BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23829_g1_i3 len=1868 path=[6675:0-330 7006:331-357 7033:358-432
7108:433-471 7147:472-621 4430:622-657 9746:658-697 7371:698-741
4715:742-782 7454:783-1333 8005:1334-1466 3552:1467-1490
8161:1491-1867]

Length=1868
                                                                      Score     E

ref|XP_009590317.1|  PREDICTED: serine carboxypeptidase-like 26         654   0.0      
ref|XP_009794618.1|  PREDICTED: serine carboxypeptidase-like 26         645   0.0      
ref|XP_002285022.1|  PREDICTED: putative serine carboxypeptidase-...    640   0.0      Vitis vinifera
ref|XP_006346455.1|  PREDICTED: serine carboxypeptidase-like 26-like    631   0.0      
ref|XP_004230807.1|  PREDICTED: serine carboxypeptidase-like 26         629   0.0      
emb|CBI32445.3|  unnamed protein product                                623   0.0      
gb|ABR16997.1|  unknown                                                 525   9e-177   Picea sitchensis
emb|CDO97155.1|  unnamed protein product                                512   2e-173   
gb|ABR16596.1|  unknown                                                 509   9e-171   Picea sitchensis
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          499   3e-167   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       492   4e-165   
ref|XP_010279514.1|  PREDICTED: serine carboxypeptidase-like 40         485   8e-162   
ref|XP_010279511.1|  PREDICTED: serine carboxypeptidase-like 40 i...    479   2e-159   
ref|XP_010261659.1|  PREDICTED: serine carboxypeptidase-like 40         474   7e-158   
ref|XP_004306277.1|  PREDICTED: serine carboxypeptidase II-3-like       473   2e-157   
ref|XP_011091773.1|  PREDICTED: serine carboxypeptidase-like 40         472   1e-156   
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3            471   3e-156   
gb|KDO66312.1|  hypothetical protein CISIN_1g039871mg                   471   3e-156   
ref|XP_006470494.1|  PREDICTED: serine carboxypeptidase-like 40-like    471   4e-156   
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       469   9e-156   Vitis vinifera
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40-like    470   1e-155   
ref|XP_004230806.1|  PREDICTED: serine carboxypeptidase II-3-like       468   3e-155   
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       468   3e-155   
ref|XP_008363303.1|  PREDICTED: serine carboxypeptidase-like 40         468   5e-155   
gb|KHG19786.1|  Serine carboxypeptidase-like 40                         467   9e-155   
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       466   2e-154   
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         467   2e-154   
ref|XP_010279510.1|  PREDICTED: serine carboxypeptidase-like 40         466   2e-154   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               466   2e-154   
gb|AAT78819.1|  putative serine carboxypeptidase                        465   3e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       465   3e-154   
gb|AAQ63884.1|  putative serine carboxypeptidase                        466   3e-154   Medicago truncatula
ref|XP_006650145.1|  PREDICTED: serine carboxypeptidase II-3-like       463   2e-153   
gb|KDP38391.1|  hypothetical protein JCGZ_04316                         462   5e-153   
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             462   8e-153   
ref|XP_007052442.1|  Serine carboxypeptidase-like 40                    463   9e-153   
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     461   1e-152   
ref|XP_009354385.1|  PREDICTED: serine carboxypeptidase-like 40         462   1e-152   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       461   2e-152   
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    460   4e-152   
ref|XP_003557804.1|  PREDICTED: serine carboxypeptidase 24-like         460   5e-152   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       459   7e-152   
ref|XP_007224802.1|  hypothetical protein PRUPE_ppa023729mg             459   9e-152   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    459   1e-151   
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             459   1e-151   
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               459   1e-151   
ref|XP_004303115.1|  PREDICTED: serine carboxypeptidase-like 40-like    459   1e-151   
gb|EYU42662.1|  hypothetical protein MIMGU_mgv1a022120mg                458   2e-151   
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       458   3e-151   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       458   3e-151   
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       457   4e-151   
ref|XP_007219043.1|  hypothetical protein PRUPE_ppa004618mg             458   4e-151   
ref|XP_011008273.1|  PREDICTED: serine carboxypeptidase-like 40         457   4e-151   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       457   5e-151   
gb|KDP43605.1|  hypothetical protein JCGZ_16892                         457   5e-151   
ref|XP_002281988.1|  PREDICTED: serine carboxypeptidase II-3-like       457   6e-151   Vitis vinifera
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       457   6e-151   
ref|XP_004984185.1|  PREDICTED: serine carboxypeptidase II-3-like...    457   8e-151   
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               457   1e-150   
gb|KHG12237.1|  Serine carboxypeptidase-like 40                         457   1e-150   
ref|XP_002517750.1|  serine carboxypeptidase, putative                  457   2e-150   Ricinus communis
ref|XP_009368057.1|  PREDICTED: serine carboxypeptidase-like 40         456   2e-150   
ref|XP_010103278.1|  Serine carboxypeptidase-like 40                    455   4e-150   
ref|XP_011025504.1|  PREDICTED: serine carboxypeptidase-like 40 i...    455   5e-150   
ref|XP_008231545.1|  PREDICTED: serine carboxypeptidase-like 40         455   6e-150   
ref|XP_002314061.1|  hypothetical protein POPTR_0009s06080g             454   7e-150   Populus trichocarpa [western balsam poplar]
gb|ABF96315.1|  Serine carboxypeptidase II-3 precursor, putative,...    454   8e-150   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148004.1|  serine carboxypeptidase precursor                  454   9e-150   Zea mays [maize]
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    454   1e-149   
ref|XP_010694765.1|  PREDICTED: serine carboxypeptidase-like 40         455   1e-149   
ref|XP_002272961.1|  PREDICTED: serine carboxypeptidase-like 40 i...    454   1e-149   Vitis vinifera
gb|AES71588.2|  serine carboxypeptidase-like protein                    453   2e-149   
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       452   2e-149   
gb|EEC75382.1|  hypothetical protein OsI_11848                          452   3e-149   Oryza sativa Indica Group [Indian rice]
gb|EEE59169.1|  hypothetical protein OsJ_11092                          452   3e-149   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008231546.1|  PREDICTED: serine carboxypeptidase-like 40         453   3e-149   
ref|XP_003592242.1|  Serine carboxypeptidase-like protein               452   4e-149   
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         451   4e-149   
ref|XP_002298413.2|  putative serine carboxypeptidase family protein    452   5e-149   Populus trichocarpa [western balsam poplar]
emb|CBI32446.3|  unnamed protein product                                451   7e-149   
emb|CBI19568.3|  unnamed protein product                                468   8e-149   
emb|CDP08509.1|  unnamed protein product                                451   8e-149   
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       453   1e-148   
gb|EYU37705.1|  hypothetical protein MIMGU_mgv1a005479mg                450   2e-148   
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       451   2e-148   
ref|XP_004514571.1|  PREDICTED: serine carboxypeptidase-like 40-like    450   3e-148   
ref|XP_009370169.1|  PREDICTED: serine carboxypeptidase II-3-like...    449   7e-148   
ref|XP_008802653.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    449   8e-148   
ref|XP_010279512.1|  PREDICTED: serine carboxypeptidase-like 40 i...    448   1e-147   
gb|KHN46300.1|  Serine carboxypeptidase II-3                            446   2e-147   
ref|XP_007160822.1|  hypothetical protein PHAVU_001G019500g             448   2e-147   
gb|KHN12757.1|  Serine carboxypeptidase II-3                            446   2e-147   
ref|XP_004292825.1|  PREDICTED: serine carboxypeptidase II-3-like       448   2e-147   
ref|XP_004292824.1|  PREDICTED: serine carboxypeptidase II-3-like       448   2e-147   
ref|XP_003542323.2|  PREDICTED: serine carboxypeptidase-like 40-l...    447   3e-147   
ref|XP_006346529.1|  PREDICTED: serine carboxypeptidase II-3-like       446   4e-147   
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             447   4e-147   
ref|XP_010315498.1|  PREDICTED: serine carboxypeptidase II-3-like       447   5e-147   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            447   6e-147   
ref|XP_006658912.1|  PREDICTED: serine carboxypeptidase II-3-like       445   1e-146   
ref|XP_010932885.1|  PREDICTED: serine carboxypeptidase-like 40 i...    444   1e-146   
ref|XP_010067792.1|  PREDICTED: serine carboxypeptidase-like 40         446   2e-146   
ref|XP_009592794.1|  PREDICTED: serine carboxypeptidase-like 40         446   2e-146   
ref|XP_003544446.1|  PREDICTED: serine carboxypeptidase II-3-like...    446   2e-146   
ref|XP_010932884.1|  PREDICTED: putative serine carboxypeptidase-...    444   4e-146   
ref|XP_006446687.1|  hypothetical protein CICLE_v10015024mg             445   4e-146   
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    443   4e-146   
ref|XP_011088288.1|  PREDICTED: serine carboxypeptidase II-3-like       444   6e-146   
ref|XP_006346531.1|  PREDICTED: serine carboxypeptidase II-3-like       442   1e-145   
emb|CDP16362.1|  unnamed protein product                                443   1e-145   
gb|KDO47634.1|  hypothetical protein CISIN_1g011108mg                   443   2e-145   
ref|XP_008809533.1|  PREDICTED: putative serine carboxypeptidase-...    451   2e-145   
gb|AES71590.2|  serine carboxypeptidase-like protein                    443   3e-145   
emb|CAN63486.1|  hypothetical protein VITISV_017087                     442   3e-145   Vitis vinifera
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         443   3e-145   
ref|XP_002517751.1|  serine carboxypeptidase, putative                  443   3e-145   Ricinus communis
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    442   4e-145   
ref|XP_009801012.1|  PREDICTED: serine carboxypeptidase II-3-like       442   4e-145   
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                441   4e-145   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    441   5e-145   
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         441   5e-145   
ref|XP_004292826.1|  PREDICTED: serine carboxypeptidase II-3-like       442   5e-145   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       441   6e-145   
ref|XP_010067796.1|  PREDICTED: serine carboxypeptidase-like 40 i...    442   6e-145   
ref|XP_004984183.1|  PREDICTED: serine carboxypeptidase II-3-like...    443   6e-145   
gb|KEH40059.1|  serine carboxypeptidase-like protein                    442   7e-145   
ref|XP_007015556.1|  Serine carboxypeptidase II-3, expressed, put...    441   9e-145   
ref|XP_006473888.1|  PREDICTED: serine carboxypeptidase-like 40-like    441   9e-145   
ref|XP_003539875.1|  PREDICTED: serine carboxypeptidase-like 40-like    441   1e-144   
gb|KHN11708.1|  Serine carboxypeptidase-like 40                         441   1e-144   
gb|KHN35601.1|  Serine carboxypeptidase II-3                            441   1e-144   
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                440   1e-144   
ref|NP_001242872.1|  uncharacterized protein LOC100820473 precursor     441   2e-144   
ref|XP_006346528.1|  PREDICTED: serine carboxypeptidase II-3-like       441   3e-144   
dbj|BAJ94105.1|  predicted protein                                      441   3e-144   
ref|XP_011088748.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    439   3e-144   
ref|XP_003599510.1|  Serine carboxypeptidase-like protein               440   3e-144   
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       439   4e-144   
sp|P52711.1|CBP23_HORVU  RecName: Full=Serine carboxypeptidase II...    440   4e-144   Hordeum vulgare [barley]
ref|XP_003534383.1|  PREDICTED: serine carboxypeptidase-like 40-l...    439   5e-144   
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         438   6e-144   Populus trichocarpa [western balsam poplar]
ref|XP_010685501.1|  PREDICTED: serine carboxypeptidase II-3-like       439   6e-144   
ref|XP_006470156.1|  PREDICTED: serine carboxypeptidase II-3-like...    439   6e-144   
ref|XP_008220190.1|  PREDICTED: serine carboxypeptidase II-3-like       439   6e-144   
gb|KHN30516.1|  Serine carboxypeptidase-like 40                         439   6e-144   
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         437   8e-144   
ref|NP_001132061.1|  uncharacterized protein LOC100193473               436   8e-144   Zea mays [maize]
ref|XP_011088290.1|  PREDICTED: serine carboxypeptidase II-3-like       438   1e-143   
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         439   1e-143   
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         437   2e-143   
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         437   2e-143   Populus trichocarpa [western balsam poplar]
dbj|BAC16131.1|  putative serine carboxypeptidase II-3 precursor        439   2e-143   Oryza sativa Japonica Group [Japonica rice]
gb|ACN29008.1|  unknown                                                 439   2e-143   Zea mays [maize]
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         438   2e-143   
emb|CDO99730.1|  unnamed protein product                                436   2e-143   
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         436   2e-143   
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         436   3e-143   
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             436   3e-143   
gb|KHN32398.1|  Serine carboxypeptidase-like 40                         437   3e-143   
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         436   3e-143   
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         436   3e-143   
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             436   3e-143   
ref|XP_002271490.3|  PREDICTED: serine carboxypeptidase-like 40 i...    437   3e-143   Vitis vinifera
ref|XP_004984181.1|  PREDICTED: serine carboxypeptidase-like 26-l...    437   4e-143   
ref|XP_006470157.1|  PREDICTED: serine carboxypeptidase II-3-like...    437   4e-143   
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         436   4e-143   
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     436   5e-143   
ref|NP_001060508.1|  Os07g0656900                                       435   5e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       436   5e-143   
ref|NP_001147904.1|  serine carboxypeptidase 1 precursor                437   6e-143   Zea mays [maize]
emb|CDP16351.1|  unnamed protein product                                436   6e-143   
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    435   7e-143   
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    436   7e-143   
ref|XP_002314060.2|  hypothetical protein POPTR_0009s06090g             436   8e-143   Populus trichocarpa [western balsam poplar]
ref|XP_010664592.1|  PREDICTED: serine carboxypeptidase-like 40         436   8e-143   
ref|XP_010067798.1|  PREDICTED: serine carboxypeptidase-like 40         436   8e-143   
ref|XP_006830191.1|  hypothetical protein AMTR_s00173p00045470          436   9e-143   
emb|CDY35977.1|  BnaA05g29730D                                          435   1e-142   
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             435   1e-142   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       436   1e-142   
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         434   1e-142   
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         434   1e-142   
ref|XP_004231124.2|  PREDICTED: serine carboxypeptidase-like 40         437   1e-142   
ref|XP_002273192.3|  PREDICTED: serine carboxypeptidase-like 40         436   1e-142   Vitis vinifera
ref|XP_002463311.1|  hypothetical protein SORBIDRAFT_02g041610          437   2e-142   Sorghum bicolor [broomcorn]
ref|XP_003559864.1|  PREDICTED: serine carboxypeptidase II-3-like       436   2e-142   
ref|XP_006345395.1|  PREDICTED: serine carboxypeptidase-like 40-like    436   2e-142   
ref|XP_007131400.1|  hypothetical protein PHAVU_011G010600g             436   2e-142   
ref|XP_010324807.1|  PREDICTED: serine carboxypeptidase-like 40 i...    435   2e-142   
emb|CBI28591.3|  unnamed protein product                                436   2e-142   
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         434   2e-142   Vitis vinifera
gb|EMT05424.1|  Serine carboxypeptidase II-3                            436   2e-142   
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          434   2e-142   
emb|CBI31484.3|  unnamed protein product                                435   2e-142   
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         434   2e-142   
ref|XP_006345490.1|  PREDICTED: serine carboxypeptidase-like 40-like    435   3e-142   
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         436   3e-142   
ref|XP_004229673.1|  PREDICTED: serine carboxypeptidase-like 40         435   3e-142   
ref|XP_008658699.1|  PREDICTED: lysosomal protective protein isof...    435   3e-142   
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         433   4e-142   
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         433   4e-142   
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         434   6e-142   
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         433   6e-142   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    433   6e-142   
emb|CDP02317.1|  unnamed protein product                                433   7e-142   
gb|AES59494.2|  serine carboxypeptidase-like protein                    434   7e-142   
emb|CDY28004.1|  BnaC05g44060D                                          432   7e-142   
ref|XP_011025637.1|  PREDICTED: serine carboxypeptidase-like 40         434   8e-142   
emb|CDP19962.1|  unnamed protein product                                440   8e-142   
ref|XP_004231125.1|  PREDICTED: serine carboxypeptidase-like 40 i...    434   8e-142   
ref|XP_006345492.1|  PREDICTED: serine carboxypeptidase-like 40-like    438   1e-141   
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         432   1e-141   
ref|XP_009592799.1|  PREDICTED: serine carboxypeptidase-like 40         437   1e-141   
ref|XP_004238587.1|  PREDICTED: putative serine carboxypeptidase-...    433   1e-141   
ref|XP_004288721.1|  PREDICTED: serine carboxypeptidase 24-like         432   1e-141   
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    432   1e-141   
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          435   1e-141   
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             432   1e-141   
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         432   1e-141   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    432   1e-141   
ref|NP_191906.1|  serine carboxypeptidase-like 40                       433   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010315499.1|  PREDICTED: serine carboxypeptidase II-3-like       433   2e-141   
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               432   2e-141   Zea mays [maize]
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    432   2e-141   
emb|CBI28593.3|  unnamed protein product                                447   2e-141   
ref|XP_010659210.1|  PREDICTED: serine carboxypeptidase-like 40 i...    433   2e-141   
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         431   2e-141   
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    431   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         431   2e-141   
gb|EMT20722.1|  Serine carboxypeptidase II-3                            433   2e-141   
ref|XP_003576614.1|  PREDICTED: serine carboxypeptidase II-3-like       432   2e-141   
emb|CDP16361.1|  unnamed protein product                                432   2e-141   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase-like 29-l...    432   2e-141   
ref|XP_004984182.1|  PREDICTED: serine carboxypeptidase-like 26-l...    432   2e-141   
ref|XP_009777076.1|  PREDICTED: putative serine carboxypeptidase-...    432   3e-141   
ref|XP_009607740.1|  PREDICTED: serine carboxypeptidase-like 40         431   3e-141   
ref|XP_006292523.1|  hypothetical protein CARUB_v10018754mg             431   3e-141   
emb|CDP16360.1|  unnamed protein product                                432   3e-141   
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   431   3e-141   
gb|EEE59170.1|  hypothetical protein OsJ_11093                          429   4e-141   Oryza sativa Japonica Group [Japonica rice]
ref|NP_187456.1|  serine carboxypeptidase-like 27                       431   4e-141   Arabidopsis thaliana [mouse-ear cress]
gb|KEH21654.1|  serine carboxypeptidase-like protein                    431   4e-141   
ref|XP_008813035.1|  PREDICTED: putative serine carboxypeptidase-...    431   4e-141   
ref|XP_006346530.1|  PREDICTED: serine carboxypeptidase II-3-like       431   4e-141   
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         430   4e-141   
dbj|BAK01526.1|  predicted protein                                      432   5e-141   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           431   5e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    431   6e-141   
ref|XP_007017345.1|  Serine carboxypeptidase 40, putative               434   6e-141   
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              431   6e-141   
gb|EEC75383.1|  hypothetical protein OsI_11849                          429   6e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             430   6e-141   
gb|KFK35499.1|  hypothetical protein AALP_AA5G292700                    431   6e-141   
gb|ACF79757.1|  unknown                                                 430   7e-141   Zea mays [maize]
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         430   7e-141   
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    430   7e-141   
ref|XP_010512774.1|  PREDICTED: serine carboxypeptidase-like 40 i...    431   8e-141   
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27-like    430   8e-141   
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    430   9e-141   
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    430   1e-140   
dbj|BAO04184.1|  hypothetical protein                                   429   1e-140   
ref|NP_194790.1|  serine carboxypeptidase 24                            430   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001050257.1|  Os03g0386800                                       429   1e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010468839.1|  PREDICTED: serine carboxypeptidase-like 40         431   1e-140   
ref|XP_002467770.1|  hypothetical protein SORBIDRAFT_01g033770          431   1e-140   Sorghum bicolor [broomcorn]
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         430   2e-140   
gb|AAC63669.1|  putative serine carboxypeptidase II                     428   2e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          429   2e-140   Sorghum bicolor [broomcorn]
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               429   2e-140   
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    429   2e-140   
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         429   2e-140   
gb|AAT78817.1|  putative serine carboxypeptidase                        429   2e-140   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69980.1|  hypothetical protein OsI_00486                          429   2e-140   Oryza sativa Indica Group [Indian rice]
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          429   2e-140   
emb|CBI21207.3|  unnamed protein product                                429   2e-140   
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         429   2e-140   Vitis vinifera
ref|NP_001042076.1|  Os01g0158200                                       429   2e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006345491.1|  PREDICTED: serine carboxypeptidase-like 40-like    430   2e-140   
emb|CDP16356.1|  unnamed protein product                                430   2e-140   
ref|XP_010098713.1|  Serine carboxypeptidase II-3                       429   3e-140   
ref|XP_010068957.1|  PREDICTED: serine carboxypeptidase-like 40         433   3e-140   
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         429   3e-140   
ref|XP_007017341.1|  Serine carboxypeptidase II-3 chain B isoform 1     430   3e-140   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    429   4e-140   
ref|XP_003589243.1|  Serine carboxypeptidase II-3                       429   4e-140   
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              428   4e-140   
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         428   4e-140   
dbj|BAB08188.1|  unnamed protein product                                429   4e-140   
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    428   4e-140   
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               428   4e-140   
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         428   4e-140   
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         428   5e-140   
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            429   5e-140   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             428   5e-140   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    428   6e-140   
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    428   6e-140   
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         429   6e-140   
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         427   6e-140   
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             428   6e-140   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    427   7e-140   
ref|XP_011088747.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    429   9e-140   
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             427   1e-139   
ref|NP_001151412.1|  lysosomal protective protein precursor             428   1e-139   
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             427   1e-139   
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         428   1e-139   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         427   1e-139   
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         427   1e-139   
emb|CDY40438.1|  BnaA04g20790D                                          426   1e-139   
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    427   1e-139   
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            427   1e-139   
ref|XP_003557803.1|  PREDICTED: serine carboxypeptidase-like 27         428   2e-139   
emb|CAC19488.1|  putative serine carboxypeptidase                       428   2e-139   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34-like    427   2e-139   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    426   2e-139   
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             427   2e-139   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             427   2e-139   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         427   2e-139   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               427   2e-139   
emb|CDY32091.1|  BnaC04g44750D                                          426   2e-139   
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            427   2e-139   
ref|XP_004229672.1|  PREDICTED: serine carboxypeptidase-like 40         427   2e-139   
ref|XP_002457308.1|  hypothetical protein SORBIDRAFT_03g005370          426   2e-139   
emb|CAN74854.1|  hypothetical protein VITISV_028701                     426   3e-139   
ref|XP_010413138.1|  PREDICTED: serine carboxypeptidase-like 40         429   3e-139   
ref|XP_002876724.1|  hypothetical protein ARALYDRAFT_486857             427   4e-139   
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    426   5e-139   
gb|AFK43035.1|  unknown                                                 425   5e-139   
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    426   5e-139   
ref|XP_010545119.1|  PREDICTED: serine carboxypeptidase-like 40         426   6e-139   
ref|XP_006402270.1|  hypothetical protein EUTSA_v10005912mg             426   6e-139   
ref|XP_004499088.1|  PREDICTED: serine carboxypeptidase II-3-like...    426   6e-139   
ref|XP_006354958.1|  PREDICTED: serine carboxypeptidase-like 40-like    426   6e-139   
gb|KHN42831.1|  Serine carboxypeptidase 24                              425   6e-139   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          425   7e-139   
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                425   8e-139   
ref|XP_009792171.1|  PREDICTED: serine carboxypeptidase-like 40         426   8e-139   
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         425   8e-139   
ref|XP_002462502.1|  hypothetical protein SORBIDRAFT_02g026860          427   8e-139   
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             425   8e-139   
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         425   9e-139   
gb|AAM65698.1|  putative serine carboxypeptidase II                     425   1e-138   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              424   1e-138   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       425   1e-138   
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         425   1e-138   
ref|NP_181121.1|  serine carboxypeptidase-like 26                       424   1e-138   
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    424   1e-138   
gb|EPS67928.1|  hypothetical protein M569_06845                         424   2e-138   
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    424   2e-138   
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         424   2e-138   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         424   2e-138   
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    424   2e-138   
ref|XP_010067794.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    423   2e-138   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             423   2e-138   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    424   2e-138   
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         423   3e-138   
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                424   3e-138   
gb|EYU39414.1|  hypothetical protein MIMGU_mgv1a005505mg                424   3e-138   
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             422   4e-138   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         423   4e-138   
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            423   4e-138   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         423   4e-138   
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       423   4e-138   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          425   4e-138   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    423   5e-138   
gb|KEH17668.1|  serine carboxypeptidase-like protein                    424   5e-138   
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          423   5e-138   
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         423   5e-138   
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            423   5e-138   
ref|XP_006423055.1|  hypothetical protein CICLE_v10028330mg             423   5e-138   
ref|XP_004499087.1|  PREDICTED: serine carboxypeptidase II-3-like...    424   7e-138   
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    423   7e-138   
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              422   8e-138   
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    422   8e-138   
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    422   9e-138   
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    423   9e-138   
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         422   1e-137   
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    422   1e-137   
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         422   1e-137   
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    422   1e-137   
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    422   1e-137   
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    422   1e-137   
gb|AES59495.2|  serine carboxypeptidase-like protein                    423   1e-137   
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    421   1e-137   
gb|AES71591.2|  serine carboxypeptidase-like protein                    423   2e-137   
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         421   2e-137   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             422   2e-137   
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg             420   2e-137   
emb|CDP16350.1|  unnamed protein product                                422   2e-137   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    421   2e-137   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         421   2e-137   
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         423   2e-137   
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            422   2e-137   
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          421   2e-137   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             421   3e-137   
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         421   3e-137   
gb|ACN26414.1|  unknown                                                 423   3e-137   
emb|CDP16358.1|  unnamed protein product                                422   3e-137   
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    421   3e-137   
ref|XP_006294162.1|  hypothetical protein CARUB_v10023155mg             421   3e-137   
ref|XP_010932886.1|  PREDICTED: serine carboxypeptidase-like 40 i...    418   3e-137   
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            421   4e-137   
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             420   4e-137   
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    421   4e-137   
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    420   4e-137   
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             420   4e-137   
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    421   4e-137   
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         420   5e-137   
ref|NP_001150676.1|  serine carboxypeptidase K10B2.2 precursor          421   5e-137   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             420   5e-137   
ref|NP_001147829.1|  LOC100281439 precursor                             422   5e-137   
ref|XP_002529402.1|  serine carboxypeptidase, putative                  420   6e-137   
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         420   6e-137   
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    421   6e-137   
ref|XP_007223971.1|  hypothetical protein PRUPE_ppa014620mg             423   7e-137   
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       423   7e-137   
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    420   7e-137   
emb|CDP18632.1|  unnamed protein product                                421   7e-137   
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    421   7e-137   
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27-like    419   8e-137   
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    420   9e-137   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         420   9e-137   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         420   1e-136   
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             420   1e-136   
emb|CBI29056.3|  unnamed protein product                                420   1e-136   
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    419   1e-136   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         421   1e-136   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         419   1e-136   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          419   1e-136   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         419   2e-136   
tpg|DAA41639.1|  TPA: serine carboxypeptidase 1                         422   2e-136   
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         419   2e-136   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         419   2e-136   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             420   2e-136   
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             419   2e-136   
gb|AFK37459.1|  unknown                                                 419   2e-136   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         419   2e-136   
ref|NP_179978.2|  serine carboxypeptidase-like 22                       418   3e-136   
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    419   3e-136   
tpg|DAA53384.1|  TPA: serine carboxypeptidase K10B2.2                   419   3e-136   
ref|XP_002528403.1|  serine carboxypeptidase, putative                  419   3e-136   
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    418   3e-136   
ref|XP_003566533.2|  PREDICTED: serine carboxypeptidase 2-like          418   3e-136   
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         418   3e-136   
ref|XP_010274881.1|  PREDICTED: serine carboxypeptidase-like 34         419   4e-136   
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    419   4e-136   
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         417   4e-136   
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         418   4e-136   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         418   4e-136   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         418   5e-136   
ref|XP_006651120.1|  PREDICTED: serine carboxypeptidase II-3-like       417   7e-136   
gb|AES62200.2|  serine carboxypeptidase-like protein                    418   7e-136   
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    417   7e-136   
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         417   7e-136   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    418   7e-136   
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             417   8e-136   
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         418   8e-136   
ref|XP_006661322.1|  PREDICTED: serine carboxypeptidase II-3-like       417   9e-136   
gb|KDO49122.1|  hypothetical protein CISIN_1g044068mg                   417   1e-135   
ref|XP_004231499.1|  PREDICTED: serine carboxypeptidase-like 34         417   1e-135   
emb|CDY43258.1|  BnaC05g48510D                                          417   1e-135   
ref|XP_008670270.1|  PREDICTED: serine carboxypeptidase II-3-like       415   1e-135   
gb|EAY76388.1|  hypothetical protein OsI_04319                          416   1e-135   
gb|EMT04608.1|  Serine carboxypeptidase-like protein 40                 417   1e-135   
gb|EMT12249.1|  Serine carboxypeptidase 2                               417   1e-135   
ref|NP_001044713.1|  Os01g0833500                                       416   2e-135   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         416   2e-135   
emb|CDP10248.1|  unnamed protein product                                416   2e-135   
gb|EYU33331.1|  hypothetical protein MIMGU_mgv1a025174mg                416   2e-135   
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         417   2e-135   
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       417   2e-135   
ref|XP_009104963.1|  PREDICTED: serine carboxypeptidase-like 40         417   2e-135   
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25-like    416   3e-135   
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             416   3e-135   
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            416   4e-135   
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         416   4e-135   
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         416   4e-135   
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         415   4e-135   
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         415   4e-135   
ref|NP_179979.4|  serine carboxypeptidase-like 23                       414   5e-135   
ref|XP_004968265.1|  PREDICTED: serine carboxypeptidase 2-like          417   5e-135   
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         416   5e-135   
emb|CDY39224.1|  BnaA03g50360D                                          415   5e-135   
dbj|BAK02399.1|  predicted protein                                      415   6e-135   
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         416   6e-135   
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              415   7e-135   
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          416   8e-135   
ref|XP_011025505.1|  PREDICTED: serine carboxypeptidase-like 40 i...    414   9e-135   
ref|XP_004968264.1|  PREDICTED: serine carboxypeptidase-like 27-like    414   1e-134   
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    414   1e-134   
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             414   1e-134   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   414   1e-134   
ref|XP_009367487.1|  PREDICTED: serine carboxypeptidase II-3-like       415   1e-134   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            415   1e-134   
ref|XP_004959516.1|  PREDICTED: serine carboxypeptidase II-3-like       415   2e-134   
dbj|BAD33942.1|  putative serine carboxypeptidase precursor             415   2e-134   
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    414   2e-134   
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         413   2e-134   
ref|XP_009392029.1|  PREDICTED: putative serine carboxypeptidase-...    415   2e-134   
ref|XP_008443850.1|  PREDICTED: serine carboxypeptidase 24-like i...    414   2e-134   
ref|XP_002462503.1|  hypothetical protein SORBIDRAFT_02g026870          415   3e-134   



