  668  EYLFLGYNRLQGSIPNSFGDLINLKFLNLSNN  699


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 53/118 (45%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR     + LE + + +N L G +P EI NL  L  L L  N L G +P  I N++ 
Sbjct  312  GEIPREFSNLAKLEMMSLSENNLQGEIPHEISNLQNLEELDLGHNKLVGTVPAAIFNVST  371

Query  101  LQ-------------------------ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+                         +L L  NN  GTIP  IFN+S L+ +++  N
Sbjct  372  LKGFSVSNNSLSGCLSSIVDARLPNLEVLYLWGNNFSGTIPRFIFNVSKLSKLSLEKN  429


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQIL  90
            SIG  S SLE   M++  ++G +P EI NL+ L  + L  N L+G IP  +  L  LQ L
Sbjct  492  SIGNLSHSLEEFQMYNCNVSGGIPEEIRNLSNLTLIDLGGNKLNGSIPITLSKLQKLQGL  551

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+NN LEG+IP+ I  ++ L  + +  N
Sbjct  552  GLENNKLEGSIPDDICRLAELFRLELGGN  580


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++ +   L+ L + +N+L GS+P +I  L  L  L+L  N LSG IP    NL  
Sbjct  536  GSIPITLSKLQKLQGLGLENNKLEGSIPDDICRLAELFRLELGGNKLSGSIPTCFSNLAS  595

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L  +IP T +N+  +  +N ++N
Sbjct  596  LRILSLGSNELT-SIPLTFWNLKDILQLNFSSN  627


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  IG    L  + +  N  +G +P EIG L  L  L L  N L G IP   G+L  
Sbjct  631  GPLPLEIGNLKVLVGIDLSMNNFSGVIPTEIGGLKNLEYLFLGYNRLQGSIPNSFGDLIN  690

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NNNL G IP ++  +S L  +N++ N
Sbjct  691  LKFLNLSNNNLSGAIPASLEKLSYLEDLNLSFN  723


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   S+L  + +  N+LNGS+P  +  L  L  L L  N L G IP +I  L  
Sbjct  512  GGIPEEIRNLSNLTLIDLGGNKLNGSIPITLSKLQKLQGLGLENNKLEGSIPDDICRLAE  571

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP    N+++L  +++ +N
Sbjct  572  LFRLELGGNKLSGSIPTCFSNLASLRILSLGSN  604


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  SSL+ L +  N+L+GS+P  I  +  L  +   EN LSG  P  I N + 
Sbjct  95   GTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSS  154

Query  101  LQILRLDNNNLEGTIPETIF-NISTLTYINMANN  3
            LQ L    N L G IP  I  N+  L YI+++ N
Sbjct  155  LQHLDFSQNTLSGEIPANICSNLPFLEYISLSKN  188


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 53/118 (45%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSG-----------  135
            G IP  I    +LE L +  N+L G++P  I N++ L    ++ NSLSG           
Sbjct  336  GEIPHEISNLQNLEELDLGHNKLVGTVPAAIFNVSTLKGFSVSNNSLSGCLSSIVDARLP  395

Query  134  --------------EIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                           IPR I N++ L  L L+ N+  G IP T  N+  L ++ + +N
Sbjct  396  NLEVLYLWGNNFSGTIPRFIFNVSKLSKLSLEKNSFSGFIPNTFGNLRNLKWLILYDN  453



>ref|XP_007012155.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
 gb|EOY29774.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
Length=970

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G+  SL+++Y+  N L+G +P+EIG LT LN+L L  N+L+GEIP  +GNL  
Sbjct  203  GPIPREVGKMKSLKWIYLGYNNLSGEIPKEIGMLTSLNHLDLVYNNLTGEIPSSLGNLGD  262

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L  N L G+IP++IF +  L  +++++N
Sbjct  263  LQYLFLYQNKLTGSIPKSIFGLKKLVSLDLSDN  295


 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI   ++L++L +  NQL G +PRE+G +  L  + L  N+LSGEIP+EIG L  
Sbjct  179  GKIPISISNITTLQFLTLASNQLVGPIPREVGKMKSLKWIYLGYNNLSGEIPKEIGMLTS  238

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G IP ++ N+  L Y+ +  N
Sbjct  239  LNHLDLVYNNLTGEIPSSLGNLGDLQYLFLYQN  271


 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G    L+YL+++ N+L GS+P+ I  L  L +L L++NSLSGE+P  I  L  
Sbjct  251  GEIPSSLGNLGDLQYLFLYQNKLTGSIPKSIFGLKKLVSLDLSDNSLSGEVPELIIQLQN  310

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N   G IP  + ++  L  + + +N
Sbjct  311  LEILHLFSNRFTGKIPNALTSLPRLQVLQLWSN  343


 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL++L +  N L G +P  I N+T L  L L  N L G IPRE+G +  
Sbjct  155  GRIPQEIGSFYSLKFLDLGGNVLVGKIPISISNITTLQFLTLASNQLVGPIPREVGKMKS  214

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L  NNL G IP+ I  +++L ++++  N
Sbjct  215  LKWIYLGYNNLSGEIPKEIGMLTSLNHLDLVYN  247


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  I +  +LE L+++ N+  G +P  + +L  L  LQL  NSLSGEIP  +G  N 
Sbjct  299  GEVPELIIQLQNLEILHLFSNRFTGKIPNALTSLPRLQVLQLWSNSLSGEIPTSLGRHNN  358

Query  101  LQILRLDNNNLEGTIPE  51
            L +L L  NNL G IP+
Sbjct  359  LTVLDLSGNNLTGRIPD  375


 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 2/93 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  S LE L + +N L+G +P+EIG+   L  L L  N L G+IP  I N+  
Sbjct  133  GQIPS--GSISRLEMLDLSNNMLSGRIPQEIGSFYSLKFLDLGGNVLVGKIPISISNITT  190

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +N L G IP  +  + +L +I +  N
Sbjct  191  LQFLTLASNQLVGPIPREVGKMKSLKWIYLGYN  223


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P S G    +E L +  N+L+GS+PR  G+LT L  L L  N L+GEIP E+ +   
Sbjct  467  GKLPHSFGR-QKIENLDLSGNELSGSIPRSFGSLTELMQLSLCGNKLTGEIPEELSSCKK  525

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L   +N L G IP     +  L  ++++ N
Sbjct  526  LVSLDFSHNQLSGHIPSGFSEMPVLGQLDLSEN  558


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS G  + L  L +  N+L G +P E+ +   L +L  + N LSG IP     + +
Sbjct  490  GSIPRSFGSLTELMQLSLCGNKLTGEIPEELSSCKKLVSLDFSHNQLSGHIPSGFSEMPV  549

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G +P  +  + +L  +N++ N
Sbjct  550  LGQLDLSENQLSGEVPPKLGKLESLVQVNISYN  582


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +  C  L  L    NQL+G +P     + +L  L L+EN LSGE+P ++G L  
Sbjct  514  GEIPEELSSCKKLVSLDFSHNQLSGHIPSGFSEMPVLGQLDLSENQLSGEVPPKLGKLES  573

Query  101  LQILRLDNNNLEGTIPET  48
            L  + +  N+L G++P T
Sbjct  574  LVQVNISYNHLHGSLPST  591


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+SI     L  L + DN L+G +P  I  L  L  L L  N  +G+IP  + +L  
Sbjct  275  GSIPKSIFGLKKLVSLDLSDNSLSGEVPELIIQLQNLEILHLFSNRFTGKIPNALTSLPR  334

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L+L +N+L G IP ++   + LT ++++ N
Sbjct  335  LQVLQLWSNSLSGEIPTSLGRHNNLTVLDLSGN  367


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +     L  L ++ N L G +P+ +   T L  ++L  N LSGE+  E   L +
Sbjct  371  GRIPDGLCSSGRLFKLILFSNSLEGVIPKNLSTCTSLQRVRLQSNRLSGELSSEFTKLPL  430

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L + NNNL G I E  +++ +L  +N+A N
Sbjct  431  VYYLDISNNNLSGNIGERKWDMPSLEMLNLARN  463


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 57/110 (52%), Gaps = 22/110 (20%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREI----------------------GNLTMLNNLQLT  153
            SI +   ++ L +  NQL+G +P +I                      G+++ L  L L+
Sbjct  90   SIFQLPYIQTLNLSSNQLDGEIPLDIFSSSSLRFLNLSNNNFTGQIPSGSISRLEMLDLS  149

Query  152  ENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             N LSG IP+EIG+   L+ L L  N L G IP +I NI+TL ++ +A+N
Sbjct  150  NNMLSGRIPQEIGSFYSLKFLDLGGNVLVGKIPISISNITTLQFLTLASN  199


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++     L+ L +W N L+G +P  +G    L  L L+ N+L+G IP  + +   
Sbjct  323  GKIPNALTSLPRLQVLQLWSNSLSGEIPTSLGRHNNLTVLDLSGNNLTGRIPDGLCSSGR  382

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N+LEG IP+ +   ++L  + + +N
Sbjct  383  LFKLILFSNSLEGVIPKNLSTCTSLQRVRLQSN  415



>ref|XP_008779587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850, partial [Phoenix dactylifera]
Length=789

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G  ++L+ L+++ N+L+G++PRE+GNL  L NL++ EN LSG IP  +GNL M
Sbjct  34   GSIPSTLGNLTTLDTLHLYTNKLSGTIPRELGNLVNLRNLEIPENQLSGSIPSTLGNLTM  93

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L LD+NNL GTIP  + N+  L  + + +N
Sbjct  94   LDVLYLDDNNLSGTIPNELGNLINLRSLALYDN  126


 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G  + L+ LY+ DN L+G++P E+GNL  L +L L +N LSG IP  +GNL M
Sbjct  82   GSIPSTLGNLTMLDVLYLDDNNLSGTIPNELGNLINLRSLALYDNQLSGSIPSTLGNLTM  141

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N+L G++P+ + N++ L YI+++ N
Sbjct  142  LDTLYLLYNHLSGSLPQELGNLTNLNYIDVSYN  174


 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G   +L  L ++DNQL+GS+P  +GNLTML+ L L  N LSG +P+E+GNL  
Sbjct  106  GTIPNELGNLINLRSLALYDNQLSGSIPSTLGNLTMLDTLYLLYNHLSGSLPQELGNLTN  165

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + +  NNL G +P  I     L Y+ + NN
Sbjct  166  LNYIDVSYNNLSGYLPSEICKGGVLQYLLLMNN  198


 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G  + L+ LY+  N L+GSLP+E+GNLT LN + ++ N+LSG +P EI    +
Sbjct  130  GSIPSTLGNLTMLDTLYLLYNHLSGSLPQELGNLTNLNYIDVSYNNLSGYLPSEICKGGV  189

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINM  12
            LQ L L NN  EG IP ++ N S+L  + +
Sbjct  190  LQYLLLMNNYFEGPIPRSLKNCSSLVRVRL  219


 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G   +L  L + +NQL+GS+P  +GNLTML+ L L +N+LSG IP E+GNL  
Sbjct  58   GTIPRELGNLVNLRNLEIPENQLSGSIPSTLGNLTMLDVLYLDDNNLSGTIPNELGNLIN  117

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L+ L L +N L G+IP T+ N++ L
Sbjct  118  LRSLALYDNQLSGSIPSTLGNLTML  142


 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP   G+   LE L +  NQL G +PRE+G +++L NL L++N +SG IP E G+L+ 
Sbjct  274  GNIPSEFGKLLQLEVLDLSSNQLAGEIPRELGTMSLLFNLTLSDNKISGIIPSEFGHLSN  333

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L NN++   IP  +     L  +N++ N
Sbjct  334  LEILDLSNNDISSPIPLQLEGCIKLRILNLSKN  366


 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G   +L  L +  NQL+GS+P  +GNLT L+ L L  N LSG IPRE+GNL  
Sbjct  10   GTIPHELGNLVNLRDLQISINQLSGSIPSTLGNLTTLDTLHLYTNKLSGTIPRELGNLVN  69

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L +  N L G+IP T+ N++ L  + + +N
Sbjct  70   LRNLEIPENQLSGSIPSTLGNLTMLDVLYLDDN  102


 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I  S   C +L Y  +  N L G++P E G L  L  L L+ N L+GEIPRE+G +++
Sbjct  250  GRILPSWAYCQNLTYFRISGNLLTGNIPSEFGKLLQLEVLDLSSNQLAGEIPRELGTMSL  309

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N + G IP    ++S L  ++++NN
Sbjct  310  LFNLTLSDNKISGIIPSEFGHLSNLEILDLSNN  342


 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  LYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTI  57
            +Y+  N L+G++P E+GNL  L +LQ++ N LSG IP  +GNL  L  L L  N L GTI
Sbjct  1    MYLGVNNLSGTIPHELGNLVNLRDLQISINQLSGSIPSTLGNLTTLDTLHLYTNKLSGTI  60

Query  56   PETIFNISTLTYINMANN  3
            P  + N+  L  + +  N
Sbjct  61   PRELGNLVNLRNLEIPEN  78


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL-QLTENSLSGEIPREIGNLNML  99
            IP  +  C  L  L +  N+ +G +P ++G L  L++L  L+ N   GEIP E+ +L  L
Sbjct  348  IPLQLEGCIKLRILNLSKNKFDGIIPSQLGELKGLHDLLDLSHNFFRGEIPSELASLTYL  407

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L +NNL G IP +  ++ +L+ I+++ N
Sbjct  408  LSLNLSHNNLSGAIPSSFGSMLSLSSIDVSYN  439


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  S L  L + DN+++G +P E G+L+ L  L L+ N +S  IP ++     
Sbjct  298  GEIPRELGTMSLLFNLTLSDNKISGIIPSEFGHLSNLEILDLSNNDISSPIPLQLEGCIK  357

Query  101  LQILRLDNNNLEGTIPETI  45
            L+IL L  N  +G IP  +
Sbjct  358  LRILNLSKNKFDGIIPSQL  376


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P+ +G  ++L Y+ +  N L+G LP EI    +L  L L  N   G IPR + N + 
Sbjct  154  GSLPQELGNLTNLNYIDVSYNNLSGYLPSEICKGGVLQYLLLMNNYFEGPIPRSLKNCSS  213

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  +RL+ + L+G I E       L YI+M+ N
Sbjct  214  LVRVRLEGSKLKGNISEDFGIYPNLLYIDMSGN  246


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 1/79 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSL-EYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP  +GE   L + L +  N   G +P E+ +LT L +L L+ N+LSG IP   G++ 
Sbjct  370  GIIPSQLGELKGLHDLLDLSHNFFRGEIPSELASLTYLLSLNLSHNNLSGAIPSSFGSML  429

Query  104  MLQILRLDNNNLEGTIPET  48
             L  + +  NNLEG +P +
Sbjct  430  SLSSIDVSYNNLEGPVPRS  448



>gb|KCW54189.1| hypothetical protein EUGRSUZ_I00178 [Eucalyptus grandis]
Length=403

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  +SL +LY+ +NQL+GS+P EIGNLT L NL L  N LSG IP EIGNL  
Sbjct  236  GSIPLEIGNLTSLIHLYLQENQLSGSIPLEIGNLTSLTNLYLGGNQLSGSIPPEIGNLRS  295

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L+ +IP  I N+ +LTY++   N
Sbjct  296  LAYLDLQGNQLDRSIPLEIGNLRSLTYLDFQGN  328


 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG  ++L  L +  NQL GS+P EIGNLT L +L L EN LSG IP EIGNL  
Sbjct  212  GPIPSSIGNLTNLTDLDLRGNQLCGSIPLEIGNLTSLIHLYLQENQLSGSIPLEIGNLTS  271

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP  I N+ +L Y+++  N
Sbjct  272  LTNLYLGGNQLSGSIPPEIGNLRSLAYLDLQGN  304


 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  +SL  LY+  NQL+GS+P EIGNL  L  L L  N L   IP EIGNL  
Sbjct  260  GSIPLEIGNLTSLTNLYLGGNQLSGSIPPEIGNLRSLAYLDLQGNQLDRSIPLEIGNLRS  319

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L    N L G+IP  I N+ +LT +++  N
Sbjct  320  LTYLDFQGNKLGGSIPPEIGNLRSLTDLDLGGN  352


 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL YL +  NQL+ S+P EIGNL  L  L    N L G IP EIGNL  
Sbjct  284  GSIPPEIGNLRSLAYLDLQGNQLDRSIPLEIGNLRSLTYLDFQGNKLGGSIPPEIGNLRS  343

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+I   I N+ +L Y+++  N
Sbjct  344  LTDLDLGGNQLGGSISPEIGNLRSLAYLDLQGN  376


 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG   SL YL    N+L GS+P EIGNL  L +L L  N L G I  EIGNL  L
Sbjct  309  SIPLEIGNLRSLTYLDFQGNKLGGSIPPEIGNLRSLTDLDLGGNQLGGSISPEIGNLRSL  368

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L  N L  +IP  I N++  TY+ M  N
Sbjct  369  AYLDLQGNRLGESIPPEIGNLTNSTYLEMQGN  400


 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G  + ++Y+ +  N   G +P  IGNLT L +L L  N L G IP EIGNL  
Sbjct  188  GSIPLELGNLAQMDYVDLSFNYFIGPIPSSIGNLTNLTDLDLRGNQLCGSIPLEIGNLTS  247

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP  I N+++LT + +  N
Sbjct  248  LIHLYLQENQLSGSIPLEIGNLTSLTNLYLGGN  280


 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P +IG   +L +L    N+LNGS+P E+GNL  ++ + L+ N   G IP  IGNL  
Sbjct  164  GVVPPTIGCLHNLRFLRFRSNKLNGSIPLELGNLAQMDYVDLSFNYFIGPIPSSIGNLTN  223

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP  I N+++L ++ +  N
Sbjct  224  LTDLDLRGNQLCGSIPLEIGNLTSLIHLYLQEN  256


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +   + L+ L +  N ++GS+P E+GNL  LN L L  N L+G +P  IG L+ 
Sbjct  116  GELPPCVQNLTRLQILNISGNYISGSIPPELGNLERLNTLNLEFNLLNGVVPPTIGCLHN  175

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ LR  +N L G+IP  + N++ + Y++++ N
Sbjct  176  LRFLRFRSNKLNGSIPLELGNLAQMDYVDLSFN  208


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  I   S L YL +  N L G LP  + NLT L  L ++ N +SG IP E+GNL  
Sbjct  92   GRMPLQICTLSRLTYLDLSSNFLYGELPPCVQNLTRLQILNISGNYISGSIPPELGNLER  151

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N L G +P TI  +  L ++   +N
Sbjct  152  LNTLNLEFNLLNGVVPPTIGCLHNLRFLRFRSN  184


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G    L  L +  N LNG +P  IG L  L  L+   N L+G IP E+GNL  
Sbjct  140  GSIPPELGNLERLNTLNLEFNLLNGVVPPTIGCLHNLRFLRFRSNKLNGSIPLELGNLAQ  199

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  + L  N   G IP +I N++ LT +++  N
Sbjct  200  MDYVDLSFNYFIGPIPSSIGNLTNLTDLDLRGN  232


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNL  69
            S  +L +  N+L G +P +I  L+ L  L L+ N L GE+P  + NL  LQIL +  N +
Sbjct  79   SFTFLDVPHNKLVGRMPLQICTLSRLTYLDLSSNFLYGELPPCVQNLTRLQILNISGNYI  138

Query  68   EGTIPETIFNISTLTYINMANN  3
             G+IP  + N+  L  +N+  N
Sbjct  139  SGSIPPELGNLERLNTLNLEFN  160


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 37/71 (52%), Gaps = 0/71 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L +  NQL GS+  EIGNL  L  L L  N L   IP EIGNL  
Sbjct  332  GSIPPEIGNLRSLTDLDLGGNQLGGSISPEIGNLRSLAYLDLQGNRLGESIPPEIGNLTN  391

Query  101  LQILRLDNNNL  69
               L +  N L
Sbjct  392  STYLEMQGNQL  402



>gb|KDP31299.1| hypothetical protein JCGZ_11675 [Jatropha curcas]
Length=1205

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  I E  SL+YL +  NQ NGS+P+E GNLT L  L L+ NSLSG IP  +GNLN 
Sbjct  379  GPLPVEISEMPSLKYLILAYNQFNGSIPKEYGNLTSLQALDLSFNSLSGSIPSSLGNLNS  438

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN+L G IP  + N S+L ++N+ANN
Sbjct  439  LLWLMLANNSLTGEIPRELGNCSSLLWVNLANN  471


 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG+  S   L+   N++ G LP ++G L ++  L +++N  SGEIP +IGN+  
Sbjct  575  GEIPQEIGKMQSFSMLHFGSNEIYGKLPPQVGELPLVV-LNVSKNGFSGEIPTQIGNIKC  633

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +NN  GT P T+ N+S L+  N++ N
Sbjct  634  LQNLDLSHNNFSGTFPVTLNNLSDLSKFNVSYN  666


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+  G  +SL+ L +  N L+GS+P  +GNL  L  L L  NSL+GEIPRE+GN + 
Sbjct  403  GSIPKEYGNLTSLQALDLSFNSLSGSIPSSLGNLNSLLWLMLANNSLTGEIPRELGNCSS  462

Query  101  LQILRLDNNNLEGTIPETIFNI  36
            L  + L NN L G IP  + NI
Sbjct  463  LLWVNLANNELSGKIPPELVNI  484


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILR  87
            S GE  SLE L + +N   G L  EI N   L  L +  N  +G+IP EIG+++ L+ L 
Sbjct  239  SFGETCSLEVLDLSENNFTGGLATEIKNCRNLIILNVWGNKFTGKIPSEIGSISSLEALY  298

Query  86   LDNNNLEGTIPETIFNISTLTYINMANN  3
            L NN+    IP+++ N+S L +++ + N
Sbjct  299  LGNNSFSPVIPKSLLNLSRLAFLDFSRN  326


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            N  +G LP EI  +  L  L L  N  +G IP+E GNL  LQ L L  N+L G+IP ++ 
Sbjct  375  NNFSGPLPVEISEMPSLKYLILAYNQFNGSIPKEYGNLTSLQALDLSFNSLSGSIPSSLG  434

Query  41   NISTLTYINMANN  3
            N+++L ++ +ANN
Sbjct  435  NLNSLLWLMLANN  447


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +   I  C +L  L +W N+  G +P EIG+++ L  L L  NS S  IP+ + NL+ 
Sbjct  258  GGLATEIKNCRNLIILNVWGNKFTGKIPSEIGSISSLEALYLGNNSFSPVIPKSLLNLSR  317

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L    N+  G + E   +   + ++ +  N
Sbjct  318  LAFLDFSRNSFGGDVQEIFGSFKQVKFLVLHGN  350


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  SSLE LY+ +N  +  +P+ + NL+ L  L  + NS  G++    G+   
Sbjct  282  GKIPSEIGSISSLEALYLGNNSFSPVIPKSLLNLSRLAFLDFSRNSFGGDVQEIFGSFKQ  341

Query  101  LQILRLDNNNLEGTIPET-IFNISTLTYINMANN  3
            ++ L L  N+  G +  + I  + ++  ++++ N
Sbjct  342  VKFLVLHGNSYTGGLYSSGILKLPSVVRLDLSYN  375



>ref|XP_006465461.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like isoform X3 [Citrus sinensis]
Length=548

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR     + LE + + DN L G +P+E+GNL  L  LQL +N+L+GEIP EIGNL  
Sbjct  164  GEIPREFSNLADLERMSLGDNNLQGGIPQELGNLAKLEGLQLLQNNLTGEIPLEIGNLQN  223

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINM  12
            L+ L+L  N L GT+P  IFN+STL ++ +
Sbjct  224  LEELQLGQNKLIGTVPAAIFNVSTLKFLGL  253


 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            N+CS L  LE L+L +N  +G IP ++  C+ L  L +  N  +G++PREIGNLT L  L
Sbjct  96   NICSNLPFLEILFLSENMFHGEIPSALSNCTYLIILSLAYNDFSGAVPREIGNLTKLREL  155

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L GEIPRE  NL  L+ + L +NNL+G IP+ + N++ L  + +  N
Sbjct  156  YLGCNRLQGEIPREFSNLADLERMSLGDNNLQGGIPQELGNLAKLEGLQLLQN  208


 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 5/86 (6%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE LY+W N  +G++PR I N + L+ L L  NS SG IP   GNL  L+ L LD N L 
Sbjct  273  LEKLYLWGNNFSGTIPRFIFNASKLSKLSLGMNSFSGFIPSTFGNLRNLEQLGLDENYLT  332

Query  65   GTIPETIF-----NISTLTYINMANN  3
             + PE  F     N  +LT I+++NN
Sbjct  333  SSTPELSFLSSLSNCKSLTLIDLSNN  358


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 57/118 (48%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L +  N L G +P EIGNL  L  LQL +N L G +P  I N++ 
Sbjct  188  GGIPQELGNLAKLEGLQLLQNNLTGEIPLEIGNLQNLEELQLGQNKLIGTVPAAIFNVST  247

Query  101  LQIL-----------------RLDN--------NNLEGTIPETIFNISTLTYINMANN  3
            L+ L                 RL N        NN  GTIP  IFN S L+ +++  N
Sbjct  248  LKFLGLQNNSLSGSLSSIANVRLPNLEKLYLWGNNFSGTIPRFIFNASKLSKLSLGMN  305


 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNL  69
            SLE  YM++  ++G +P EI NLT L  + L  N L+G IP  +G L  LQ L L++N L
Sbjct  375  SLEEFYMYNCNISGGIPEEISNLTNLVEIDLGGNKLNGSIPITLGKLRKLQRLNLEDNIL  434

Query  68   EGTIPETIFNISTLTYINMANN  3
            EG+IP+ I  ++ L  + + +N
Sbjct  435  EGSIPDDICRLAELYRLELGSN  456


 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L + DN L GS+P +I  L  L  L+L  N L G IP   GNL  
Sbjct  412  GSIPITLGKLRKLQRLNLEDNILEGSIPDDICRLAELYRLELGSNKLYGSIPACFGNLAS  471

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L  +IP T +N+  +  +N ++N
Sbjct  472  LRILSLGSNKLT-SIPLTFWNLKDILQLNFSSN  503


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   ++L  + +  N+LNGS+P  +G L  L  L L +N L G IP +I  L  
Sbjct  388  GGIPEEISNLTNLVEIDLGGNKLNGSIPITLGKLRKLQRLNLEDNILEGSIPDDICRLAE  447

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G+IP    N+++L  +++ +N
Sbjct  448  LYRLELGSNKLYGSIPACFGNLASLRILSLGSN  480


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-GNLN  105
            G IP  +G  SSL+ L +  N+L+GS+P  I     L ++ L EN LSG+IP  I  NL 
Sbjct  43   GTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKHVSLGENQLSGQIPTNICSNLP  102

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+IL L  N   G IP  + N + L  +++A N
Sbjct  103  FLEILFLSENMFHGEIPSALSNCTYLIILSLAYN  136



>ref|XP_008339062.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=625

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G+ + L+ LY+ DN L G +P+ +G LT L  L L++N L+GEIP+ +G L  
Sbjct  75   GEIPQSLGKLTQLQQLYLSDNHLTGEIPQSLGKLTQLQQLYLSDNHLTGEIPQSLGKLTQ  134

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L NN+L G IP+++ N+S L  ++++ N
Sbjct  135  LQQLYLSNNHLTGEIPQSLGNLSRLQRLDLSAN  167


 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G+ + L+ LY+ DN L G +P+ +G LT L  L L++N L+GEIP+ +G L  
Sbjct  51   GEIPQSLGKLTQLQQLYLSDNHLTGEIPQSLGKLTQLQQLYLSDNHLTGEIPQSLGKLTQ  110

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +N+L G IP+++  ++ L  + ++NN
Sbjct  111  LQQLYLSDNHLTGEIPQSLGKLTQLQQLYLSNN  143


 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G+ + L+ LY+ DN L G +P+ +G LT L  L L+ N L+GEIP+ +GNL+ 
Sbjct  99   GEIPQSLGKLTQLQQLYLSDNHLTGEIPQSLGKLTQLQQLYLSNNHLTGEIPQSLGNLSR  158

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L  NN  G IP  I  ++ L ++N+++N
Sbjct  159  LQRLDLSANNFTGVIPR-ISGLTGLYFLNLSSN  190


 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G+ + L YL++ DN L G +P+ +G LT L  L L +N L+GEIP+ +G L  
Sbjct  3    GEIPQSLGKLTQLYYLHLSDNHLTGEIPQSLGKLTQLWGLYLDDNHLTGEIPQSLGKLTQ  62