>ref|XP_009590317.1| PREDICTED: serine carboxypeptidase-like 26 [Nicotiana tomentosiformis]
Length=492

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/493 (67%), Positives = 381/493 (77%), Gaps = 15/493 (3%)
 Frame = +2

Query  131   SLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemee  310
             SL  TK   LF L+ ++T  G  HG  ++DQAR +M  RR+KM   H   T  A +E E 
Sbjct  8     SLFLTKLK-LFFLVTLSTFHGLSHGF-QMDQARTLMSWRRSKM---HAQTTTYATNEDET  62

Query  311   eemVFDD---VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAE-SAQT  478
             E +VF D   VG+MEDDLI  GLP QPSNV FKQYAGYVNVD  NGRSLFYYFAE S+  
Sbjct  63    ENLVFSDEKHVGNMEDDLIKDGLPAQPSNVMFKQYAGYVNVDVKNGRSLFYYFAEASSGN  122

Query  479   PHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAG  658
               +KPL+LWLNGGPGCSSLG GA +ELGPFGVNPDGKTLYSRRFAWNKVAN +FLESPAG
Sbjct  123   ASSKPLVLWLNGGPGCSSLGFGAMLELGPFGVNPDGKTLYSRRFAWNKVANVMFLESPAG  182

Query  659   VGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELAD  838
             VGFSYSNT+SDY  SGD+RTA+DAY+FLVNWFKRFPHYK RDFYI+GESYAGFY+PELAD
Sbjct  183   VGFSYSNTTSDYSKSGDKRTAEDAYRFLVNWFKRFPHYKGRDFYIMGESYAGFYVPELAD  242

Query  839   VIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV  1018
             +IVK N +P T   I  KGIMIGNGIMND+TD +G  DYLWSHALISDETH GL++HC  
Sbjct  243   IIVKMNMLPTTNFYIQFKGIMIGNGIMNDETDEKGTLDYLWSHALISDETHRGLLQHCKT  302

Query  1019  NFSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLN  1192
               +  C+HF+  A  E+G++D YNIYGP C  +  SR    +L  G+DPC + YV +YLN
Sbjct  303   E-TETCQHFQNIAEAELGNVDPYNIYGPQCSINSKSRSSSPKLKNGYDPCEQQYVQNYLN  361

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
             LP VQKALHAN T LPY W  CS +   WKD  +TMFPIY+RLIASG +ILL+SGDVD+V
Sbjct  362   LPHVQKALHANLTNLPYLWNPCSNLD--WKDTPATMFPIYKRLIASGLRILLYSGDVDAV  419

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRR  1552
             V VTSTRYS+ AM LKVIKPW PW DDT++V GY VVY+GL FATVRGAGH+VPQF PRR
Sbjct  420   VSVTSTRYSLSAMNLKVIKPWRPWLDDTQEVAGYMVVYDGLAFATVRGAGHQVPQFQPRR  479

Query  1553  ALTLLNMFLSTNH  1591
             A  LLNMF + NH
Sbjct  480   AFALLNMFFA-NH  491



>ref|XP_009794618.1| PREDICTED: serine carboxypeptidase-like 26 [Nicotiana sylvestris]
Length=495

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/489 (67%), Positives = 374/489 (76%), Gaps = 21/489 (4%)
 Frame = +2

Query  158   LFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQ----LHGGITDEA-WSemeeeemV  322
             LF L+ +  H G  HG  ++DQAR +M  RR+KM       +G   DE  W+E      V
Sbjct  16    LFFLVTLTFH-GLSHGF-QMDQARTLMSWRRSKMHARTTTTYGPHEDETLWAENL----V  69

Query  323   FDD---VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQ-TPHTK  490
             F D   VG+MEDDLI  GLPGQPSNV FKQYAGYVNVD+ NGRSLFYYFAES+     +K
Sbjct  70    FSDEKHVGNMEDDLIKDGLPGQPSNVMFKQYAGYVNVDEKNGRSLFYYFAESSSGNASSK  129

Query  491   PLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFS  670
             PL+LWLNGGPGCSSLG GA +ELGPFGVNPDGKTLYSR FAWNKVAN +FLESPAGVGFS
Sbjct  130   PLVLWLNGGPGCSSLGFGAMLELGPFGVNPDGKTLYSRTFAWNKVANVMFLESPAGVGFS  189

Query  671   YSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVK  850
             YSNT+SDY  SGD+RTA+DAY+FLVNWFKRFPHY+ RDFYI+GESYAGFY+PELAD+IVK
Sbjct  190   YSNTTSDYAKSGDKRTAEDAYRFLVNWFKRFPHYRDRDFYIMGESYAGFYVPELADIIVK  249

Query  851   RNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI  1030
             RN +P     I  KGIMIGNGIMND+TD +G  DYLWSHALISDETH GL++HC    + 
Sbjct  250   RNMLPTANFNIQFKGIMIGNGIMNDETDEKGTLDYLWSHALISDETHRGLVQHCKTE-TE  308

Query  1031  KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKV  1204
              C+HF   A  E G++D YNIYGP C  +  SR    RL  G+DPC + YV +YLNLP V
Sbjct  309   TCQHFRNIAEAEFGNVDPYNIYGPQCSINSKSRSSSPRLKNGYDPCEQQYVQNYLNLPHV  368

Query  1205  QKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             QKALHAN T LPY W  CS +   WKD  STMFPIYRRLIASG +ILL+SGDVD+VV VT
Sbjct  369   QKALHANLTNLPYLWNPCSNLD--WKDTPSTMFPIYRRLIASGLRILLYSGDVDAVVSVT  426

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTL  1564
             STRYS+ AM LKV+KPW PW DDT++V GY VV++GL FATVRGAGH+VPQF PRRA  L
Sbjct  427   STRYSLSAMNLKVMKPWRPWLDDTQEVAGYMVVFDGLAFATVRGAGHQVPQFQPRRAFAL  486

Query  1565  LNMFLSTNH  1591
             LNMF + NH
Sbjct  487   LNMFFA-NH  494



>ref|XP_002285022.1| PREDICTED: putative serine carboxypeptidase-like 23 [Vitis vinifera]
Length=481

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 374/480 (78%), Gaps = 3/480 (1%)
 Frame = +2

Query  146   KFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVF  325
             +++ LF+L+++    G  HG+  IDQA R+  LR  ++        D  W  ++ E+  F
Sbjct  2     QYYNLFILLVLVLLHGLSHGLG-IDQASRLRALRGKRLGGERSS-DDGRWEVLDMEDEGF  59

Query  326   DDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILW  505
              D G MEDDLI GGLPGQPS V FKQY+GYV V++  GR+LFYYFAE+A+ P +KPL+LW
Sbjct  60    FDSGKMEDDLIEGGLPGQPSGVLFKQYSGYVTVNELKGRNLFYYFAEAAEDPSSKPLLLW  119

Query  506   LNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTS  685
             LNGGPGCSSLGVGA +E+GPFGV PDGKTLY R +AWNKVANTLFLESP GVGFSYSN S
Sbjct  120   LNGGPGCSSLGVGAMVEIGPFGVKPDGKTLYLRPYAWNKVANTLFLESPVGVGFSYSNNS  179

Query  686   SDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMP  865
              +Y+ +GD+RTA+D Y FL+NWF+RFPHYK RDFYI+GESYAGFYIPELAD I++RN   
Sbjct  180   FEYNENGDKRTAQDTYAFLINWFRRFPHYKNRDFYIMGESYAGFYIPELADTIIRRNMKA  239

Query  866   ETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIKCEHF  1045
              ++  I LKGIMIGNGIMND TD RG YDYLWSHALISD+TH GL+E+C    S +C+  
Sbjct  240   VSSSIIHLKGIMIGNGIMNDMTDNRGFYDYLWSHALISDKTHQGLVEYCKFPDSYECKKL  299

Query  1046  ERAAGIEIGSIDFYNIYGPLCLD-SESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
             E    +E+G IDFYNIY P+CL  S SSRK KR  GFDPC  DYV  YLNLP+VQ+ALHA
Sbjct  300   EDHIELEVGLIDFYNIYAPVCLRASNSSRKPKRHGGFDPCEADYVLRYLNLPQVQEALHA  359

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
             N TK+PY WEVCS VIT W D  STMFPIY+RLI+SG +IL++SGDVD+VV V  TRYS+
Sbjct  360   NRTKIPYAWEVCSSVITSWTDSPSTMFPIYKRLISSGLQILIYSGDVDAVVSVVGTRYSI  419

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             +A+ LKVI+PWHPW + TK VGGY+VVYEGLTFAT+RGAGHEVP+F PRRA  L+  F++
Sbjct  420   NALNLKVIRPWHPWSESTKVVGGYRVVYEGLTFATIRGAGHEVPRFQPRRAFALMESFVA  479



>ref|XP_006346455.1| PREDICTED: serine carboxypeptidase-like 26-like [Solanum tuberosum]
Length=505

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/495 (65%), Positives = 370/495 (75%), Gaps = 23/495 (5%)
 Frame = +2

Query  158   LFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQ-QLHGGITDEAWSemeeeemVFDD-  331
              F L+ +  H    HG    +QAR +M  RR+K++ ++     DE WS  +    VFD  
Sbjct  16    FFFLVTLIFHGLIVHGFQMDNQARTLMSWRRSKIRSRMINSYQDETWSTEKL---VFDSD  72

Query  332   ------VGSMEDDLINGGLPGQP-SNVKFKQYAGYVNVDKTNGRSLFYYFAESAQ-TPHT  487
                   VG+MEDDLI  GLPGQP +NVKFKQYAGYVNVD+ NGRSLFYYFAESA     +
Sbjct  73    EEEKLHVGNMEDDLIKDGLPGQPKTNVKFKQYAGYVNVDEKNGRSLFYYFAESASGNASS  132

Query  488   KPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGF  667
             KPL+LWLNGGPGCSSLG GA +ELGPFGV PDGKTLYSR F+WNKVAN +FLESPAGVGF
Sbjct  133   KPLVLWLNGGPGCSSLGFGAMLELGPFGVKPDGKTLYSRTFSWNKVANVMFLESPAGVGF  192

Query  668   SYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIV  847
             SYSNTSSDY  SGD+RTA+DAY+FLVNWFKRFPHYK+RDFYI+GESYAGFY+PELAD+IV
Sbjct  193   SYSNTSSDYAQSGDKRTAQDAYRFLVNWFKRFPHYKSRDFYIMGESYAGFYVPELADIIV  252

Query  848   KRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFS  1027
             K N +  T   I  KGIMIGNGIMND TD +G  DYLWSHALISDET+ G+ +HC     
Sbjct  253   KSNMLTNTNFNIQFKGIMIGNGIMNDVTDEKGQLDYLWSHALISDETYLGIQQHCKTQTE  312

Query  1028  IK-CEHFERAAGIEIGSIDFYNIYGPLC------LDSESSRKVKRRLGFDPCAEDYVYSY  1186
              K CE F+  A  E G+ID YNIYGP+C        S S R+V ++ G+DPC + YV  Y
Sbjct  313   TKTCEQFQSTAQTEFGNIDPYNIYGPICPLDDDDSSSSSRRRVFKKNGYDPCEQYYVRDY  372

Query  1187  LNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVD  1366
             LNLP+VQKALHAN T LP  WE CS +   WKD  S+MFPIY RLIASG +ILLFSGDVD
Sbjct  373   LNLPQVQKALHANLTNLPNPWEPCSGLP--WKDSPSSMFPIYNRLIASGLRILLFSGDVD  430

Query  1367  SVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTP  1546
             +VV VTSTRYS+ AM L VIKPWH W DDTK+V GY VVY+GL FATVRGAGH+VPQF P
Sbjct  431   AVVSVTSTRYSISAMNLTVIKPWHVWHDDTKEVAGYMVVYDGLAFATVRGAGHQVPQFQP  490

Query  1547  RRALTLLNMFLSTNH  1591
             RRA  LLNMF + NH
Sbjct  491   RRAFALLNMFFA-NH  504



>ref|XP_004230807.1| PREDICTED: serine carboxypeptidase-like 26 [Solanum lycopersicum]
Length=508

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/497 (64%), Positives = 369/497 (74%), Gaps = 25/497 (5%)
 Frame = +2

Query  158   LFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQ-QLHGGITDEAWSemeeeemVFDD-  331
              F L+ +  H+   HG     QARR+M  RR+K++ +      DE WS  +      DD 
Sbjct  17    FFFLVTLIFHVLIVHGFQIDTQARRLMSWRRSKIRSRWINSYQDETWSTEKIVFDSDDDE  76

Query  332   ----VGSMEDDLINGGLPGQPS-NVKFKQYAGYVNVDKTNGRSLFYYFAESAQ-TPHTKP  493
                 VG+MEDDLI  GLPGQP  NVKF QYAGYVNVD+ NGRSLFYYFAESA     +KP
Sbjct  77    EELHVGNMEDDLIKYGLPGQPKLNVKFNQYAGYVNVDEKNGRSLFYYFAESASGNASSKP  136

Query  494   LILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSY  673
             L+LWLNGGPGCSSLG GA +ELGPFGV PDGKTLYSR FAWNKVAN +FLESPAGVGFSY
Sbjct  137   LVLWLNGGPGCSSLGFGAMLELGPFGVKPDGKTLYSRTFAWNKVANVMFLESPAGVGFSY  196

Query  674   SNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKR  853
             SNTSSDY  SGD+RTA+DAY+FLVNWFKRFPHYK+RDFYI+GESYAGFY+PELAD+IVK 
Sbjct  197   SNTSSDYAQSGDKRTAQDAYRFLVNWFKRFPHYKSRDFYIMGESYAGFYVPELADIIVKS  256

Query  854   NTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC--VVNFS  1027
             N +  T  KI  KGIMIGNGIMND TD +G  DYLWSHALISDETH G+ +HC    + +
Sbjct  257   NMLATTNSKIQFKGIMIGNGIMNDVTDEKGQLDYLWSHALISDETHLGIQQHCKTQTDET  316

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLC---------LDSESSRKVKRRLGFDPCAEDYVY  1180
               CE F+  A  E G+ID YNIYGP+C           S S R++ ++ G+DPC + YV 
Sbjct  317   KICEQFQSTAQTEFGNIDPYNIYGPICPLDDDDSSSSSSSSRRRIFKKNGYDPCEQHYVR  376

Query  1181  SYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGD  1360
              YLNLP+VQK+LHAN   LP  WE CS++   WKD  S+MFPIY RLI+SG +ILLFSGD
Sbjct  377   HYLNLPQVQKSLHAN---LPNRWESCSDLT--WKDSPSSMFPIYNRLISSGLRILLFSGD  431

Query  1361  VDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQF  1540
             VD+VV VTSTRYS+ AM L VIKPWH W DDTK+V GY VVY+GL FATVRGAGH+VPQF
Sbjct  432   VDAVVSVTSTRYSISAMNLTVIKPWHVWHDDTKEVAGYMVVYDGLAFATVRGAGHQVPQF  491

Query  1541  TPRRALTLLNMFLSTNH  1591
              PRRA  LLNMF + NH
Sbjct  492   QPRRAFALLNMFFA-NH  507



>emb|CBI32445.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/415 (70%), Positives = 341/415 (82%), Gaps = 1/415 (0%)
 Frame = +2

Query  341   MEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGP  520
             MEDDLI GGLPGQPS V FKQY+GYV V++  GR+LFYYFAE+A+ P +KPL+LWLNGGP
Sbjct  1     MEDDLIEGGLPGQPSGVLFKQYSGYVTVNELKGRNLFYYFAEAAEDPSSKPLLLWLNGGP  60

Query  521   GCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDM  700
             GCSSLGVGA +E+GPFGV PDGKTLY R +AWNKVANTLFLESP GVGFSYSN S +Y+ 
Sbjct  61    GCSSLGVGAMVEIGPFGVKPDGKTLYLRPYAWNKVANTLFLESPVGVGFSYSNNSFEYNE  120

Query  701   SGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLK  880
             +GD+RTA+D Y FL+NWF+RFPHYK RDFYI+GESYAGFYIPELAD I++RN    ++  
Sbjct  121   NGDKRTAQDTYAFLINWFRRFPHYKNRDFYIMGESYAGFYIPELADTIIRRNMKAVSSSI  180

Query  881   IPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIKCEHFERAAG  1060
             I LKGIMIGNGIMND TD RG YDYLWSHALISD+TH GL+E+C    S +C+  E    
Sbjct  181   IHLKGIMIGNGIMNDMTDNRGFYDYLWSHALISDKTHQGLVEYCKFPDSYECKKLEDHIE  240

Query  1061  IEIGSIDFYNIYGPLCLD-SESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKL  1237
             +E+G IDFYNIY P+CL  S SSRK KR  GFDPC  DYV  YLNLP+VQ+ALHAN TK+
Sbjct  241   LEVGLIDFYNIYAPVCLRASNSSRKPKRHGGFDPCEADYVLRYLNLPQVQEALHANRTKI  300

Query  1238  PYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKL  1417
             PY WEVCS VIT W D  STMFPIY+RLI+SG +IL++SGDVD+VV V  TRYS++A+ L
Sbjct  301   PYAWEVCSSVITSWTDSPSTMFPIYKRLISSGLQILIYSGDVDAVVSVVGTRYSINALNL  360

Query  1418  KVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             KVI+PWHPW + TK VGGY+VVYEGLTFAT+RGAGHEVP+F PRRA  L+  F++
Sbjct  361   KVIRPWHPWSESTKVVGGYRVVYEGLTFATIRGAGHEVPRFQPRRAFALMESFVA  415



>gb|ABR16997.1| unknown [Picea sitchensis]
Length=536

 Score =   525 bits (1352),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 255/421 (61%), Positives = 312/421 (74%), Gaps = 8/421 (2%)
 Frame = +2

Query  338   SMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGG  517
             + E D +  GLPGQP  +KF+QY+GYV VD   GR+LFYYF E+ + P  +PL+LWLNGG
Sbjct  112   TQEADYLPHGLPGQPMGIKFRQYSGYVTVDAKAGRALFYYFTEAVRDPSKQPLVLWLNGG  171

Query  518   PGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYD  697
             PGCSSLG GA  E+GPF VNPDGKT++  R+ WN+VAN LFLESPAGVGFSYSNTSSDY 
Sbjct  172   PGCSSLGFGAMAEVGPFRVNPDGKTVHFNRYTWNQVANILFLESPAGVGFSYSNTSSDYS  231

Query  698   M-SGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
               SGDRRTAKDAY FL+ WF RFP YK RDFYI GESYAG YIPELA  I+    + + +
Sbjct  232   KHSGDRRTAKDAYTFLMKWFIRFPQYKFRDFYIAGESYAGNYIPELAATILHHQRLSQAS  291