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +N+L G IP+++  ++ L  + +++N
Sbjct  63   LQQLYLSDNHLTGEIPQSLGKLTQLQQLYLSDN  95


 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G+ + L  LY+ DN L G +P+ +G LT L  L L++N L+GEIP+ +G L  
Sbjct  27   GEIPQSLGKLTQLWGLYLDDNHLTGEIPQSLGKLTQLQQLYLSDNHLTGEIPQSLGKLTQ  86

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +N+L G IP+++  ++ L  + +++N
Sbjct  87   LQQLYLSDNHLTGEIPQSLGKLTQLQQLYLSDN  119


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            + G +P+ +G LT L  L L++N L+GEIP+ +G L  L  L LD+N+L G IP+++  +
Sbjct  1    MTGEIPQSLGKLTQLYYLHLSDNHLTGEIPQSLGKLTQLWGLYLDDNHLTGEIPQSLGKL  60

Query  35   STLTYINMANN  3
            + L  + +++N
Sbjct  61   TQLQQLYLSDN  71



>ref|XP_010268541.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nelumbo nucifera]
Length=1174

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +G   +L  L + +N LNG++P  IGN ++L  L    N+L G IP EIG+L  
Sbjct  200  GGVPRELGMLPNLRVLAIANNSLNGTIPPSIGNSSLLEVLSFYSNNLQGSIPWEIGDLLN  259

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ LRLDNN L GTIP TIFNISTL Y  + NN
Sbjct  260  LRELRLDNNQLTGTIPSTIFNISTLQYFYLTNN  292


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 60/118 (51%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+  C  LE L +  N   GSLPREIG+L+ L  + + +N L+G IP  IGNL+ 
Sbjct  321  GPIPSSLCRCGRLEVLSLRANNFTGSLPREIGSLSNLKYIVVYQNFLTGTIPPSIGNLSN  380

Query  101  LQILRLDNN-------------------------NLEGTIPETIFNISTLTYINMANN  3
            L IL L  N                         +L G+IPE IFNISTL  +++  N
Sbjct  381  LVILDLSENYLVGKNIPRELGYLQNLQCLNFRACSLTGSIPEEIFNISTLESVDLGYN  438


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I     L+ L    N L GS+P EI +LT L NL+L  N LSG+IP  IGNL +
Sbjct  595  GTIPSTIQGLKKLQGLSFEGNNLQGSIPNEICSLTKLVNLKLLGNKLSGQIPNCIGNLRV  654

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L + +N L   IP +++ I  L ++NM++N
Sbjct  655  LQNLYIQSNMLTSPIPLSLWTIPDLLFLNMSDN  687


 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG  S LE L  + N L GS+P EIG+L  L  L+L  N L+G IP  I N++ 
Sbjct  224  GTIPPSIGNSSLLEVLSFYSNNLQGSIPWEIGDLLNLRELRLDNNQLTGTIPSTIFNIST  283

Query  101  LQILRLDNNNLEGTIPETI-FNISTLTYINMANN  3
            LQ   L NN+L G +P  I ++   L Y+ +  N
Sbjct  284  LQYFYLTNNSLSGGLPMNIGYSFPNLVYLYLGMN  317


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP S+     L +L M DN L+ SLP  +GNL  L  L ++ N L G IP  IG+L  L 
Sbjct  669  IPLSLWTIPDLLFLNMSDNSLHESLPAAVGNLETLVQLDISRNQLFGSIPSTIGDLQRLN  728

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINM  12
             L L  N+ +G +PE++ N+ +L Y+++
Sbjct  729  HLSLSRNSFQGPLPESLGNMVSLEYLDL  756


 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G  S L+ + +  NQ +G +P  + N   L  + L+ N L+G +PRE+G L  
Sbjct  152  GHLPNGLGHLSRLKRIDLSRNQFDGMIPPSLSNCRKLEEISLSLNQLTGGVPRELGMLPN  211

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L + NN+L GTIP +I N S L  ++  +N
Sbjct  212  LRVLAIANNSLNGTIPPSIGNSSLLEVLSFYSN  244


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            ++P ++G   +L  L +  NQL GS+P  IG+L  LN+L L+ NS  G +P  +GN+  L
Sbjct  692  SLPAAVGNLETLVQLDISRNQLFGSIPSTIGDLQRLNHLSLSRNSFQGPLPESLGNMVSL  751

Query  98   QILRLDNNNLEGTIPETI  45
            + L L+ NNL G+IP+++
Sbjct  752  EYLDLNFNNLSGSIPKSM  769


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN-LNM  102
            NIPR +G   +L+ L      L GS+P EI N++ L ++ L  N LSG +P  +G+ LN 
Sbjct  395  NIPRELGYLQNLQCLNFRACSLTGSIPEEIFNISTLESVDLGYNRLSGHLPSNMGHSLNQ  454

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L+NN+L G IP +I N S L  + ++ N
Sbjct  455  LEELNLNNNSLSGPIPASISNASQLITLCLSRN  487


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P S+G  S SL  L M   Q+ GS+P+ IGNL+ L  L    N +SG IP  I  L 
Sbjct  546  GILPESLGNLSASLRKLAMEGCQIRGSIPKGIGNLSSLIALGFDYNDISGTIPSTIQGLK  605

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L  + NNL+G+IP  I +++ L  + +  N
Sbjct  606  KLQGLSFEGNNLQGSIPNEICSLTKLVNLKLLGN  639


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIG-ECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P +IG    +L YLY+  NQ  G +P  +     L  L L  N+ +G +PREIG+L+
Sbjct  296  GGLPMNIGYSFPNLVYLYLGMNQFGGPIPSSLCRCGRLEVLSLRANNFTGSLPREIGSLS  355

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ + +  N L GTIP +I N+S L  ++++ N
Sbjct  356  NLKYIVVYQNFLTGTIPPSIGNLSNLVILDLSEN  389


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+  C  LE L +  N LNG LP  +GNL+  L  L +    + G IP+ IGNL+ L  L
Sbjct  527  SLTNCRFLEVLNVDHNWLNGILPESLGNLSASLRKLAMEGCQIRGSIPKGIGNLSSLIAL  586

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
              D N++ GTIP TI  +  L  ++   N
Sbjct  587  GFDYNDISGTIPSTIQGLKKLQGLSFEGN  615


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG  SSL  L    N ++G++P  I  L  L  L    N+L G IP EI +L  
Sbjct  571  GSIPKGIGNLSSLIALGFDYNDISGTIPSTIQGLKKLQGLSFEGNNLQGSIPNEICSLTK  630

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L  N L G IP  I N+  L  + + +N
Sbjct  631  LVNLKLLGNKLSGQIPNCIGNLRVLQNLYIQSN  663


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = -1

Query  281  GNIPRSIGEC-SSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P ++G   + LE L + +N L+G +P  I N + L  L L+ NS SG +P  +GNL 
Sbjct  442  GHLPSNMGHSLNQLEELNLNNNSLSGPIPASISNASQLITLCLSRNSFSGPVPTSLGNLQ  501

Query  104  MLQILRLDNNNL--EGTIPETIFNISTLT  24
             LQIL L +N+L  +   PE +F +S+LT
Sbjct  502  QLQILILAHNDLTSQPDSPELVF-LSSLT  529


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG    L+ LY+  N L   +P  +  +  L  L +++NSL   +P  +GNL  
Sbjct  643  GQIPNCIGNLRVLQNLYIQSNMLTSPIPLSLWTIPDLLFLNMSDNSLHESLPAAVGNLET  702

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L +  N L G+IP TI ++  L +++++ N
Sbjct  703  LVQLDISRNQLFGSIPSTIGDLQRLNHLSLSRN  735


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I   + L  L +  N+L+G +P  IGNL +L NL +  N L+  IP  +  +  
Sbjct  619  GSIPNEICSLTKLVNLKLLGNKLSGQIPNCIGNLRVLQNLYIQSNMLTSPIPLSLWTIPD  678

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L + +N+L  ++P  + N+ TL  ++++ N
Sbjct  679  LLFLNMSDNSLHESLPAAVGNLETLVQLDISRN  711


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG+   L +L +  N   G LP  +GN+  L  L L  N+LSG IP+ +  L++
Sbjct  715  GSIPSTIGDLQRLNHLSLSRNSFQGPLPESLGNMVSLEYLDLNFNNLSGSIPKSMEKLSL  774

Query  101  LQILRLDNNNLEGTIP  54
            L  L L +N+L+G IP
Sbjct  775  LSYLNLSHNSLKGEIP  790



>ref|XP_006465459.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like isoform X1 [Citrus sinensis]
Length=548

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR     + LE + + DN L G +P+E+GNL  L  LQL +N+L+GEIP EIGNL  
Sbjct  164  GEIPREFSNLADLERMSLGDNNLQGGIPQELGNLAKLEGLQLLQNNLTGEIPLEIGNLQN  223

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINM  12
            L+ L+L  N L GT+P  IFN+STL ++ +
Sbjct  224  LEELQLGQNKLIGTVPAAIFNVSTLKFLGL  253


 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            N+CS L  LE L+L +N  +G IP ++  C+ L  L +  N  +G++PREIGNLT L  L
Sbjct  96   NICSNLPFLEILFLSENMFHGEIPSALSNCTYLIILSLAYNDFSGAVPREIGNLTKLREL  155

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L GEIPRE  NL  L+ + L +NNL+G IP+ + N++ L  + +  N
Sbjct  156  YLGCNRLQGEIPREFSNLADLERMSLGDNNLQGGIPQELGNLAKLEGLQLLQN  208


 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 5/86 (6%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE LY+W N  +G++PR I N + L+ L L  NS SG IP   GNL  L+ L LD N L 
Sbjct  273  LEKLYLWGNNFSGTIPRFIFNASKLSKLSLGMNSFSGFIPSTFGNLRNLEQLGLDENYLT  332

Query  65   GTIPETIF-----NISTLTYINMANN  3
             + PE  F     N  +LT I+++NN
Sbjct  333  SSTPELSFLSSLSNCKSLTLIDLSNN  358


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 57/118 (48%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L +  N L G +P EIGNL  L  LQL +N L G +P  I N++ 
Sbjct  188  GGIPQELGNLAKLEGLQLLQNNLTGEIPLEIGNLQNLEELQLGQNKLIGTVPAAIFNVST  247

Query  101  LQIL-----------------RLDN--------NNLEGTIPETIFNISTLTYINMANN  3
            L+ L                 RL N        NN  GTIP  IFN S L+ +++  N
Sbjct  248  LKFLGLQNNSLSGSLSSIANVRLPNLEKLYLWGNNFSGTIPRFIFNASKLSKLSLGMN  305


 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNL  69
            SLE  YM++  ++G +P EI NLT L  + L  N L+G IP  +G L  LQ L L++N L
Sbjct  375  SLEEFYMYNCNISGGIPEEISNLTNLVEIDLGGNKLNGSIPITLGKLRKLQRLNLEDNIL  434

Query  68   EGTIPETIFNISTLTYINMANN  3
            EG+IP+ I  ++ L  + + +N
Sbjct  435  EGSIPDDICRLAELYRLELGSN  456


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   ++L  + +  N+LNGS+P  +G L  L  L L +N L G IP +I  L  
Sbjct  388  GGIPEEISNLTNLVEIDLGGNKLNGSIPITLGKLRKLQRLNLEDNILEGSIPDDICRLAE  447

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G+IP    N+++L  +++ +N
Sbjct  448  LYRLELGSNKLYGSIPACFGNLASLRILSLCSN  480


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L + DN L GS+P +I  L  L  L+L  N L G IP   GNL  
Sbjct  412  GSIPITLGKLRKLQRLNLEDNILEGSIPDDICRLAELYRLELGSNKLYGSIPACFGNLAS  471

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L  +IP T +N+  + ++  + N
Sbjct  472  LRILSLCSNELT-SIPLTFWNLKDILHLYFSLN  503


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-GNLN  105
            G IP  +G  SSL+ L +  N+L+GS+P  I     L ++ L EN LSG+IP  I  NL 
Sbjct  43   GTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKHVSLGENQLSGQIPTNICSNLP  102

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+IL L  N   G IP  + N + L  +++A N
Sbjct  103  FLEILFLSENMFHGEIPSALSNCTYLIILSLAYN  136


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP   G  +SL  L +  N+L  S+P    NL  + +L  + N  +G +P EIGNL +
Sbjct  460  GSIPACFGNLASLRILSLCSNELT-SIPLTFWNLKDILHLYFSLNFFTGPLPLEIGNLKV  518

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L  +    NN  G IP  I  +  L Y+
Sbjct  519  LIGIDFSMNNFSGVIPREIGGLKNLEYL  546



>ref|XP_010030330.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=412

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  +SL +LY+ +NQL+GS+P EIGNLT L NL L  N LSG IP EIGNL  
Sbjct  245  GSIPLEIGNLTSLIHLYLQENQLSGSIPLEIGNLTSLTNLYLGGNQLSGSIPPEIGNLRS  304

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L+ +IP  I N+ +LTY++   N
Sbjct  305  LAYLDLQGNQLDRSIPLEIGNLRSLTYLDFQGN  337


 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG  ++L  L +  NQL GS+P EIGNLT L +L L EN LSG IP EIGNL  
Sbjct  221  GPIPSSIGNLTNLTDLDLRGNQLCGSIPLEIGNLTSLIHLYLQENQLSGSIPLEIGNLTS  280

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP  I N+ +L Y+++  N
Sbjct  281  LTNLYLGGNQLSGSIPPEIGNLRSLAYLDLQGN  313


 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  +SL  LY+  NQL+GS+P EIGNL  L  L L  N L   IP EIGNL  
Sbjct  269  GSIPLEIGNLTSLTNLYLGGNQLSGSIPPEIGNLRSLAYLDLQGNQLDRSIPLEIGNLRS  328

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L    N L G+IP  I N+ +LT +++  N
Sbjct  329  LTYLDFQGNKLGGSIPPEIGNLRSLTDLDLGGN  361


 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL YL +  NQL+ S+P EIGNL  L  L    N L G IP EIGNL  
Sbjct  293  GSIPPEIGNLRSLAYLDLQGNQLDRSIPLEIGNLRSLTYLDFQGNKLGGSIPPEIGNLRS  352

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+I   I N+ +L Y+++  N
Sbjct  353  LTDLDLGGNQLGGSISPEIGNLRSLAYLDLQGN  385


 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG   SL YL    N+L GS+P EIGNL  L +L L  N L G I  EIGNL  L
Sbjct  318  SIPLEIGNLRSLTYLDFQGNKLGGSIPPEIGNLRSLTDLDLGGNQLGGSISPEIGNLRSL  377

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L  N L  +IP  I N++  TY+ M  N
Sbjct  378  AYLDLQGNRLGESIPPEIGNLTNSTYLEMQGN  409


 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G  + ++Y+ +  N   G +P  IGNLT L +L L  N L G IP EIGNL  
Sbjct  197  GSIPLELGNLAQMDYVDLSFNYFIGPIPSSIGNLTNLTDLDLRGNQLCGSIPLEIGNLTS  256

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP  I N+++LT + +  N
Sbjct  257  LIHLYLQENQLSGSIPLEIGNLTSLTNLYLGGN  289


 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P +IG   +L +L    N+LNGS+P E+GNL  ++ + L+ N   G IP  IGNL  
Sbjct  173  GVVPPTIGCLHNLRFLRFRSNKLNGSIPLELGNLAQMDYVDLSFNYFIGPIPSSIGNLTN  232

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP  I N+++L ++ +  N
Sbjct  233  LTDLDLRGNQLCGSIPLEIGNLTSLIHLYLQEN  265


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +   + L+ L +  N ++GS+P E+GNL  LN L L  N L+G +P  IG L+ 
Sbjct  125  GELPPCVQNLTRLQILNISGNYISGSIPPELGNLERLNTLNLEFNLLNGVVPPTIGCLHN  184

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ LR  +N L G+IP  + N++ + Y++++ N
Sbjct  185  LRFLRFRSNKLNGSIPLELGNLAQMDYVDLSFN  217


 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  I   S L YL +  N L G LP  + NLT L  L ++ N +SG IP E+GNL  
Sbjct  101  GRMPLQICTLSRLTYLDLSSNFLYGELPPCVQNLTRLQILNISGNYISGSIPPELGNLER  160

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N L G +P TI  +  L ++   +N
Sbjct  161  LNTLNLEFNLLNGVVPPTIGCLHNLRFLRFRSN  193


 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G    L  L +  N LNG +P  IG L  L  L+   N L+G IP E+GNL  
Sbjct  149  GSIPPELGNLERLNTLNLEFNLLNGVVPPTIGCLHNLRFLRFRSNKLNGSIPLELGNLAQ  208

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  + L  N   G IP +I N++ LT +++  N
Sbjct  209  MDYVDLSFNYFIGPIPSSIGNLTNLTDLDLRGN  241


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNL  69
            S  +L +  N+L G +P +I  L+ L  L L+ N L GE+P  + NL  LQIL +  N +
Sbjct  88   SFTFLDVPHNKLVGRMPLQICTLSRLTYLDLSSNFLYGELPPCVQNLTRLQILNISGNYI  147

Query  68   EGTIPETIFNISTLTYINMANN  3
             G+IP  + N+  L  +N+  N
Sbjct  148  SGSIPPELGNLERLNTLNLEFN  169


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 37/71 (52%), Gaps = 0/71 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L +  NQL GS+  EIGNL  L  L L  N L   IP EIGNL  
Sbjct  341  GSIPPEIGNLRSLTDLDLGGNQLGGSISPEIGNLRSLAYLDLQGNRLGESIPPEIGNLTN  400

Query  101  LQILRLDNNNL  69
               L +  N L
Sbjct  401  STYLEMQGNQL  411



>gb|KCW56528.1| hypothetical protein EUGRSUZ_I02256 [Eucalyptus grandis]
Length=516

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQ-LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP SIG  S+L YLY+ DNQ L+GS+P EIGNL  L +L L+ N+ SGEIP E G+L 
Sbjct  163  GTIPSSIGNLSNLTYLYLSDNQFLSGSVPSEIGNLKSLAHLDLSSNNFSGEIPVEFGHLT  222

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L LDN++L GTIP +I N+  L  ++++ N
Sbjct  223  ALIDLYLDNDSLSGTIPPSIGNLKRLAELDLSLN  256


 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   S L  L +  N L+G LP  +GNLTML  L L  N L G IP E+G L  
Sbjct  91   GRIPLQICALSRLARLDLSGNSLSGELPPCLGNLTMLEELDLQHNQLRGPIPPELGTLKR  150

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL GTIP +I N+S LTY+ +++N
Sbjct  151  LVRLFLGYNNLNGTIPSSIGNLSNLTYLYLSDN  183


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  ++L  LY+ ++ L+G++P  IGNL  L  L L+ N+ SGEIP E G+L  
Sbjct  212  GEIPVEFGHLTALIDLYLDNDSLSGTIPPSIGNLKRLAELDLSLNNFSGEIPIEFGHLTA  271

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L    LDNN+L GTIP +I N+  L  ++++ N
Sbjct  272  LIDFYLDNNSLSGTIPPSIGNLKCLAELDLSLN  304


 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  ++L   Y+ +N L+G++P  IGNL  L  L L+ N+ SGEIP E G L  
Sbjct  260  GEIPIEFGHLTALIDFYLDNNSLSGTIPPSIGNLKCLAELDLSLNNFSGEIPVEFGRLTA  319

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               L L NN L GTIP ++     L  IN+++N
Sbjct  320  WYDLDLHNNCLSGTIPGSLIEHLHLRSINLSHN  352


 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG    L  L +  N  +G +P E G+LT L +  L  NSLSG IP  IGNL  
Sbjct  236  GTIPPSIGNLKRLAELDLSLNNFSGEIPIEFGHLTALIDFYLDNNSLSGTIPPSIGNLKC  295

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NN  G IP     ++    +++ NN
Sbjct  296  LAELDLSLNNFSGEIPVEFGRLTAWYDLDLHNN  328



>gb|KDO39219.1| hypothetical protein CISIN_1g045487mg, partial [Citrus sinensis]
Length=729

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  SSL+ L +  N  +G++PREIGNLT L  L+L  N L GEIP E+GNL  
Sbjct  86   GTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAE  145

Query  101  LQILRLDNNNLEGTIPETIFNISTL-TYINMANN  3
            L++L L+NN L GTIP +IFN+S++ T ++ +NN
Sbjct  146  LEVLVLNNNLLTGTIPASIFNLSSISTGLDFSNN  179


 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  + +  NQ  G +PR++GN T L +L L  N+L GEIP+EIGNL  
Sbjct  330  GPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRN  389

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL +D +NL G +P+TI NISTL  +++ NN
Sbjct  390  LEILGIDQSNLVGFVPDTILNISTLKILSLFNN  422


 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L    +  NQ  G LPR++GNLT L +L L  N+L GEIP E+GNL  
Sbjct  208  GPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAE  267

Query  101  LQILRLDNNNLEGTIPETIFNIST-LTYINMANN  3
            L++L L +N L G IP +IFN+S+ LT ++  NN
Sbjct  268  LEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNN  301


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  S S+E +YM+   ++G +P+EIG+L  L  L L +N+LSG +P  +G L 
Sbjct  530  GVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLK  589

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L NN  EG IP+   + S L  ++M  N
Sbjct  590  KLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGN  623


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P ++G    L+ LY+ +N+  G +P+E  + + L  + +  N LSG IP  +G+LN 
Sbjct  579  GSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDLNS  638

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L   IP T +N+  +   + ++N
Sbjct  639  LRILSLSSNELTSIIPSTFWNLEDILSFDFSSN  671


 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  224  DNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
            D  L G++P  +GNL+ L  L L+ N  SG IPREIGNL  L+ LRL  N L+G IPE +
Sbjct  81   DLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEEL  140

Query  44   FNISTLTYINMANN  3
             N++ L  + + NN
Sbjct  141  GNLAELEVLVLNNN  154


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   +L  L + DN L+GSLP  +G L  L  L L  N   G IP+E  + + 
Sbjct  555  GRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSR  614

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + ++ N L G+IP  + ++++L  +++++N
Sbjct  615  LYEVDMNGNKLSGSIPSCLGDLNSLRILSLSSN  647


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + L+ L++  N L G +P+EIGNL  L  L + +++L G +P  I N++ 
Sbjct  354  GRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNIST  413

Query  101  LQILRLDNNNLEGTIPET  48
            L+IL L NN   G +P +
Sbjct  414  LKILSLFNNTFSGNLPSS  431


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G+ +SL  L +  N+L   +P    NL  + +   + NSL+G +P EIGNL  
Sbjct  627  GSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKA  686

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  + L  N L G IP TI  +  L  +++ +N
Sbjct  687  VVNIDLSWNRLSGNIPSTIVGLKNLQRLSLKHN  719


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G+ P  + E    L+ LY+  NQ  G +P  + +   L++  L+ N  +G +PR++GNL 
Sbjct  183  GSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLT  242

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L  NNL G IPE + N++ L  + + +N
Sbjct  243  RLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSN  276



>emb|CDP19964.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  + +CS L+ L ++ N+ +G +P   GNLTML+ L L  N LSG IP ++G+L +
Sbjct  169  GVLPAQLTQCSKLQNLSIYSNKFSGVIPEGFGNLTMLDELDLGSNELSGSIPPKLGHLKL  228

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +++L L NN+L G+IP  IFNIS+L  +++ NN
Sbjct  229  MELLSLSNNSLTGSIPTQIFNISSLQVLDLMNN  261


 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  + L+ L +  N+L+GS+P ++G+L ++  L L+ NSL+G IP +I N++ 
Sbjct  193  GVIPEGFGNLTMLDELDLGSNELSGSIPPKLGHLKLMELLSLSNNSLTGSIPTQIFNISS  252

Query  101  LQILRLDNNNLEGTIPETI  45
            LQ+L L NN+  G IP  +
Sbjct  253  LQVLDLMNNSFSGNIPSIV  271


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L M  N   G LP E+ +L  L  L LT+N L G IP  +G+L  
Sbjct  38   GTIPPQLGNPSFLVSLDMSWNNFQGELPHELTHLRRLRVLNLTDNKLGGSIPSWVGSLQK  97

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L    L NN+  G+IP +I N+S L
Sbjct  98   LHYFSLKNNSFAGSIPPSISNMSNL  122


 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G+IP  +G    +E L + +N L GS+P +I N++ L  L L  NS SG IP  +G  L 
Sbjct  217  GSIPPKLGHLKLMELLSLSNNSLTGSIPTQIFNISSLQVLDLMNNSFSGNIPSIVGYGLM  276

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L+ N  +G IP++I N+S L+ + +  N
Sbjct  277  NLEELYLNVNKFDGVIPDSISNVSQLSILQLVGN  310


 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G++P ++GN + L +L ++ N+  GE+P E+ +L  L++L L +N L G+IP  + ++
Sbjct  36   LTGTIPPQLGNPSFLVSLDMSWNNFQGELPHELTHLRRLRVLNLTDNKLGGSIPSWVGSL  95

Query  35   STLTYINMANN  3
              L Y ++ NN
Sbjct  96   QKLHYFSLKNN  106


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -1

Query  281  GNIPRSIGE-CSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            GNIP  +G    +LE LY+  N+ +G +P  I N++ L+ LQL  N  SG IP  +G+L 
Sbjct  265  GNIPSIVGYGLMNLEELYLNVNKFDGVIPDSISNVSQLSILQLVGNKFSGPIPNSLGDLR  324

Query  104  MLQILRLDNNNLEGTIPET  48
            +L  L L   NL G  P+T
Sbjct  325  LLTSLDLA-GNLTGAEPQT  342



>ref|XP_006495104.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
[Citrus sinensis]
Length=116

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  + +  NQ  G +PR++GN T L  L L+ N+L GEIP+EIG+L  
Sbjct  20   GPIPNNLWHCKELSRVSLSFNQFTGRIPRDLGNSTKLKLLYLSFNNLIGEIPQEIGSLRN  79

Query  101  LQILRLDNNNLEGTIPETIFNIST--LTYINMA  9
            L+ILR+D NNL G IP+TIFN+ST  + YI + 
Sbjct  80   LEILRIDQNNLVGFIPDTIFNMSTSAVPYIRLG  112



>ref|XP_006465460.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like isoform X2 [Citrus sinensis]
Length=548

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR     + LE + + DN L G +P+E+GNL  L  LQL +N+L+GEIP EIGNL  
Sbjct  164  GEIPREFSNLADLERMSLGDNNLQGGIPQELGNLAKLEGLQLLQNNLTGEIPLEIGNLQN  223

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINM  12
            L+ L+L  N L GT+P  IFN+STL ++ +
Sbjct  224  LEELQLGQNKLIGTVPAAIFNVSTLKFLGL  253


 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            N+CS L  LE L+L +N  +G IP ++  C+ L  L +  N  +G++PREIGNLT L  L
Sbjct  96   NICSNLPFLEILFLSENMFHGEIPSALSNCTYLIILSLAYNDFSGAVPREIGNLTKLREL  155

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  N L GEIPRE  NL  L+ + L +NNL+G IP+ + N++ L  + +  N
Sbjct  156  YLGCNRLQGEIPREFSNLADLERMSLGDNNLQGGIPQELGNLAKLEGLQLLQN  208


 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 5/86 (6%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE LY+W N  +G++PR I N + L+ L L  NS SG IP   GNL  L+ L LD N L 
Sbjct  273  LEKLYLWGNNFSGTIPRFIFNASKLSKLSLGMNSFSGFIPSTFGNLRNLEQLGLDENYLT  332

Query  65   GTIPETIF-----NISTLTYINMANN  3
             + PE  F     N  +LT I+++NN
Sbjct  333  SSTPELSFLSSLSNCKSLTLIDLSNN  358


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 57/118 (48%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  + LE L +  N L G +P EIGNL  L  LQL +N L G +P  I N++ 
Sbjct  188  GGIPQELGNLAKLEGLQLLQNNLTGEIPLEIGNLQNLEELQLGQNKLIGTVPAAIFNVST  247

Query  101  LQIL-----------------RLDN--------NNLEGTIPETIFNISTLTYINMANN  3
            L+ L                 RL N        NN  GTIP  IFN S L+ +++  N
Sbjct  248  LKFLGLQNNSLSGSLSSIANVRLPNLEKLYLWGNNFSGTIPRFIFNASKLSKLSLGMN  305