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF--SIKCEHFE  1048
               I  KGIM+GNGIMN DTD  G   Y W+HALISDET++GLI +C+ +    I CE  E
Sbjct  292   F-INFKGIMVGNGIMNSDTDNIGQITYPWTHALISDETYEGLINNCIKSNVDEILCEVLE  350

Query  1049  RAAGIEIGSIDFYNIYGPLCL--DSESSRKVKRRL-GFDPCAEDYVYSYLNLPKVQKALH  1219
                 +E+G+ID Y+IY PLCL   SE +++ +  + G+DPC++DYV++Y N P VQKA+H
Sbjct  351   LKMSLEMGNIDPYSIYAPLCLTNSSELAKQEEAEIPGYDPCSDDYVFTYFNTPDVQKAIH  410

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             AN T L YTW  CS VI+ W D AST+ PIYR LIA+G +ILL SGD D+VVPVTSTR S
Sbjct  411   ANVTNLNYTWNQCSNVISNWTDYASTVLPIYRHLIATGLRILLLSGDTDTVVPVTSTRLS  470

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             ++ +KL +  PW+PW +   +VGGY V+Y+GLTFATVRGAGHEVP F P RALTL   FL
Sbjct  471   INELKLPIATPWYPWLNG-DEVGGYTVIYKGLTFATVRGAGHEVPAFQPSRALTLFKSFL  529

Query  1580  S  1582
             +
Sbjct  530   A  530



>emb|CDO97155.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   512 bits (1318),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 255/421 (61%), Positives = 305/421 (72%), Gaps = 28/421 (7%)
 Frame = +2

Query  329   DVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWL  508
             DVG MEDDLI  GLPGQPS V FKQYAGYVNVDK NGR+LFYYF E+AQ P +KPLILWL
Sbjct  37    DVGKMEDDLIKDGLPGQPSGVMFKQYAGYVNVDKVNGRNLFYYFVEAAQDPLSKPLILWL  96

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             NGGPGCSSLG     E  P        T     ++W+ +   +FL               
Sbjct  97    NGGPGCSSLGY----EDMP-------GTELQIHYSWSLLLVLVFLIL-------------  132

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
                       A+D+Y FLVNWFK+FPHYK RD Y++GESYAG+Y+PELA+VI+KRN M E
Sbjct  133   ---APTPTTKAEDSYTFLVNWFKKFPHYKARDLYVMGESYAGYYVPELAEVIIKRNAMGE  189

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIKCEHFE  1048
                KI LKGIMIGNGIMN+ TDVRG YD+LWSHALISDET+  L E+C+V  +  C+ FE
Sbjct  190   PISKIQLKGIMIGNGIMNEVTDVRGTYDFLWSHALISDETYQRLRENCMVE-TKTCQEFE  248

Query  1049  RAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANN  1228
              A  +E G+ID  NIYGP C  S+S  + K  +G+ PC  DYV +YLNLP VQ+ALHAN 
Sbjct  249   DAGKMEFGAIDPSNIYGPSCSHSDSPWRTKFLVGYFPCEGDYVVNYLNLPHVQEALHANQ  308

Query  1229  TKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             TKLPY+W++CS++I YWKD  STMFP YRRLIASG +ILLFSGDVD +V VTSTRYS+DA
Sbjct  309   TKLPYSWQLCSDIIDYWKDSPSTMFPTYRRLIASGLRILLFSGDVDVIVSVTSTRYSIDA  368

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLSTN  1588
             M +KVIKPWHPW D+T  VGGY+V+Y+GLTFATVR AGH+VP++ PRRA  LL  FL+  
Sbjct  369   MNMKVIKPWHPWLDETSDVGGYQVIYDGLTFATVREAGHQVPEYQPRRAFALLRRFLAAE  428

Query  1589  H  1591
             +
Sbjct  429   N  429



>gb|ABR16596.1| unknown [Picea sitchensis]
Length=535

 Score =   509 bits (1312),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 251/421 (60%), Positives = 304/421 (72%), Gaps = 9/421 (2%)
 Frame = +2

Query  338   SMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGG  517
             + E D +  GLPGQP  +KF+QY+GYV VD   GR+LFYYF E+ + P  +PL+LWLNGG
Sbjct  112   TQEADYLPHGLPGQPMGIKFRQYSGYVTVDAKAGRALFYYFTEAVRDPSKQPLVLWLNGG  171

Query  518   PGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYD  697
             PGCSSLG GA  E+GPF VNPDGKT++  R+ WN+VAN LFLESPAGVGFSYSNTSSDY 
Sbjct  172   PGCSSLGFGAMAEVGPFRVNPDGKTVHFNRYTWNQVANILFLESPAGVGFSYSNTSSDYS  231

Query  698   M-SGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
               SGDRRTAKDAY FL+ WF RFP YK RDFYI GESYAG YIPELA  I+    + + +
Sbjct  232   KHSGDRRTAKDAYTFLMKWFIRFPQYKFRDFYIAGESYAGNYIPELAATILHHQRLSQAS  291

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF--SIKCEHFE  1048
               I  KGIM+GNGIMN DTD  G   Y W+HALISDET++GLI +C+ +    I CE  E
Sbjct  292   F-INFKGIMVGNGIMNSDTDNIGQITYPWTHALISDETYEGLINNCIKSNVDEILCEVLE  350

Query  1049  RAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL---GFDPCAEDYVYSYLNLPKVQKALH  1219
                 +E+G+ID Y+IY PLCL + S    +      G+DPC +DYV  Y N P VQKA+H
Sbjct  351   LKMSLEMGNIDPYSIYAPLCLTNSSELAKQEEAAIPGYDPCIDDYVSKYFNRPDVQKAIH  410

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             AN T L + W  CS+++  W D AST+ PIYR LIA G +ILLFSGD D+VVPVTSTR S
Sbjct  411   ANVTNLNHRWIHCSDLLR-WNDSASTVLPIYRHLIARGLRILLFSGDTDTVVPVTSTRLS  469

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             ++ +KL +  PW+PW +   +VGGY V+Y+GLTFATVRGAGHEVP F P RALTL   FL
Sbjct  470   INELKLPIATPWYPWLNG-DEVGGYTVIYKGLTFATVRGAGHEVPAFQPSRALTLFKSFL  528

Query  1580  S  1582
             +
Sbjct  529   A  529



>ref|XP_006853073.1| hypothetical protein AMTR_s00038p00085900 [Amborella trichopoda]
 gb|ERN14540.1| hypothetical protein AMTR_s00038p00085900 [Amborella trichopoda]
Length=494

 Score =   499 bits (1284),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 258/485 (53%), Positives = 320/485 (66%), Gaps = 15/485 (3%)
 Frame = +2

Query  149   FHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFD  328
             F+ L  +  +  H G      +  Q   +  L +AKM         + W    E      
Sbjct  9     FYSLVSVATVMCHFG----TCEAGQGEALTKLMKAKMTGESRVEMVQKWESFGEVARALP  64

Query  329   DVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWL  508
               G  E D I GGL GQP  V+FKQYAGYV +D+T GR+LFYYFAE A  P +KPL+LWL
Sbjct  65    QHGLKEKDEIVGGLHGQPEGVEFKQYAGYVTLDETAGRALFYYFAE-AVDPLSKPLLLWL  123

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             NGGPGCSSLG GA  ELGPF V  DGKTLY  R+AWNK AN LFLESPAGVGFSYSNT+S
Sbjct  124   NGGPGCSSLGYGAMEELGPFRVQSDGKTLYKNRYAWNKAANVLFLESPAGVGFSYSNTTS  183

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
             DY++SGD RTA DAY FL+NWF+RFP YK RDFYI GESYAG Y+P+LA  ++  N    
Sbjct  184   DYELSGDSRTASDAYTFLINWFERFPEYKNRDFYISGESYAGHYVPQLAYQVLSHNQKAG  243

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIK  1033
              T+ I LKGI IGN ++ND+TD  G YDY W+HA ISDET   + ++C       + + +
Sbjct  244   KTI-INLKGIAIGNAVINDETDGPGMYDYFWNHAFISDETIGAIHKYCDFSPNATSQNQQ  302

Query  1034  CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQ  1207
             C    R A   +  ID YNIY PLC  S  + K  +R  L FDPC + YV +YLNLP+VQ
Sbjct  303   CHDAAREADKNVNPIDIYNIYAPLCNFSGFTHKPHKRVVLEFDPCTDYYVDNYLNLPEVQ  362

Query  1208  KALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTS  1387
             KA HAN T+L Y W  CS++IT+W D  ST+ P+ +  +A+G ++L++SGD D  VPVT 
Sbjct  363   KAFHANVTRLNYPWSACSDIITHWNDSPSTILPLLKDFMANGIRVLVYSGDTDGRVPVTG  422

Query  1388  TRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTL  1564
             TRYS++ + L V  PW+PW    K+VGGY V+Y  GLTFATVRGAGHEVP + P R+LTL
Sbjct  423   TRYSLNMLNLSVKTPWYPWY-TRKEVGGYSVIYNGGLTFATVRGAGHEVPSYQPARSLTL  481

Query  1565  LNMFL  1579
             +N FL
Sbjct  482   VNAFL  486



>ref|XP_010916829.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=459

 Score =   492 bits (1267),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 250/458 (55%), Positives = 310/458 (68%), Gaps = 10/458 (2%)
 Frame = +2

Query  215   IDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPSNVK  394
             +++ R +M  +R+     HG  T  A  +      V    G ME D I+  LPGQP  V 
Sbjct  1     MNRLRELMKSQRSSSTLHHGLQTHPASKKTYSPVYVGPQNGQMEADKIDE-LPGQPEGVN  59

Query  395   FKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGV  574
             F QYAGYV VD   GR+LFYYF ES Q P TKPL+LWLNGGPGCSSLG GA +ELGPFGV
Sbjct  60    FDQYAGYVTVDPEAGRALFYYFVESPQDPSTKPLVLWLNGGPGCSSLGAGAMVELGPFGV  119

Query  575   NPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWF  754
             N DG+TLY+   AWN VAN +FLESPAGVGFSYSNT++DY++SGD+RTA+D+Y FLVNW 
Sbjct  120   NSDGRTLYANIHAWNIVANVIFLESPAGVGFSYSNTTTDYELSGDKRTAEDSYTFLVNWL  179

Query  755   KRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTD  934
             +RFP YKTRDFY+ GESYAG YIPELA +I+  N +   T  I LKG+ IGN  ++DDT+
Sbjct  180   ERFPQYKTRDFYMTGESYAGHYIPELASLILANNKIMNRT-AINLKGVAIGNAYIDDDTN  238

Query  935   VRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHFERAAGIEIGSIDFYNIYGPL  1105
              R  YDY W+HALISDE +  +   C     +++  C     AA  E+G+ID+Y+IY PL
Sbjct  239   TRATYDYYWTHALISDEAYKEIRSKCTFSGQSYTPGCVSALTAADAEVGNIDYYDIYAPL  298

Query  1106  CLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKD  1285
             C D   +  +  +L  DPCA  Y +SYLNLP+VQKALHAN T L Y W  C      W D
Sbjct  299   CKDPSKTTHLT-KLEVDPCAGSYTWSYLNLPEVQKALHANVTGLWYPWSRCR---GNWTD  354

Query  1286  RASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQV  1465
                T+ P  + LI+SG  + L+SGD DSVVPVTSTRYS+D + L +   W PW  D  +V
Sbjct  355   APDTLLPTIKELISSGISVWLYSGDQDSVVPVTSTRYSIDMLGLGIESSWRPWYID-GEV  413

Query  1466  GGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             GGY V Y+GLTFATVRGAGH VP + P R+LT+++ FL
Sbjct  414   GGYVVGYKGLTFATVRGAGHMVPSYQPERSLTMISSFL  451



>ref|XP_010279514.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=491

 Score =   485 bits (1248),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 260/493 (53%), Positives = 332/493 (67%), Gaps = 22/493 (4%)
 Frame = +2

Query  137   MSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGI---TDE-AWSem  304
             M     + FLLI ++  +   H      QA  +  L + K+Q    GI   +DE   +++
Sbjct  1     MKVGLVIYFLLIYLSCFVAQSHA----SQANALANLYKKKLQGKIAGIDLTSDEMKMTQI  56

Query  305   eeeemVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPH  484
               E  V    G  E D+I   LPGQP  V FKQY GYV VD++ GR+LFYYFAE AQ   
Sbjct  57    ITEAKVLPQEGLKEKDMIER-LPGQPP-VGFKQYGGYVTVDESAGRALFYYFAE-AQDAK  113

Query  485   TKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVG  664
             +KPL+LWLNGGPGCSS G GA +ELGPF V+ DGKTLY   ++WN+VAN +FLESPAGVG
Sbjct  114   SKPLLLWLNGGPGCSSFGYGAMVELGPFRVHSDGKTLYENHYSWNRVANVVFLESPAGVG  173

Query  665   FSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVI  844
             FSYSN +SDY+  GD  TA+D Y FLVNW +RFP YKTRDFYI GESYAG Y+P+LA  I
Sbjct  174   FSYSNKTSDYNTRGDGNTAQDNYVFLVNWLERFPEYKTRDFYIAGESYAGHYVPQLAHTI  233

Query  845   VKRNTM-PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN  1021
             +  N + P  T  I LKGIMIGN ++ND+TD++G YDY+W+HAL SDET+  +  +C  N
Sbjct  234   LLHNKIAPNNT--INLKGIMIGNAVLNDETDMKGMYDYVWTHALSSDETNKAINTYCNFN  291

Query  1022  ---FSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSY  1186
                 S KC +    A + +G ID YNIYGPLC  S  + K K    + FDPC++ YV +Y
Sbjct  292   ATKLSEKCLNSLIEAEMNVGFIDIYNIYGPLCFSSNLTEKPKMASLMKFDPCSDYYVIAY  351

Query  1187  LNLPKVQKALHANNTKLPYTWEVCS-EVITYWKDRASTMFPIYRRLIASGQKILLFSGDV  1363
             LN P VQ+ALHAN TKL Y W  C+ E+ + W D AST+ P+ + L+A G ++L+FSGDV
Sbjct  352   LNHPDVQEALHANITKLKYKWRPCNHEIYSNWSDSASTVLPLLQELMAEGIRVLVFSGDV  411

Query  1364  DSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQF  1540
             D  VPVTST+YS++ ++L V   W+PW  +  +VGGY VVY+ GLTF+TVRGAGHEVP +
Sbjct  412   DGRVPVTSTKYSLNKLQLLVNTSWYPWYTNN-EVGGYTVVYKGGLTFSTVRGAGHEVPSY  470

Query  1541  TPRRALTLLNMFL  1579
              P RAL L+  FL
Sbjct  471   QPLRALDLVKYFL  483



>ref|XP_010279511.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Nelumbo 
nucifera]
Length=493

 Score =   479 bits (1233),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 251/487 (52%), Positives = 331/487 (68%), Gaps = 21/487 (4%)
 Frame = +2

Query  155   MLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAW----SemeeeemV  322
             ++  L+ ++ ++   HG     QA  +  L +AK+Q   G     ++    +++  E  V
Sbjct  7     VICFLLSLSCYVAQSHG----RQADALARLYQAKLQNKAGIDLTSSYEMKMTQIINEAEV  62

Query  323   FDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLIL  502
                 G  E D+I   LPGQP  V FKQY GYV VD++ GR+LFYYF E AQ P +KPL+L
Sbjct  63    LPQEGLKEKDMIER-LPGQPP-VGFKQYGGYVTVDESAGRALFYYFVE-AQDPKSKPLLL  119

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSSLG GA  ELGPF V+ DGKTLY  R++WN+V N LFLESPAGVGFSYSN 
Sbjct  120   WLNGGPGCSSLGYGAMEELGPFRVHSDGKTLYENRYSWNRVVNVLFLESPAGVGFSYSNR  179

Query  683   SSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM  862
             +SDY   GD+ TA+D Y FLVNW +RFP YKTRDFYI GESYAG Y+P+ A  I++ N +
Sbjct  180   TSDYATRGDQSTAEDNYVFLVNWLERFPEYKTRDFYIAGESYAGHYVPQFAHTILQHNKI  239

Query  863   PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFS  1027
              +  + I LKGIMIGN ++ND+TD +G YDY W+HAL SDET+  + ++C      + +S
Sbjct  240   EQNNI-INLKGIMIGNAVINDETDQKGMYDYAWTHALSSDETNIAINKYCNFSESELEWS  298

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPK  1201
              +C +    A +    ID YNIYG  C  S  + K K+   + FDPC+++YV +YLN P 
Sbjct  299   DECINSTNEAFMNEVLIDIYNIYGSQCFSSNLTEKPKKASLMNFDPCSDNYVVAYLNQPD  358