 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNL  69
            SLE  YM++  ++G +P EI NLT L  + L  N L+G IP  +G L  LQ L L++N L
Sbjct  375  SLEEFYMYNCNISGGIPEEISNLTNLVEIDLGGNKLNGSIPITLGKLRKLQRLNLEDNIL  434

Query  68   EGTIPETIFNISTLTYINMANN  3
            EG+IP+ I  ++ L  + + +N
Sbjct  435  EGSIPDDICRLAELYRLELGSN  456


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G+   L+ L + DN L GS+P +I  L  L  L+L  N L G IP   GNL  
Sbjct  412  GSIPITLGKLRKLQRLNLEDNILEGSIPDDICRLAELYRLELGSNKLYGSIPACFGNLAS  471

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L  +IP T +N+  + ++  + N
Sbjct  472  LRILSLCSNELT-SIPLTFWNLKDILHLYFSLN  503


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I   ++L  + +  N+LNGS+P  +G L  L  L L +N L G IP +I  L  
Sbjct  388  GGIPEEISNLTNLVEIDLGGNKLNGSIPITLGKLRKLQRLNLEDNILEGSIPDDICRLAE  447

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G+IP    N+++L  +++ +N
Sbjct  448  LYRLELGSNKLYGSIPACFGNLASLRILSLCSN  480


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-GNLN  105
            G IP  +G  SSL+ L +  N+L+GS+P  I     L ++ L EN LSG+IP  I  NL 
Sbjct  43   GTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKHVSLGENQLSGQIPTNICSNLP  102

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+IL L  N   G IP  + N + L  +++A N
Sbjct  103  FLEILFLSENMFHGEIPSALSNCTYLIILSLAYN  136


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP   G  +SL  L +  N+L  S+P    NL  + +L  + N  +G +P EIGNL +
Sbjct  460  GSIPACFGNLASLRILSLCSNELT-SIPLTFWNLKDILHLYFSLNFFTGPLPLEIGNLKV  518

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L  +    NN  G IP  I  +  L Y+
Sbjct  519  LIGIDFSMNNFSGVIPREIGGLKNLEYL  546



>ref|XP_008372587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Malus domestica]
Length=863

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G+ + L+ LY+ DN L G +P+ +G LT L  L L +N L+GEIP+ +GNL+ 
Sbjct  254  GEIPQSLGKLTQLQGLYLSDNHLTGEIPQSLGKLTQLQQLYLFDNHLTGEIPQSLGNLSQ  313

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L LD N+L G IP+++  ++ L  ++++ N
Sbjct  314  LQVLYLDQNHLTGEIPQSLGKLTQLQALDLSAN  346


 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G  S L+ LY+ DN L G +P+ +G LT L  L L++N L+GEIP+ +G L  
Sbjct  206  GEIPQSLGNLSQLQVLYLDDNHLTGEIPQSLGKLTQLRQLSLSDNHLTGEIPQSLGKLTQ  265

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +N+L G IP+++  ++ L  + + +N
Sbjct  266  LQGLYLSDNHLTGEIPQSLGKLTQLQQLYLFDN  298


 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G+ + L  L + DN L G +P+ +G LT L  L L++N L+GEIP+ +G L  
Sbjct  230  GEIPQSLGKLTQLRQLSLSDNHLTGEIPQSLGKLTQLQGLYLSDNHLTGEIPQSLGKLTQ  289

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +N+L G IP+++ N+S L  + +  N
Sbjct  290  LQQLYLFDNHLTGEIPQSLGNLSQLQVLYLDQN  322


 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G+ + L+ LY++DN L G +P+ +GNL+ L  L L +N L+GEIP+ +G L  
Sbjct  278  GEIPQSLGKLTQLQQLYLFDNHLTGEIPQSLGNLSQLQVLYLDQNHLTGEIPQSLGKLTQ  337

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L  N+  G IP  I  +  L  ++++NN
Sbjct  338  LQALDLSANSFTGVIPR-ISGMLDLRLLSLSNN  369


 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 61/96 (64%), Gaps = 4/96 (4%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G  S L+ LY+  N L G +P+ +G LT L  L L+ NS +G IPR  G L+ 
Sbjct  302  GEIPQSLGNLSQLQVLYLDQNHLTGEIPQSLGKLTQLQALDLSANSFTGVIPRISGMLD-  360

Query  101  LQILRLDNNNLEGTIPETIF---NISTLTYINMANN  3
            L++L L NNNL G IP  +F    ++ L Y+N+++N
Sbjct  361  LRLLSLSNNNLTGVIPIHLFLAVGLTGLVYLNLSSN  396


 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I   IG  + L+YL ++ N+ NG +P+ +GNL+ L  L L +N L+GEIP+ +G L  
Sbjct  182  GTISAEIGLLTQLQYLRLYSNEFNGEIPQSLGNLSQLQVLYLDDNHLTGEIPQSLGKLTQ  241

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N+L G IP+++  ++ L  + +++N
Sbjct  242  LRQLSLSDNHLTGEIPQSLGKLTQLQGLYLSDN  274


 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  +   + L  LY+ DN  +G++  EIG LT L  L+L  N  +GEIP+ +GNL+ LQ
Sbjct  160  LPSLVSNWTELVSLYLQDNSFSGTISAEIGLLTQLQYLRLYSNEFNGEIPQSLGNLSQLQ  219

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +L LD+N+L G IP+++  ++ L  +++++N
Sbjct  220  VLYLDDNHLTGEIPQSLGKLTQLRQLSLSDN  250


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG+   L  L +  N LN S+P E G  T L  L L+ N L+GE+P  + NL  
Sbjct  85   GKIPPSIGKLRELRSLDLSYNSLNSSIPSEFGLCTNLTYLSLSSNKLNGELPLSLSNLKN  144

Query  101  LQILRLDNNNLEGTI-PETIFNISTLTYINMANN  3
            L  LRLDNN   G I P  + N + L  + + +N
Sbjct  145  LVELRLDNNLFIGQILPSLVSNWTELVSLYLQDN  178


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWD-------NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPR  123
            G IP +IG  SSL  L + +       NQ +G +P  IG ++ L ++ L+ N L G+IP 
Sbjct  30   GPIPSAIGNLSSLTTLDLGNKFYEETHNQFSGPIPDNIGLISGLQHIDLSWNLLEGKIPP  89

Query  122  EIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             IG L  L+ L L  N+L  +IP      + LTY+++++N
Sbjct  90   SIGKLRELRSLDLSYNSLNSSIPSEFGLCTNLTYLSLSSN  129



>emb|CDP18613.1| unnamed protein product [Coffea canephora]
Length=995

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  SSL++LY++ N L G++P+ +GNLT L  L L++N L+G IP  IGNL+ 
Sbjct  238  GSIPISIGNLSSLQFLYLYQNNLTGAIPKSLGNLTKLIELDLSDNQLNGSIPTSIGNLST  297

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L +N   G+IP T  N++ L  +++A N
Sbjct  298  LKVLHLGSNQFSGSIPATFGNLNRLVELDLAFN  330


 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G  ++L  LY+++NQL+GS+ +E+G+L  L +++L EN L+G IP  IGNL+ 
Sbjct  190  GAIPKSLGNLTNLIILYLYENQLSGSIFKEVGDLKFLTDMELGENQLNGSIPISIGNLSS  249

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L  NNL G IP+++ N++ L  +++++N
Sbjct  250  LQFLYLYQNNLTGAIPKSLGNLTKLIELDLSDN  282


 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG  S L YL  W N+L+G +P EI NL  L +L    N LSG IP  +GNL  
Sbjct  118  GSIPKQIGNLSKLIYLDFWANELSGKIPPEICNLRNLTHLDFESNQLSGPIPVVMGNLIS  177

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L  NNL G IP+++ N++ L  + +  N
Sbjct  178  LQFLYLCQNNLTGAIPKSLGNLTNLIILYLYEN  210


 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+I + +G+   L  + + +NQLNGS+P  IGNL+ L  L L +N+L+G IP+ +GNL  
Sbjct  214  GSIFKEVGDLKFLTDMELGENQLNGSIPISIGNLSSLQFLYLYQNNLTGAIPKSLGNLTK  273

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G+IP +I N+STL  +++ +N
Sbjct  274  LIELDLSDNQLNGSIPTSIGNLSTLKVLHLGSN  306


 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G   SL++LY+  N L G++P+ +GNLT L  L L EN LSG I +E+G+L  
Sbjct  166  GPIPVVMGNLISLQFLYLCQNNLTGAIPKSLGNLTNLIILYLYENQLSGSIFKEVGDLKF  225

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L  N L G+IP +I N+S+L ++ +  N
Sbjct  226  LTDMELGENQLNGSIPISIGNLSSLQFLYLYQN  258


 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+G  + L  L + DNQLNGS+P  IGNL+ L  L L  N  SG IP   GNLN 
Sbjct  262  GAIPKSLGNLTKLIELDLSDNQLNGSIPTSIGNLSTLKVLHLGSNQFSGSIPATFGNLNR  321

Query  101  LQILRLDNNNLEGTIPETI  45
            L  L L  N L G+IP +I
Sbjct  322  LVELDLAFNQLSGSIPVSI  340


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 63/115 (55%), Gaps = 22/115 (19%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN-  105
            G +  + G+C  L+ L +  N + GS+P EIGNLT L+ L L+ N +SGEIPRE+G L  
Sbjct  423  GKLSSNWGKCKMLKTLVVAKNNITGSIPLEIGNLTQLHTLNLSSNYISGEIPREVGKLTS  482

Query  104  ---------------------MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                                 +++ L L  N+L GT+PE + ++  L ++N++NN
Sbjct  483  LLKLDLHDNQLTGGIPQELGVLMEFLDLSTNSLNGTLPELLGDLKHLFHMNLSNN  537


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +G+   L ++ + +N L+  +P +IG LT L+ L L++N L+GEIP E  NL  
Sbjct  517  GTLPELLGDLKHLFHMNLSNNVLSQKIPLQIGKLTQLSELDLSQNLLTGEIPSEFQNLQN  576

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G IP+ +  +  L +IN++ N
Sbjct  577  LGTLDLSQNNLSGLIPKALAELPGLLHINLSFN  609


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LEYL +  NQ+ GS+P++IGNL+ L  L    N LSG+IP EI NL  L  L  ++N L 
Sbjct  106  LEYLDLSFNQIFGSIPKQIGNLSKLIYLDFWANELSGKIPPEICNLRNLTHLDFESNQLS  165

Query  65   GTIPETIFNISTLTYINMANN  3
            G IP  + N+ +L ++ +  N
Sbjct  166  GPIPVVMGNLISLQFLYLCQN  186


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G+ +SL  L + DNQL G +P+E+G   ++  L L+ NSL+G +P  +G+L  
Sbjct  471  GEIPREVGKLTSLLKLDLHDNQLTGGIPQELG--VLMEFLDLSTNSLNGTLPELLGDLKH  528

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L NN L   IP  I  ++ L+ ++++ N
Sbjct  529  LFHMNLSNNVLSQKIPLQIGKLTQLSELDLSQN  561


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  S+L+ L++  NQ +GS+P   GNL  L  L L  N LSG IP  IGNL+ 
Sbjct  286  GSIPTSIGNLSTLKVLHLGSNQFSGSIPATFGNLNRLVELDLAFNQLSGSIPVSIGNLSN  345

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L++L L  N   GTIP+ + N++ L
Sbjct  346  LELLSLGQNQCFGTIPQELGNLNKL  370


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+    G    L+++ + +NQ  G L    G   ML  L + +N+++G IP EIGNL  
Sbjct  399  GNLSEMFGIYPVLDFIDLSNNQFYGKLSSNWGKCKMLKTLVVAKNNITGSIPLEIGNLTQ  458

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N + G IP  +  +++L  +++ +N
Sbjct  459  LHTLNLSSNYISGEIPREVGKLTSLLKLDLHDN  491


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
             IP  IG+ + L  L +  N L G +P E  NL  L  L L++N+LSG IP+ +  L  L
Sbjct  542  KIPLQIGKLTQLSELDLSQNLLTGEIPSEFQNLQNLGTLDLSQNNLSGLIPKALAELPGL  601

Query  98   QILRLDNNNLEGTIP  54
              + L  NNLEG IP
Sbjct  602  LHINLSFNNLEGPIP  616


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 7/93 (8%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  S+LE L +  NQ  G++P+E+GNL  LN        L+G IP+ + N + 
Sbjct  334  GSIPVSIGNLSNLELLSLGQNQCFGTIPQELGNLNKLN-------MLTGPIPKSLQNCSS  386

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L   R D N+ +G + E       L +I+++NN
Sbjct  387  LVRARFDGNHFQGNLSEMFGIYPVLDFIDLSNN  419



>ref|XP_007021860.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY13385.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=859

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSI-GECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G++P  +     +LE ++ +DN+L+G+ P +IGN TML  L+L  N+ +G IP+EIGNL 
Sbjct  19   GSLPHDLCHRLPNLEKVFFYDNKLDGNFPADIGNCTMLQQLRLGRNNFTGVIPQEIGNLK  78

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ILRL  N+L G IP  IFN+STL  I++A+N
Sbjct  79   HLEILRLSINSLTGPIPPGIFNMSTLKEISLASN  112


 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 61/99 (62%), Gaps = 0/99 (0%)
 Frame = -1

Query  341  NMCSRlqkleelylyknklYGNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL  162
            ++C RL  LE+++ Y NKL GN P  IG C+ L+ L +  N   G +P+EIGNL  L  L
Sbjct  24   DLCHRLPNLEKVFFYDNKLDGNFPADIGNCTMLQQLRLGRNNFTGVIPQEIGNLKHLEIL  83

Query  161  QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETI  45
            +L+ NSL+G IP  I N++ L+ + L +N   G +P  I
Sbjct  84   RLSINSLTGPIPPGIFNMSTLKEISLASNYFSGNLPSDI  122


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP + G+   L  L +  N L GS+P   G++  +  L L+ N+LSG IP+ +  L+ 
Sbjct  389  GHIPHNFGDLKDLTSLSLAHNNLQGSIPESFGHMVSMEFLDLSSNNLSGVIPKSLERLSF  448

Query  101  LQILRLDNNNLEGTIPE--TIFNISTLTYIN  15
            L+ L +  N LEG IP      N S  ++IN
Sbjct  449  LKYLNVSFNTLEGEIPNGGPFGNFSARSFIN  479


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -1

Query  263  IGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRL  84
            IG    L  + +  N L G +P   G+L  L +L L  N+L G IP   G++  ++ L L
Sbjct  371  IGNLKVLTQIDLSKNTLVGHIPHNFGDLKDLTSLSLAHNNLQGSIPESFGHMVSMEFLDL  430

Query  83   DNNNLEGTIPETIFNISTLTYINMANN  3
             +NNL G IP+++  +S L Y+N++ N
Sbjct  431  SSNNLSGVIPKSLERLSFLKYLNVSFN  457


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  194  EIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYIN  15
            EIGNL +L  + L++N+L G IP   G+L  L  L L +NNL+G+IPE+  ++ ++ +++
Sbjct  370  EIGNLKVLTQIDLSKNTLVGHIPHNFGDLKDLTSLSLAHNNLQGSIPESFGHMVSMEFLD  429

Query  14   MANN  3
            +++N
Sbjct  430  LSSN  433



>gb|KCW48742.1| hypothetical protein EUGRSUZ_K02381 [Eucalyptus grandis]
Length=1120

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG+   L++LY+W NQL+GS+P EIG LT L +L  +EN L G IP  +GNL+ 
Sbjct  352  GPIPREIGDLRRLKFLYLWTNQLSGSIPAEIGRLTGLIDLGFSENKLVGRIPASLGNLSS  411

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G+IP +I  ++ L  ++ ++N
Sbjct  412  LNVLYLYENKLSGSIPSSIGRLTNLIELDFSDN  444


 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG+   L++LY+W NQL+GS+P EIG LT L +L  ++N L G IP  +GNL+ 
Sbjct  208  GPIPREIGDLRRLKFLYLWMNQLSGSIPAEIGRLTGLIDLGFSDNKLVGRIPASLGNLSS  267

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L  +IP  I  ++ L  ++ ++N
Sbjct  268  LNVLYLYGNQLSRSIPSEIGRLTNLIELDFSDN  300


 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  SSL  LY+++N+L+GS+P  IG LT L  L  ++N L G IP  +GNL+ 
Sbjct  400  GRIPASLGNLSSLNVLYLYENKLSGSIPSSIGRLTNLIELDFSDNKLVGHIPASLGNLSS  459

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L LD N   G+IP ++  +  L  +++A N
Sbjct  460  LNVLYLDGNQFLGSIPPSLGKLGNLRNLSLAKN  492


 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  SSL  LY++ NQL+ S+P EIG LT L  L  ++N L G IP  +GNL+ 
Sbjct  256  GRIPASLGNLSSLNVLYLYGNQLSRSIPSEIGRLTNLIELDFSDNKLVGHIPASLGNLSS  315

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L LD N + G+IP ++  +  L  +++A N
Sbjct  316  LNVLYLDRNQILGSIPPSLGKLGNLRNLSLAKN  348


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  SSL  LY+  NQ+ GS+P  +G L  L NL L +N LSG IPREIG+L  
Sbjct  304  GHIPASLGNLSSLNVLYLDRNQILGSIPPSLGKLGNLRNLSLAKNDLSGPIPREIGDLRR  363

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G+IP  I  ++ L  +  + N
Sbjct  364  LKFLYLWTNQLSGSIPAEIGRLTGLIDLGFSEN  396


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  SSL  LY+  NQ  GS+P  +G L  L NL L +N LSG IPREIG+L  
Sbjct  448  GHIPASLGNLSSLNVLYLDGNQFLGSIPPSLGKLGNLRNLSLAKNDLSGPIPREIGDLRR  507

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L  +IP  I  ++ L  ++ ++N
Sbjct  508  LKFLYLWMNQLSRSIPSEIGRLTNLIELDFSDN  540


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  +    N L G +P  +G L  L NL L +N LSG IPREIG+L  
Sbjct  160  GHIPWEIGLLDSLSEVSFSKNNLKGPIPTSLGKLGNLRNLSLAKNDLSGPIPREIGDLRR  219

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G+IP  I  ++ L  +  ++N
Sbjct  220  LKFLYLWMNQLSGSIPAEIGRLTGLIDLGFSDN  252


 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G+  +L  L +  N L+G +PREIG+L  L  L L  N LSG IP EIG L  
Sbjct  328  GSIPPSLGKLGNLRNLSLAKNDLSGPIPREIGDLRRLKFLYLWTNQLSGSIPAEIGRLTG  387

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L    N L G IP ++ N+S+L  + +  N
Sbjct  388  LIDLGFSENKLVGRIPASLGNLSSLNVLYLYEN  420


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G+  +L  L +  N L+G +PREIG+L  L  L L  N LSG IP EIG L  
Sbjct  184  GPIPTSLGKLGNLRNLSLAKNDLSGPIPREIGDLRRLKFLYLWMNQLSGSIPAEIGRLTG  243

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L   +N L G IP ++ N+S+L  + +  N
Sbjct  244  LIDLGFSDNKLVGRIPASLGNLSSLNVLYLYGN  276


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  S LEYL +  N L+G++P ++   T L +L L++N +   IP EIGN   
Sbjct  645  GDIPHQIGFLSRLEYLNLGSNNLSGAIPPQLSLCTNLLSLNLSQNKIERSIPSEIGNAQF  704

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N L G IP  +  +  L  +N+++N
Sbjct  705  LRVLDLSQNLLTGRIPPNLGKLRVLETLNISHN  737


 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 59/122 (48%), Gaps = 29/122 (24%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLT-------------------------  177
            G IPR IG+   L++LY+W NQL+ S+P EIG LT                         
Sbjct  496  GPIPREIGDLRRLKFLYLWMNQLSRSIPSEIGRLTNLIELDFSDNKLEGNKLTGNVTEAF  555

Query  176  ----MLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMA  9
                 LN + L+ N L GE+  + G+ + L  LR+ NN + G IP     ++ L +++++
Sbjct  556  GVYPQLNFMDLSHNYLHGELSWKWGHCHNLTSLRISNNKISGEIPSIFGRMAQLQFLDLS  615

Query  8    NN  3
             N
Sbjct  616  AN  617


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +  SI   S L+YL   DN+L+G +P EIG L  L+ +  ++N+L G IP  +G L  
Sbjct  136  GAMTSSISNLSKLKYLNFCDNRLSGHIPWEIGLLDSLSEVSFSKNNLKGPIPTSLGKLGN  195

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L+ L L  N+L G IP  I ++  L ++
Sbjct  196  LRNLSLAKNDLSGPIPREIGDLRRLKFL  223


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +  C++L  L +  N++  S+P EIGN   L  L L++N L+G IP  +G L +
Sbjct  669  GAIPPQLSLCTNLLSLNLSQNKIERSIPSEIGNAQFLRVLDLSQNLLTGRIPPNLGKLRV  728

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + +N L G+IP +  ++  L  ++++ N
Sbjct  729  LETLNISHNGLSGSIPYSFADLWALISVDVSYN  761


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 5/98 (5%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G+  +L  L +  N L+G +PREIG+L  L  L L  N LS  IP EIG L  
Sbjct  472  GSIPPSLGKLGNLRNLSLAKNDLSGPIPREIGDLRRLKFLYLWMNQLSRSIPSEIGRLTN  531

Query  101  LQIL-----RLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L     +L+ N L G + E       L ++++++N
Sbjct  532  LIELDFSDNKLEGNKLTGNVTEAFGVYPQLNFMDLSHN  569


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  + L++L +  N L+G +PRE+G+L +L +L L  N ++G+IP +IG L+ 
Sbjct  597  GEIPSIFGRMAQLQFLDLSANNLSGKIPRELGSLHLLLDLILNNNGITGDIPHQIGFLSR  656

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +NNL G IP  +   + L  +N++ N
Sbjct  657  LEYLNLGSNNLSGAIPPQLSLCTNLLSLNLSQN  689


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +    G C +L  L + +N+++G +P   G +  L  L L+ N+LSG+IPRE+G+L++
Sbjct  573  GELSWKWGHCHNLTSLRISNNKISGEIPSIFGRMAQLQFLDLSANNLSGKIPRELGSLHL  632

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+NN + G IP  I  +S L Y+N+ +N
Sbjct  633  LLDLILNNNGITGDIPHQIGFLSRLEYLNLGSN  665


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            N + G++   I NL+ L  L   +N LSG IP EIG L+ L  +    NNL+G IP ++ 
Sbjct  132  NSIYGAMTSSISNLSKLKYLNFCDNRLSGHIPWEIGLLDSLSEVSFSKNNLKGPIPTSLG  191

Query  41   NISTLTYINMANN  3
             +  L  +++A N
Sbjct  192  KLGNLRNLSLAKN  204


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  IG    L  L +  N L G +P  +G L +L  L ++ N LSG IP    +L  L
Sbjct  694  SIPSEIGNAQFLRVLDLSQNLLTGRIPPNLGKLRVLETLNISHNGLSGSIPYSFADLWAL  753

Query  98   QILRLDNNNLEGTIP  54
              + +  N+LEG +P
Sbjct  754  ISVDVSYNDLEGPLP  768



>ref|XP_003563067.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Brachypodium distachyon]
Length=1264

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIGECS+L+ +  + NQLNGS+P  IGNL+ L  L L +N LSGEIP E+G+   
Sbjct  461  GEIPESIGECSTLQMMDFFGNQLNGSIPASIGNLSRLTFLHLRQNELSGEIPPELGDCRR  520

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L +N L G IP T   + +L    + NN
Sbjct  521  LEVLDLADNALSGEIPGTFDKLQSLEQFMLYNN  553


 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREI-GNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IP S+GE S+L  L +    L G++PR +   L+ L  L L ENSLSG IP  IG + 
Sbjct  166  GPIPDSLGELSNLTVLGLASCNLTGAIPRRLFARLSGLTALNLQENSLSGPIPAGIGAIA  225

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ++ L NNNL G IP  + +++ L  +N+ NN
Sbjct  226  GLQVISLANNNLTGVIPPELGSLAELQKLNLGNN  259


 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P SIG   SL  LY ++NQ  G +P  IG  + L  +    N L+G IP  IGNL+ 
Sbjct  437  GRLPGSIGNLRSLRILYAYENQFTGEIPESIGECSTLQMMDFFGNQLNGSIPASIGNLSR  496

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP  + +   L  +++A+N
Sbjct  497  LTFLHLRQNELSGEIPPELGDCRRLEVLDLADN  529


 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C+ L ++ + +N+L+G +P  +G L  L  L L+ N  SG +P E+ N + 
Sbjct  652  GGIPDALSRCAQLSHVVLNNNRLSGPVPAWLGTLPQLGELTLSTNEFSGAMPVELSNCSK  711

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L LD N + GT+P  I  +++L  +N+A N
Sbjct  712  LLKLSLDGNLINGTVPHEIGRLASLNVLNLARN  744


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  +   + L  L ++ N+L G LP  IGNL  L  L   EN  +GEIP  IG  + LQ
Sbjct  415  LPPELFNLTELGTLALYHNELTGRLPGSIGNLRSLRILYAYENQFTGEIPESIGECSTLQ  474

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ++    N L G+IP +I N+S LT++++  N
Sbjct  475  MMDFFGNQLNGSIPASIGNLSRLTFLHLRQN  505


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSI-GECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G IPR +    S L  L + +N L+G +P  IG +  L  + L  N+L+G IP E+G+L 
Sbjct  190  GAIPRRLFARLSGLTALNLQENSLSGPIPAGIGAIAGLQVISLANNNLTGVIPPELGSLA  249

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L NN LEG IP  +  +  L Y+N+ NN
Sbjct  250  ELQKLNLGNNTLEGPIPPELGALGELLYLNLMNN  283


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-----  117
            G IPR++G  S +  L +  N L G +P E+G LT LN L L+ N+L+G IP E+     
Sbjct  287  GRIPRTLGALSRVRTLDLSWNMLTGGIPAELGRLTELNFLVLSNNNLTGRIPGELCGDEE  346

Query  116  -GNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              ++  L+ L L  NNL G IP T+     LT +++ANN
Sbjct  347  AESMMSLEHLMLSTNNLTGEIPGTLSRCRALTQLDLANN  385


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ + + +N L G +P E+G+L  L  L L  N+L G IP E+G L  
Sbjct  215  GPIPAGIGAIAGLQVISLANNNLTGVIPPELGSLAELQKLNLGNNTLEGPIPPELGALGE  274

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN+L G IP T+  +S +  ++++ N
Sbjct  275  LLYLNLMNNSLTGRIPRTLGALSRVRTLDLSWN  307


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 2/94 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLN  105
            G +P ++    +L+ + +  N+L GS+P  +G L   L  L L  N L+ EIP  IG L 
Sbjct  92   GPVPSALSRLDALQTIDLSSNRLTGSIPPALGRLGRSLEVLMLYSNDLASEIPASIGRLA  151

Query  104  MLQILRL-DNNNLEGTIPETIFNISTLTYINMAN  6
             LQ+LRL DN  L G IP+++  +S LT + +A+
Sbjct  152  ALQVLRLGDNPRLSGPIPDSLGELSNLTVLGLAS  185


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G    L YL + +N L G +PR +G L+ +  L L+ N L+G IP E+G L  
Sbjct  263  GPIPPELGALGELLYLNLMNNSLTGRIPRTLGALSRVRTLDLSWNMLTGGIPAELGRLTE  322

Query  101  LQILRLDNNNLEGTIP  54
            L  L L NNNL G IP
Sbjct  323  LNFLVLSNNNLTGRIP  338


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  + L+ L + +N L G +P E+G L  L  L L  NSL+G IPR +G L+ 
Sbjct  239  GVIPPELGSLAELQKLNLGNNTLEGPIPPELGALGELLYLNLMNNSLTGRIPRTLGALSR  298

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ++ L L  N L G IP  +  ++ L ++ ++NN
Sbjct  299  VRTLDLSWNMLTGGIPAELGRLTELNFLVLSNN  331


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL-QLTENSLSGEIPREIGNLN  105
            G IP ++    +L  L +  N L+G +P ++G L  L +L  L+ N L G+IP  +G+L+
Sbjct  748  GPIPATVARLGNLYELNLSQNHLSGRIPPDMGKLQELQSLLDLSSNDLIGKIPASLGSLS  807

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L +N L GT+P  +  +S+L  +++++N
Sbjct  808  KLEDLNLSHNALVGTVPSQLAGMSSLVQLDLSSN  841