Query  1202  VQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPV  1381
             VQ+ALHAN TKL Y W+ CS+V+T W D  ST+  + +  + +G ++L+FSGDVD  VPV
Sbjct  359   VQEALHANITKLKYDWQPCSDVLTKWNDSPSTVVYLLQEFMDNGIRVLVFSGDVDGRVPV  418

Query  1382  TSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRAL  1558
             TSTRYS++ ++L+V   W+PW    ++VGGY VVY+ GLTFATVRGAGHEVP + P RAL
Sbjct  419   TSTRYSLNKLQLQVNTSWYPWY-TKREVGGYTVVYKGGLTFATVRGAGHEVPSYQPLRAL  477

Query  1559  TLLNMFL  1579
             TL+N FL
Sbjct  478   TLVNYFL  484



>ref|XP_010261659.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=484

 Score =   474 bits (1221),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 234/424 (55%), Positives = 307/424 (72%), Gaps = 10/424 (2%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
             V    GS E D I+  LPGQPS V F QY GYV VD + GR+LFYYF E A    ++PL+
Sbjct  59    VLPQSGSKESDRISM-LPGQPS-VNFNQYGGYVTVDGSAGRALFYYFVE-APDAMSRPLV  115

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSSLG GA  ELGPF V  DG+TLY   +AWN+VAN LFLESPAGVGFSYSN
Sbjct  116   LWLNGGPGCSSLGDGAMTELGPFRVQSDGRTLYRNPYAWNQVANVLFLESPAGVGFSYSN  175

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
             TSSDY   GD+ TA+D Y FLVNW +RFP YKTRDFYI+GESYAG Y+P+LA+ I++   
Sbjct  176   TSSDYSTRGDQSTAEDNYVFLVNWLERFPEYKTRDFYIVGESYAGHYVPQLANAILQNKN  235

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF-SIKC  1036
                 ++   L+GIMIGN ++N +TD+RG YDY W+HAL+SD+ ++ +  +C  ++ S +C
Sbjct  236   AGMNSIN--LRGIMIGNPLINGETDMRGMYDYRWTHALVSDQINNAINSYCYASYQSEQC  293

Query  1037  EHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKAL  1216
              +    A   + SID YNIY PLC  S ++  +   L +DPC E YV +Y+NLP+VQ+AL
Sbjct  294   NYAMNQANAAVNSIDIYNIYAPLCA-SGANPTIAASLNWDPCGETYVRNYMNLPEVQRAL  352

Query  1217  HANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             HAN  +  + WE CS +I + W+D AST+ P+ R+ +A+G ++ +FSGDVD ++PVTSTR
Sbjct  353   HANVIRPGFYWEHCSNMINSNWRDSASTILPLLRQFMANGIRVWVFSGDVDGLIPVTSTR  412

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLN  1570
             YS++ ++L    PW+PW  + ++VGGY VVY+ GLTFATVRGAGHEVP+  P R+LTL+N
Sbjct  413   YSLNTLQLAESIPWYPWFAN-REVGGYSVVYQGGLTFATVRGAGHEVPKHQPSRSLTLVN  471

Query  1571  MFLS  1582
              FL+
Sbjct  472   YFLA  475



>ref|XP_004306277.1| PREDICTED: serine carboxypeptidase II-3-like [Fragaria vesca 
subsp. vesca]
Length=479

 Score =   473 bits (1218),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/419 (56%), Positives = 285/419 (68%), Gaps = 12/419 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSN-VKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLN  511
             GS EDD I+  LPGQP+  V F QYAGYV VD   GR+LFYYF ES Q   T PL+LWLN
Sbjct  61    GSKEDDKIDA-LPGQPTEGVDFDQYAGYVTVDADAGRALFYYFVESPQNSSTAPLVLWLN  119

Query  512   GGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSD  691
             GGPGCSSLG GA  ELGPF VN +G +LY   +AWN  AN LFLESPAGVGFSYSNT+SD
Sbjct  120   GGPGCSSLGFGAMEELGPFRVNSNGNSLYMNDYAWNNEANVLFLESPAGVGFSYSNTTSD  179

Query  692   YDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPET  871
             Y   GD +TA D+YKFL+NW ++FP YKTRDFYI GESYAG Y+P+LA  IV  N +   
Sbjct  180   YQNVGDNKTASDSYKFLINWLEKFPEYKTRDFYITGESYAGHYVPQLAYTIVSENKVTNQ  239

Query  872   TLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEH  1042
             T KI LKGI IGN  ++  T  +G YDYLWSHAL SDET  G+ ++C    +N +  CE 
Sbjct  240   T-KINLKGIAIGNAWIDASTGAQGQYDYLWSHALNSDETMAGINKYCDFVALNITSSCEK  298

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
             +   +  E+G+ID YNIY PLC     +        FDPC++DYV +YLNLP+VQ ALHA
Sbjct  299   YMSQSDNEVGNIDSYNIYAPLCGTESPAPSASSVYEFDPCSDDYVNTYLNLPEVQAALHA  358

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
                  P  W  C  V   W D   T+ PI + LIASG ++ ++SGDVDSVV VT+TR ++
Sbjct  359   R----PTQWSACGNV--GWTDSPDTVLPIIQELIASGIRLWVYSGDVDSVVAVTTTRLAI  412

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             + M LK   P+ PW     +VGGY ++YEGL FATVRGAGHEVP + P RALTL + FL
Sbjct  413   NTMNLKTTTPFRPWYSSPGEVGGYVIMYEGLVFATVRGAGHEVPSYQPGRALTLFSAFL  471



>ref|XP_011091773.1| PREDICTED: serine carboxypeptidase-like 40 [Sesamum indicum]
Length=499

 Score =   472 bits (1214),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 235/431 (55%), Positives = 302/431 (70%), Gaps = 16/431 (4%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
             V   VGS E D I   LPGQP  VKFKQY GYV VD+  GR+ +YYF E+ ++  + PL+
Sbjct  65    VHAQVGSKESDRIER-LPGQPP-VKFKQYGGYVTVDRKAGRAFYYYFVEAQRSHKSLPLL  122

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSSL  GA  ELGPF V+ DGKTLY  RFAWN  AN LFLESPAGVGFSYSN
Sbjct  123   LWLNGGPGCSSLAYGAMQELGPFRVHSDGKTLYKNRFAWNYAANVLFLESPAGVGFSYSN  182

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
             T++D+++ GDR+TA D Y FL+NW KRFP YK RDFYI GESYAG Y+P+LA  I+  N 
Sbjct  183   TTTDFEIGGDRKTAMDNYVFLLNWLKRFPEYKNRDFYISGESYAGHYVPQLAHTILYHNL  242

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI---  1030
                 T+ I LKGI+IGN +++D+TDV+G Y+Y  +HAL+SDET + ++++C  +FS    
Sbjct  243   KANNTI-INLKGIIIGNAVIDDETDVKGMYEYFGTHALVSDETTNRIMKYC--DFSPNAT  299

Query  1031  ----KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG--FDPCAEDYVYSYLN  1192
                 +C      A   I +ID YNIY PLC +S  + K K+  G   DPC++ YVY+YLN
Sbjct  300   QQLDECNEAANEADRCINAIDIYNIYAPLCSNSSLTEKPKKANGVSLDPCSDSYVYAYLN  359

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
              P+VQ+ALHAN TK+PY W+ CSEV+  W D  +T+ P+ +  +A G ++ +FSGD+D  
Sbjct  360   RPEVQEALHANVTKIPYAWQPCSEVLKKWTDSPATIIPLLKEFMAHGLRVWIFSGDIDGR  419

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPR  1549
             +PVTST+ S+  MKL +   WHPW     +VGGY  VYEG LTFATVRGAGH+VP + P 
Sbjct  420   IPVTSTKQSIQKMKLPIKTSWHPWFLG-GEVGGYTQVYEGNLTFATVRGAGHQVPSYQPA  478

Query  1550  RALTLLNMFLS  1582
             RAL+L+  FL+
Sbjct  479   RALSLIMHFLA  489



>ref|XP_009391583.1| PREDICTED: serine carboxypeptidase II-3 [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   471 bits (1211),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 238/431 (55%), Positives = 297/431 (69%), Gaps = 15/431 (3%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESA-QTPHTKPL  496
             ++ D GS E+D I   LPGQP+ V F QY GYV VD  NGR+LFYYFAE+A +   +KPL
Sbjct  58    LYADSGSKENDRIVE-LPGQPAGVDFVQYGGYVTVDDRNGRALFYYFAEAAGKQSSSKPL  116

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSS G+GA  ELGPF V  DG+TLY   +AWN VAN LFLESPAGVGFSYS
Sbjct  117   LLWLNGGPGCSSFGIGAMQELGPFRVMSDGRTLYRNPYAWNSVANVLFLESPAGVGFSYS  176

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NT+SDY  SGD++TA+DA+ FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I++  
Sbjct  177   NTTSDYSKSGDKKTAEDAFVFLVNWMERFPEYKGRDFYIAGESYAGHYVPQLAYTILQNK  236

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFS---  1027
                     I LKGI IGN ++ND+TD RG YD+ W+HALISD T + + ++C  NFS   
Sbjct  237   NQSAAGAAINLKGIAIGNAVINDETDSRGIYDFFWTHALISDATVEAIHKYC--NFSPNA  294

Query  1028  ----IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYL  1189
                  +C      A      +D YNIY PLC  S  +   K+     FDPC   YV +YL
Sbjct  295   VKEPQQCLDAASEADKVFEELDIYNIYAPLCFSSNLTSPPKKPSIEDFDPCTSIYVNAYL  354

Query  1190  NLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDS  1369
             N P+VQKALHAN T+L Y+W  CS VI+ W D  ST+ PI ++++A G +IL++SGD D 
Sbjct  355   NDPEVQKALHANITRLNYSWSSCSRVISNWVDSPSTILPIIQQILAHGVQILVYSGDTDG  414

Query  1370  VVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTP  1546
              VPVTSTRYS++ + L +  PW  W  ++ +VGGY VVY+  LTFATVRGAGHEVP + P
Sbjct  415   RVPVTSTRYSLNVLNLPIKSPWRSWTINS-EVGGYTVVYDRNLTFATVRGAGHEVPSYQP  473

Query  1547  RRALTLLNMFL  1579
              RAL L++ FL
Sbjct  474   ARALVLIDSFL  484



>gb|KDO66312.1| hypothetical protein CISIN_1g039871mg [Citrus sinensis]
Length=503

 Score =   471 bits (1212),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 229/420 (55%), Positives = 287/420 (68%), Gaps = 12/420 (3%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLN  511
              GSME D IN  LPGQP+ + F QYAGYV VD   GR+LFYYF ES +   T PL+LWLN
Sbjct  83    TGSMEQDKINA-LPGQPNGIGFNQYAGYVTVDAQAGRALFYYFVESPENSSTNPLVLWLN  141

Query  512   GGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSD  691
             GGPGCSS G GA  ELGPF VN DGKTL+   +AWN VAN +FLESPAGVGFSYSNT+SD
Sbjct  142   GGPGCSSFGNGAMTELGPFRVNSDGKTLFQNEYAWNNVANVIFLESPAGVGFSYSNTTSD  201

Query  692   YDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPET  871
             YD +GD  TA D+Y FLVNW +RFP YK RDF+I GESYAG Y+P+LAD IV  N +   
Sbjct  202   YDHAGDNSTAADSYTFLVNWLERFPQYKNRDFFITGESYAGHYVPQLADTIVSHNKVANQ  261

Query  872   TLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEH  1042
             T+ I LKG+ IGNG++ND TD  G  D+ WSHALISDE++ G+  +C     N + +C+ 
Sbjct  262   TI-INLKGVAIGNGVLNDPTDEWGAVDFYWSHALISDESYKGIHTYCDFTSENSTEQCDK  320

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG-FDPCAEDYVYSYLNLPKVQKALH  1219
             F   +  EIG I  YNIY P C  + +       +  FDPC+ DYV +YLN P+VQ ALH
Sbjct  321   FLSQSSDEIGDIFGYNIYAPFCNGTGTQGNPSGSVNEFDPCSRDYVNTYLNSPQVQTALH  380

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
              N TK    W  CS +   W D   T+ P+ + L+A+G ++ ++SGD+D VVP+TSTRYS
Sbjct  381   VNPTK----WSSCSAI--GWTDSPPTVLPLIKDLMANGIRVWIYSGDIDGVVPITSTRYS  434

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             + ++ L +  PW+PW  +  +VGGY   YEGLTF TVRGAGH VP + P+RAL ++  FL
Sbjct  435   ISSLNLPIKTPWYPWYINANEVGGYVEGYEGLTFVTVRGAGHFVPSYQPKRALVMIASFL  494



>ref|XP_006470494.1| PREDICTED: serine carboxypeptidase-like 40-like [Citrus sinensis]
Length=503

 Score =   471 bits (1211),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 230/420 (55%), Positives = 287/420 (68%), Gaps = 12/420 (3%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLN  511
              GSME D IN  LPGQP+ + F QYAGYV VD   GR+LFYYF ES +   T PL+LWLN
Sbjct  83    TGSMEQDKINA-LPGQPNGIGFNQYAGYVTVDAQAGRALFYYFVESPENSSTNPLVLWLN  141

Query  512   GGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSD  691
             GGPGCSS G GA  ELGPF VN DGKTL+   +AWN VAN +FLESPAGVGFSYSNT+SD
Sbjct  142   GGPGCSSFGNGAMTELGPFRVNSDGKTLFQNEYAWNNVANVIFLESPAGVGFSYSNTTSD  201

Query  692   YDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPET  871
             YD +GD  TA D+Y FLVNW +RFP YK RDF+I GESYAG Y+P+LAD IV  N +   
Sbjct  202   YDHAGDNSTAADSYTFLVNWLERFPQYKNRDFFITGESYAGHYVPQLADTIVSHNKVANQ  261

Query  872   TLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEH  1042
             T+ I LKG+ IGNG++ND TD  G  D+ WSHALISDE++ G+  +C     N + +C+ 
Sbjct  262   TI-INLKGVAIGNGVLNDPTDEWGAVDFYWSHALISDESYKGIHTYCDFTSENSTEQCDK  320

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG-FDPCAEDYVYSYLNLPKVQKALH  1219
             F   +  EIG I  YNIY P C  + +       +  FDPC+ DYV +YLN P+VQ ALH
Sbjct  321   FLSQSSDEIGDIFGYNIYAPFCNGTGTQGNPSGSVNEFDPCSRDYVDTYLNSPQVQTALH  380

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
              N TK    W  CS +   W D   T+ P+ + L+A+G ++ ++SGD+D VVPVTSTRYS
Sbjct  381   VNPTK----WSSCSAI--GWTDSPPTVLPLIKDLMANGIRVWIYSGDIDGVVPVTSTRYS  434

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             + ++ L +  PW+PW  +  +VGGY   YEGLTF TVRGAGH VP + P+RAL ++  FL
Sbjct  435   ISSLNLPIKTPWYPWYLNANEVGGYVEGYEGLTFVTVRGAGHFVPSYQPKRALVMIASFL  494



>ref|XP_002282331.1| PREDICTED: serine carboxypeptidase II-3-like [Vitis vinifera]
Length=488

 Score =   469 bits (1207),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 238/419 (57%), Positives = 295/419 (70%), Gaps = 13/419 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G M+DD I   LPGQP  V F QYAGYV VD   GR+LFYYF ES +   TKPL+LWLNG
Sbjct  71    GLMQDDKIES-LPGQPEGVNFDQYAGYVTVDPKAGRALFYYFVESPEDSSTKPLVLWLNG  129

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GA  ELGPF VNPDGKTL+   +AWN V+N +FLESPAGVGFSYSNTSSDY
Sbjct  130   GPGCSSLGYGAMEELGPFRVNPDGKTLFRNEYAWNNVSNVIFLESPAGVGFSYSNTSSDY  189

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
                GD++TA+D+Y FL+NW +RFP YKTRDF+I GESY+G Y+P+LA  I+  N     T
Sbjct  190   VNVGDKKTAEDSYTFLINWLERFPQYKTRDFFITGESYSGHYVPQLAYTILSNNNKTNQT  249

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHF  1045
             + I LKGI IGN  ++D+T ++G YDY+W+HAL SDE++ G+ ++C     NFS KC  +
Sbjct  250   V-INLKGIAIGNAWIDDNTSLKGIYDYIWTHALSSDESNAGIQKYCDFTTGNFSTKCLDY  308

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDS-ESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
                A  E+G+ID YNIY PLC  S  +SR V     FDPC++ YV SYLNL +VQKALHA
Sbjct  309   TYQAEGEVGNIDIYNIYAPLCHSSGPTSRSVGSVNDFDPCSDYYVESYLNLAEVQKALHA  368