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +  CS L  L +  N +NG++P EIG L  LN L L  N LSG IP  +  L  
Sbjct  700  GAMPVELSNCSKLLKLSLDGNLINGTVPHEIGRLASLNVLNLARNQLSGPIPATVARLGN  759

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L  L L  N+L G IP  +  +  L
Sbjct  760  LYELNLSQNHLSGRIPPDMGKLQEL  784


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 23/116 (20%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPR---EIGNLTMLN-------------------  168
            G IP +  +  SLE   +++N L+G++P    E  N+T +N                   
Sbjct  533  GEIPGTFDKLQSLEQFMLYNNSLSGAIPDGMFECRNITRVNIAHNRLSGSLVPLCGSARL  592

Query  167  -NLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             +   T NS  G IP ++G    LQ +RL +N L G IP ++  I+ LT ++++ N
Sbjct  593  LSFDATNNSFQGGIPAQLGRSASLQRVRLGSNALSGPIPPSLGRIAALTLLDVSCN  648


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 52/116 (45%), Gaps = 23/116 (20%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIP------RE  120
            G IP  +G+C  LE L + DN L+G +P     L  L    L  NSLSG IP      R 
Sbjct  509  GEIPPELGDCRRLEVLDLADNALSGEIPGTFDKLQSLEQFMLYNNSLSGAIPDGMFECRN  568

Query  119  IGNLNM---------------LQILRLD--NNNLEGTIPETIFNISTLTYINMANN  3
            I  +N+                ++L  D  NN+ +G IP  +   ++L  + + +N
Sbjct  569  ITRVNIAHNRLSGSLVPLCGSARLLSFDATNNSFQGGIPAQLGRSASLQRVRLGSN  624


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            N   G +P ++G    L  ++L  N+LSG IP  +G +  L +L +  N L G IP+ + 
Sbjct  600  NSFQGGIPAQLGRSASLQRVRLGSNALSGPIPPSLGRIAALTLLDVSCNALTGGIPDALS  659

Query  41   NISTLTYINMANN  3
              + L+++ + NN
Sbjct  660  RCAQLSHVVLNNN  672



>ref|XP_010910120.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Elaeis guineensis]
Length=999

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  + L+ LY+WDN L+GS+P EIGNL  L NL L+ N L+G IP  +GNL  
Sbjct  136  GSIPTSLGNLTKLKTLYLWDNHLSGSIPPEIGNLVKLTNLLLSNNGLTGSIPTTLGNLTK  195

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L I+ L +N+L  +IP  I N+ +LT ++M+ N
Sbjct  196  LDIMLLWDNHLSDSIPHEIENLVSLTKLDMSIN  228


 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  + LE LY+++NQ++GS+P EI NL  L +LQ+  N L G IP  IGNL  
Sbjct  40   GSIPASLGSLTKLEILYLYENQISGSIPHEIQNLVSLRDLQIYTNFLDGSIPASIGNLTK  99

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL L +NNL G+IP  I N+  LT ++++ N
Sbjct  100  LNILNLWDNNLSGSIPPEIGNLVELTELSLSTN  132


 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  + L  L +WDN L+GS+P EIGNL  L  L L+ N+L G IP  +GNL  
Sbjct  88   GSIPASIGNLTKLNILNLWDNNLSGSIPPEIGNLVELTELSLSTNNLIGSIPTSLGNLTK  147

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N+L G+IP  I N+  LT + ++NN
Sbjct  148  LKTLYLWDNHLSGSIPPEIGNLVKLTNLLLSNN  180


 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S G  +SL  L+++DNQL+GSLP+E  N+T L +LQL  N+ SG +P +I    +
Sbjct  280  GSIPPSFGSLTSLTVLHLFDNQLSGSLPQEFNNITNLESLQLMNNNFSGHLPHDICKGGV  339

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN+ EG IP+++ N ++L  + +  N
Sbjct  340  LYYLVLSNNHFEGPIPKSLKNCTSLGTVRLQQN  372


 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SI   + LE L++  NQ++G +P E+GNL  LN+L L  N +SG IP   G+L  
Sbjct  232  GSIPASIENLTKLELLHLCGNQISGPIPHELGNLRKLNSLLLQVNQISGSIPPSFGSLTS  291

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L +N L G++P+   NI+ L  + + NN
Sbjct  292  LTVLHLFDNQLSGSLPQEFNNITNLESLQLMNN  324


 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQL-TENSLSGEIPREIGNLN  105
            G +P  +G C  L  L + +N LNGS+P +IGNL  L++L   + NS +GEIP + G L+
Sbjct  496  GRVPEQLGNCIKLRLLKLGNNHLNGSIPFQIGNLVYLDDLLDLSHNSFTGEIPSQFGKLD  555

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ+L L +N++ G +P ++  + +L+ I+++ N
Sbjct  556  RLQVLNLSHNDMTGHVPSSLRYMISLSSIDLSYN  589


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++G  + L+ + +WDN L+ S+P EI NL  L  L ++ N L G IP  I NL  
Sbjct  184  GSIPTTLGNLTKLDIMLLWDNHLSDSIPHEIENLVSLTKLDMSINHLDGSIPASIENLTK  243

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L++L L  N + G IP  + N+  L
Sbjct  244  LELLHLCGNQISGPIPHELGNLRKL  268


 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G    L  L +  NQ++GS+P   G+LT L  L L +N LSG +P+E  N+  
Sbjct  256  GPIPHELGNLRKLNSLLLQVNQISGSIPPSFGSLTSLTVLHLFDNQLSGSLPQEFNNITN  315

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L+L NNN  G +P  I     L Y+ ++NN
Sbjct  316  LESLQLMNNNFSGHLPHDICKGGVLYYLVLSNN  348


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +    +L  L +  NQL GS+P  +G+LT L  L L EN +SG IP EI NL  
Sbjct  16   GTIPQELERLVNLLDLRISYNQLTGSIPASLGSLTKLEILYLYENQISGSIPHEIQNLVS  75

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L++  N L+G+IP +I N++ L  +N+ +N
Sbjct  76   LRDLQIYTNFLDGSIPASIGNLTKLNILNLWDN  108


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP  I    SL  L M  N L+GS+P  I NLT L  L L  N +SG IP E+GNL  L
Sbjct  209  SIPHEIENLVSLTKLDMSINHLDGSIPASIENLTKLELLHLCGNQISGPIPHELGNLRKL  268

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L  N + G+IP +  ++++LT +++ +N
Sbjct  269  NSLLLQVNQISGSIPPSFGSLTSLTVLHLFDN  300


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+++ + S+L  L + +NQL G +  E G L+ L  L L+ N L G +P ++GN   
Sbjct  448  GEIPKNLSKLSNLFNLSLSNNQLVGEIYPEFGELSDLETLDLSANRLRGRVPEQLGNCIK  507

Query  101  LQILRLDNNNLEGTIPETIFNISTLTY  21
            L++L+L NN+L G+IP   F I  L Y
Sbjct  508  LRLLKLGNNHLNGSIP---FQIGNLVY  531


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -1

Query  251  SSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNN  72
            + L +LY++ N L+G++P+E+  L  L +L+++ N L+G IP  +G+L  L+IL L  N 
Sbjct  2    TRLNFLYLYQNLLSGTIPQELERLVNLLDLRISYNQLTGSIPASLGSLTKLEILYLYENQ  61

Query  71   LEGTIPETIFNISTLTYINMANN  3
            + G+IP  I N+ +L  + +  N
Sbjct  62   ISGSIPHEIQNLVSLRDLQIYTN  84


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G+ + L  L +  N L+G +P+ +  L+ L NL L+ N L GEI  E G L+ 
Sbjct  424  GIIPPELGKLTQLCVLDLSSNHLSGEIPKNLSKLSNLFNLSLSNNQLVGEIYPEFGELSD  483

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G +PE + N   L  + + NN
Sbjct  484  LETLDLSANRLRGRVPEQLGNCIKLRLLKLGNN  516


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -1

Query  260  GECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLD  81
            GEC +L  L +  N + G +P E+G LT L  L L+ N LSGEIP+ +  L+ L  L L 
Sbjct  407  GECHNLSLLRISSNNVTGIIPPELGKLTQLCVLDLSSNHLSGEIPKNLSKLSNLFNLSLS  466

Query  80   NNNLEGTIPETIFNISTLTYINMANN  3
            NN L G I      +S L  ++++ N
Sbjct  467  NNQLVGEIYPEFGELSDLETLDLSAN  492


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+  C+SL  + +  NQL+G +   +G    L  + L+ N LSG +    G  + 
Sbjct  352  GPIPKSLKNCTSLGTVRLQQNQLSGDISENLGVYPHLWYIDLSFNKLSGMLSSNWGECHN  411

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +LR+ +NN+ G IP  +  ++ L  +++++N
Sbjct  412  LSLLRISSNNVTGIIPPELGKLTQLCVLDLSSN  444


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+I  ++G    L Y+ +  N+L+G L    G    L+ L+++ N+++G IP E+G L  
Sbjct  376  GDISENLGVYPHLWYIDLSFNKLSGMLSSNWGECHNLSLLRISSNNVTGIIPPELGKLTQ  435

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L +N+L G IP+ +  +S L  ++++NN
Sbjct  436  LCVLDLSSNHLSGEIPKNLSKLSNLFNLSLSNN  468



>ref|XP_006489993.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
isoform X2 [Citrus sinensis]
Length=118

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++ +C  L+ L +  N L+G++P+EIGNLTML  + L  N L GEIP EI NL  
Sbjct  4    GKIPSALSKCKQLQQLNLQFNNLSGAIPKEIGNLTMLKGIYLGYNKLHGEIPHEIANLLN  63

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G  P  IFN+STL  + + NN
Sbjct  64   LEDLVLGMNILVGVFPAAIFNMSTLKVLMLINN  96


 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + L+ +Y+  N+L+G +P EI NL  L +L L  N L G  P  I N++ 
Sbjct  28   GAIPKEIGNLTMLKGIYLGYNKLHGEIPHEIANLLNLEDLVLGMNILVGVFPAAIFNMST  87

Query  101  LQILRLDNNNLEGTIPETI  45
            L++L L NN+L G++P  I
Sbjct  88   LKVLMLINNSLSGSLPSRI  106


 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
             +G +P  +     L  L L  N+LSG IP+EIGNL ML+ + L  N L G IP  I N+
Sbjct  2    FHGKIPSALSKCKQLQQLNLQFNNLSGAIPKEIGNLTMLKGIYLGYNKLHGEIPHEIANL  61



>gb|KHN27325.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=1136

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG  SSL YLY++ N L+GS+P E+GNL  L  +QL  N+LSG IP  IGNL  
Sbjct  364  GKIPSTIGNLSSLNYLYLYGNSLSGSIPDEVGNLHSLFTIQLLFNNLSGPIPASIGNLIN  423

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  +RLD N L G+IP TI N++ L  +++ +N
Sbjct  424  LNSIRLDGNKLSGSIPSTIGNLTNLEVLSLFDN  456


 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR IG+  +L+ LY+  N  +GS+PREIG L  L  L L+ N LSG+IP  IGNL+ 
Sbjct  316  GSIPREIGKLVNLKILYLGGNDFSGSIPREIGFLKQLGELGLSNNFLSGKIPSTIGNLSS  375

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINM  12
            L  L L  N+L G+IP+ + N+ +L  I +
Sbjct  376  LNYLYLYGNSLSGSIPDEVGNLHSLFTIQL  405


 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  S L YL +  N L+G++P EI  L  L+ L L+EN++SG +P+EIG L  
Sbjct  148  GSIPSSIGNLSKLSYLNLRTNDLSGTIPSEITQLIDLHALLLSENNISGSLPQEIGRLRN  207

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL    +NL GTIP +I  ++ L+Y+++  N
Sbjct  208  LRILDTHLSNLTGTIPISIEKLNNLSYLDLGAN  240


 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   ++ +L M     NGS+PREIG L  L  L L  N  SG IPREIG L  
Sbjct  292  GSIPEEIGMLENVIHLDMRQCNFNGSIPREIGKLVNLKILYLGGNDFSGSIPREIGFLKQ  351

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G IP TI N+S+L Y+ +  N
Sbjct  352  LGELGLSNNFLSGKIPSTIGNLSSLNYLYLYGN  384


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR IG    L  L + +N L+G +P  IGNL+ LN L L  NSLSG IP E+GNL+ 
Sbjct  340  GSIPREIGFLKQLGELGLSNNFLSGKIPSTIGNLSSLNYLYLYGNSLSGSIPDEVGNLHS  399

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  ++L  NNL G IP +I N+  L  I +  N
Sbjct  400  LFTIQLLFNNLSGPIPASIGNLINLNSIRLDGN  432


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG  ++LE L ++DNQL+G +P E   LT L NLQL +N+  G +PR +     
Sbjct  436  GSIPSTIGNLTNLEVLSLFDNQLSGKIPTEFNRLTALKNLQLADNNFVGYLPRNVCIGGK  495

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L      NNN  G IP+++ N S+L  + +  N
Sbjct  496  LVNFTASNNNFTGPIPKSLKNCSSLVRVRLQQN  528


 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P+ I     L  L +  N L+G +P+++GNL  L ++ L++N   G IP E+G L  
Sbjct  627  GNVPKEIASMQKLRTLKLGSNNLSGLIPKQLGNLLNLLDMSLSQNKFQGNIPSELGKLKF  686

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N+L GTIP T   + +L  +N+++N
Sbjct  687  LTSLDLSGNSLRGTIPSTFGELKSLETLNLSHN  719


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG   +L  + +  N+L+GS+P  IGNLT L  L L +N LSG+IP E   L  
Sbjct  412  GPIPASIGNLINLNSIRLDGNKLSGSIPSTIGNLTNLEVLSLFDNQLSGKIPTEFNRLTA  471

Query  101  LQILRLDNNNLEGTIPETI  45
            L+ L+L +NN  G +P  +
Sbjct  472  LKNLQLADNNFVGYLPRNV  490


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I   S+L  L +  N L+GS+P  IGNL+ L+ L L  N LSG IP EI  L  
Sbjct  124  GSIPPQIDALSNLNTLDLSTNNLSGSIPSSIGNLSKLSYLNLRTNDLSGTIPSEITQLID  183

Query  101  LQILRLDNNNLEGTIPETI  45
            L  L L  NN+ G++P+ I
Sbjct  184  LHALLLSENNISGSLPQEI  202


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 54/118 (46%), Gaps = 26/118 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLS------------  138
            GNIPR I     L++L   DN  NGS+P+EI  L  L  L L +N  S            
Sbjct  244  GNIPRGIWHMD-LKFLSFADNNFNGSIPKEIWKLRNLEYLNLGQNDFSAGSIPEEIGMLE  302

Query  137  -------------GEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                         G IPREIG L  L+IL L  N+  G+IP  I  +  L  + ++NN
Sbjct  303  NVIHLDMRQCNFNGSIPREIGKLVNLKILYLGGNDFSGSIPREIGFLKQLGELGLSNN  360


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  239  YLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGT  60
            +L M  N L+GS+P +I  L+ LN L L+ N+LSG IP  IGNL+ L  L L  N+L GT
Sbjct  114  FLNMSHNFLSGSIPPQIDALSNLNTLDLSTNNLSGSIPSSIGNLSKLSYLNLRTNDLSGT  173

Query  59   IPETI  45
            IP  I
Sbjct  174  IPSEI  178


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I +   L  L + +N ++GSLP+EIG L  L  L    ++L+G IP  I  LN 
Sbjct  172  GTIPSEITQLIDLHALLLSENNISGSLPQEIGRLRNLRILDTHLSNLTGTIPISIEKLNN  231

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G IP  I+++  L +++ A+N
Sbjct  232  LSYLDLGANNLSGNIPRGIWHMD-LKFLSFADN  263


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P+ IG   +L  L    + L G++P  I  L  L+ L L  N+LSG IPR I +++ 
Sbjct  196  GSLPQEIGRLRNLRILDTHLSNLTGTIPISIEKLNNLSYLDLGANNLSGNIPRGIWHMD-  254

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L   +NN  G+IP+ I+ +  L Y+N+  N
Sbjct  255  LKFLSFADNNFNGSIPKEIWKLRNLEYLNLGQN  287


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++  + G+  SL  L + +N L+G +P E+G  T L  L L  N L+G IP+++ NL +
Sbjct  556  GHLSPNWGKFGSLTSLKISNNNLSGVIPPELGGATKLEQLHLFSNHLTGNIPQDLCNLTL  615

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               L L+NNNL G +P+ I ++  L  + + +N
Sbjct  616  FD-LSLNNNNLTGNVPKEIASMQKLRTLKLGSN  647


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (51%), Gaps = 23/116 (20%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTM-----------------------L  171
            G IP  +G  + LE L+++ N L G++P+++ NLT+                       L
Sbjct  580  GVIPPELGGATKLEQLHLFSNHLTGNIPQDLCNLTLFDLSLNNNNLTGNVPKEIASMQKL  639

Query  170  NNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L+L  N+LSG IP+++GNL  L  + L  N  +G IP  +  +  LT ++++ N
Sbjct  640  RTLKLGSNNLSGLIPKQLGNLLNLLDMSLSQNKFQGNIPSELGKLKFLTSLDLSGN  695


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G   +L  + +  N+  G++P E+G L  L +L L+ NSL G IP   G L  
Sbjct  651  GLIPKQLGNLLNLLDMSLSQNKFQGNIPSELGKLKFLTSLDLSGNSLRGTIPSTFGELKS  710

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +NNL G +  +  ++ +LT I+++ N
Sbjct  711  LETLNLSHNNLSGDL-SSFDDMISLTSIDISYN  742


 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+S+  CSSL  + +  NQL G +    G L  L+ ++L++N+  G +    G    
Sbjct  508  GPIPKSLKNCSSLVRVRLQQNQLTGDITDAFGVLPNLDFIELSDNNFYGHLSPNWGKFGS  567

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L++ NNNL G IP  +   + L  +++ +N
Sbjct  568  LTSLKISNNNLSGVIPPELGGATKLEQLHLFSN  600


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+I  + G   +L+++ + DN   G L    G    L +L+++ N+LSG IP E+G    
Sbjct  532  GDITDAFGVLPNLDFIELSDNNFYGHLSPNWGKFGSLTSLKISNNNLSGVIPPELGGATK  591

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N+L G IP+ + N+ TL  +++ NN
Sbjct  592  LEQLHLFSNHLTGNIPQDLCNL-TLFDLSLNNN  623


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP      ++L+ L + DN   G LPR +     L N   + N+ +G IP+ + N + 
Sbjct  460  GKIPTEFNRLTALKNLQLADNNFVGYLPRNVCIGGKLVNFTASNNNFTGPIPKSLKNCSS  519

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  +RL  N L G I +    +  L +I +++N
Sbjct  520  LVRVRLQQNQLTGDITDAFGVLPNLDFIELSDN  552



>ref|XP_010064493.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Eucalyptus grandis]
Length=146

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 63/93 (68%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR  G  + L Y+Y+  N+L G +P+E+GN++ L+ L +  N L G +P E+GNL+M
Sbjct  12   GTIPREWG-STKLSYIYLLGNRLTGPIPKELGNISTLSELDVESNWLYGPLPPELGNLSM  70

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L +NN  G +P+TIFN++ L Y+ + +N
Sbjct  71   LYVLCLTSNNFTGELPQTIFNLTNLEYLQLGDN  103


 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  S+L  L +  N L G LP E+GNL+ML  L LT N+ +GE+P+ I NL  
Sbjct  35   GPIPKELGNISTLSELDVESNWLYGPLPPELGNLSMLYVLCLTSNNFTGELPQTIFNLTN  94

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L+ L+L +N   G IP+ I N+++L
Sbjct  95   LEYLQLGDNQFTGKIPKFIKNLTSL  119


 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  +G  S L  L +  N   G LP+ I NLT L  LQL +N  +G+IP+ I NL  
Sbjct  59   GPLPPELGNLSMLYVLCLTSNNFTGELPQTIFNLTNLEYLQLGDNQFTGKIPKFIKNLTS  118

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L+IL ++ + L+G IP  I ++  L ++
Sbjct  119  LEILVIEGSGLQGPIPSEIADLERLYHL  146



>ref|XP_009606790.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Nicotiana tomentosiformis]
Length=236

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PRSI EC+ L+ L ++ N + G++PRE+GNL +L  L L +N L G IP EIG+L+ 
Sbjct  128  GELPRSISECAQLQVLLLFQNNIVGTIPREVGNLLLLQYLDLGQNRLEGTIPDEIGHLHN  187

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ LR++ N L G+IP  IFNIS+L  ++M NN
Sbjct  188  LKELRMEQNALTGSIPLIIFNISSLEVLSMWNN  220


 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  S L  L +  N   G LP E   L  L  + L+ N LSG+ P+ +G+L  
Sbjct  5    GTIPPQFGNLSFLVSLDLSYNNFQGELPPEFTRLLRLRAIDLSFNFLSGQTPQLLGDLED  64

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L+NN+  G IP +I  +  L ++N+  N
Sbjct  65   LRMLSLENNSFSGFIPSSISKMKNLEFLNLKYN  97



>ref|XP_010446261.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Camelina sativa]
Length=1429

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G+  SLEYLY++ NQLNG++PREIGNL     +  +EN+L+GEIP E+GN+  
Sbjct  279  GPIPKELGDLVSLEYLYLYRNQLNGTIPREIGNLLNAIEIDFSENALTGEIPLELGNIEG  338

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N L GTIP  +  +  L  ++++ N
Sbjct  339  LELLHLFENQLTGTIPVELTTLKNLAKLDLSIN  371


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 63/117 (54%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR +G CS+L+ L + DN   G LPREIG L+ L  L ++ N L+GE+P EI N  M
Sbjct  495  GSIPREVGNCSALQRLQLADNGFTGELPREIGTLSQLGTLNISSNKLTGEVPSEIFNFKM  554

Query  101  LQ------------------------ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ                        +L+L NNNL GTIP  + N+S LT + M  N
Sbjct  555  LQRLDMCCNNFSGTLPSKVGSLYQLELLKLSNNNLSGTIPVALGNLSRLTELQMGGN  611


 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G  P ++ +  +L  + +  N+  GS+PRE+GN + L  LQL +N  +GE+PREIG L+ 
Sbjct  471  GRFPSNLCKLVNLTAIELGQNRFRGSIPREVGNCSALQRLQLADNGFTGELPREIGTLSQ  530

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L + +N L G +P  IFN   L  ++M  N
Sbjct  531  LGTLNISSNKLTGEVPSEIFNFKMLQRLDMCCN  563


 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP+ IG CSSLE L + +N+  G +P EIG L  L NL +  N +SG +P EIGNL  
Sbjct  111  GNIPKEIGNCSSLEILKLNNNEFEGEIPVEIGKLVSLENLIIYNNRISGSLPVEIGNLLS  170

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L   +NN+ G +P ++ N+  LT      N
Sbjct  171  LSQLVTYSNNISGQLPRSVGNLKRLTSFRAGQN  203


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG C SL  L +  NQL+G LP+EIG L  L+ + L EN  +G IPREI N   
Sbjct  207  GSLPSEIGGCESLVMLGLAQNQLSGELPKEIGMLKNLSQVILWENEFTGFIPREISNCTS  266

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G IP+ + ++ +L Y+ +  N
Sbjct  267  LETLALYKNQLVGPIPKELGDLVSLEYLYLYRN  299


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG+  SLE L +++N+++GSLP EIGNL  L+ L    N++SG++PR +GNL  
Sbjct  135  GEIPVEIGKLVSLENLIIYNNRISGSLPVEIGNLLSLSQLVTYSNNISGQLPRSVGNLKR  194

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L   R   N + G++P  I    +L  + +A N
Sbjct  195  LTSFRAGQNMISGSLPSEIGGCESLVMLGLAQN  227


 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ IG   +L  + +W+N+  G +PREI N T L  L L +N L G IP+E+G+L  
Sbjct  231  GELPKEIGMLKNLSQVILWENEFTGFIPREISNCTSLETLALYKNQLVGPIPKELGDLVS  290

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L GTIP  I N+     I+ + N
Sbjct  291  LEYLYLYRNQLNGTIPREIGNLLNAIEIDFSEN  323


 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGN-LN  105
            G IPR I  C+SLE L ++ NQL G +P+E+G+L  L  L L  N L+G IPREIGN LN
Sbjct  255  GFIPREISNCTSLETLALYKNQLVGPIPKELGDLVSLEYLYLYRNQLNGTIPREIGNLLN  314

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             ++I     N L G IP  + NI  L  +++  N
Sbjct  315  AIEI-DFSENALTGEIPLELGNIEGLELLHLFEN  347


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP  I  C +L  L +  N L G  P  +  L  L  ++L +N   G IPRE+GN + 
Sbjct  447  GNIPTGITTCKTLAQLRLARNNLVGRFPSNLCKLVNLTAIELGQNRFRGSIPREVGNCSA  506

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L+L +N   G +P  I  +S L  +N+++N
Sbjct  507  LQRLQLADNGFTGELPREIGTLSQLGTLNISSN  539


 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLN-NLQLTENSLSGEIPREIGNLN  105
            G IP ++G  S L  L M  N  +GS+PRE+G+LT L   L L+ N L+GEIP E+ NL 
Sbjct  591  GTIPVALGNLSRLTELQMGGNLFSGSIPRELGSLTGLQIELNLSYNKLTGEIPPELSNLV  650

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ML+ L L+NNNL G IP +  N+S+L   N + N
Sbjct  651  MLEFLLLNNNNLSGEIPSSFANLSSLLGCNFSYN  684


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PRS+G    L       N ++GSLP EIG    L  L L +N LSGE+P+EIG L  
Sbjct  183  GQLPRSVGNLKRLTSFRAGQNMISGSLPSEIGGCESLVMLGLAQNQLSGELPKEIGMLKN  242

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L  N   G IP  I N ++L  + +  N
Sbjct  243  LSQVILWENEFTGFIPREISNCTSLETLALYKN  275


 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG   SL  L  + N ++G LPR +GNL  L + +  +N +SG +P EIG    
Sbjct  159  GSLPVEIGNLLSLSQLVTYSNNISGQLPRSVGNLKRLTSFRAGQNMISGSLPSEIGGCES  218

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L +L L  N L G +P+ I  +  L+ +
Sbjct  219  LVMLGLAQNQLSGELPKEIGMLKNLSQV  246


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +  SIG    L+ L +  N+L+G++P+EIGN + L  L+L  N   GEIP EIG L  
Sbjct  87   GKLSPSIGGLVHLKQLDLSYNELSGNIPKEIGNCSSLEILKLNNNEFEGEIPVEIGKLVS  146

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + NN + G++P  I N+ +L+ +   +N
Sbjct  147  LENLIIYNNRISGSLPVEIGNLLSLSQLVTYSN  179


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L+G L   IG L  L  L L+ N LSG IP+EIGN + L+IL+L+NN  EG IP  I  +
Sbjct  85   LSGKLSPSIGGLVHLKQLDLSYNELSGNIPKEIGNCSSLEILKLNNNEFEGEIPVEIGKL  144

Query  35   STLTYINMANN  3
             +L  + + NN
Sbjct  145  VSLENLIIYNN  155


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 57/117 (49%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNL--------------------  162
            G IP  +G    LE L++++NQL G++P E+  L  L  L                    
Sbjct  327  GEIPLELGNIEGLELLHLFENQLTGTIPVELTTLKNLAKLDLSINALTGPIPLGFQYLRG  386

Query  161  ----QLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                QL +NSLSG IP+++G  + L +L L +N+L G IP  +   S L  +N+  N
Sbjct  387  LYMLQLFQNSLSGTIPQKLGWYSDLWVLDLSDNHLSGRIPSYLCLHSNLIILNLGAN  443


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  I     L+ L M  N  +G+LP ++G+L  L  L+L+ N+LSG IP  +GNL+ 
Sbjct  543  GEVPSEIFNFKMLQRLDMCCNNFSGTLPSKVGSLYQLELLKLSNNNLSGTIPVALGNLSR  602

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L  L++  N   G+IP  + +++ L
Sbjct  603  LTELQMGGNLFSGSIPRELGSLTGL  627


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP        L  L ++ N L+G++P+++G  + L  L L++N LSG IP  +   + 
Sbjct  375  GPIPLGFQYLRGLYMLQLFQNSLSGTIPQKLGWYSDLWVLDLSDNHLSGRIPSYLCLHSN  434

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL L  NNL G IP  I    TL  + +A N
Sbjct  435  LIILNLGANNLSGNIPTGITTCKTLAQLRLARN  467