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
              NT    TW  CS V   W D  +T+ P  ++L+ASG  + ++SGD D  VPVTS+RYS+
Sbjct  369   RNT----TWGACSGVG--WTDSPTTILPTIKQLMASGISVWIYSGDTDGRVPVTSSRYSI  422

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +  KL V   W PW  + K+VGGY V Y+G+ FATVRGAGH VP + P RALT++  FL
Sbjct  423   NTFKLPVKTAWRPWYYN-KEVGGYVVEYKGVVFATVRGAGHLVPSYQPGRALTMIASFL  480



>ref|XP_004135951.1| PREDICTED: serine carboxypeptidase-like 40-like [Cucumis sativus]
 ref|XP_004158177.1| PREDICTED: serine carboxypeptidase-like 40-like [Cucumis sativus]
 gb|KGN45090.1| hypothetical protein Csa_7G420830 [Cucumis sativus]
Length=512

 Score =   470 bits (1209),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 232/430 (54%), Positives = 295/430 (69%), Gaps = 15/430 (3%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
             ++D  G  + D I   LPGQP NV+F QY GYV V+K+ GR+ +YYF E+     + PL+
Sbjct  75    IYDQTGMKKQDKIER-LPGQPPNVRFSQYGGYVTVNKSAGRAFYYYFVEAPHNKKSLPLL  133

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSSL  GA  ELGPF V  DGKTL+  +F+WN  AN LFLESP GVGFSYSN
Sbjct  134   LWLNGGPGCSSLAYGAMAELGPFRVRSDGKTLFQNKFSWNHAANVLFLESPTGVGFSYSN  193

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
             T+SDY+ +GD+ TAK+ Y FLVNW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N 
Sbjct  194   TTSDYNTNGDKSTAKNNYAFLVNWLERFPEYKTRDFYIAGESYAGHYVPQLAHTILSHNK  253

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI---  1030
                  + + LKGI+IGN ++ND+TD  G YD+  SHALI+D T + + ++C  NF+    
Sbjct  254   KAGKKI-VNLKGIIIGNAVINDETDQIGMYDFFASHALIADRTANDIRKYC--NFTSEEA  310

Query  1031  ----KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLN  1192
                 +C        + IG ID YNIY PLC +S  +   K+   L +DPC + Y Y+YLN
Sbjct  311   VQNRQCLDASNMVELNIGVIDIYNIYYPLCQNSTLTNVPKKASVLNYDPCTDYYTYAYLN  370

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
                VQKA+HAN TKL Y WE CS+V+  W D AST+ P+ R  +ASG ++ +FSGD D  
Sbjct  371   RADVQKAMHANVTKLSYDWEPCSDVMQGWSDSASTVVPLLREFMASGLRVWVFSGDFDGR  430

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPR  1549
             VP+TST+YS+D+MKL V K W+PW  +  +VGGY  VYEG LT ATVRGAGHEVP + PR
Sbjct  431   VPITSTKYSIDSMKLPVKKSWYPWF-NANEVGGYAEVYEGELTLATVRGAGHEVPSYQPR  489

Query  1550  RALTLLNMFL  1579
             RAL+L+  FL
Sbjct  490   RALSLIKHFL  499



>ref|XP_004230806.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum lycopersicum]
Length=487

 Score =   468 bits (1204),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 248/496 (50%), Positives = 329/496 (66%), Gaps = 23/496 (5%)
 Frame = +2

Query  113   MGKKQDSLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEA  292
             M +K+    S     L L  + A    +     + D  R  +  RRAK   ++ G+    
Sbjct  1     MSRKKMKANSVLTLSLILCCLSAQQYCYA---GEADVLREFLKTRRAKTTIINHGLAASE  57

Query  293   WSemeeeemVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESA  472
               +    E++    GS E+D I+  LP QPS V+F QYAGYV VD   GR+LFYY AES+
Sbjct  58    -KQRSVSELIVPQAGSKENDKISA-LPEQPSAVRFNQYAGYVTVDANAGRALFYYLAESS  115

Query  473   QTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESP  652
               P TKPL+LWLNGGPGCSSLG GA IELGPF VN DGKTL+  +FAWN VAN LFLESP
Sbjct  116   GDPSTKPLVLWLNGGPGCSSLGAGAMIELGPFRVNNDGKTLWLNQFAWNNVANILFLESP  175

Query  653   AGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPEL  832
             AGVGFSYSNTSSDY  +GD +T KD++ FL+NW +RFP YK RDFYI+GESYAG Y+P+L
Sbjct  176   AGVGFSYSNTSSDY-TTGDEKTRKDSFTFLLNWMERFPEYKHRDFYIVGESYAGHYVPQL  234

Query  833   ADVIVK-RNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEH  1009
             A +I+  R T P   L I L+GI  GN +++D+T  RG YD+ W+HALISDE HDG++++
Sbjct  235   AQLILSHRKTEPN--LVINLQGIATGNALLDDETMRRGSYDFYWTHALISDEVHDGIVKN  292

Query  1010  CVVNFSIK-----CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDY  1174
             C  NFS +     C+ + + AG  +G+I  Y+IY PLC  + +S  V    GFDPC+++Y
Sbjct  293   C--NFSTETTSEACDKYIKQAGSSLGNIYGYDIYAPLCNSNATSLPV---CGFDPCSDNY  347

Query  1175  VYSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFS  1354
             V SYLN  +VQKAL  N   +PY+W  CS  +  W+D   T+ PI++ L+ SG ++ ++S
Sbjct  348   VNSYLNSAEVQKAL--NVRGIPYSWAACSTDLI-WQDWPPTVLPIFQGLMKSGIRVWIYS  404

Query  1355  GDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVP  1534
             GD DSV+ VT+TRY+++ +K  V  PW+PW     +VGG+ V YE LTF TVRGAGH VP
Sbjct  405   GDTDSVLAVTTTRYAINKIKTAVKTPWYPWYFQ-GEVGGHAVEYENLTFVTVRGAGHFVP  463

Query  1535  QFTPRRALTLLNMFLS  1582
              + P RALT+ + F++
Sbjct  464   SYQPGRALTMFSSFIN  479



>ref|XP_008813040.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=487

 Score =   468 bits (1204),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 243/485 (50%), Positives = 308/485 (64%), Gaps = 13/485 (3%)
 Frame = +2

Query  143   TKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemV  322
             T +  L L+      L   +  N+ D  RR++  +R           D   +       V
Sbjct  2     TAYFSLLLISCCLFVLPNNNEANQADHLRRLIKTKRPTWPHQSYSWADLDAAVSVSPVYV  61

Query  323   FDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLIL  502
              +  G ME D I   LPGQP+ V+F QY+GYV VD  NGR+LFYYF ES   P TKPLIL
Sbjct  62    SNQDGLMEADRIKS-LPGQPTGVEFNQYSGYVTVDTKNGRALFYYFVESQHNPSTKPLIL  120

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSSLG GA  ELGPF V+ DGKTL   ++AWN VAN LFLESPAGVGFSYSNT
Sbjct  121   WLNGGPGCSSLGYGAMQELGPFRVHSDGKTLQRNKYAWNNVANVLFLESPAGVGFSYSNT  180

Query  683   SSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM  862
             SSDYDM+GD+RTA+D+Y FLVNWF+RFPHYK  +F+I GESYAG Y+P+LA  I+  NT 
Sbjct  181   SSDYDMNGDQRTAEDSYTFLVNWFERFPHYKNHEFFITGESYAGHYVPQLASTILHHNTQ  240

Query  863   PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFS-----  1027
                T+ I L+G+ IGN  ++  T+ + GY+++W+H LISDET+    + C  NFS     
Sbjct  241   TNQTV-INLQGVAIGNAFVDSATNDKAGYEFMWNHNLISDETYAKFCKAC--NFSGIEST  297

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG-FDPCAEDYVYSYLNLPKV  1204
             + C      A +E G ID YNIY P C DS ++      +  FDPC+  YV SYLN  +V
Sbjct  298   VDCAAATEDAYVESGDIDPYNIYAPKCDDSNTTSMSGIAMADFDPCSTSYVDSYLNNLEV  357

Query  1205  QKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             QKALH    KLP  W+ CS +   W D A TM P  ++LI S  ++ LFSGD+D+VV +T
Sbjct  358   QKALHIKAPKLPNPWQSCSNLA--WVDMAPTMLPTIKQLITSRIRLWLFSGDIDTVVSIT  415

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTL  1564
             +T+Y+V  + L +   W  W   + QVGGY V YEGL F TVRGAGH VP + P RALT+
Sbjct  416   ATKYAVRNLNLPIKSSWRAWYSKS-QVGGYVVGYEGLAFVTVRGAGHMVPSYQPERALTM  474

Query  1565  LNMFL  1579
             ++ FL
Sbjct  475   ISSFL  479



>ref|XP_008363303.1| PREDICTED: serine carboxypeptidase-like 40 [Malus domestica]
Length=502

 Score =   468 bits (1204),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 237/425 (56%), Positives = 292/425 (69%), Gaps = 16/425 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I+  LPGQP  VKF QY GYV VDK  GR+LFYY  E+ +   + PL+LWLNG
Sbjct  72    GLKEKDRIDK-LPGQPK-VKFSQYGGYVTVDKKAGRALFYYLVEAEKAKDSSPLLLWLNG  129

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA +ELGPF ++ DGKTLY  RF+WN  AN LFLESPAGVGFSYSN +SDY
Sbjct  130   GPGCSSLAYGAMLELGPFRIHSDGKTLYRNRFSWNYAANVLFLESPAGVGFSYSNRTSDY  189

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D SGDR TA D Y FLVNW +RFP YK R+FYI GESYAG Y+P+LA  I+  N     T
Sbjct  190   DASGDRNTAADNYVFLVNWLERFPEYKGREFYISGESYAGHYVPQLAHTILNHNKRANKT  249

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI-------K  1033
             + I LKGI+IGN ++ND+TD +G YDYL SHALISD+T + + ++C  NF+        +
Sbjct  250   I-INLKGIIIGNAVINDETDSKGMYDYLASHALISDKTANNINKYC--NFAANATTQPKE  306

Query  1034  CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQ  1207
             C     AA  +   +D YNIY PLCL +  + K KR     FDPC+E Y Y YLN P VQ
Sbjct  307   CNDATDAANKDTYYVDIYNIYAPLCLSTNLTAKPKRTSIFEFDPCSEYYAYGYLNRPDVQ  366

Query  1208  KALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTS  1387
             +ALHAN TKL + WE CS++IT+W D AST+ P+    + +G ++ +FSGD+D  VPVTS
Sbjct  367   QALHANVTKLSHDWEPCSDIITHWGDSASTVLPLLHEFLDNGLRVWIFSGDIDGRVPVTS  426

Query  1388  TRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTL  1564
             T+YS+D M L V   WH W   + +VGGY  VYE GLTFATVR AGH+VP + P R L+L
Sbjct  427   TKYSIDKMNLAVKTEWHAWF-LSGEVGGYTQVYEGGLTFATVREAGHQVPSYQPARGLSL  485

Query  1565  LNMFL  1579
             +  FL
Sbjct  486   IKHFL  490



>gb|KHG19786.1| Serine carboxypeptidase-like 40 [Gossypium arboreum]
Length=497

 Score =   467 bits (1202),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 239/431 (55%), Positives = 300/431 (70%), Gaps = 17/431 (4%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
             V    G  E D I   LPGQP  V F+QY GYV VDK  GR+L+YYF E+  +  + PL+
Sbjct  61    VHTQQGMKEKDRIEK-LPGQPG-VLFQQYGGYVTVDKAAGRALYYYFVEAYHSKESLPLL  118

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSSL  GA  ELGPF V+ +GKTLY  R++WN  AN LFLESPAGVGFSY+N
Sbjct  119   LWLNGGPGCSSLAYGAMEELGPFRVHSNGKTLYRNRYSWNYAANVLFLESPAGVGFSYAN  178

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
             T+SDYD SGD +TA D Y FL+NW +RFP Y  R FYI GESYAG Y+P+LA  I++ N 
Sbjct  179   TTSDYDDSGDSKTAVDNYVFLLNWLERFPEYSNRKFYIAGESYAGHYVPQLAHTILQHNK  238

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF-----  1024
                TT+ I LKGI+IGN ++ND+TDV+G YDYL SHALISDET +G+ +HC  NF     
Sbjct  239   NANTTI-INLKGILIGNAVINDETDVKGMYDYLASHALISDETANGIEKHC--NFAPEDD  295

Query  1025  ---SIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYL  1189
                S +C+     AG +I  +D YNIY PLC +S  + + K      FDPC++ YVY+YL
Sbjct  296   SESSRECDAATDEAGQDIYYVDIYNIYAPLCHNSSLTIRPKEPSVANFDPCSDYYVYAYL  355

Query  1190  NLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDS  1369
             N   VQ+A+HAN TKL + WE CS++I  W D  ST+ P+ + L+A+G ++ +FSGD D 
Sbjct  356   NRDDVQEAMHANVTKLDHDWEPCSDIIRRWGDSPSTIIPLLQELMANGLRVWIFSGDADG  415

Query  1370  VVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTP  1546
              +PVTST+YS+  MKL V   WHPW  D  +VGGY  VY+G LTFATVRGAGH+VP F P
Sbjct  416   RIPVTSTKYSIKKMKLAVKTKWHPWYLD-GEVGGYTEVYKGDLTFATVRGAGHQVPSFQP  474

Query  1547  RRALTLLNMFL  1579
             +RAL+L+  FL
Sbjct  475   KRALSLIKHFL  485



>ref|XP_008800209.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=498

 Score =   466 bits (1200),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 237/416 (57%), Positives = 291/416 (70%), Gaps = 21/416 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT-PHTKPLILWLNGGPGCSSLGVG  544
             LPGQP  V F QY GYV VD   GR+LFYYFAE+A   P ++PL+LWLNGGPGCSSLG G
Sbjct  85    LPGQPEGVDFDQYGGYVTVDMEAGRALFYYFAEAASADPSSRPLVLWLNGGPGCSSLGYG  144

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             A  ELGPF V  DGKTL+   +AWN+VAN LFLESPAGVGFSYSNT+SDY  SGD +TAK
Sbjct  145   AMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYSNTTSDYGNSGDSKTAK  204

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVK-RNTMPETTLKIPLKGIM  901
             DAY FLVNW +RFP YK RDFYI GESY G Y+P+LA  I++ +N++      I L+GIM
Sbjct  205   DAYVFLVNWMERFPEYKGRDFYIAGESYGGHYVPQLAHTILQHKNSI------INLRGIM  258

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFS-------IKCEHFERAAG  1060
             IGNG++ND+TD  G +DY W+HALISDE  +G+  +C  NFS        +C+     A 
Sbjct  259   IGNGVINDETDNEGMFDYFWTHALISDEAINGIHNYC--NFSPNASSQPQQCQQAMDVAS  316

Query  1061  IEIGSIDFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKVQKALHANNTK  1234
               IG+ID YNIY PLC     +   KR     FDPC +DYV +YLN  +VQ+ALHAN TK
Sbjct  317   QSIGTIDVYNIYAPLCTSPGITPSPKRYSIKNFDPCTDDYVSAYLNTAEVQEALHANVTK  376

Query  1235  LPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMK  1414
             L YTW  CS+VIT W DR  T+ P+ +  +A+  ++L++SGDVD  VPVTS+RYS++ + 
Sbjct  377   LNYTWSGCSQVITQWTDRPYTVLPLIKECMANDVRVLVYSGDVDGRVPVTSSRYSLNQLN  436

Query  1415  LKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             L+V   W  W  +  +VGGY VVY+G LTFATVRGAGHEVP +   RAL L   FL
Sbjct  437   LRVKTQWKSWLIE-NEVGGYSVVYDGNLTFATVRGAGHEVPSYQALRALVLAKFFL  491



>ref|XP_008461353.1| PREDICTED: serine carboxypeptidase-like 40 [Cucumis melo]
Length=517

 Score =   467 bits (1201),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 232/430 (54%), Positives = 293/430 (68%), Gaps = 15/430 (3%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
             ++D  G  + D I   LPGQP NV+  QY GYV V+K+ GR+ +YYF E+     + PL+
Sbjct  80    IYDQTGMKKQDKI-VRLPGQPPNVRLSQYGGYVTVNKSAGRAFYYYFVEAPHNKKSLPLL  138

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSSL  GA  ELGPF V  DGKTL+  +F+WN  AN LFLESP GVGFSYSN
Sbjct  139   LWLNGGPGCSSLAYGAMAELGPFRVRSDGKTLFQNKFSWNHAANVLFLESPTGVGFSYSN  198

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
             T+SDYD +GD+ TA++ Y FLVNW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N 
Sbjct  199   TTSDYDTNGDKSTAENNYAFLVNWLERFPEYKTRDFYIAGESYAGHYVPQLAHTILSHNK  258

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI---  1030
                  + + LKGI+IGN ++ND+TD  G YD+  SHALI+D T   + ++C  NF+    
Sbjct  259   KAGKNI-VNLKGIIIGNAVINDETDQIGMYDFFASHALIADRTAKDIRKYC--NFTSDEA  315

Query  1031  ----KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLN  1192
                 +C          IG ID YNIY PLC ++  +   KR   L +DPC + Y Y+YLN
Sbjct  316   VQNRQCIDASNMVESNIGVIDIYNIYYPLCQNTTLTNVPKRASVLNYDPCTDYYTYAYLN  375

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
                VQKA+HAN TKL Y WE CS+V+  W D AST+ P+ R  +ASG ++ +FSGD D  
Sbjct  376   RADVQKAMHANVTKLSYDWEPCSDVMQGWSDSASTVVPLLREFMASGLRVWVFSGDFDGR  435

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPR  1549
             VP+TST+YS+D+MKL V K W+PW  + K+VGGY  VYEG LT ATVRGAGHEVP + PR
Sbjct  436   VPITSTKYSIDSMKLPVKKSWYPWF-NAKEVGGYAEVYEGELTLATVRGAGHEVPSYQPR  494

Query  1550  RALTLLNMFL  1579
             RAL+L+  FL
Sbjct  495   RALSLIKHFL  504



>ref|XP_010279510.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=493

 Score =   466 bits (1199),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 248/470 (53%), Positives = 305/470 (65%), Gaps = 28/470 (6%)
 Frame = +2

Query  221   QARRIMWLRRAKMQQLHG---------GITDEAWSemeeeemVFDDVGSMEDDLINGGLP  373
             QA  +   R AK+Q+             I DEA         V    G  E D I   LP
Sbjct  25    QAEVLGRFRMAKLQRKVAIDRSFDEKIEIMDEA--------RVLPQEGLKEKDRIKR-LP  75

Query  374   GQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFI  553
             GQP  V+F QY GYV VD++ GR+L+YYFAES     +KPL+LWLNGGPGCSSLG GA  
Sbjct  76    GQPP-VRFSQYGGYVTVDESAGRALYYYFAESHYNKKSKPLLLWLNGGPGCSSLGYGAME  134

Query  554   ELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAY  733
             ELGPF V  DGKTLY   FAWNKVAN LFLESPAGVGFSYSN +SDY   GDR TA+D Y
Sbjct  135   ELGPFRVKSDGKTLYENPFAWNKVANVLFLESPAGVGFSYSNRTSDYATRGDRNTAEDNY  194

Query  734   KFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNG  913
              FLVNW +RFP YKTRDFYI GESYAG Y+P+ A  I++ N + +  + I LKGIMIGN 
Sbjct  195   VFLVNWLERFPEYKTRDFYIAGESYAGHYVPQFAHTILQHNKISQKNI-INLKGIMIGNA  253

Query  914   IMNDDTDVRGGYDYLWSHALISDETHDGLIEHCV----VNFSIKCEHFERAAGIEIGSID  1081
             ++ND+TD +G  DY W+HAL SDE    + ++C      N + KC         +I  ID
Sbjct  254   VINDETDTKGMLDYFWTHALTSDEDKYAIDKYCDFSPGANITDKCIEAVNEDYEDIDPID  313

Query  1082  FYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
              YNIY PLC  S  + K K      FDPC + YVY+YLN P VQ ALHAN TKL Y W+ 
Sbjct  314   MYNIYAPLCHSSNLTEKPKLASIEEFDPCTDYYVYAYLNRPDVQNALHANVTKLKYDWQP  373

Query  1256  CSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             CS+V+  W D  ST+ P+ +  +A+G ++ ++SGDVD+ VPVTSTRYS++ ++L V   W
Sbjct  374   CSDVLNNWTDSPSTILPLLQEFMANGLRVWVYSGDVDARVPVTSTRYSLNKLQLAVNTSW  433

Query  1436  HPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             +PW   + +VGGY VVY+G LTFATVRGAGHEVP + PRR L L+  +L 
Sbjct  434   YPWA-LSNEVGGYSVVYKGNLTFATVRGAGHEVPSYQPRRGLALIYYYLQ  482



>ref|XP_003592239.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003601336.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES71587.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   466 bits (1199),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 237/412 (58%), Positives = 287/412 (70%), Gaps = 16/412 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV VD   GR LFYYF ES    +TKPLILWLNGGPGCSSLG GA
Sbjct  81    LPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPHNSYTKPLILWLNGGPGCSSLGYGA  140

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTLY   +AWN+VAN LFLESPAGVGFSYSNTSSDYD SGD+ TAKD
Sbjct  141   FEELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTSSDYDNSGDKSTAKD  200

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N +   T+ I LKGI IG
Sbjct  201   AYVFLINWLERFPQYKTRDFYITGESYAGHYVPQLASTILYNNKLYNNTI-INLKGISIG  259

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHFERAAGIEIGSI  1078
             N  ++D T+++G YD LW+HAL SD+TH+ + ++C     N S  C +    A +E G I
Sbjct  260   NAWIDDATNLKGIYDNLWTHALNSDQTHELIEKYCDFTKENVSAICNNATDKAFVETGKI  319

Query  1079  DFYNIYGPLCLDSESSRKVKRRLG-----FDPCAEDYVYSYLNLPKVQKALHANNTKLPY  1243
             D YNI+ PLC D  SS K     G     FDPC++ YV +YLN P+VQKALHA     P 
Sbjct  320   DIYNIHAPLCHD--SSLKNGSSTGYVSNDFDPCSDYYVTAYLNRPEVQKALHAK----PT  373

Query  1244  TWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKV  1423
              W  C+ ++T WKD  +T+ P  + LI SG K+ ++SGD D VVP TS+RY ++ +KL +
Sbjct  374   NWTHCTHLLTTWKDSPATVLPTVKYLIDSGIKLWIYSGDTDVVVPTTSSRYLINTLKLPI  433

Query  1424  IKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
                W PW    K++GGY V Y+GLTF TVRGAGH VP + P RALTL++ FL
Sbjct  434   NSAWRPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTLISSFL  484



>gb|AAT78819.1| putative serine carboxypeptidase [Oryza sativa Japonica Group]
Length=486

 Score =   465 bits (1197),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 232/459 (51%), Positives = 298/459 (65%), Gaps = 6/459 (1%)
 Frame = +2

Query  218   DQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPSNVKF  397
             DQA R++   R++M+      T E  S+    ++       +++      LPGQP    F
Sbjct  22    DQAARVLEFSRSRMEMRDDQYTTEHTSQRANHQLYMSSQDGLKEADKVSELPGQPGRAGF  81

Query  398   KQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVN  577
              QYAGYV V+ T+G++LFYYFAE+   P TKPL+LWLNGGPGCSSLG GA +E+GPF VN
Sbjct  82    DQYAGYVTVNATSGKALFYYFAEATDDPSTKPLVLWLNGGPGCSSLGDGAMLEIGPFLVN  141

Query  578   PDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFK  757
              D +TL   R+AWN VAN LFLESPAGVGFSYSNT+SDYD +GD  TA DAY FL NW +
Sbjct  142   GDNRTLSINRYAWNNVANMLFLESPAGVGFSYSNTTSDYDNTGDTSTAADAYTFLTNWLE  201

Query  758   RFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDV  937
             RFP YK RDF+I GESY G YIP+LA+ I+  N +   T+ I LKG+ IGN  ++D T+ 
Sbjct  202   RFPEYKGRDFFITGESYGGHYIPQLANAILSNNNITNVTI-INLKGVAIGNAYLDDSTNT  260

Query  938   RGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSIDFYNIYGPLCL  1111
             R   DY W+HALIS ETH  +  +C  N  +  +C +    A  E G ID YNIY PLC 
Sbjct  261   RATIDYYWTHALISKETHLAVQRNCSFNGTYMAQCRNALAEADTEKGVIDPYNIYAPLCW  320

Query  1112  DSESSRKVK-RRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVIT--YWK  1282
             ++ + R++    +  DPC+  YV SYLN P+VQ+ LHAN T L   W  CS +IT   WK
Sbjct  321   NASNPRQLHGSAINVDPCSRYYVESYLNRPEVQRTLHANTTGLKQPWSGCSNIITPENWK  380

Query  1283  DRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQ  1462
             D   +M P  + LI+SG    L+SGD+D+V PVTST YS+D ++L +   W PW  D  +
Sbjct  381   DAPVSMLPSIQGLISSGVSTWLYSGDIDAVCPVTSTLYSLDILELPINSSWRPWYSDDNE  440

Query  1463  VGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             V GY V Y+GL FATVR +GH VP + P+RALTL + FL
Sbjct  441   VAGYVVGYKGLVFATVRESGHMVPTYQPQRALTLFSSFL  479



>ref|XP_006595329.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=489

 Score =   465 bits (1197),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 238/419 (57%), Positives = 291/419 (69%), Gaps = 13/419 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP  V F QY+GYV VD   GR+LFYYF ES   P TKPL+LWLNG
Sbjct  67    GQKEADRIVA-LPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNG  125

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GAF ELGPF +N DG+TLY  ++AWN+VAN LFLESPAGVGFSYSNT+SDY
Sbjct  126   GPGCSSLGYGAFEELGPFRINSDGETLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDY  185

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
               SGD+ TAKDAY FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N   +  
Sbjct  186   GHSGDKSTAKDAYVFLINWLERFPEYKTRDFYITGESYAGHYVPQLAYTILVNNKFSQQ-  244

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHF  1045
              KI LKGI IGN  ++D   ++G YDY+W+HAL SD+TH+ + ++C V   N S  C + 
Sbjct  245   -KIKLKGIAIGNAWIDDVASIKGIYDYIWTHALSSDQTHELIEKYCDVTSENVSAMCVNA  303

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
              R A IEIG+ID YNIY PLC DS   +        FDPC++ Y  +YLN P+VQ ALHA
Sbjct  304   TRTAAIEIGNIDDYNIYAPLCHDSSLKNGSAGSVYDFDPCSDYYGEAYLNRPEVQLALHA  363

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
                  P  W  CS++I  WKD  +T+ P+ + LI S   + ++SGD DSVVPVTS+RYS+
Sbjct  364   K----PTNWAHCSDLIN-WKDSPATILPVIKYLIDSDIGLWIYSGDTDSVVPVTSSRYSI  418

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             + +KL +  PW PW     +VGGY V Y+G+TF TVRGAGH VP + P RALTL+  FL
Sbjct  419   NTLKLPIQVPWRPWYSG-NEVGGYVVKYKGVTFVTVRGAGHLVPSWQPSRALTLIFSFL  476



>gb|AAQ63884.1| putative serine carboxypeptidase [Medicago truncatula]
Length=495

 Score =   466 bits (1198),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 237/412 (58%), Positives = 287/412 (70%), Gaps = 16/412 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV VD   GR LFYYF ES    +TKPLILWLNGGPGCSSLG GA
Sbjct  81    LPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPHNSYTKPLILWLNGGPGCSSLGYGA  140

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTLY   +AWN+VAN LFLESPAGVGFSYSNTSSDYD SGD+ TAKD
Sbjct  141   FEELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTSSDYDNSGDKSTAKD  200

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N +   T+ I LKGI IG
Sbjct  201   AYVFLINWLERFPQYKTRDFYITGESYAGHYVPQLASTILYNNKLYNNTI-INLKGISIG  259

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHFERAAGIEIGSI  1078
             N  ++D T+++G YD LW+HAL SD+TH+ + ++C     N S  C +    A +E G I
Sbjct  260   NAWIDDATNLKGIYDNLWTHALNSDQTHELIEKYCDFTKENVSAICNNATDKAFVETGKI  319

Query  1079  DFYNIYGPLCLDSESSRKVKRRLG-----FDPCAEDYVYSYLNLPKVQKALHANNTKLPY  1243
             D YNI+ PLC D  SS K     G     FDPC++ YV +YLN P+VQKALHA     P 
Sbjct  320   DIYNIHAPLCHD--SSLKNGSSTGYVSNDFDPCSDYYVTAYLNRPEVQKALHAK----PT  373

Query  1244  TWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKV  1423
              W  C+ ++T WKD  +T+ P  + LI SG K+ ++SGD D VVP TS+RY ++ +KL +
Sbjct  374   NWTHCTHLLTTWKDSPATVLPTVKYLIDSGIKLWIYSGDTDVVVPTTSSRYLINTLKLPI  433

Query  1424  IKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
                W PW    K++GGY V Y+GLTF TVRGAGH VP + P RALTL++ FL
Sbjct  434   NSAWRPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTLISSFL  484



>ref|XP_006650145.1| PREDICTED: serine carboxypeptidase II-3-like [Oryza brachyantha]
Length=487

 Score =   463 bits (1192),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 239/485 (49%), Positives = 312/485 (64%), Gaps = 25/485 (5%)
 Frame = +2

Query  158   LFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDV-  334
             LF L+++       HG    DQA R++   R++M+  +    DE  +     + V   + 
Sbjct  10    LFFLVLV-------HGA-LADQAARVVEFSRSRMEMQY----DEQDAAKHTSQHVNHQLY  57

Query  335   -----GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
                  G  E D ++  LPGQPS   F QYAGYV V+ T+G++LFYYF E+ Q P TKPL+
Sbjct  58    MSSQDGLKEADKVSE-LPGQPSRADFDQYAGYVTVNATSGKALFYYFVEAVQDPSTKPLV  116

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSSLG GA +E+GPF VN D +TL   R+AWN VAN LF+ESPAGVGFSYSN
Sbjct  117   LWLNGGPGCSSLGDGAMLEIGPFFVNSDNRTLSINRYAWNNVANMLFIESPAGVGFSYSN  176

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
              +S+Y+ +GDR T  DAY FL NW +RFP YK RDF+I GESY G YIP+LA+ I+  N 
Sbjct  177   ATSEYNNTGDRSTTADAYTFLTNWLERFPEYKGRDFFITGESYGGHYIPQLANAILSNNN  236

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIK  1033
             +   T+ I LKG+ IGN  ++D T+ R   DY W+HALIS ETH  + +HC  +  +  +
Sbjct  237   ITNATI-INLKGVAIGNAYLDDSTNTRATIDYYWTHALISKETHLAVQQHCSFDGTYMAQ  295

Query  1034  CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVK-RRLGFDPCAEDYVYSYLNLPKVQK  1210
             C +   AA  E G ID YNIY PLC ++   +++    +  DPC+  Y+ SYLN P+VQ+
Sbjct  296   CRNALAAAENEKGVIDPYNIYAPLCWNASDPQQLHGLAINVDPCSRYYIDSYLNRPEVQR  355

Query  1211  ALHANNTKLPYTWEVCSEVIT--YWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             ALHAN T L   W  CS +IT   WKD   +M P  + LI+SG    L+SGD+D+V PVT
Sbjct  356   ALHANATGLKQPWSDCSNIITPENWKDAPMSMLPSIQELISSGVSTWLYSGDIDAVCPVT  415

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTL  1564
             ST YS+D ++L +   W PW  D  +VGGY V Y+GL FATVR AGH VP + P+RALTL
Sbjct  416   STLYSLDILELPISSFWRPWYSDDNEVGGYVVGYKGLVFATVREAGHMVPTYQPQRALTL  475

Query  1565  LNMFL  1579
              + FL
Sbjct  476   FSSFL  480



>gb|KDP38391.1| hypothetical protein JCGZ_04316 [Jatropha curcas]
Length=488

 Score =   462 bits (1189),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 248/464 (53%), Positives = 307/464 (66%), Gaps = 24/464 (5%)
 Frame = +2

Query  224   ARRIMWLRR-AKMQQLHGGITDEAWSeme----eeemVFDDVGSMEDDLINGGLPGQPSN  388
             A +I  LR+  +  + H  +  E W+E          V    G M+ D I G LPGQP  
Sbjct  23    ANQINTLRKFIRSHKRHVSLHTEPWNEEAYRLRSSVYVGRQDGLMKADKI-GSLPGQPQG  81

Query  389   VKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPF  568
             V F QYAGYV VD  NGR+LFYYF ES     TKPL+LWLNGGPGCSS G GA  ELGPF
Sbjct  82    VDFDQYAGYVTVDPENGRALFYYFVESPYNSSTKPLVLWLNGGPGCSSFGYGAMEELGPF  141

Query  569   GVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVN  748
              VN DGKTLY  ++AWN VAN +FLESPAGVGFSYSNTSSDY ++GD++TA+D+Y FLVN
Sbjct  142   RVNSDGKTLYRNKYAWNNVANVIFLESPAGVGFSYSNTSSDY-ITGDKKTAEDSYTFLVN  200