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 48/96 (50%), Gaps = 6/96 (6%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREI---GNLTMLNNLQLTENSLSGEIPREIGN  111
            G IP+ +G  S L  L + DN L+G +P  +    NL +LN   L  N+LSG IP  I  
Sbjct  399  GTIPQKLGWYSDLWVLDLSDNHLSGRIPSYLCLHSNLIILN---LGANNLSGNIPTGITT  455

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               L  LRL  NNL G  P  +  +  LT I +  N
Sbjct  456  CKTLAQLRLARNNLVGRFPSNLCKLVNLTAIELGQN  491



>ref|WP_030001516.1| hypothetical protein, partial [Marinimicrobia bacterium SCGC 
AAA003-E22]
Length=154

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG   SL +L +W+NQL+G +P EIGNL  L  L LT+N L+GEIP EIGNL  
Sbjct  11   GVIPVAIGNLDSLTHLDLWNNQLSGEIPSEIGNLMNLTKLDLTDNQLTGEIPIEIGNLTN  70

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N+L G IP  I N++ L+Y+ +  N
Sbjct  71   LTHLWLYGNHLTGEIPPEIGNLTNLSYLWLYGN  103


 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +L  L + DNQL G +P EIGNLT L +L L  N L+GEIP EIGNL  
Sbjct  35   GEIPSEIGNLMNLTKLDLTDNQLTGEIPIEIGNLTNLTHLWLYGNHLTGEIPPEIGNLTN  94

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N+L G IP  I N++ LTY+N+ +N
Sbjct  95   LSYLWLYGNHLTGGIPPEIGNLTNLTYLNLNSN  127


 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L +L+++ N L G +P EIGNLT L+ L L  N L+G IP EIGNL  
Sbjct  59   GEIPIEIGNLTNLTHLWLYGNHLTGEIPPEIGNLTNLSYLWLYGNHLTGGIPPEIGNLTN  118

Query  101  LQILRLDNNNLEGTIPETIFNI  36
            L  L L++N L G IP+ + ++
Sbjct  119  LTYLNLNSNQLSGEIPQEVCDL  140


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L G +P  IGNL  L +L L  N LSGEIP EIGNL  L  L L +N L G IP  I N+
Sbjct  9    LTGVIPVAIGNLDSLTHLDLWNNQLSGEIPSEIGNLMNLTKLDLTDNQLTGEIPIEIGNL  68

Query  35   STLTYINMANN  3
            + LT++ +  N
Sbjct  69   TNLTHLWLYGN  79



>ref|XP_006830630.1| hypothetical protein AMTR_s00120p00096470 [Amborella trichopoda]
 gb|ERM98046.1| hypothetical protein AMTR_s00120p00096470 [Amborella trichopoda]
Length=1164

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +   SSL  L + DN+L G +P+EIG L+ LN L+L++N LSGEIP EIGN+  
Sbjct  493  GEIPKEVRHGSSLVRLRLGDNRLGGQIPKEIGGLSSLNFLELSDNQLSGEIPVEIGNITH  552

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L NN+LEGT+P ++ +++ L  ++++ N
Sbjct  553  LQMLNLSNNSLEGTLPTSLTSLAGLQVLDVSMN  585


 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  SSL +L + DNQL+G +P EIGN+T L  L L+ NSL G +P  + +L  
Sbjct  517  GQIPKEIGGLSSLNFLELSDNQLSGEIPVEIGNITHLQMLNLSNNSLEGTLPTSLTSLAG  576

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L +  N + G IPE    + +L  ++++ N
Sbjct  577  LQVLDVSMNRITGQIPEAFGELKSLNKLSLSGN  609


 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP   G    L+ L ++   L+G +P E+GN + L NL L EN LSG IP E+G L  
Sbjct  277  GSIPPEFGRLQRLQTLSIYTAMLSGPIPPELGNCSELMNLYLYENELSGSIPPELGKLQK  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ + L  NN  GTIP+ + N  +L  ++++ N
Sbjct  337  LQKMLLWQNNFVGTIPKELGNCRSLRMVDLSIN  369


 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G CS L  LY+++N+L+GS+P E+G L  L  + L +N+  G IP+E+GN   
Sbjct  301  GPIPPELGNCSELMNLYLYENELSGSIPPELGKLQKLQKMLLWQNNFVGTIPKELGNCRS  360

Query  101  LQILRLDNNNLEGTIPETIFN  39
            L+++ L  N+L G+IP +  N
Sbjct  361  LRMVDLSINSLSGSIPLSFGN  381


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG+ SSL+ L +  NQL G +P EI   T L  L + +N LSG IP EIG ++ 
Sbjct  180  GEIPSSIGKLSSLQNLILNSNQLQGGIPVEITQCTSLRQLLIFDNKLSGNIPAEIGRISS  239

Query  101  LQILRL-DNNNLEGTIPETIFNISTLTYINMAN  6
            L++LR   N ++EG IP  +     LT + +A+
Sbjct  240  LEVLRAGGNQDIEGEIPIGLAMCQNLTILGLAD  272


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G+   L+ + +W N   G++P+E+GN   L  + L+ NSLSG IP   GNL  
Sbjct  325  GSIPPELGKLQKLQKMLLWQNNFVGTIPKELGNCRSLRMVDLSINSLSGSIPLSFGNLLE  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +NN+ G+IP  + N + L+ + + NN
Sbjct  385  LSELMLSDNNVSGSIPSVLANCAGLSQLQLDNN  417


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  + E  +L  L +  N L+G +P+E+ + + L  L+L +N L G+IP+EIG L+ 
Sbjct  469  GSIPPGLFELRNLTKLLLLSNDLSGEIPKEVRHGSSLVRLRLGDNRLGGQIPKEIGGLSS  528

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G IP  I NI+ L  +N++NN
Sbjct  529  LNFLELSDNQLSGEIPVEIGNITHLQMLNLSNN  561


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 58/117 (50%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTEN---------------  147
            G IP+ IG+ S L   + W N+L GS+P  + +   L  L L+ N               
Sbjct  421  GPIPQEIGQLSHLTVFFAWQNRLEGSIPVFLSDCASLQALDLSHNRLTGSIPPGLFELRN  480

Query  146  ---------SLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                      LSGEIP+E+ + + L  LRL +N L G IP+ I  +S+L ++ +++N
Sbjct  481  LTKLLLLSNDLSGEIPKEVRHGSSLVRLRLGDNRLGGQIPKEIGGLSSLNFLELSDN  537


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S G    L  L + DN ++GS+P  + N   L+ LQL  N +SG IP+EIG L+ 
Sbjct  373  GSIPLSFGNLLELSELMLSDNNVSGSIPSVLANCAGLSQLQLDNNQISGPIPQEIGQLSH  432

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +     N LEG+IP  + + ++L  +++++N
Sbjct  433  LTVFFAWQNRLEGSIPVFLSDCASLQALDLSHN  465


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G C SL  + +  N L+GS+P   GNL  L+ L L++N++SG IP  + N   
Sbjct  349  GTIPKELGNCRSLRMVDLSINSLSGSIPLSFGNLLELSELMLSDNNVSGSIPSVLANCAG  408

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L  L+LDNN + G IP+ I  +S LT  
Sbjct  409  LSQLQLDNNQISGPIPQEIGQLSHLTVF  436


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +  C+ L  L + +NQ++G +P+EIG L+ L      +N L G IP  + +   
Sbjct  397  GSIPSVLANCAGLSQLQLDNNQISGPIPQEIGQLSHLTVFFAWQNRLEGSIPVFLSDCAS  456

Query  101  LQILRLDNNNLEGTIPETIF  42
            LQ L L +N L G+IP  +F
Sbjct  457  LQALDLSHNRLTGSIPPGLF  476


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  +     L+ L +    L G +P E+GN + L +L L+ N L+GEIP  IG L+ LQ
Sbjct  134  VPTQLRPLLHLQKLVISGANLTGKIPPEVGNYSQLVHLDLSSNRLTGEIPSSIGKLSSLQ  193

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L++N L+G IP  I   ++L  + + +N
Sbjct  194  NLILNSNQLQGGIPVEITQCTSLRQLLIFDN  224


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +  C +L  L + D +++GS+P E G L  L  L +    LSG IP E+GN + 
Sbjct  253  GEIPIGLAMCQNLTILGLADTKISGSIPPEFGRLQRLQTLSIYTAMLSGPIPPELGNCSE  312

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L  L L  N L G+IP  +  +  L
Sbjct  313  LMNLYLYENELSGSIPPELGKLQKL  337


 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP + GE  SL  L +  N  NGS+P  +   + L  L L+ N LSG+IP E+G +  
Sbjct  589  GQIPEAFGELKSLNKLSLSGNYFNGSIPTPLSLCSSLQLLDLSNNRLSGKIPAELGRIQA  648

Query  101  LQI-LRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L I L L  N+L G IP  +  ++ L+ +++++N
Sbjct  649  LDIALNLSQNSLSGEIPNELSTLTKLSILDLSHN  682


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ L + +N L G+LP  + +L  L  L ++ N ++G+IP   G L  
Sbjct  541  GEIPVEIGNITHLQMLNLSNNSLEGTLPTSLTSLAGLQVLDVSMNRITGQIPEAFGELKS  600

Query  101  LQILRLDNNNLEGTIP  54
            L  L L  N   G+IP
Sbjct  601  LNKLSLSGNYFNGSIP  616



>gb|AAX19030.1| Hcr2-p7.1 [Solanum pimpinellifolium]
Length=487

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S G  S+L +L++++NQL  S+P EIG L  LN L L+EN+L+G IP  +GNLN 
Sbjct  373  GFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASLGNLNN  432

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LT +++ NN
Sbjct  433  LSSLYLYNNQLSGSIPEEIGYLSSLTELHLGNN  465


 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ + ++ NQLNG +P+EIG L  L  L L  N LSG IP  +GNLN 
Sbjct  133  GTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNN  192

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY++++ N
Sbjct  193  LSFLYLYNNQLSGSIPEEICYLRSLTYLDLSEN  225


 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +L+++ NQL+GS+P EIG L  LN L L+EN+L+G IP  +GNL  
Sbjct  229  GSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKN  288

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IP ++ N++ L+ + + NN
Sbjct  289  LSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNN  321


 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G   +L  L + +NQL+GS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  277  GSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNN  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LTY++++NN
Sbjct  337  LSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNN  369


 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +LY+++NQL+GS+P EI  L  L  L L+EN+L+G IP  +GNLN 
Sbjct  181  GSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNN  240

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IPE I  + +L  + ++ N
Sbjct  241  LSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSEN  273


 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P  +GNL  L+ L L  N LSG IP EIG L+ 
Sbjct  301  GSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSS  360

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN++ G IP +  N+S L ++ +  N
Sbjct  361  LTYLDLSNNSINGFIPASFGNMSNLAFLFLYEN  393


 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L + +N LNGS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  253  GSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNN  312

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L NN L G+IP ++ N++ L+ + + NN
Sbjct  313  LSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNN  345


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I    SL YL + +N LNGS+P  +GNL  L+ L L  N LSG IP EIG L  
Sbjct  205  GSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRS  264

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G+IP ++ N+  L+ +N+ NN
Sbjct  265  LNVLGLSENALNGSIPASLGNLKNLSRLNLVNN  297


 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L+ NS++G IP   GN++ 
Sbjct  325  GSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSN  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L  ++PE I  + +L  ++++ N
Sbjct  385  LAFLFLYENQLASSVPEEIGYLRSLNVLDLSEN  417


 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  IG   SL  L + +N LNGS+P  +GNL  L++L L  N LSG IP EIG L+ L 
Sbjct  399  VPEEIGYLRSLNVLDLSENALNGSIPASLGNLNNLSSLYLYNNQLSGSIPEEIGYLSSLT  458

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINM  12
             L L NN+L G+IP ++ N++ L+ +++
Sbjct  459  ELHLGNNSLNGSIPASLGNLNNLSSLDV  486


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L YL + +NQ++G++P +IG L  L  +++  N L+G IP+EIG L  
Sbjct  109  GTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRS  168

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ + NN
Sbjct  169  LTKLSLGINFLSGSIPASVGNLNNLSFLYLYNN  201


 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L  NSL+G IP  +GNLN 
Sbjct  421  GSIPASLGNLNNLSSLYLYNNQLSGSIPEEIGYLSSLTELHLGNNSLNGSIPASLGNLNN  480

Query  101  LQILRLD  81
            L  L + 
Sbjct  481  LSSLDVH  487


 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL  L +  N L+GS+P  +GNL  L+ L L  N LSG IP EI  L  
Sbjct  157  GFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRS  216

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ +  N
Sbjct  217  LTYLDLSENALNGSIPASLGNLNNLSFLFLYGN  249


 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE L +  N + G++P EIGNLT L  L L  N +SG IP +IG L  LQI+R+ +N L 
Sbjct  97   LENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLN  156

Query  65   GTIPETIFNISTLTYINMANN  3
            G IP+ I  + +LT +++  N
Sbjct  157  GFIPKEIGYLRSLTKLSLGIN  177



>gb|AAX19031.1| Hcr2-p7.2 [Solanum pimpinellifolium]
Length=487

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S G  S+L +L++++NQL  S+P EIG L  LN L L+EN+L+G IP  +GNLN 
Sbjct  373  GFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASLGNLNN  432

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LT +++ NN
Sbjct  433  LSSLYLYNNQLSGSIPEEIGYLSSLTELHLGNN  465


 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ + ++ NQLNG +P+EIG L  L  L L  N LSG IP  +GNLN 
Sbjct  133  GTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNN  192

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY++++ N
Sbjct  193  LSFLYLYNNQLSGSIPEEICYLRSLTYLDLSEN  225


 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +L+++ NQL+GS+P EIG L  LN L L+EN+L+G IP  +GNL  
Sbjct  229  GSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKN  288

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IP ++ N++ L+ + + NN
Sbjct  289  LSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNN  321


 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G   +L  L + +NQL+GS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  277  GSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNN  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LTY++++NN
Sbjct  337  LSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNN  369


 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +LY+++NQL+GS+P EI  L  L  L L+EN+L+G IP  +GNLN 
Sbjct  181  GSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNN  240

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IPE I  + +L  + ++ N
Sbjct  241  LSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSEN  273


 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P  +GNL  L+ L L  N LSG IP EIG L+ 
Sbjct  301  GSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSS  360

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN++ G IP +  N+S L ++ +  N
Sbjct  361  LTYLDLSNNSINGFIPASFGNMSNLAFLFLYEN  393


 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L + +N LNGS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  253  GSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNN  312

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L NN L G+IP ++ N++ L+ + + NN
Sbjct  313  LSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNN  345


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I    SL YL + +N LNGS+P  +GNL  L+ L L  N LSG IP EIG L  
Sbjct  205  GSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRS  264

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G+IP ++ N+  L+ +N+ NN
Sbjct  265  LNVLGLSENALNGSIPASLGNLKNLSRLNLVNN  297


 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L+ NS++G IP   GN++ 
Sbjct  325  GSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSN  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L  ++PE I  + +L  ++++ N
Sbjct  385  LAFLFLYENQLASSVPEEIGYLRSLNVLDLSEN  417


 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  IG   SL  L + +N LNGS+P  +GNL  L++L L  N LSG IP EIG L+ L 
Sbjct  399  VPEEIGYLRSLNVLDLSENALNGSIPASLGNLNNLSSLYLYNNQLSGSIPEEIGYLSSLT  458

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINM  12
             L L NN+L G+IP ++ N++ L+ +++
Sbjct  459  ELHLGNNSLNGSIPASLGNLNNLSSLDV  486


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L YL + +NQ++G++P +IG L  L  +++  N L+G IP+EIG L  
Sbjct  109  GTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRS  168

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ + NN
Sbjct  169  LTKLSLGINFLSGSIPASVGNLNNLSFLYLYNN  201


 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L  NSL+G IP  +GNLN 
Sbjct  421  GSIPASLGNLNNLSSLYLYNNQLSGSIPEEIGYLSSLTELHLGNNSLNGSIPASLGNLNN  480

Query  101  LQILRLD  81
            L  L + 
Sbjct  481  LSSLDVH  487


 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL  L +  N L+GS+P  +GNL  L+ L L  N LSG IP EI  L  
Sbjct  157  GFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRS  216

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ +  N
Sbjct  217  LTYLDLSENALNGSIPASLGNLNNLSFLFLYGN  249


 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNL  69
            SLE L +  N + G++P EIGNLT L  L L  N +SG IP +IG L  LQI+R+ +N L
Sbjct  96   SLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQL  155

Query  68   EGTIPETIFNISTLTYINMANN  3
             G IP+ I  + +LT +++  N
Sbjct  156  NGFIPKEIGYLRSLTKLSLGIN  177



>ref|XP_008219741.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Prunus mume]
Length=957

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+G  +SL +LY++ NQL+GS+P+EIGN+  L +L+L+ N+LSG IP  IG+L  
Sbjct  200  GSIPRSLGNLTSLTHLYLYTNQLSGSIPKEIGNMESLEDLELSSNTLSGVIPPNIGHLKK  259

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP+ I N+ +L  + +  N
Sbjct  260  LNTLYLYTNQLSGSIPKEIGNLKSLVDLQLYEN  292


 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG   SL  LY++ N++NGS+PR +GNLT L +L L  N LSG IP+EIGN+  
Sbjct  176  GDIPKEIGNLKSLVELYLYKNKINGSIPRSLGNLTSLTHLYLYTNQLSGSIPKEIGNMES  235

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G IP  I ++  L  + +  N
Sbjct  236  LEDLELSSNTLSGVIPPNIGHLKKLNTLYLYTN  268


 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+ IG   SL  L +++NQLNGS+PR + NLT L NL L    LSG +P EIGN+  
Sbjct  272  GSIPKEIGNLKSLVDLQLYENQLNGSIPRSLCNLTSLTNLYLYATQLSGTVPNEIGNMKS  331

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L IL L  N L G+IP+++ N+ +L  + +  N
Sbjct  332  LVILDLSGNQLSGSIPKSLGNLKSLVDLQLHEN  364


 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +IG    L  LY++ NQL+GS+P+EIGNL  L +LQL EN L+G IPR + NL  
Sbjct  248  GVIPPNIGHLKKLNTLYLYTNQLSGSIPKEIGNLKSLVDLQLYENQLNGSIPRSLCNLTS  307

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L    L GT+P  I N+ +L  ++++ N
Sbjct  308  LTNLYLYATQLSGTVPNEIGNMKSLVILDLSGN  340


 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPRS+   +SL  LY++  QL+G++P EIGN+  L  L L+ N LSG IP+ +GNL  
Sbjct  296  GSIPRSLCNLTSLTNLYLYATQLSGTVPNEIGNMKSLVILDLSGNQLSGSIPKSLGNLKS  355

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+L  N L G+IP +   +S L ++ + +N
Sbjct  356  LVDLQLHENQLRGSIPISFGTLSNLEFLYLRDN  388


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S G  S+LE+LY+ DNQL+GS+P+EI +L  L  LQL  N  SG +P+ I     
Sbjct  368  GSIPISFGTLSNLEFLYLRDNQLSGSIPKEIESLKKLIGLQLDSNQFSGYLPQNICQGGK  427

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L       N+L G IPE++ N ++L  + +  N
Sbjct  428  LTNFTASTNHLTGLIPESLKNCTSLVRVRLNQN  460


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +L +L +++N   G +P+EIGNL  L  L L +N ++G IPR +GNL  
Sbjct  152  GRIPSEIGLLRNLTFLGLYENTFFGDIPKEIGNLKSLVELYLYKNKINGSIPRSLGNLTS  211

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP+ I N+ +L  + +++N
Sbjct  212  LTHLYLYTNQLSGSIPKEIGNMESLEDLELSSN  244


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  IG   SL  L +  NQL+GS+P+ +GNL  L +LQL EN L G IP   G L+ 
Sbjct  320  GTVPNEIGNMKSLVILDLSGNQLSGSIPKSLGNLKSLVDLQLHENQLRGSIPISFGTLSN  379

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G+IP+ I ++  L  + + +N
Sbjct  380  LEFLYLRDNQLSGSIPKEIESLKKLIGLQLDSN  412


 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP  I   S L YL +  NQL+G +P EIG L  L  L L EN+  G+IP+EIGNL  L 
Sbjct  130  IPPQISYLSKLHYLDLSLNQLSGRIPSEIGLLRNLTFLGLYENTFFGDIPKEIGNLKSLV  189

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L  N + G+IP ++ N+++LT++ +  N
Sbjct  190  ELYLYKNKINGSIPRSLGNLTSLTHLYLYTN  220


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP+S+G   SL  L + +NQL GS+P   G L+ L  L L +N LSG IP+EI +L  
Sbjct  344  GSIPKSLGNLKSLVDLQLHENQLRGSIPISFGTLSNLEFLYLRDNQLSGSIPKEIESLKK  403

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L+LD+N   G +P+ I     LT    + N
Sbjct  404  LIGLQLDSNQFSGYLPQNICQGGKLTNFTASTN  436


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
            +IP ++G+   L YL + +N++  ++P ++G L  L +L L+ NSL G IP E+ N+  L
Sbjct  585  SIPSTLGDLFRLHYLNLSNNKMAQAVPIKLGKLFQLTDLDLSHNSLEGRIPSEMSNMESL  644

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              L L +NNL G IP +  ++  L+Y++++ N
Sbjct  645  VSLNLSHNNLSGFIPTSFEDMYGLSYVDISYN  676


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP  IG  + +  L +  N L G +P+E G LT L  L L  N LSG IP E+G+L  
Sbjct  512  GNIPPEIGIGTQINGLDLSLNNLVGMIPKEFGRLTPLVKLMLNGNQLSGRIPLELGSLID  571

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N    +IP T+ ++  L Y+N++NN
Sbjct  572  LEYLDLSTNKFNESIPSTLGDLFRLHYLNLSNN  604


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G    LEYL +  N+ N S+P  +G+L  L+ L L+ N ++  +P ++G L  
Sbjct  560  GRIPLELGSLIDLEYLDLSTNKFNESIPSTLGDLFRLHYLNLSNNKMAQAVPIKLGKLFQ  619

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N+LEG IP  + N+ +L  +N+++N
Sbjct  620  LTDLDLSHNSLEGRIPSEMSNMESLVSLNLSHN  652


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G I    G+C  L+ L +  N L G++P EIG  T +N L L+ N+L G IP+E G L  
Sbjct  488  GEISYKWGQCPQLKTLRLAGNNLTGNIPPEIGIGTQINGLDLSLNNLVGMIPKEFGRLTP  547

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N L G IP  + ++  L Y++++ N
Sbjct  548  LVKLMLNGNQLSGRIPLELGSLIDLEYLDLSTN  580


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+  G  + L  L +  NQL+G +P E+G+L  L  L L+ N  +  IP  +G+L  
Sbjct  536  GMIPKEFGRLTPLVKLMLNGNQLSGRIPLELGSLIDLEYLDLSTNKFNESIPSTLGDLFR  595

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN +   +P  +  +  LT +++++N
Sbjct  596  LHYLNLSNNKMAQAVPIKLGKLFQLTDLDLSHN  628


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+  C+SL  + +  NQL G++  + G    L+ + ++ N+L GEI  + G    
Sbjct  440  GLIPESLKNCTSLVRVRLNQNQLTGNISEDFGVYPNLDFIDVSHNNLYGEISYKWGQCPQ  499

Query  101  LQILRLDNNNLEGTIPETI  45
            L+ LRL  NNL G IP  I
Sbjct  500  LKTLRLAGNNLTGNIPPEI  518


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE+L +  N+L  ++P +I  L+ L+ L L+ N LSG IP EIG L  L  L L  N   
Sbjct  116  LEHLDLNRNKLFDAIPPQISYLSKLHYLDLSLNQLSGRIPSEIGLLRNLTFLGLYENTFF  175

Query  65   GTIPETIFNISTLTYINMANN  3
            G IP+ I N+ +L  + +  N
Sbjct  176  GDIPKEIGNLKSLVELYLYKN  196



>emb|CAC20842.1| receptor protein kinase [Pinus sylvestris]
Length=1145

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G+   LE LY+WDN+L+GS+P E+G+ + L  + L+ NSLSG IP   G+L  
Sbjct  307  GAIPRELGKLQKLEKLYLWDNELDGSIPAELGSCSSLKFVDLSTNSLSGSIPDSFGSLKN  366

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L + +NN+ G+IP  + N + LT I + NN
Sbjct  367  LSELEITDNNVSGSIPAALANCTELTQIQLYNN  399


 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G CS L  LY+++N+L+G++PRE+G L  L  L L +N L G IP E+G+ + 
Sbjct  283  GTIPAELGNCSELVNLYLYENRLSGAIPRELGKLQKLEKLYLWDNELDGSIPAELGSCSS  342

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L  N+L G+IP++  ++  L+ + + +N
Sbjct  343  LKFVDLSTNSLSGSIPDSFGSLKNLSELEITDN  375


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S G    L+ L ++   L+G++P E+GN + L NL L EN LSG IPRE+G L  
Sbjct  259  GKIPLSFGSLKKLQTLAIYTAFLSGTIPAELGNCSELVNLYLYENRLSGAIPRELGKLQK  318

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L+G+IP  + + S+L +++++ N
Sbjct  319  LEKLYLWDNELDGSIPAELGSCSSLKFVDLSTN  351


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++  C+ L  + +++NQ++G +P E+G L  L  L L +N+L G IP  +G+ + 
Sbjct  379  GSIPAALANCTELTQIQLYNNQISGQMPAELGALKKLTVLFLWQNNLEGPIPSSLGSCDN  438

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +N L G+IP ++F I  LT + + +N
Sbjct  439  LQSLDLSHNRLTGSIPPSLFEIKNLTKLLLLSN  471


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  NIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNML  99
             IPR IG+  +L +L +  NQ +GS+P EIG  + L  L L  N L GE+PR +G L+ L
Sbjct  500  QIPREIGKLENLVFLDLAMNQFSGSIPAEIGGCSQLQMLDLHGNRLGGELPRALGFLHGL  559

Query  98   QILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            Q++ L  N L G IP  + N+  LT + +  N
Sbjct  560  QVVDLSANELTGLIPANLGNLVALTKLTLNGN  591


 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S G   +L  L + DN ++GS+P  + N T L  +QL  N +SG++P E+G L  
Sbjct  355  GSIPDSFGSLKNLSELEITDNNVSGSIPAALANCTELTQIQLYNNQISGQMPAELGALKK  414

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  NNLEG IP ++ +   L  +++++N
Sbjct  415  LTVLFLWQNNLEGPIPSSLGSCDNLQSLDLSHN  447


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G CSSL+++ +  N L+GS+P   G+L  L+ L++T+N++SG IP  + N   
Sbjct  331  GSIPAELGSCSSLKFVDLSTNSLSGSIPDSFGSLKNLSELEITDNNVSGSIPAALANCTE  390

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  ++L NN + G +P  +  +  LT + +  N
Sbjct  391  LTQIQLYNNQISGQMPAELGALKKLTVLFLWQN  423


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+ E  +L  L +  N+L G+LP EIGN   L+ L+L  N L  +IPREIG L  
Sbjct  451  GSIPPSLFEIKNLTKLLLLSNELTGALPPEIGNCVALSRLRLGNNRLLNQIPREIGKLEN  510

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N   G+IP  I   S L  +++  N
Sbjct  511  LVFLDLAMNQFSGSIPAEIGGCSQLQMLDLHGN  543


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG CS L+ L +  N+L G LPR +G L  L  + L+ N L+G IP  +GNL  
Sbjct  523  GSIPAEIGGCSQLQMLDLHGNRLGGELPRALGFLHGLQVVDLSANELTGLIPANLGNLVA  582

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L+ N L G IP  I   + L  ++++ N
Sbjct  583  LTKLTLNGNALSGAIPWEISRCTNLQLLDLSLN  615


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  IG C +L  L + +N+L   +PREIG L  L  L L  N  SG IP EIG  + 
Sbjct  475  GALPPEIGNCVALSRLRLGNNRLLNQIPREIGKLENLVFLDLAMNQFSGSIPAEIGGCSQ  534

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  N L G +P  +  +  L  ++++ N
Sbjct  535  LQMLDLHGNRLGGELPRALGFLHGLQVVDLSAN  567


 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G C +L+ L +  N+L GS+P  +  +  L  L L  N L+G +P EIGN   
Sbjct  427  GPIPSSLGSCDNLQSLDLSHNRLTGSIPPSLFEIKNLTKLLLLSNELTGALPPEIGNCVA  486

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL NN L   IP  I  +  L ++++A N
Sbjct  487  LSRLRLGNNRLLNQIPREIGKLENLVFLDLAMN  519


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SLE L +  N+L G++P EI  L  L +L L  N L G IP EIGN + 
Sbjct  138  GSIPAEIGGYESLEILDLSGNRLRGNIPAEISKLKNLKSLILNSNQLQGSIPAEIGNCHN  197

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L + +N L G IP  +  ++ L       N
Sbjct  198  LVDLVVFDNQLSGKIPAELGRLANLEVFRAGGN  230


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 55/118 (47%), Gaps = 25/118 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIG-------------------------NLT  177
            G+IP  IG C +L  L ++DNQL+G +P E+G                         N T
Sbjct  186  GSIPAEIGNCHNLVDLVVFDNQLSGKIPAELGRLANLEVFRAGGNENIEGTLPDELSNCT  245

Query  176  MLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L  L L E ++SG+IP   G+L  LQ L +    L GTIP  + N S L  + +  N
Sbjct  246  NLVTLGLAETNISGKIPLSFGSLKKLQTLAIYTAFLSGTIPAELGNCSELVNLYLYEN  303


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P       SL  L +    L GS+P EIG    L  L L+ N L G IP EI  L  
Sbjct  114  GNVPSQFAVLGSLRSLVISAANLTGSIPAEIGGYESLEILDLSGNRLRGNIPAEISKLKN  173

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L++N L+G+IP  I N   L  + + +N
Sbjct  174  LKSLILNSNQLQGSIPAEIGNCHNLVDLVVFDN  206


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR++G    L+ + +  N+L G +P  +GNL  L  L L  N+LSG IP EI     
Sbjct  547  GELPRALGFLHGLQVVDLSANELTGLIPANLGNLVALTKLTLNGNALSGAIPWEISRCTN  606

Query  101  LQILRLDNNNLEGTIP  54
            LQ+L L  N   G IP
Sbjct  607  LQLLDLSLNRFSGQIP  622


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++G   +L  L +  N L+G++P EI   T L  L L+ N  SG+IP E+G    
Sbjct  571  GLIPANLGNLVALTKLTLNGNALSGAIPWEISRCTNLQLLDLSLNRFSGQIPPEMGKCKR  630

Query  101  LQI-LRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+I L L  NNL G+IP     ++ L  +++++N
Sbjct  631  LEIALNLSWNNLSGSIPAQFSGLTKLASLDLSHN  664



>ref|XP_006279918.1| hypothetical protein CARUB_v10025776mg [Capsella rubella]
 gb|EOA12816.1| hypothetical protein CARUB_v10025776mg [Capsella rubella]
Length=1101

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G+  SLEYLY++ N LNG++PREIGNL+    +  +EN+L+GEIP E+GN+  
Sbjct  280  GPIPKELGDLVSLEYLYLYRNGLNGTIPREIGNLSNAIEIDFSENALTGEIPLELGNIEG  339

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N L GTIP  +  +  LT ++++ N
Sbjct  340  LELLHLFENKLTGTIPVELTTLKNLTKLDLSIN  372


 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 63/117 (54%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR +G CS+L+ L + DN   G LPREIG L+ L  L ++ N L+GEIP EI N  M
Sbjct  496  GSIPREVGNCSALQRLQLADNGFTGELPREIGTLSQLGTLNISSNKLTGEIPSEIFNCKM  555

Query  101  LQ------------------------ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ                        +L+L NNNL GTIP  + N+S LT + M  N
Sbjct  556  LQRLDMCCNNFSGTLPSKVGSLYQLELLKLSNNNLSGTIPVALGNLSRLTELQMGGN  612


 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ +G   +L  + +W+N+ +G +PREI N T L  L L +N L G IP+E+G+L  
Sbjct  232  GELPKEVGMLKNLSQVILWENEFSGFIPREISNCTSLETLALYKNQLVGPIPKELGDLVS  291

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L GTIP  I N+S    I+ + N
Sbjct  292  LEYLYLYRNGLNGTIPREIGNLSNAIEIDFSEN  324


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G  P ++ +  +L  + +  N+  GS+PRE+GN + L  LQL +N  +GE+PREIG L+ 
Sbjct  472  GRFPSNLCKLVNLTAIELGQNRFRGSIPREVGNCSALQRLQLADNGFTGELPREIGTLSQ  531

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L + +N L G IP  IFN   L  ++M  N
Sbjct  532  LGTLNISSNKLTGEIPSEIFNCKMLQRLDMCCN  564


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG+  SLE L +++N+++GSLP EIGNL  L+ L    N++SG++PR IGNL  
Sbjct  136  GEIPVEIGKLESLENLIIYNNRISGSLPVEIGNLLSLSQLVTYSNNISGQLPRSIGNLKR  195

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+  R   N + G++P  I    +L  + +A N
Sbjct  196  LKSFRAGQNMISGSLPSEIGGCESLVMLGLAQN  228


 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG C SL  L +  NQL+G LP+E+G L  L+ + L EN  SG IPREI N   
Sbjct  208  GSLPSEIGGCESLVMLGLAQNQLSGELPKEVGMLKNLSQVILWENEFSGFIPREISNCTS  267

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L G IP+ + ++ +L Y+ +  N
Sbjct  268  LETLALYKNQLVGPIPKELGDLVSLEYLYLYRN  300


 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR I  C+SLE L ++ NQL G +P+E+G+L  L  L L  N L+G IPREIGNL+ 
Sbjct  256  GFIPREISNCTSLETLALYKNQLVGPIPKELGDLVSLEYLYLYRNGLNGTIPREIGNLSN  315

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               +    N L G IP  + NI  L  +++  N
Sbjct  316  AIEIDFSENALTGEIPLELGNIEGLELLHLFEN  348


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP+ IG C SLE L + +NQ  G +P EIG L  L NL +  N +SG +P EIGNL  
Sbjct  112  GNIPKEIGNCLSLEILKLNNNQFEGEIPVEIGKLESLENLIIYNNRISGSLPVEIGNLLS  171

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L   +NN+ G +P +I N+  L       N
Sbjct  172  LSQLVTYSNNISGQLPRSIGNLKRLKSFRAGQN  204


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP  I  C +L  L +  N L G  P  +  L  L  ++L +N   G IPRE+GN + 
Sbjct  448  GNIPTGITTCKTLAQLRLARNNLVGRFPSNLCKLVNLTAIELGQNRFRGSIPREVGNCSA  507

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L+L +N   G +P  I  +S L  +N+++N
Sbjct  508  LQRLQLADNGFTGELPREIGTLSQLGTLNISSN  540


 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PRSIG    L+      N ++GSLP EIG    L  L L +N LSGE+P+E+G L  
Sbjct  184  GQLPRSIGNLKRLKSFRAGQNMISGSLPSEIGGCESLVMLGLAQNQLSGELPKEVGMLKN  243

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L  N   G IP  I N ++L  + +  N
Sbjct  244  LSQVILWENEFSGFIPREISNCTSLETLALYKN  276


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLN-NLQLTENSLSGEIPREIGNLN  105
            G IP ++G  S L  L M  N  +GS+P+E+G+LT L   L L+ N L+GEIP E+ NL 
Sbjct  592  GTIPVALGNLSRLTELQMGGNLFSGSIPQELGSLTGLQIALNLSYNKLTGEIPPELSNLV  651

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ML+ L L+NNNL G IP +  N+S+L   N + N
Sbjct  652  MLEFLLLNNNNLSGEIPSSFANLSSLLGCNFSYN  685


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG   SL  L  + N ++G LPR IGNL  L + +  +N +SG +P EIG    
Sbjct  160  GSLPVEIGNLLSLSQLVTYSNNISGQLPRSIGNLKRLKSFRAGQNMISGSLPSEIGGCES  219

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYI  18
            L +L L  N L G +P+ +  +  L+ +
Sbjct  220  LVMLGLAQNQLSGELPKEVGMLKNLSQV  247


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +  SIG    L++L +  N+L+G++P+EIGN   L  L+L  N   GEIP EIG L  
Sbjct  88   GKLSPSIGGLVHLKFLDLSYNELSGNIPKEIGNCLSLEILKLNNNQFEGEIPVEIGKLES  147

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + NN + G++P  I N+ +L+ +   +N
Sbjct  148  LENLIIYNNRISGSLPVEIGNLLSLSQLVTYSN  180


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I  C  L+ L M  N  +G+LP ++G+L  L  L+L+ N+LSG IP  +GNL+ 
Sbjct  544  GEIPSEIFNCKMLQRLDMCCNNFSGTLPSKVGSLYQLELLKLSNNNLSGTIPVALGNLSR  603

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L  L++  N   G+IP+ + +++ L
Sbjct  604  LTELQMGGNLFSGSIPQELGSLTGL  628


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L+G L   IG L  L  L L+ N LSG IP+EIGN   L+IL+L+NN  EG IP  I  +
Sbjct  86   LSGKLSPSIGGLVHLKFLDLSYNELSGNIPKEIGNCLSLEILKLNNNQFEGEIPVEIGKL  145

Query  35   STLTYINMANN  3
             +L  + + NN
Sbjct  146  ESLENLIIYNN  156


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREI---GNLTMLN-------------------  168
            G IP  +G    LE L++++N+L G++P E+    NLT L+                   
Sbjct  328  GEIPLELGNIEGLELLHLFENKLTGTIPVELTTLKNLTKLDLSINALTGPIPLGFQYLRG  387

Query  167  --NLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               LQL +NSLSG IP ++G  + L +L L +N+L G IP  +   S +  +N+  N
Sbjct  388  LFMLQLFQNSLSGTIPSKLGWYSDLWVLDLSDNHLRGRIPSYLCLHSNMIILNLGAN  444


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 46/96 (48%), Gaps = 6/96 (6%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREI---GNLTMLNNLQLTENSLSGEIPREIGN  111
            G IP  +G  S L  L + DN L G +P  +    N+ +LN   L  N+LSG IP  I  
Sbjct  400  GTIPSKLGWYSDLWVLDLSDNHLRGRIPSYLCLHSNMIILN---LGANNLSGNIPTGITT  456

Query  110  LNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               L  LRL  NNL G  P  +  +  LT I +  N
Sbjct  457  CKTLAQLRLARNNLVGRFPSNLCKLVNLTAIELGQN  492



>gb|AAX19033.1| Hcr2-p7.4 [Solanum pimpinellifolium]
 gb|AAX19034.1| Hcr2-p7.5 [Solanum pimpinellifolium]
Length=487

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S G  S+L +L++++NQL  S+P EIG L  LN L L+EN+L+G IP  +GNLN 
Sbjct  373  GFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASLGNLNN  432

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LT +++ NN
Sbjct  433  LSSLYLYNNQLSGSIPEEIGYLSSLTELHLGNN  465


 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ + ++ NQLNG +P+EIG L  L  L L  N LSG IP  +GNLN 
Sbjct  133  GTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNN  192

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY++++ N
Sbjct  193  LSFLYLYNNQLSGSIPEEICYLRSLTYLDLSEN  225


 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +L+++ NQL+GS+P EIG L  LN L L+EN+L+G IP  +GNL  
Sbjct  229  GSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKN  288

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IP ++ N++ L+ + + NN
Sbjct  289  LSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNN  321


 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G   +L  L + +NQL+GS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  277  GSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNN  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LTY++++NN
Sbjct  337  LSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNN  369


 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +LY+++NQL+GS+P EI  L  L  L L+EN+L+G IP  +GNLN 
Sbjct  181  GSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNN  240

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IPE I  + +L  + ++ N
Sbjct  241  LSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSEN  273


 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P  +GNL  L+ L L  N LSG IP EIG L+ 
Sbjct  301  GSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSS  360

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN++ G IP +  N+S L ++ +  N
Sbjct  361  LTYLDLSNNSINGFIPASFGNMSNLAFLFLYEN  393


 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L + +N LNGS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  253  GSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNN  312

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L NN L G+IP ++ N++ L+ + + NN
Sbjct  313  LSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNN  345


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I    SL YL + +N LNGS+P  +GNL  L+ L L  N LSG IP EIG L  
Sbjct  205  GSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRS  264

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G+IP ++ N+  L+ +N+ NN
Sbjct  265  LNVLGLSENALNGSIPASLGNLKNLSRLNLVNN  297


 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L+ NS++G IP   GN++ 
Sbjct  325  GSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSN  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L  ++PE I  + +L  ++++ N
Sbjct  385  LAFLFLYENQLASSVPEEIGYLRSLNVLDLSEN  417


 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  IG   SL  L + +N LNGS+P  +GNL  L++L L  N LSG IP EIG L+ L 
Sbjct  399  VPEEIGYLRSLNVLDLSENALNGSIPASLGNLNNLSSLYLYNNQLSGSIPEEIGYLSSLT  458

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINM  12
             L L NN+L G+IP ++ N++ L+ +++
Sbjct  459  ELHLGNNSLNGSIPASLGNLNNLSSLDV  486


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L YL + +NQ++G++P +IG L  L  +++  N L+G IP+EIG L  
Sbjct  109  GTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRS  168

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ + NN
Sbjct  169  LTKLSLGINFLSGSIPASVGNLNNLSFLYLYNN  201


 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L  NSL+G IP  +GNLN 
Sbjct  421  GSIPASLGNLNNLSSLYLYNNQLSGSIPEEIGYLSSLTELHLGNNSLNGSIPASLGNLNN  480

Query  101  LQILRLD  81
            L  L + 
Sbjct  481  LSSLDVH  487


 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL  L +  N L+GS+P  +GNL  L+ L L  N LSG IP EI  L  
Sbjct  157  GFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRS  216

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ +  N
Sbjct  217  LTYLDLSENALNGSIPASLGNLNNLSFLFLYGN  249


 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNL  69
            SLE L +  N + G++P EIGNLT L  L L  N +SG IP +IG L  LQI+R+ +N L
Sbjct  96   SLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQL  155

Query  68   EGTIPETIFNISTLTYINMANN  3
             G IP+ I  + +LT +++  N
Sbjct  156  NGFIPKEIGYLRSLTKLSLGIN  177



>ref|XP_010040512.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Eucalyptus grandis]
Length=657

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S+L+++    NQL GS+P  IGNL+ L  +   +N LSG IP+ +G LN 
Sbjct  43   GGIPAELGSLSNLQFVNFAANQLTGSIPSSIGNLSSLEAIYCYQNGLSGIIPQSLGRLNK  102

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L +N L GTIP TIFN+S+LT IN+  N
Sbjct  103  LKVLTLGSNGLSGTIPPTIFNLSSLTEINVRAN  135


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  SSLE +Y + N L+G +P+ +G L  L  L L  N LSG IP  I NL+ 
Sbjct  67   GSIPSSIGNLSSLEAIYCYQNGLSGIIPQSLGRLNKLKVLTLGSNGLSGTIPPTIFNLSS  126

Query  101  LQILRLDNNNLEGTIPETI-FNISTLTYINMANN  3
            L  + +  N + G +PE I F +  L  + +A+N
Sbjct  127  LTEINVRANQIRGNLPEDIGFTLPNLQVLIIASN  160


 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            L YL +  N ++G LP EI NL  L+ L ++ N L  EIP  +GN + L +LRL +N   
Sbjct  237  LIYLDLSRNHMSGVLPMEIRNLKHLDTLDVSRNILDSEIPSSLGNCDGLTVLRLQDNLFH  296

Query  65   GTIPETIFNISTLTYINMANN  3
            G IP++I ++ ++  ++++ N
Sbjct  297  GPIPQSISSLRSIEELDLSVN  317



>ref|XP_010666186.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
Length=1105

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP+ IG  + L  L +W NQL+G++P+EI N T L  L L +N+L GEIP EIGNL  
Sbjct  233  GNIPKEIGLLTKLTELILWGNQLSGTIPKEIANCTNLETLALYQNNLVGEIPAEIGNLKF  292

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L GTIP  I N+S +T I+ + N
Sbjct  293  LKRLYLYRNQLNGTIPREIGNLSLVTEIDFSEN  325


 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG    L+ LY++ NQLNG++PREIGNL+++  +  +EN L+G+IP E GN+  
Sbjct  281  GEIPAEIGNLKFLKRLYLYRNQLNGTIPREIGNLSLVTEIDFSENLLTGKIPAEFGNIKN  340

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G+IP  + +   LT ++++ N
Sbjct  341  LTLLHLFQNQLTGSIPVELTSSRNLTKLDLSIN  373


 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ I  C++LE L ++ N L G +P EIGNL  L  L L  N L+G IPREIGNL++
Sbjct  257  GTIPKEIANCTNLETLALYQNNLVGEIPAEIGNLKFLKRLYLYRNQLNGTIPREIGNLSL  316

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  +    N L G IP    NI  LT +++  N
Sbjct  317  VTEIDFSENLLTGKIPAEFGNIKNLTLLHLFQN  349


 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG C  LEYL +  N+L G++P+EIG LT L  L L  N LSG IP+EI N   
Sbjct  209  GSLPPEIGRCDKLEYLGLAQNELEGNIPKEIGLLTKLTELILWGNQLSGTIPKEIANCTN  268

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NNL G IP  I N+  L  + +  N
Sbjct  269  LETLALYQNNLVGEIPAEIGNLKFLKRLYLYRN  301


 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  SSL+YL + +NQ+ G +P E GNL+ L       N +SG +PR +GNL  
Sbjct  137  GPIPASLGSLSSLQYLNLCNNQIFGPIPEEFGNLSSLVEFVAYTNKISGPLPRSLGNLKQ  196

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ  R    ++ G++P  I     L Y+ +A N
Sbjct  197  LQKFRAGQTSITGSLPPEIGRCDKLEYLGLAQN  229


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP  +  C SL  L +  N L GS P E+  L  L+ ++L +N  SG IP E+GN N 
Sbjct  449  GNIPSGVLNCPSLVQLRLVQNSLTGSFPSEMCKLKNLSAVELGQNKFSGPIPPEVGNCNR  508

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L +NN    +P+ I  +S L   N+++N
Sbjct  509  LQRLDLADNNFVLELPKEIGKLSQLVTFNISSN  541


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L+GSL R IG LT L  L ++ NSL G IP E+GN + LQ L L+NN+ EG IP ++ ++
Sbjct  87   LSGSLERSIGCLTHLIFLDVSFNSLGGSIPHELGNCSSLQSLSLNNNHFEGPIPASLGSL  146

Query  35   STLTYINMANN  3
            S+L Y+N+ NN
Sbjct  147  SSLQYLNLCNN  157


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G  SSL     + N+++G LPR +GNL  L   +  + S++G +P EIG  + 
Sbjct  161  GPIPEEFGNLSSLVEFVAYTNKISGPLPRSLGNLKQLQKFRAGQTSITGSLPPEIGRCDK  220

Query  101  LQILRLDNNNLEGTIPETIFNISTLT  24
            L+ L L  N LEG IP+ I  ++ LT
Sbjct  221  LEYLGLAQNELEGNIPKEIGLLTKLT  246


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++ RSIG  + L +L +  N L GS+P E+GN + L +L L  N   G IP  +G+L+ 
Sbjct  89   GSLERSIGCLTHLIFLDVSFNSLGGSIPHELGNCSSLQSLSLNNNHFEGPIPASLGSLSS  148

Query  101  LQILRLDNNNLEGTIPETIFNISTLT  24
            LQ L L NN + G IPE   N+S+L 
Sbjct  149  LQYLNLCNNQIFGPIPEEFGNLSSLV  174


 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PRS+G    L+        + GSLP EIG    L  L L +N L G IP+EIG L  
Sbjct  185  GPLPRSLGNLKQLQKFRAGQTSITGSLPPEIGRCDKLEYLGLAQNELEGNIPKEIGLLTK  244

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L GTIP+ I N + L  + +  N
Sbjct  245  LTELILWGNQLSGTIPKEIANCTNLETLALYQN  277


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G C+ L+ L + DN     LP+EIG L+ L    ++ N L+G IP +I N  M
Sbjct  497  GPIPPEVGNCNRLQRLDLADNNFVLELPKEIGKLSQLVTFNISSNYLTGRIPIDIINCKM  556

Query  101  LQILRLDNNNLEGTIP  54
            LQ L L  N+ EG +P
Sbjct  557  LQRLDLSFNSFEGVLP  572


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+ P  + +  +L  + +  N+ +G +P E+GN   L  L L +N+   E+P+EIG L+ 
Sbjct  473  GSFPSEMCKLKNLSAVELGQNKFSGPIPPEVGNCNRLQRLDLADNNFVLELPKEIGKLSQ  532

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L    + +N L G IP  I N   L  ++++ N
Sbjct  533  LVTFNISSNYLTGRIPIDIINCKMLQRLDLSFN  565


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 52/99 (53%), Gaps = 25/99 (25%)
 Frame = -1

Query  224  DNQLNGSLPREIGNLTMLNNLQLTENS-------------------------LSGEIPRE  120
            +N+ +G++P  +GNLT L  LQ+  NS                         LSG IP E
Sbjct  588  ENKFSGNIPAALGNLTRLTELQMGGNSFSGPLPSSLGSLSSLQIALNISSNNLSGTIPSE  647

Query  119  IGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +GNL +L+ L L+NN+L G IP T  N+S+L   N++ N
Sbjct  648  LGNLILLEYLYLNNNHLTGGIPSTFGNLSSLLGFNLSYN  686


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G   +L  L+++ NQL GS+P E+ +   L  L L+ N L+G IP     L  
Sbjct  329  GKIPAEFGNIKNLTLLHLFQNQLTGSIPVELTSSRNLTKLDLSINGLTGPIPIGFQYLPQ  388

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L+L +N L G+IP  +   S L  ++ + N
Sbjct  389  MIQLQLFDNALTGSIPRGLGIYSPLWVVDFSAN  421


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR IG  S +  +   +N L G +P E GN+  L  L L +N L+G IP E+ +   
Sbjct  305  GTIPREIGNLSLVTEIDFSENLLTGKIPAEFGNIKNLTLLHLFQNQLTGSIPVELTSSRN  364

Query  101  LQILRLDNNNLEGTIP  54
            L  L L  N L G IP
Sbjct  365  LTKLDLSINGLTGPIP  380


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (51%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP        +  L ++DN L GS+PR +G  + L  +  + N L+G IP  +   + 
Sbjct  377  GPIPIGFQYLPQMIQLQLFDNALTGSIPRGLGIYSPLWVVDFSANLLTGRIPPFLCRHSN  436

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L++N L G IP  + N  +L  + +  N
Sbjct  437  LILLNLESNKLYGNIPSGVLNCPSLVQLRLVQN  469



>gb|AAX19032.1| Hcr2-p7.3 [Solanum pimpinellifolium]
Length=487

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S G  S+L +L++++NQL  S+P EIG L  LN L L+EN+L+G IP  +GNLN 
Sbjct  373  GFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASLGNLNN  432

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LT +++ NN
Sbjct  433  LSSLYLYNNQLSGSIPEEIGYLSSLTELHLGNN  465


 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ + ++ NQLNG +P+EIG L  L  L L  N LSG IP  +GNLN 
Sbjct  133  GTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNN  192

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY++++ N
Sbjct  193  LSFLYLYNNQLSGSIPEEICYLRSLTYLDLSEN  225


 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +L+++ NQL+GS+P EIG L  LN L L+EN+L+G IP  +GNL  
Sbjct  229  GSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKN  288

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IP ++ N++ L+ + + NN
Sbjct  289  LSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNN  321


 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G   +L  L + +NQL+GS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  277  GSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNN  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LTY++++NN
Sbjct  337  LSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNN  369


 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +LY+++NQL+GS+P EI  L  L  L L+EN+L+G IP  +GNLN 
Sbjct  181  GSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNN  240

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IPE I  + +L  + ++ N
Sbjct  241  LSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSEN  273


 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P  +GNL  L+ L L  N LSG IP EIG L+ 
Sbjct  301  GSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSS  360

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN+  G IP +  N+S L ++ +  N
Sbjct  361  LTYLDLSNNSXNGFIPASFGNMSNLAFLFLYEN  393


 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L + +N LNGS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  253  GSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNN  312

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L NN L G+IP ++ N++ L+ + + NN
Sbjct  313  LSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNN  345


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I    SL YL + +N LNGS+P  +GNL  L+ L L  N LSG IP EIG L  
Sbjct  205  GSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRS  264

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G+IP ++ N+  L+ +N+ NN
Sbjct  265  LNVLGLSENALNGSIPASLGNLKNLSRLNLVNN  297


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L+ NS +G IP   GN++ 
Sbjct  325  GSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSXNGFIPASFGNMSN  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L  ++PE I  + +L  ++++ N
Sbjct  385  LAFLFLYENQLASSVPEEIGYLRSLNVLDLSEN  417


 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  IG   SL  L + +N LNGS+P  +GNL  L++L L  N LSG IP EIG L+ L 
Sbjct  399  VPEEIGYLRSLNVLDLSENALNGSIPASLGNLNNLSSLYLYNNQLSGSIPEEIGYLSSLT  458

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINM  12
             L L NN+L G+IP ++ N++ L+ +++
Sbjct  459  ELHLGNNSLNGSIPASLGNLNNLSSLDV  486


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L YL + +NQ++G++P +IG L  L  +++  N L+G IP+EIG L  
Sbjct  109  GTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRS  168

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ + NN
Sbjct  169  LTKLSLGINFLSGSIPASVGNLNNLSFLYLYNN  201


 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L  NSL+G IP  +GNLN 
Sbjct  421  GSIPASLGNLNNLSSLYLYNNQLSGSIPEEIGYLSSLTELHLGNNSLNGSIPASLGNLNN  480

Query  101  LQILRLD  81
            L  L + 
Sbjct  481  LSSLDVH  487


 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL  L +  N L+GS+P  +GNL  L+ L L  N LSG IP EI  L  
Sbjct  157  GFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRS  216

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ +  N
Sbjct  217  LTYLDLSENALNGSIPASLGNLNNLSFLFLYGN  249


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNL  69
            SLE L +  N + G++P EIGNLT L  L L  N +SG IP +IG L  LQI+R+ +N L
Sbjct  96   SLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQL  155

Query  68   EGTIPETIFNISTLTYINMANN  3
             G IP+ I  + +LT +++  N
Sbjct  156  NGFIPKEIGYLRSLTKLSLGIN  177



>ref|XP_002281133.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Vitis vinifera]
 ref|XP_010648487.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Vitis vinifera]
 emb|CBI20837.3| unnamed protein product [Vitis vinifera]
Length=967

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G   SL+++Y+  N L+G +P+EIG LT LN+L L  N+L+GEIP  +GNL+ 
Sbjct  201  GEIPRELGRMKSLKWIYLGYNNLSGGIPKEIGELTSLNHLDLVYNNLTGEIPSSLGNLSD  260

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP +IF++  L  +++++N
Sbjct  261  LHFLFLYQNKLSGSIPPSIFDLKKLISLDLSDN  293


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SI   +SLE+L +  NQL G +PRE+G +  L  + L  N+LSG IP+EIG L  
Sbjct  177  GKIPNSIANITSLEFLTLASNQLVGEIPRELGRMKSLKWIYLGYNNLSGGIPKEIGELTS  236

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  NNL G IP ++ N+S L ++ +  N
Sbjct  237  LNHLDLVYNNLTGEIPSSLGNLSDLHFLFLYQN  269


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+G  S L +L+++ N+L+GS+P  I +L  L +L L++NSLSGEIP  +  L  
Sbjct  249  GEIPSSLGNLSDLHFLFLYQNKLSGSIPPSIFDLKKLISLDLSDNSLSGEIPELVIQLQN  308

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L  N+  G IP  + ++  L  + + +N
Sbjct  309  LEILHLFANDFTGKIPRALASLPRLQILQLWSN  341


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP +I  C SL YL + +N L GS+PR  G+ + L  L L+ N +SGEIP ++G  + 
Sbjct  107  GGIPGNISLCYSLRYLNLSNNNLTGSMPR--GSASGLEALDLSNNVISGEIPADMGLFSR  164

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N L G IP +I NI++L ++ +A+N
Sbjct  165  LKVLDLGGNFLVGKIPNSIANITSLEFLTLASN  197


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+P+S G  S LE L + +NQ +G++P   GNL+ L  L+L+EN LSG+IP E+ +   
Sbjct  465  GNLPQSFG-ASKLENLDLSENQFSGAVPSSFGNLSELMQLKLSENMLSGDIPEELSSCKK  523

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G IP +  ++  L  ++++ N
Sbjct  524  LVSLNLSHNQLSGHIPASFSDMPVLGQLDLSQN  556


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  + +  +LE L+++ N   G +PR + +L  L  LQL  N LSGEIP+ +G  N 
Sbjct  297  GEIPELVIQLQNLEILHLFANDFTGKIPRALASLPRLQILQLWSNKLSGEIPKNLGKQNN  356

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  NNL G IPE++ N   L  + + +N
Sbjct  357  LTVLDLSTNNLSGEIPESLCNSGRLFKLILFSN  389


 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IGE +SL +L +  N L G +P  +GNL+ L+ L L +N LSG IP  I +L  
Sbjct  225  GGIPKEIGELTSLNHLDLVYNNLTGEIPSSLGNLSDLHFLFLYQNKLSGSIPPSIFDLKK  284

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N+L G IPE +  +  L  +++  N
Sbjct  285  LISLDLSDNSLSGEIPELVIQLQNLEILHLFAN  317


 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L+ L +  N L G +P  I N+T L  L L  N L GEIPRE+G +  
Sbjct  153  GEIPADMGLFSRLKVLDLGGNFLVGKIPNSIANITSLEFLTLASNQLVGEIPRELGRMKS  212

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L  NNL G IP+ I  +++L ++++  N
Sbjct  213  LKWIYLGYNNLSGGIPKEIGELTSLNHLDLVYN  245


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR++     L+ L +W N+L+G +P+ +G    L  L L+ N+LSGEIP  + N   
Sbjct  321  GKIPRALASLPRLQILQLWSNKLSGEIPKNLGKQNNLTVLDLSTNNLSGEIPESLCNSGR  380

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N+LEG +P+++ +  +L  + + +N
Sbjct  381  LFKLILFSNSLEGEVPKSLSDCRSLRRVRLQSN  413


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P S G  S L  L + +N L+G +P E+ +   L +L L+ N LSG IP    ++ +
Sbjct  488  GAVPSSFGNLSELMQLKLSENMLSGDIPEELSSCKKLVSLNLSHNQLSGHIPASFSDMPV  547

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G IP  +  + +L  +N++NN
Sbjct  548  LGQLDLSQNQLSGKIPPNLGRVESLVQVNLSNN  580


 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +  C  L  L +  NQL+G +P    ++ +L  L L++N LSG+IP  +G +  
Sbjct  512  GDIPEELSSCKKLVSLNLSHNQLSGHIPASFSDMPVLGQLDLSQNQLSGKIPPNLGRVES  571

Query  101  LQILRLDNNNLEGTIPET  48
            L  + L NN+L G++P T
Sbjct  572  LVQVNLSNNHLHGSLPST  589


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SI +   L  L + DN L+G +P  +  L  L  L L  N  +G+IPR + +L  
Sbjct  273  GSIPPSIFDLKKLISLDLSDNSLSGEIPELVIQLQNLEILHLFANDFTGKIPRALASLPR  332

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQIL+L +N L G IP+ +   + LT ++++ N
Sbjct  333  LQILQLWSNKLSGEIPKNLGKQNNLTVLDLSTN  365


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+     L  L ++ N L G +P+ + +   L  ++L  N  SGE+  E   L +
Sbjct  369  GEIPESLCNSGRLFKLILFSNSLEGEVPKSLSDCRSLRRVRLQSNHFSGELSSEFMKLPL  428

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +  L + +NNL G I +  +++ +L  +++A N
Sbjct  429  VYFLDISDNNLTGKISDRRWDMPSLQMLSLARN  461


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 52/93 (56%), Gaps = 1/93 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+S+ +C SL  + +  N  +G L  E   L ++  L +++N+L+G+I     ++  
Sbjct  393  GEVPKSLSDCRSLRRVRLQSNHFSGELSSEFMKLPLVYFLDISDNNLTGKISDRRWDMPS  452

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L  N   G +P++ F  S L  ++++ N
Sbjct  453  LQMLSLARNRFFGNLPQS-FGASKLENLDLSEN  484



>ref|XP_006358724.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=1084

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +    +L +LY+W NQ +G +P  + NLT L  L L  N L GEIPREIG+L  
Sbjct  137  GAIPPFLSLLPNLRFLYLWSNQFSGKIPSSLSNLTKLEVLSLRNNFLEGEIPREIGDLRY  196

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G+IP +IFNI+T+  I ++NN
Sbjct  197  LTFLDLQDNQLTGSIPTSIFNITTMQNIGLSNN  229


 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++ +C +L+ L +  N+  G++PRE+ NLT L  L +    L GEIP E+GNL  
Sbjct  258  GVIPPTLEKCRNLQVLSLSLNEFTGTVPRELANLTALTRLYIATLHLEGEIPAELGNLEK  317

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L  N   G++P +IFN+S L  + ++ N
Sbjct  318  LQRLILAENGFTGSVPASIFNMSALKILELSIN  350


 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+   + LE L + +N L G +PREIG+L  L  L L +N L+G IP  I N+  
Sbjct  161  GKIPSSLSNLTKLEVLSLRNNFLEGEIPREIGDLRYLTFLDLQDNQLTGSIPTSIFNITT  220

Query  101  LQILRLDNNNLEGTIPETI  45
            +Q + L NNNL G +P TI
Sbjct  221  MQNIGLSNNNLTGKLPTTI  239


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +   ++L  LY+    L G +P E+GNL  L  L L EN  +G +P  I N++ 
Sbjct  282  GTVPRELANLTALTRLYIATLHLEGEIPAELGNLEKLQRLILAENGFTGSVPASIFNMSA  341

Query  101  LQILRLDNNNLEGTIPETI  45
            L+IL L  NNL GT+P  +
Sbjct  342  LKILELSINNLSGTLPSDL  360


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  +G  +SL  L++ +N L+  LP  +G+L  L    ++ N LSGEIP E GNL  
Sbjct  552  GSVPSCLGNVTSLRKLHLANNNLDSRLPSSLGSLQDLIEFDISSNLLSGEIPLESGNLKA  611

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              ++ L  N   G IP T+  +  L  +++A+N
Sbjct  612  ATLIDLSRNYFSGKIPSTLGGLDKLINLSLAHN  644


 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++    SL+ LY+  N++ G++P  I +L  L  L L+EN  SG +P  +GN+  
Sbjct  504  GHIPDTVHGMLSLQELYLLSNKIEGTIPDVICSLKNLGALDLSENHFSGSVPSCLGNVTS  563

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NNNL+  +P ++ ++  L   ++++N
Sbjct  564  LRKLHLANNNLDSRLPSSLGSLQDLIEFDISSN  596


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P S+G    L    +  N L+G +P E GNL     + L+ N  SG+IP  +G L+ L 
Sbjct  578  LPSSLGSLQDLIEFDISSNLLSGEIPLESGNLKAATLIDLSRNYFSGKIPSTLGGLDKLI  637

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L L +N LEG IPE+   + +L Y++++ N
Sbjct  638  NLSLAHNRLEGPIPESFGKMLSLEYLDLSYN  668


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 57/117 (49%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNL---------------------TMLNN  165
            G IP  IG  S L  L + DN  +G LP E  +L                     ++L N
Sbjct  89   GTIPPHIGNLSFLVSLDISDNTFHGGLPEEFAHLRRLKVISVASNNFTGAIPPFLSLLPN  148

Query  164  LQ---LTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+   L  N  SG+IP  + NL  L++L L NN LEG IP  I ++  LT++++ +N
Sbjct  149  LRFLYLWSNQFSGKIPSSLSNLTKLEVLSLRNNFLEGEIPREIGDLRYLTFLDLQDN  205


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P S+G  S SL+       +L G++P+EIGNLT + ++ L  N L G IP  +  + 
Sbjct  455  GVLPPSVGNLSKSLDSFDGNGCKLKGAIPQEIGNLTGMTSMSLYNNELIGHIPDTVHGML  514

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L +N +EGTIP+ I ++  L  ++++ N
Sbjct  515  SLQELYLLSNKIEGTIPDVICSLKNLGALDLSEN  548


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG  + +  + +++N+L G +P  +  +  L  L L  N + G IP  I +L  
Sbjct  480  GAIPQEIGNLTGMTSMSLYNNELIGHIPDTVHGMLSLQELYLLSNKIEGTIPDVICSLKN  539

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N+  G++P  + N+++L  +++ANN
Sbjct  540  LGALDLSENHFSGSVPSCLGNVTSLRKLHLANN  572


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  218  QLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFN  39
            QL+G++P  IGNL+ L +L +++N+  G +P E  +L  L+++ + +NN  G IP  +  
Sbjct  86   QLHGTIPPHIGNLSFLVSLDISDNTFHGGLPEEFAHLRRLKVISVASNNFTGAIPPFLSL  145

Query  38   ISTLTYINMANN  3
            +  L ++ + +N
Sbjct  146  LPNLRFLYLWSN  157


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 58/142 (41%), Gaps = 49/142 (35%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGE----------  132
            G IPR IG+   L +L + DNQL GS+P  I N+T + N+ L+ N+L+G+          
Sbjct  185  GEIPREIGDLRYLTFLDLQDNQLTGSIPTSIFNITTMQNIGLSNNNLTGKLPTTICDHLP  244

Query  131  ---------------------------------------IPREIGNLNMLQILRLDNNNL  69
                                                   +PRE+ NL  L  L +   +L
Sbjct  245  HLEGLYISKNYLSGVIPPTLEKCRNLQVLSLSLNEFTGTVPRELANLTALTRLYIATLHL  304

Query  68   EGTIPETIFNISTLTYINMANN  3
            EG IP  + N+  L  + +A N
Sbjct  305  EGEIPAELGNLEKLQRLILAEN  326


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G   +   + +  N  +G +P  +G L  L NL L  N L G IP   G +  
Sbjct  600  GEIPLESGNLKAATLIDLSRNYFSGKIPSTLGGLDKLINLSLAHNRLEGPIPESFGKMLS  659

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  NNL G IP+++  +  L  +N + N
Sbjct  660  LEYLDLSYNNLSGQIPKSLEALVYLKNMNFSFN  692


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G IP  +G    L+ L + +N   GS+P  I N++ L  L+L+ N+LSG +P ++G  + 
Sbjct  306  GEIPAELGNLEKLQRLILAENGFTGSVPASIFNMSALKILELSINNLSGTLPSDLGRGMP  365

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L     NL G I ++I N S L  I++  N
Sbjct  366  NLEGLYCAATNLTGFISDSISNSSKLREIDLTVN  399


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++G    L  L +  N+L G +P   G +  L  L L+ N+LSG+IP+ +  L  
Sbjct  624  GKIPSTLGGLDKLINLSLAHNRLEGPIPESFGKMLSLEYLDLSYNNLSGQIPKSLEALVY  683

Query  101  LQILRLDNNNLEGTIP  54
            L+ +    N L G IP
Sbjct  684  LKNMNFSFNKLSGEIP  699



>ref|XP_006494331.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like [Citrus sinensis]
Length=857

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP ++  C  L  + +  NQ  G +PR++GN T L  L L+ N+L GEIP+EIG+L  
Sbjct  20   GPIPNNLWHCKELSRVSLSFNQFTGRIPRDLGNSTKLKLLYLSFNNLIGEIPQEIGSLRN  79

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ILR+D NNL G IP+TIFN+STL  +++ NN
Sbjct  80   LEILRIDQNNLVGFIPDTIFNMSTLKTLSLLNN  112


 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = -1

Query  281  GNIPRSIGEC-SSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG    S+E +YM+   ++G +P+EIGNL  L  L L  N+LSG +P  +G L 
Sbjct  220  GVLPSSIGNLYVSVEEIYMYKCNIHGRIPKEIGNLINLTKLSLGYNNLSGSLPITLGRLK  279

Query  104  MLQILRLDNNNLEGTIPETIFNISTL  27
             LQ L L NN  EG IP    + S L
Sbjct  280  KLQGLDLQNNKFEGPIPHEFCHFSRL  305


 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  NQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIF  42
            N LNGSLP EIGNL  + ++ L+ N LSG IP  I  L  LQ L L +N L+G IPE+  
Sbjct  361  NSLNGSLPLEIGNLKAVVSIYLSRNHLSGNIPTTIVGLKNLQSLSLKHNRLQGPIPESFG  420

Query  41   NISTLTYINMANN  3
             + +L +++++NN
Sbjct  421  ELISLEFLDLSNN  433


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P ++G    L+ L + +N+  G +P E  + + L    L  N LSG IP  +G+LN 
Sbjct  269  GSLPITLGRLKKLQGLDLQNNKFEGPIPHEFCHFSRLYKFYLNRNKLSGSIPSCLGDLNS  328

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL L +N L   IP T +N+  +   + ++N
Sbjct  329  LRILSLGSNELTSVIPSTFWNLEDILSFDFSSN  361


 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 58/119 (49%), Gaps = 26/119 (22%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR +G  + L+ LY+  N L G +P+EIG+L  L  L++ +N+L G IP  I N++ 
Sbjct  44   GRIPRDLGNSTKLKLLYLSFNNLIGEIPQEIGSLRNLEILRIDQNNLVGFIPDTIFNMST  103

Query  101  LQILRLDN--------------------------NNLEGTIPETIFNISTLTYINMANN  3
            L+ L L N                          NN  G+IP   FN S L Y+ +A N
Sbjct  104  LKTLSLLNNTLSGNLPSSKNLIGLPNLEGLILGLNNFSGSIPSFFFNASKLYYLELAYN  162


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   +L  L +  N L+GSLP  +G L  L  L L  N   G IP E  + + 
Sbjct  245  GRIPKEIGNLINLTKLSLGYNNLSGSLPITLGRLKKLQGLDLQNNKFEGPIPHEFCHFSR  304

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L    L+ N L G+IP  + ++++L  +++ +N
Sbjct  305  LYKFYLNRNKLSGSIPSCLGDLNSLRILSLGSN  337


 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = -1

Query  254  CSSLEYLYMWDNQLNGSLPREIGNLTM-LNNLQLTENSLSGEIPREIGNLNMLQILRLDN  78
            C SL+ + + +N ++G LP  IGNL + +  + + + ++ G IP+EIGNL  L  L L  
Sbjct  205  CKSLKVIVLAENPVDGVLPSSIGNLYVSVEEIYMYKCNIHGRIPKEIGNLINLTKLSLGY  264

Query  77   NNLEGTIPETIFNISTLTYINMANN  3
            NNL G++P T+  +  L  +++ NN
Sbjct  265  NNLSGSLPITLGRLKKLQGLDLQNN  289


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 2/90 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP +I    +L+ L +  N+L G +P   G L  L  L L+ N+LSG+IP  +  L  
Sbjct  389  GNIPTTIVGLKNLQSLSLKHNRLQGPIPESFGELISLEFLDLSNNNLSGDIPTSLEKLLY  448

Query  101  LQILRLDNNNLEGTIPE--TIFNISTLTYI  18
            L+ L L  N L G IP      N S  ++I
Sbjct  449  LKSLNLSFNKLVGEIPRGGAFANFSAESFI  478



>gb|KDO77432.1| hypothetical protein CISIN_1g001794mg [Citrus sinensis]
Length=1012

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+  C  L  L + +N+  G++P EIGNLTMLN L L  N+  GEIP EIGNL+ 
Sbjct  177  GPIPFSLFNCQKLSVLSLSNNRFQGTIPAEIGNLTMLNTLYLGVNNFQGEIPPEIGNLHN  236

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N++ G+IP +IFN ST+T I +++N
Sbjct  237  LETLFLSANSMTGSIPSSIFNASTMTDIALSDN  269


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSS-LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  SS L+ L ++++++ G +P EIGNLT L +L L +N L+G IP+ IG L 
Sbjct  377  GTLPVSIGNFSSALQILSLYESRIKGIIPGEIGNLTNLISLNLDDNKLTGTIPKTIGRLR  436

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ L L N+ L+G+IP  + ++  L ++ +  N
Sbjct  437  GLQFLSLRNSRLQGSIPFELCHLERLAFLTLTGN  470


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = -1

Query  257  ECSSLEYLYMWDNQLNGSLPREIGNL-TMLNNLQLTENSLSGEIPREIGNLNMLQILRLD  81
            +C +L  L ++ N LNG+LP  IGN  + L  L L E+ + G IP EIGNL  L  L LD
Sbjct  361  DCKNLRSLVLYGNPLNGTLPVSIGNFSSALQILSLYESRIKGIIPGEIGNLTNLISLNLD  420

Query  80   NNNLEGTIPETIFNISTLTYINMANN  3
            +N L GTIP+TI  +  L ++++ N+
Sbjct  421  DNKLTGTIPKTIGRLRGLQFLSLRNS  446


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP +IG+   L++L   DN+L G +P+  G +  L  L L+ NSLSG++PR +  L  
Sbjct  546  GDIPITIGDLQQLKHLSSADNRLQGHIPQTFGEMVSLEFLDLSNNSLSGKVPRSMEELLY  605

Query  101  LQILRLDNNNLEGTIP  54
            LQ L L  N+LEG IP
Sbjct  606  LQYLNLSLNHLEGEIP  621


 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            IP ++G       +    N LNGSLP E GNL ++  L L+ N + G+IP  IG+L  L+
Sbjct  500  IPSALGNLVDTLNINFSANSLNGSLPSEFGNLKVVTELDLSRNQIIGDIPITIGDLQQLK  559

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L   +N L+G IP+T   + +L +++++NN
Sbjct  560  HLSSADNRLQGHIPQTFGEMVSLEFLDLSNN  590


 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIG-NLN  105
            G IP  IG   +LE L++  N + GS+P  I N + + ++ L++N LSG +P  IG  L 
Sbjct  225  GEIPPEIGNLHNLETLFLSANSMTGSIPSSIFNASTMTDIALSDNYLSGHLPSTIGLWLP  284

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L+ L L  N L G IP  I N S LT I ++ N
Sbjct  285  NLEQLLLAKNKLTGPIPNAISNASQLTTIELSLN  318


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L  LY+  N   G +P EIGNL  L  L L+ NS++G IP  I N + 
Sbjct  201  GTIPAEIGNLTMLNTLYLGVNNFQGEIPPEIGNLHNLETLFLSANSMTGSIPSSIFNAST  260

Query  101  LQILRLDNNNLEGTIPETI  45
            +  + L +N L G +P TI
Sbjct  261  MTDIALSDNYLSGHLPSTI  279


 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P   G    +  L +  NQ+ G +P  IG+L  L +L   +N L G IP+  G +  
Sbjct  522  GSLPSEFGNLKVVTELDLSRNQIIGDIPITIGDLQQLKHLSSADNRLQGHIPQTFGEMVS  581

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L NN+L G +P ++  +  L Y+N++ N
Sbjct  582  LEFLDLSNNSLSGKVPRSMEELLYLQYLNLSLN  614


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L   +N   GS+PRE+ +L  L  +    NSL GEIP    +LN 
Sbjct  66   GTIPPHLGNLSFLARLDFKNNSFYGSIPRELVSLQRLKYINFMNNSLGGEIPSWFVSLNE  125

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             Q L L  NN  G IP +   +  L  ++++NN
Sbjct  126  TQTLVLSGNNFRGVIPFSFCCMPKLETLDLSNN  158


 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = -1

Query  242  EYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEG  63
            E LY+  NQL+G +P  + N   L+ L L+ N   G IP EIGNL ML  L L  NN +G
Sbjct  166  EALYLTWNQLSGPIPFSLFNCQKLSVLSLSNNRFQGTIPAEIGNLTMLNTLYLGVNNFQG  225

Query  62   TIPETIFNISTLTYINMANN  3
             IP  I N+  L  + ++ N
Sbjct  226  EIPPEIGNLHNLETLFLSAN  245


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP++IG    L++L + +++L GS+P E+ +L  L  L LT N L+G +   +GN++ 
Sbjct  426  GTIPKTIGRLRGLQFLSLRNSRLQGSIPFELCHLERLAFLTLTGNKLTGPLAACLGNISS  485

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N     IP  + N+     IN + N
Sbjct  486  LRTLSLSSNGFTSEIPSALGNLVDTLNINFSAN  518


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSL------------------------PREIGNLTM  174
            G+IP  +     L +L +  N+L G L                        P  +GNL  
Sbjct  450  GSIPFELCHLERLAFLTLTGNKLTGPLAACLGNISSLRTLSLSSNGFTSEIPSALGNLVD  509

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
              N+  + NSL+G +P E GNL ++  L L  N + G IP TI ++  L +++ A+N
Sbjct  510  TLNINFSANSLNGSLPSEFGNLKVVTELDLSRNQIIGDIPITIGDLQQLKHLSSADN  566


 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR +     L+Y+   +N L G +P    +L     L L+ N+  G IP     +  
Sbjct  90   GSIPRELVSLQRLKYINFMNNSLGGEIPSWFVSLNETQTLVLSGNNFRGVIPFSFCCMPK  149

Query  101  LQILRLDNNNLEGTIPETIF  42
            L+ L L NN L+G+IPE ++
Sbjct  150  LETLDLSNNMLQGSIPEALY  169



>ref|XP_006387609.1| hypothetical protein POPTR_0780s002001g, partial [Populus trichocarpa]
 gb|ERP46523.1| hypothetical protein POPTR_0780s002001g, partial [Populus trichocarpa]
Length=157

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG  +SL  LY+WDN+L+G +P  IGN+TML  L L  N+L+G IP  IGN   
Sbjct  38   GPIPSSIGNLTSLSMLYLWDNKLSGFIPFSIGNMTMLTVLALYRNNLTGPIPSSIGNFTS  97

Query  101  LQILRLDNNNLEGTIPETI  45
            L  L L +N L G+IP+ I
Sbjct  98   LSKLSLHSNKLSGSIPQEI  116


 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -1

Query  230  MWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPE  51
            + DN L+G +P  IGNLT L+ L L +N LSG IP  IGN+ ML +L L  NNL G IP 
Sbjct  31   LADNSLSGPIPSSIGNLTSLSMLYLWDNKLSGFIPFSIGNMTMLTVLALYRNNLTGPIPS  90

Query  50   TIFNISTLTYINMANN  3
            +I N ++L+ +++ +N
Sbjct  91   SIGNFTSLSKLSLHSN  106


 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP SIG  +SL  L +  N+L+GS+P+EIG L  LN L+L+ N L+  IP  IG L  
Sbjct  86   GPIPSSIGNFTSLSKLSLHSNKLSGSIPQEIGLLESLNELELSNNVLTSRIPYSIGKLRN  145

Query  101  LQILRLDNNNLE  66
            L  L L  N L 
Sbjct  146  LSFLGLAKNQLS  157


 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L L +NSLSG IP  IGNL  L +L L +N L G IP +I N++ LT + +  N
Sbjct  29   LDLADNSLSGPIPSSIGNLTSLSMLYLWDNKLSGFIPFSIGNMTMLTVLALYRN  82



>emb|CDY68314.1| BnaCnng58470D, partial [Brassica napus]
Length=909

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ +G  +SLEYLY++ N LNG++PREIGNL+    +  +EN L+GEIP E GN+  
Sbjct  277  GPIPKGLGNLASLEYLYLYRNMLNGTIPREIGNLSSAVEIDFSENGLTGEIPLEFGNIQG  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N L GTIP  + ++  LT ++++ N
Sbjct  337  LELLYLFENQLVGTIPVELTSLKNLTKLDLSIN  369


 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 60/117 (51%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-----  117
            G+IPR +G C +L+ L + DN   G LPREIG L  L  L L+ N L+GEIP EI     
Sbjct  493  GSIPREVGNCRALQRLQLADNAFTGELPREIGTLRELGTLNLSSNKLTGEIPSEIFKCKM  552

Query  116  -------------------GNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
                               G+L  L++L+L NN L G IP  + N+S LT + M  N
Sbjct  553  LQRLDMCCNNFSGTLASDVGSLYQLELLKLSNNKLSGAIPLALGNLSRLTELQMGGN  609


 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG    L  + +W+NQL+G +P EI N T L  L L +N L G IP+ +GNL  
Sbjct  229  GEIPKEIGMLKKLSQVILWENQLSGLIPNEITNCTSLQTLALYKNQLVGPIPKGLGNLAS  288

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L  N L GTIP  I N+S+   I+ + N
Sbjct  289  LEYLYLYRNMLNGTIPREIGNLSSAVEIDFSEN  321


 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG C SL  L +  NQL+G +P+EIG L  L+ + L EN LSG IP EI N   
Sbjct  205  GSLPSEIGGCESLVMLGLAQNQLSGEIPKEIGMLKKLSQVILWENQLSGLIPNEITNCTS  264

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L  N L G IP+ + N+++L Y+ +  N
Sbjct  265  LQTLALYKNQLVGPIPKGLGNLASLEYLYLYRN  297


 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G  P ++ +  +L  + +  N+  GS+PRE+GN   L  LQL +N+ +GE+PREIG L  
Sbjct  469  GRFPSNLCKLVNLTAIELGQNKFRGSIPREVGNCRALQRLQLADNAFTGELPREIGTLRE  528

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G IP  IF    L  ++M  N
Sbjct  529  LGTLNLSSNKLTGEIPSEIFKCKMLQRLDMCCN  561


 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P  IG+ SSLE L +++N+  GSLP EIGNL  L  L    N++SG +PR IG L  
Sbjct  133  GEVPVEIGKLSSLEKLIIYNNRFTGSLPMEIGNLLSLTQLVTYSNNISGSLPRSIGKLKK  192

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L   R   N + G++P  I    +L  + +A N
Sbjct  193  LTSFRAGQNMISGSLPSEIGGCESLVMLGLAQN  225


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++PRSIG+   L       N ++GSLP EIG    L  L L +N LSGEIP+EIG L  
Sbjct  181  GSLPRSIGKLKKLTSFRAGQNMISGSLPSEIGGCESLVMLGLAQNQLSGEIPKEIGMLKK  240

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L  N L G IP  I N ++L  + +  N
Sbjct  241  LSQVILWENQLSGLIPNEITNCTSLQTLALYKN  273


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I  C+SL+ L ++ NQL G +P+ +GNL  L  L L  N L+G IPREIGNL+ 
Sbjct  253  GLIPNEITNCTSLQTLALYKNQLVGPIPKGLGNLASLEYLYLYRNMLNGTIPREIGNLSS  312

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
               +    N L G IP    NI  L  + +  N
Sbjct  313  AVEIDFSENGLTGEIPLEFGNIQGLELLYLFEN  345


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP SI  C +L  L +  N L G  P  +  L  L  ++L +N   G IPRE+GN   
Sbjct  445  GNIPTSITTCKTLVQLRLAGNSLVGRFPSNLCKLVNLTAIELGQNKFRGSIPREVGNCRA  504

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L+L +N   G +P  I  +  L  +N+++N
Sbjct  505  LQRLQLADNAFTGELPREIGTLRELGTLNLSSN  537


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  IG   SL  L  + N ++GSLPR IG L  L + +  +N +SG +P EIG    
Sbjct  157  GSLPMEIGNLLSLTQLVTYSNNISGSLPRSIGKLKKLTSFRAGQNMISGSLPSEIGGCES  216

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G IP+ I  +  L+ + +  N
Sbjct  217  LVMLGLAQNQLSGEIPKEIGMLKKLSQVILWEN  249


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GN+  SIG    L+ L +  N L+G++P+EIGN   L NL+L  N   GE+P EIG L+ 
Sbjct  85   GNLSPSIGRLVHLKDLDLSYNGLSGNIPKEIGNCLSLVNLRLNNNMFGGEVPVEIGKLSS  144

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L + NN   G++P  I N+ +LT +   +N
Sbjct  145  LEKLIIYNNRFTGSLPMEIGNLLSLTQLVTYSN  177


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP   G    LE LY+++NQL G++P E+ +L  L  L L+ N+L+G IP     L  
Sbjct  325  GEIPLEFGNIQGLELLYLFENQLVGTIPVELTSLKNLTKLDLSINALTGPIPLGFQYLRK  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L+L  N+L G IP  +   S L  +++++N
Sbjct  385  LFMLQLFQNSLSGIIPPKLGVYSNLWVLDLSDN  417


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  I +C  L+ L M  N  +G+L  ++G+L  L  L+L+ N LSG IP  +GNL+ 
Sbjct  541  GEIPSEIFKCKMLQRLDMCCNNFSGTLASDVGSLYQLELLKLSNNKLSGAIPLALGNLSR  600

Query  101  LQILRLDNNNLEGTIPETIFNISTL  27
            L  L++  N   G+IP    +++ L
Sbjct  601  LTELQMGGNLFYGSIPREFGSLTGL  625


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLN-NLQLTENSLSGEIPREIGNLN  105
            G IP ++G  S L  L M  N   GS+PRE G+LT L   L L+ N L+GEIP ++ N+ 
Sbjct  589  GAIPLALGNLSRLTELQMGGNLFYGSIPREFGSLTGLQIALNLSFNKLTGEIPSQLSNVV  648

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ML++L L+NN+L G IP +  N+S+L   N + N
Sbjct  649  MLELLLLNNNDLSGEIPSSFANLSSLFGYNFSYN  682


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            L+G+L   IG L  L +L L+ N LSG IP+EIGN   L  LRL+NN   G +P  I  +
Sbjct  83   LSGNLSPSIGRLVHLKDLDLSYNGLSGNIPKEIGNCLSLVNLRLNNNMFGGEVPVEIGKL  142

Query  35   STLTYINMANN  3
            S+L  + + NN
Sbjct  143  SSLEKLIIYNN  153



>ref|XP_010520939.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR2 
[Tarenaya hassleriana]
Length=1125

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IPR++GE  +L YL ++DN L GSLPRE+GN + L  L+L  N + G IPREIG L  
Sbjct  331  GEIPRTVGELVALNYLLLFDNMLTGSLPRELGNCSSLVELRLQNNYIGGSIPREIGKLEQ  390

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L NN + G+IP  I N++ +  + + NN
Sbjct  391  LRVLLLFNNRIRGSIPAEIGNMTGIEQLALYNN  423


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++PR +G CSSL  L + +N + GS+PREIG L  L  L L  N + G IP EIGN+  
Sbjct  355  GSLPRELGNCSSLVELRLQNNYIGGSIPREIGKLEQLRVLLLFNNRIRGSIPAEIGNMTG  414

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ++ L L NN+L GT+P  +  +  L ++++A+N
Sbjct  415  IEQLALYNNSLTGTVPYGVTLLKKLRFLSLAHN  447


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I +   L  + +  N+L G +PR +G L  LN L L +N L+G +PRE+GN + 
Sbjct  307  GSIPDRISQSHQLSVVALSSNKLTGEIPRTVGELVALNYLLLFDNMLTGSLPRELGNCSS  366

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  LRL NN + G+IP  I  +  L  + + NN
Sbjct  367  LVELRLQNNYIGGSIPREIGKLEQLRVLLLFNN  399


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IPR IG+   L  L +++N++ GS+P EIGN+T +  L L  NSL+G +P  +  L  
Sbjct  379  GSIPREIGKLEQLRVLLLFNNRIRGSIPAEIGNMTGIEQLALYNNSLTGTVPYGVTLLKK  438

Query  101  LQILRLDNNNLEGTIPETI  45
            L+ L L +NNL G +P ++
Sbjct  439  LRFLSLAHNNLSGALPSSL  457


 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP ++ +  +LE L +  N+LNGS+P  I     L+ + L+ N L+GEIPR +G L  
Sbjct  283  GSIPDTLWDLENLEELVLSGNKLNGSIPDRISQSHQLSVVALSSNKLTGEIPRTVGELVA  342

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L +N L G++P  + N S+L  + + NN
Sbjct  343  LNYLLLFDNMLTGSLPRELGNCSSLVELRLQNN  375


 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +PR +  CS L  + + DN+  GS+P EI     ++ L    NSLSGEIPRE+ +   
Sbjct  115  GPVPRQLPTCSKLTVIRLNDNRFQGSVPAEIFLSDRISTLDFGRNSLSGEIPREVSSCTN  174

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L +N L G IP  + ++  L ++ +  N
Sbjct  175  LEYLGLYDNFLTGDIPVEVLSLPKLKHLFLNTN  207


 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLN-NLQLTENSLSGEIPREIGNLN  105
            G +P +     +L  L + DN   G +P  +  L   +  L L+ N LSGEIP  +G +N
Sbjct  645  GVLPDTFASLENLIELQLGDNMFEGPIPCSLSELQHFSLVLNLSNNRLSGEIPPCLGKMN  704

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQIL L  NNL G IPE + N+ +L Y N+++N
Sbjct  705  KLQILDLSRNNLRGKIPEEMNNMVSLEYANVSSN  738


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREI-GNLN  105
            G++P     C  L+ L++ +NQL G+LP  + N   L +   + N + G+IP E+   L 
Sbjct  211  GSLPGFPPSCQLLD-LWVHENQLVGTLPVTLSNCRNLTSFIASGNGIGGQIPAEMFKGLW  269

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             LQ+L LD N LEG+IP+T++++  L  + ++ N
Sbjct  270  NLQLLYLDGNRLEGSIPDTLWDLENLEELVLSGN  303


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            L+ LY+  N+L GS+P  + +L  L  L L+ N L+G IP  I   + L ++ L +N L 
Sbjct  271  LQLLYLDGNRLEGSIPDTLWDLENLEELVLSGNKLNGSIPDRISQSHQLSVVALSSNKLT  330

Query  65   GTIPETIFNISTLTYINMANN  3
            G IP T+  +  L Y+ + +N
Sbjct  331  GEIPRTVGELVALNYLLLFDN  351


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = -1

Query  272  PRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQI  93
            P + G   +L  L +  N+ +G +P E G L  L  L+L+ N L+GE+P E+    M+  
Sbjct  551  PSAFGHWRNLSMLDLSRNKFSGPIPHEFGQLVNLQVLRLSSNRLTGELPSELSRCAMVID  610

Query  92   LRLDNNNLEGTIPETIF  42
            L L  N L G+IP  I 
Sbjct  611  LDLSKNCLSGSIPPEIL  627


 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 24/117 (21%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSL------------------------PREIGNLTM  174
            G+ P  I EC SL  + + +N L G++                        P   G+   
Sbjct  500  GSFPAEIAECPSLRRVILSNNLLQGNISENLGKESGIETLNLGGNLLGGLLPSAFGHWRN  559

Query  173  LNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ L L+ N  SG IP E G L  LQ+LRL +N L G +P  +   + +  ++++ N
Sbjct  560  LSMLDLSRNKFSGPIPHEFGQLVNLQVLRLSSNRLTGELPSELSRCAMVIDLDLSKN  616


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G++P  I     +  L    N L+G +PRE+ + T L  L L +N L+G+IP E+ +L  
Sbjct  139  GSVPAEIFLSDRISTLDFGRNSLSGEIPREVSSCTNLEYLGLYDNFLTGDIPVEVLSLPK  198

Query  101  LQILRLDNNNLEGTIP  54
            L+ L L+ NNL G++P
Sbjct  199  LKHLFLNTNNLTGSLP  214



>gb|KCW80202.1| hypothetical protein EUGRSUZ_C015471, partial [Eucalyptus grandis]
Length=226

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P ++ +CS+LE LY+ DNQL G +P E+G+L+ L  L L+ N+L+G IP  IGNL+ 
Sbjct  69   GQMPTNLSQCSNLEILYLIDNQLVGKIPDELGSLSKLRVLGLSRNNLAGSIPHSIGNLSQ  128

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L+G IP+T+  +  LT++ + NN
Sbjct  129  LCKLSLRKNGLQGEIPKTLSKLYGLTFVQLMNN  161


 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N L GS+P  IGNL+ L  L L +N L GEIP+ +  L  
Sbjct  93   GKIPDELGSLSKLRVLGLSRNNLAGSIPHSIGNLSQLCKLSLRKNGLQGEIPKTLSKLYG  152

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  ++L NN L G IP  IFN+S + Y +++NN
Sbjct  153  LTFVQLMNNQLTGEIPLAIFNMSNILYFSVSNN  185


 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+SIG    L +L +  N  +G +P  +   + L  L L +N L G+IP E+G+L+ 
Sbjct  45   GEIPQSIGHLFRLHHLVLGINSFSGQMPTNLSQCSNLEILYLIDNQLVGKIPDELGSLSK  104

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  NNL G+IP +I N+S L  +++  N
Sbjct  105  LRVLGLSRNNLAGSIPHSIGNLSQLCKLSLRKN  137


 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG  S L  L +  N L G +P+ +  L  L  +QL  N L+GEIP  I N++ 
Sbjct  117  GSIPHSIGNLSQLCKLSLRKNGLQGEIPKTLSKLYGLTFVQLMNNQLTGEIPLAIFNMSN  176

Query  101  LQILRLDNNNLEGTIPETIFN-ISTLTYINMANN  3
            +    + NN L G+IP  I + + +L +++  +N
Sbjct  177  ILYFSVSNNQLRGSIPPYIGDTLPSLFFLDFLSN  210



>gb|AAC78593.1| Hcr2-0B [Solanum lycopersicum]
Length=944

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +LY+++NQL+GS+P EIG L  L  L L EN+L+G IP  +GNLN 
Sbjct  229  GSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNN  288

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY+++  N
Sbjct  289  LSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGEN  321


 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +L++++NQL+G +P EIG L  L  L L  N LSG IP  +GNLN 
Sbjct  181  GSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNN  240

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY+++  N
Sbjct  241  LSFLYLYNNQLSGSIPEEIGYLRSLTYLDLGEN  273


 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  L +++N+L+GS+P EIG L  L  L L EN+L+G IP  +GNLN 
Sbjct  277  GSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNN  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY+++  N
Sbjct  337  LSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGEN  369


 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L NL L  NSL+G IP   GN+  
Sbjct  421  GSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTNLYLGNNSLNGLIPASFGNMRN  480

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L++NNL G IP  + N+++L  + M  N
Sbjct  481  LQALFLNDNNLIGEIPSFVCNLTSLELLYMPRN  513


 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +   +SLE LYM  N L G +P+ +GN++ L  L ++ NS SGE+P  I NL  
Sbjct  493  GEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNISDLLVLSMSSNSFSGELPSSISNLTS  552

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+IL    NNLEG IP+   NIS+L   +M NN
Sbjct  553  LKILDFGRNNLEGAIPQCFGNISSLQVFDMQNN  585


 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  L +++N+L+GS+P EIG L  L  L L EN+L+G IP  +GNLN 
Sbjct  325  GSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNN  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LT +++ NN
Sbjct  385  LSRLDLYNNKLSGSIPEEIGYLRSLTKLSLGNN  417


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  L +++N+L+GS+P EIG L  L  L L  N LSG IP  +GNLN 
Sbjct  373  GSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTKLSLGNNFLSGSIPASLGNLNN  432

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L NN L G+IPE I  +S+LT + + NN
Sbjct  433  LFMLYLYNNQLSGSIPEEIGYLSSLTNLYLGNN  465


 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL YL + +N LNGS+P  +GNL  L+ L L  N LSG IP EIG L  
Sbjct  253  GSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRS  312

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+ +++ NN
Sbjct  313  LTYLDLGENALNGSIPASLGNLNNLSRLDLYNN  345


 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL YL + +N LNGS+P  +GNL  L+ L L  N LSG IP EIG L  
Sbjct  301  GSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRS  360

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+ +++ NN
Sbjct  361  LTYLDLGENALNGSIPASLGNLNNLSRLDLYNN  393


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL YL + +N LNGS+P  +GNL  L+ L L  N LSG IP EIG L  
Sbjct  349  GSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRS  408

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IP ++ N++ L  + + NN
Sbjct  409  LTKLSLGNNFLSGSIPASLGNLNNLFMLYLYNN  441


 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG  SSL  LY+ +N LNG +P   GN+  L  L L +N+L GEIP  + NL  
Sbjct  445  GSIPEEIGYLSSLTNLYLGNNSLNGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTS  504

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L +  NNL+G +P+ + NIS L  ++M++N
Sbjct  505  LELLYMPRNNLKGKVPQCLGNISDLLVLSMSSN  537


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   SL  L +  N L+GS+P  +GN+T L+ L L EN LSG IP EIG L  
Sbjct  157  GFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRS  216

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L LD N L G+IP ++ N++ L+++ + NN
Sbjct  217  LTKLSLDINFLSGSIPASLGNLNNLSFLYLYNN  249


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ + +++N LNG +P EIG L  L  L L  N LSG IP  +GN+  
Sbjct  133  GTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTN  192

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINM  12
            L  L L  N L G IPE I  + +LT +++
Sbjct  193  LSFLFLYENQLSGFIPEEIGYLRSLTKLSL  222


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = -1

Query  245  LEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLE  66
            LE L + +N ++G++P EIGNLT L  L L  N +SG IP +IG+L  LQI+R+ NN+L 
Sbjct  97   LENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLN  156

Query  65   GTIPETIFNISTLTYINMANN  3
            G IPE I  + +LT +++  N
Sbjct  157  GFIPEEIGYLRSLTKLSLGIN  177


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L YL +  NQ++G++P +IG+L  L  +++  N L+G IP EIG L  
Sbjct  109  GTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRS  168

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ +  N
Sbjct  169  LTKLSLGINFLSGSIPASLGNMTNLSFLFLYEN  201


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L + +N L+GS+P  +GNL  L  L L  N LSG IP EIG L+ 
Sbjct  397  GSIPEEIGYLRSLTKLSLGNNFLSGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSS  456

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN+L G IP +  N+  L  + + +N
Sbjct  457  LTNLYLGNNSLNGLIPASFGNMRNLQALFLNDN  489


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G +P+ +G  S L  L M  N  +G LP  I NLT L  L    N+L G IP+  GN++ 
Sbjct  517  GKVPQCLGNISDLLVLSMSSNSFSGELPSSISNLTSLKILDFGRNNLEGAIPQCFGNISS  576

Query  101  LQILRLDNNNLEGTIP  54
            LQ+  + NN L GT+P
Sbjct  577  LQVFDMQNNKLSGTLP  592


 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  +G+  ++  L +  N L G +P  +G+L+ + +L L+ N LSGEIP+++ +L  
Sbjct  750  GHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSRVESLDLSFNQLSGEIPQQLASLTF  809

Query  101  LQILRLDNNNLEGTIPE  51
            L+ L L +N L+G IP+
Sbjct  810  LEFLNLSHNYLQGCIPQ  826


 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S G   +L+ L++ DN L G +P  + NLT L  L +  N+L G++P+ +GN++ 
Sbjct  469  GLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNISD  528

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L + +N+  G +P +I N+++L  ++   N
Sbjct  529  LLVLSMSSNSFSGELPSSISNLTSLKILDFGRN  561


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+  G  SSL+   M +N+L+G+LP        L +L L  N L  EIP  + N   
Sbjct  565  GAIPQCFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNCKK  624

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ+L L +N L  T P  +  +  L  + + +N
Sbjct  625  LQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSN  657


 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  191  IGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNISTLTYINM  12
              +L  L NL L+ N++SG IP EIGNL  L  L L+ N + GTIP  I +++ L  I +
Sbjct  91   FSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRI  150

Query  11   ANN  3
             NN
Sbjct  151  FNN  153



>gb|AAX19036.1| Hcr2-p7.7 [Solanum pimpinellifolium]
Length=487

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S G  S+L +L++++NQL  S+P EIG L  LN L L+EN+L+G IP  +GNLN 
Sbjct  373  GFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASLGNLNN  432

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LT +++ NN
Sbjct  433  LSRLYLYNNQLSGSIPEEIGYLSSLTELHLGNN  465


 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  + L+ + ++ NQLNG +P+EIG L  L  L L  N LSG IP  +GNLN 
Sbjct  133  GTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNN  192

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY++++ N
Sbjct  193  LSFLYLYNNQLSGSIPEEICYLRSLTYLDLSEN  225


 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +L+++ NQL+GS+P EIG L  LN L L+EN+L+G IP  +GNL  
Sbjct  229  GSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKN  288

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IP ++ N++ L+ + + NN
Sbjct  289  LSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNN  321


 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G   +L  L + +NQL+GS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  277  GSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNN  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  +S+LTY++++NN
Sbjct  337  LSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNN  369


 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +LY+++NQL+GS+P EI  L  L  L L+EN+L+G IP  +GNLN 
Sbjct  181  GSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNN  240

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IPE I  + +L  + ++ N
Sbjct  241  LSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSEN  273


 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P  +GNL  L+ L L  N LSG IP EIG L+ 
Sbjct  301  GSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSS  360

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN++ G IP +  N+S L ++ +  N
Sbjct  361  LTYLDLSNNSINGFIPASFGNMSNLAFLFLYEN  393


 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  IG   SL  L + +N LNGS+P  +GNL  L+ L L  N LSG IP  +GNLN 
Sbjct  253  GSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNN  312

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L NN L G+IP ++ N++ L+ + + NN
Sbjct  313  LSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNN  345


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP  I    SL YL + +N LNGS+P  +GNL  L+ L L  N LSG IP EIG L  
Sbjct  205  GSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRS  264

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L +L L  N L G+IP ++ N+  L+ +N+ NN
Sbjct  265  LNVLGLSENALNGSIPASLGNLKNLSRLNLVNN  297


 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L+ NS++G IP   GN++ 
Sbjct  325  GSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSN  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L  ++PE I  + +L  ++++ N
Sbjct  385  LAFLFLYENQLASSVPEEIGYLRSLNVLDLSEN  417


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  275  IPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQ  96
            +P  IG   SL  L + +N LNGS+P  +GNL  L+ L L  N LSG IP EIG L+ L 
Sbjct  399  VPEEIGYLRSLNVLDLSENALNGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLT  458

Query  95   ILRLDNNNLEGTIPETIFNISTLTYINM  12
             L L NN+L G+IP ++ N++ L+ +++
Sbjct  459  ELHLGNNSLNGSIPASLGNLNNLSSLDV  486


 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG  ++L YL + +N+++G++P +IG L  L  +++  N L+G IP+EIG L  
Sbjct  109  GTIPPEIGNLTNLVYLDLNNNKISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRS  168

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ + NN
Sbjct  169  LTKLSLGINFLSGSIPASVGNLNNLSFLYLYNN  201


 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L  L L  NSL+G IP  +GNLN 
Sbjct  421  GSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTELHLGNNSLNGSIPASLGNLNN  480

Query  101  LQILRLD  81
            L  L + 
Sbjct  481  LSSLDVH  487


 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP+ IG   SL  L +  N L+GS+P  +GNL  L+ L L  N LSG IP EI  L  
Sbjct  157  GFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEICYLRS  216

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L  N L G+IP ++ N++ L+++ +  N
Sbjct  217  LTYLDLSENALNGSIPASLGNLNNLSFLFLYGN  249


 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  248  SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNL  69
            SLE L +  N + G++P EIGNLT L  L L  N +SG IP +IG L  LQI+R+ +N L
Sbjct  96   SLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNKISGTIPPQIGLLAKLQIIRIFHNQL  155

Query  68   EGTIPETIFNISTLTYINMANN  3
             G IP+ I  + +LT +++  N
Sbjct  156  NGFIPKEIGYLRSLTKLSLGIN  177



>ref|XP_003571217.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brachypodium distachyon]
Length=1149

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP      + +E+L++  N L+G++P  +GNL+ L +L LT N LSG IP  +G+   
Sbjct  287  GSIPSVTAVFAPVEFLHLGGNSLSGTIPSSLGNLSSLIDLYLTRNKLSGRIPESLGHFPK  346

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            +Q+L L+ NN  G +P ++FN+STLT++ MANN
Sbjct  347  VQVLNLNYNNFSGPVPPSVFNMSTLTFLAMANN  379


 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP++ G   SL  L    N+L+G +P  IGNL  L +++L  N+ SG IP  IG    
Sbjct  531  GNIPQTFGHLRSLVVLNFARNRLSGQIPDVIGNLIQLTDIKLDGNNFSGSIPASIGRCTQ  590

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQIL L +N+L+G+IP  I   S    +++++N
Sbjct  591  LQILNLAHNSLDGSIPSKILVPSLSEELDLSHN  623


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP  +  CSSLE L +  N + G +P  +   T L  + L +N L G IP   G+L  
Sbjct  143  GNIPPQLSSCSSLEMLGLSKNSIQGVIPPSLSQCTRLKEINLGDNKLHGSIPSAFGDLPE  202

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L NN L G IP ++ +  +L Y+++  N
Sbjct  203  LQTLVLANNKLTGDIPPSLGSSPSLRYVDLGFN  235


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG   +L  +YM  N   G++P+  G+L  L  L    N LSG+IP  IGNL  
Sbjct  507  GPIPPEIGNLKNLTVVYMDYNLFTGNIPQTFGHLRSLVVLNFARNRLSGQIPDVIGNLIQ  566

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  ++LD NN  G+IP +I   + L  +N+A+N
Sbjct  567  LTDIKLDGNNFSGSIPASIGRCTQLQILNLAHN  599


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP SIG C+ L+ L +  N L+GS+P +I   ++   L L+ N L G IP E+GNL  
Sbjct  579  GSIPASIGRCTQLQILNLAHNSLDGSIPSKILVPSLSEELDLSHNYLFGGIPEEVGNLIH  638

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ   + NN L G IP  +    +L ++ + +N
Sbjct  639  LQKFSISNNRLSGNIPPPLGRCMSLKFLQIQSN  671


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP + G+   L+ L + +N+L G +P  +G+   L  + L  NSL G IP  + N + 
Sbjct  191  GSIPSAFGDLPELQTLVLANNKLTGDIPPSLGSSPSLRYVDLGFNSLIGRIPESLANSSS  250

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++LRL  N L G +P+ +FN S+LT I +  N
Sbjct  251  LEVLRLMENTLGGELPKGLFNTSSLTAICLQEN  283


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP S+ +C+ L+ + + DN+L+GS+P   G+L  L  L L  N L+G+IP  +G+   
Sbjct  167  GVIPPSLSQCTRLKEINLGDNKLHGSIPSAFGDLPELQTLVLANNKLTGDIPPSLGSSPS  226

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L  N+L G IPE++ N S+L  + +  N
Sbjct  227  LRYVDLGFNSLIGRIPESLANSSSLEVLRLMEN  259


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = -1

Query  281  GNIPRSIGECS-SLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLN  105
            G +P SIG  S SLE+L++ +N ++G +P EIGNL  L  + +  N  +G IP+  G+L 
Sbjct  482  GELPSSIGNLSGSLEFLWLRNNNISGPIPPEIGNLKNLTVVYMDYNLFTGNIPQTFGHLR  541

Query  104  MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             L +L    N L G IP+ I N+  LT I +  N
Sbjct  542  SLVVLNFARNRLSGQIPDVIGNLIQLTDIKLDGN  575


 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = -1

Query  266  SIGECSSLEYLYMWDNQLNGSLPREIGNLT-MLNNLQLTENSLSGEIPREIGNLNMLQIL  90
            S+  CS L  L +  N L G LP  IGNL+  L  L L  N++SG IP EIGNL  L ++
Sbjct  463  SLSRCSRLNKLILGGNNLQGELPSSIGNLSGSLEFLWLRNNNISGPIPPEIGNLKNLTVV  522

Query  89   RLDNNNLEGTIPETIFNISTLTYINMANN  3
             +D N   G IP+T  ++ +L  +N A N
Sbjct  523  YMDYNLFTGNIPQTFGHLRSLVVLNFARN  551


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+I   I   +SL  L +++N L G +P E+G+L+ L +L L+ NSL G IP ++ + + 
Sbjct  95   GSISPCIANLTSLTTLQLFNNSLQGGIPSELGSLSRLISLNLSSNSLEGNIPPQLSSCSS  154

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L++L L  N+++G IP ++   + L  IN+ +N
Sbjct  155  LEMLGLSKNSIQGVIPPSLSQCTRLKEINLGDN  187


 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G   SL Y+ +  N L G +P  + N + L  L+L EN+L GE+P+ + N + 
Sbjct  215  GDIPPSLGSSPSLRYVDLGFNSLIGRIPESLANSSSLEVLRLMENTLGGELPKGLFNTSS  274

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  + L  NN  G+IP      + + ++++  N
Sbjct  275  LTAICLQENNFVGSIPSVTAVFAPVEFLHLGGN  307


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            GNIP  +G C SL++L +  N   GS+P+   NL  +  + +++N+LSG+IP  + +L+ 
Sbjct  651  GNIPPPLGRCMSLKFLQIQSNFFVGSIPQTFVNLIGIEQMDVSQNNLSGKIPEFLTSLSS  710

Query  101  LQILRLDNNNLEGTIPE  51
            L  L L  NN +G +P 
Sbjct  711  LHDLNLSFNNFDGEVPR  727


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G    L+   + +N+L+G++P  +G    L  LQ+  N   G IP+   NL  
Sbjct  627  GGIPEEVGNLIHLQKFSISNNRLSGNIPPPLGRCMSLKFLQIQSNFFVGSIPQTFVNLIG  686

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            ++ + +  NNL G IPE + ++S+L  +N++ N
Sbjct  687  IEQMDVSQNNLSGKIPEFLTSLSSLHDLNLSFN  719


 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  IG    L  + +  N  +GS+P  IG  T L  L L  NSL G IP +I   ++
Sbjct  555  GQIPDVIGNLIQLTDIKLDGNNFSGSIPASIGRCTQLQILNLAHNSLDGSIPSKILVPSL  614

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
             + L L +N L G IPE + N+  L   +++NN
Sbjct  615  SEELDLSHNYLFGGIPEEVGNLIHLQKFSISNN  647


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +G  S L  L +  N L G++P ++ + + L  L L++NS+ G IP  +     
Sbjct  119  GGIPSELGSLSRLISLNLSSNSLEGNIPPQLSSCSSLEMLGLSKNSIQGVIPPSLSQCTR  178

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L+ + L +N L G+IP    ++  L  + +ANN
Sbjct  179  LKEINLGDNKLHGSIPSAFGDLPELQTLVLANN  211


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  215  LNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNMLQILRLDNNNLEGTIPETIFNI  36
            + GS+   I NLT L  LQL  NSL G IP E+G+L+ L  L L +N+LEG IP  + + 
Sbjct  93   ITGSISPCIANLTSLTTLQLFNNSLQGGIPSELGSLSRLISLNLSSNSLEGNIPPQLSSC  152

Query  35   STLTYINMANN  3
            S+L  + ++ N
Sbjct  153  SSLEMLGLSKN  163


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 52/120 (43%), Gaps = 27/120 (23%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLP--------------------------REIGNL  180
            G IP S+     L  LY+  N L GS+P                            +   
Sbjct  408  GPIPTSLLHTYHLSRLYLHSNSLAGSIPFFGSLPNLEELDLTNNKLEAGDWGFISSLSRC  467

Query  179  TMLNNLQLTENSLSGEIPREIGNLN-MLQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            + LN L L  N+L GE+P  IGNL+  L+ L L NNN+ G IP  I N+  LT + M  N
Sbjct  468  SRLNKLILGGNNLQGELPSSIGNLSGSLEFLWLRNNNISGPIPPEIGNLKNLTVVYMDYN  527



>ref|XP_010321824.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At1g35710 [Solanum lycopersicum]
Length=992

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +LY+++NQL+GS+P EIG L  L  L L EN+L+G IP  +GNLN 
Sbjct  229  GSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNN  288

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY+++  N
Sbjct  289  LSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGEN  321


 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L +L++++NQL+G +P EIG L  L  L L  N LSG IP  +GNLN 
Sbjct  181  GSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNN  240

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY+++  N
Sbjct  241  LSFLYLYNNQLSGSIPEEIGYLRSLTYLDLGEN  273


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  L +++N+L+GS+P EIG L  L  L L EN+L+G IP  +GNLN 
Sbjct  325  GSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNN  384

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY+++  N
Sbjct  385  LSRLDLYNNKLSGSIPEEISYLRSLTYLDLGEN  417


 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  L +++N+L+GS+P EIG L  L  L L EN+L+G IP  +GNLN 
Sbjct  277  GSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNN  336

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            L  L L NN L G+IPE I  + +LTY+++  N
Sbjct  337  LSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGEN  369


 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G+IP S+G  ++L  LY+++NQL+GS+P EIG L+ L NL L  NSL+G IP   GN+  
Sbjct  469  GSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTNLYLGNNSLNGLIPASFGNMRN  528

Query  101  LQILRLDNNNLEGTIPETIFNISTLTYINMANN  3
            LQ L L++NNL G IP  + N+++L  + M  N
Sbjct  529  LQALFLNDNNLIGEIPSFVCNLTSLELLYMPRN  561


 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  281  GNIPRSIGECSSLEYLYMWDNQLNGSLPREIGNLTMLNNLQLTENSLSGEIPREIGNLNM  102
            G IP  +   +SLE LYM  N L G +P+ +GN++ L  L ++ NS SGE+P  I NL  
Sbjct  541  GEIPSFVCNLTSLELLYM