Query  749   WFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDD  928
             W +R+P YKTRDFYI GESYAG Y P+LA  I+  N     T KI LKGI IGN  ++ +
Sbjct  201   WLERYPQYKTRDFYITGESYAGHYAPQLAYTILSNNNNSNHT-KINLKGIAIGNAWIDQN  259

Query  929   TDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHFERAAGIEIGSIDFYNIYG  1099
             T ++G YDY W+HAL SDETH G+ ++C     NFS  C  ++     EIG ID YNIY 
Sbjct  260   TGLKGTYDYYWTHALNSDETHAGITKYCDFVTGNFSNICYQYQDLGDREIGVIDNYNIYA  319

Query  1100  PLC----LDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEV  1267
             PLC    L+S S+  VK    FDPC+ +YV+SYLNL +VQK LHA     P  W+ CS V
Sbjct  320   PLCDQSKLNSVSTASVK---DFDPCSSNYVHSYLNLTEVQKVLHAK----PTEWDSCSVV  372

Query  1268  ITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWE  1447
             + Y  D   T+ P  ++LIASG +I ++SGD DSVV VTS+RY+++  KL +   W PW 
Sbjct  373   LDY-TDIPPTVLPTVKQLIASGIRIWIYSGDTDSVVSVTSSRYAINNFKLPIHTAWRPWY  431

Query  1448  DDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
               + +VGGY   YEG+T  TVRGAGH VP + P RALT+++ FL
Sbjct  432   -TSSEVGGYLEEYEGITLITVRGAGHTVPSYQPERALTMISSFL  474



>ref|XP_007146042.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
 gb|ESW18036.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
Length=489

 Score =   462 bits (1188),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 231/409 (56%), Positives = 287/409 (70%), Gaps = 12/409 (3%)
 Frame = +2

Query  365   GLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVG  544
              LPGQ   V F QY+GYV VD   GR+LFYYF ES   P TKPL+LWLNGGPGCSSLG G
Sbjct  76    ALPGQSYGVNFDQYSGYVTVDPEAGRALFYYFVESPYNPSTKPLVLWLNGGPGCSSLGYG  135

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             AF ELGPF +N DGKTLY  ++AWN+VAN LFLESPAGVGFSYSNTSSDYD +GD+ TAK
Sbjct  136   AFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTSSDYDHAGDKSTAK  195

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMI  904
             DAY FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N      + I  K I I
Sbjct  196   DAYVFLINWLERFPQYKTRDFYITGESYAGHYVPQLAYTILLNNKYSHQNINI--KSIAI  253

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHFERAAGIEIGS  1075
             GN  ++D T  +G  DYLWSHAL SD+TH+ + ++C     N S  C +  R A IE G+
Sbjct  254   GNAWIDDVTGSKGIVDYLWSHALNSDQTHELIQKYCDFSAENVSEICANATRTALIEKGN  313

Query  1076  IDFYNIYGPLCLDSESSRKVKRRLG-FDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
             IDFYNIY PLCLDS         +  FDPC++ Y  +YLN P+VQ ALHA     P  W 
Sbjct  314   IDFYNIYAPLCLDSSLKNGSTGSVSDFDPCSDYYGEAYLNRPEVQLALHAK----PTNWT  369

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
             +CS+ ++ W D  +T+ P+ + LI SG  + ++SGD D+ VPVTS+RYS++++KL +  P
Sbjct  370   LCSDQLS-WNDSPTTILPVIKYLIDSGIGLWIYSGDTDARVPVTSSRYSINSLKLPIQVP  428

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             W PW  + K+VGGY V Y+G+TF TVRGAGH VP + P+RALT ++ FL
Sbjct  429   WRPWYSE-KEVGGYVVKYKGVTFVTVRGAGHLVPSWQPKRALTFVSSFL  476



>ref|XP_007052442.1| Serine carboxypeptidase-like 40 [Theobroma cacao]
 gb|EOX96599.1| Serine carboxypeptidase-like 40 [Theobroma cacao]
Length=542

 Score =   463 bits (1192),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 243/505 (48%), Positives = 325/505 (64%), Gaps = 22/505 (4%)
 Frame = +2

Query  98    PSALFMGKKQDSLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGG  277
             P AL +  +++S +   F ++   ++  +H           Q + +  L R KM+   G 
Sbjct  39    PPALLVTMEKNSFILVAFFLMLSCMVAPSH--------GKKQTQALGDLYRTKMKGSSGI  90

Query  278   ITDEAWSeme-eeemVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFY  454
             +T          +  V    G  E D I   LPGQP +V+F QY GYV VDK+ GR+L+Y
Sbjct  91    VTSLFEPIQSISKASVHPQEGMKEKDRIEK-LPGQP-DVQFSQYGGYVTVDKSAGRALYY  148

Query  455   YFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANT  634
             YFAE+  +  + PL+LWLNGGPGCSSL  GA  ELGPF V+  GKTLY   ++WN  AN 
Sbjct  149   YFAEAQHSKESLPLLLWLNGGPGCSSLAYGAMQELGPFRVHSTGKTLYRNSYSWNYAANV  208

Query  635   LFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAG  814
             LFLESPAGVGFSYSN +SDY+ SGD +TA D Y FL+NW +RFP YK RDFYI GESYAG
Sbjct  209   LFLESPAGVGFSYSNRTSDYNESGDSKTAADNYVFLLNWLERFPEYKGRDFYISGESYAG  268

Query  815   FYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHD  994
              Y+P+LA  I++ N     TL I LKGI+IGN ++ND+TDV+G YDY  SHALIS++T  
Sbjct  269   HYVPQLAHTILQHNQKANKTL-INLKGIIIGNAVINDETDVKGMYDYFESHALISEDTAS  327

Query  995   GLIEHC------VVNFSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LG  1150
              + +HC        N + KC      A  +   +D Y+IY PLC +S  + + K+   + 
Sbjct  328   RIKKHCNLLSEDTTNATRKCIAAVDEADRDTYYLDIYSIYAPLCHNSNLTARPKKASVMN  387

Query  1151  FDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIAS  1330
              DPC+++YVY+YLN   VQ+ALHAN TKL + WE CS+++  W+D  ST+ P+ +  +A+
Sbjct  388   IDPCSDNYVYAYLNRADVQEALHANVTKLDHDWEPCSDILGKWRDSPSTIIPLLQEFMAN  447

Query  1331  GQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFAT  1507
             G ++ +FSGD D  VPVTST+YS++ MKL V   WHPW  D  +VGGY  VY+G LTFAT
Sbjct  448   GLRVWVFSGDTDGRVPVTSTQYSINKMKLPVKTKWHPWYLDA-EVGGYTQVYKGDLTFAT  506

Query  1508  VRGAGHEVPQFTPRRALTLLNMFLS  1582
             VRGAGH+VP + P+RAL L+  FL+
Sbjct  507   VRGAGHQVPSYQPKRALALIKHFLT  531



>gb|KCW66184.1| hypothetical protein EUGRSUZ_F00022 [Eucalyptus grandis]
Length=480

 Score =   461 bits (1186),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 244/487 (50%), Positives = 311/487 (64%), Gaps = 23/487 (5%)
 Frame = +2

Query  134   LMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITD-EAWSemee  310
             L  TK  MLF L  +A  L      +++D  ++++  R+++       + D + W+  + 
Sbjct  4     LAFTKLLMLFALCQLA--LPISCRADQLDNLKKLLESRKSR------NLPDSKPWNLEKA  55

Query  311   eem-VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHT  487
               + V    G ME D I   LPGQP  V F QYAGYV V+   GR+LFYYF ES Q   T
Sbjct  56    SSVYVGPQKGLMEADKITA-LPGQPDGVDFDQYAGYVTVNPKAGRALFYYFVESPQNSST  114

Query  488   KPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGF  667
             KPL+LWLNGGPGCSSLG GA  ELGPF V+ DGKTLY   +AWN VAN +FLESPAGVGF
Sbjct  115   KPLVLWLNGGPGCSSLGYGAMEELGPFRVHSDGKTLYRNNYAWNNVANVIFLESPAGVGF  174

Query  668   SYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIV  847
             SYSNTSSDY  +GD  TA D+Y FLVNW  RFP YKTRDFYI GESYAG Y+P+LA  IV
Sbjct  175   SYSNTSSDYAKAGDNSTADDSYTFLVNWLDRFPQYKTRDFYITGESYAGHYVPQLAYTIV  234

Query  848   KRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VV  1018
              RN  P  T  I LKGI IGN  ++D+  ++G Y+Y W+HAL SDETH G++++C     
Sbjct  235   SRNKNPNQT-HINLKGIAIGNAWIDDNMCLKGMYEYFWTHALNSDETHAGIMKNCDFVTG  293

Query  1019  NFSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLP  1198
               SI C+ +   +  E G +D YNIY P C      +       FDPC+++YV SYLN P
Sbjct  294   KSSIACDQYTSESAQEHGDLDIYNIYAPFC-KPTGPKSAHLVNDFDPCSDNYVDSYLNRP  352

Query  1199  KVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVP  1378
             +VQ ALHA     P  W  C++    W D  +T+ P  ++LIASG  + ++SGD+D  VP
Sbjct  353   EVQAALHAK----PTQWSACTDFP--WTDSPATILPTIQQLIASGIDVWVYSGDIDGRVP  406

Query  1379  VTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRAL  1558
             VTS+RYS++A+KL V   W PW  +  +VGGY + Y+G+T  TVRGAGH VP + P RAL
Sbjct  407   VTSSRYSLNALKLPVKTAWRPWHSN-GEVGGYVIGYKGVTLTTVRGAGHTVPSYEPERAL  465

Query  1559  TLLNMFL  1579
             TL+  FL
Sbjct  466   TLIAAFL  472



>ref|XP_009354385.1| PREDICTED: serine carboxypeptidase-like 40 [Pyrus x bretschneideri]
Length=502

 Score =   462 bits (1188),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 234/423 (55%), Positives = 288/423 (68%), Gaps = 12/423 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I+  LPGQP NVKF QY GYV VDK  GR+LFYY  E+ +   + PL+LWLNG
Sbjct  72    GLKEKDRIDK-LPGQP-NVKFSQYGGYVTVDKKAGRALFYYLVEAEKAKDSSPLLLWLNG  129

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA +ELGPF ++ DGKTLY  RF+WN  AN LFLESPAGVGFSYSN +SDY
Sbjct  130   GPGCSSLAYGAMLELGPFRIHSDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNRTSDY  189

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D SGDR TA D Y FLVNW +RFP YK R+FYI GESYAG Y+P+LA  I+  N     T
Sbjct  190   DASGDRNTAADNYVFLVNWLERFPEYKGREFYISGESYAGHYVPQLAHTILNHNKRANKT  249

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCE  1039
             + I LKGI+IGN  +ND+TD +G YDYL +HALISD+T + + ++C     V     +C 
Sbjct  250   I-INLKGIIIGNAAINDETDSKGTYDYLATHALISDKTANNINKYCNFAANVTTQPKECN  308

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKA  1213
                 AA  +   +D +NIY PLCL +  + K KR     FDPC+E Y Y YLN P VQ+A
Sbjct  309   DATDAADKDTYYVDIFNIYAPLCLSTNLTAKPKRTSIFEFDPCSEYYAYGYLNRPDVQQA  368

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             LHAN TKL + WE CS++IT W D AST+ P+    + +G ++ +FSGD+D  V VTST+
Sbjct  369   LHANVTKLSHDWEPCSDIITNWGDSASTVLPLLHEFLDNGLRVWIFSGDIDGRVSVTSTK  428

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLN  1570
             YS+D M L V   WH W   + +VGGY  VYE GLTFATVR AGH+VP + P R L+L+ 
Sbjct  429   YSIDKMNLAVKTEWHAWF-LSGEVGGYTQVYEGGLTFATVREAGHQVPSYQPARGLSLIK  487

Query  1571  MFL  1579
              FL
Sbjct  488   HFL  490



>ref|XP_010938742.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=489

 Score =   461 bits (1185),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 237/432 (55%), Positives = 291/432 (67%), Gaps = 20/432 (5%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT-PHTKPL  496
             V+   G  E D I G LPGQP  + F QY GYV VD   GR+LFYYFAE+    P +KPL
Sbjct  61    VYPQQGLKEGDKI-GKLPGQPERIDFDQYGGYVTVDAEAGRALFYYFAEAVSADPSSKPL  119

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSSLG GA  ELGPF V  DGKTL+   +AWN+VAN LFLESPAGVGFSYS
Sbjct  120   VLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYS  179

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NT+SDYD SGDRRTA+DAY FLVNW +RFP YK RDF+I GESYAG Y+P+LA  I++ N
Sbjct  180   NTTSDYDKSGDRRTAEDAYVFLVNWMERFPEYKGRDFFIAGESYAGHYVPQLAHTILQHN  239

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFS---  1027
                     I LKGIMIGNG++ND+TD +G YDY W+HALISDET D + ++C  NFS   
Sbjct  240   DT-----NINLKGIMIGNGVINDETDNKGLYDYFWTHALISDETIDAIHKYC--NFSPDA  292

Query  1028  ----IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYL  1189
                  +C             +D YNIY PLC  S  +   KR     FDPC  DYV +YL
Sbjct  293   TDQTKQCYQAVDVTDQVFEMLDIYNIYAPLCSSSGVTPSPKRYSIKNFDPCTYDYVAAYL  352

Query  1190  NLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDS  1369
             N  +VQ+ALHAN TKL YTW  CS     W D  ST+ P+ +  +A+  ++ ++SGDVD 
Sbjct  353   NTAEVQEALHANVTKLNYTWSGCSRQFAQWMDSPSTVLPLIKECMANDVRVWVYSGDVDG  412

Query  1370  VVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTP  1546
              VPVTS+RYS++ + L +   W PW  +  +VGGY ++Y+G LTFATVRGAGHE+P +  
Sbjct  413   RVPVTSSRYSLNQLNLSIKTEWQPWFIN-NEVGGYSIIYDGNLTFATVRGAGHEIPSYQA  471

Query  1547  RRALTLLNMFLS  1582
              RAL L+  FL+
Sbjct  472   LRALILVKFFLN  483



>ref|XP_006482952.1| PREDICTED: serine carboxypeptidase-like 40-like [Citrus sinensis]
Length=497

 Score =   460 bits (1184),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 236/481 (49%), Positives = 315/481 (65%), Gaps = 17/481 (4%)
 Frame = +2

Query  164   LLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSe--meeeemVFDDVG  337
               II++ ++   H      Q +R+  L +AK+++ + G+    +          +    G
Sbjct  13    FFIIVSCYIAETHAKK---QEQRLGHLYKAKLKE-NSGVDTSLFKTIHNVSRATIHSQDG  68

Query  338   SMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGG  517
               E+D I   LPGQP  V+F QY GYV VD++ GR+++YYF E+ ++  + PL+LWLNGG
Sbjct  69    LKENDRIEK-LPGQPE-VEFSQYGGYVTVDESAGRAMYYYFVEAQKSKDSAPLLLWLNGG  126

Query  518   PGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYD  697
             PGCSSL  GA  ELGPF V  DGK+L+  R++WN  AN LFLESPAGVGFSYSN +SDYD
Sbjct  127   PGCSSLAYGAMQELGPFRVRSDGKSLFRNRYSWNNAANVLFLESPAGVGFSYSNRTSDYD  186

Query  698   MSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTL  877
              SGDR+TA D Y FLVNW +RFP YK R+FYI GESYAG Y P+LA  I+  N    TT+
Sbjct  187   ESGDRKTAADNYMFLVNWLERFPEYKGREFYISGESYAGHYAPQLAHTILYHNKKANTTI  246

Query  878   KIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHF  1045
              I LKGIMIGN ++ND+TDVRG Y+Y  SHALISDE    + ++C        S +C   
Sbjct  247   -INLKGIMIGNAVINDETDVRGMYEYFQSHALISDEAAYQIQKYCDFSPNATRSDECNAA  305

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKALH  1219
                A   I  +D YNIY PLC +S  + + K+     FDPC++ YVY+YLN P VQ+ALH
Sbjct  306   TEEAEENISHLDIYNIYAPLCSNSSLTARPKKASITNFDPCSDYYVYAYLNRPDVQQALH  365

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             AN TKL + WE CS+++  W+D  ST+ P+ R  + +G ++ +FSGD D  +PVTST+ S
Sbjct  366   ANVTKLDHDWEPCSDILRKWQDSPSTIIPLLREFMENGLRLWIFSGDTDGRIPVTSTKNS  425

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMF  1576
             ++ MKL +  PWH W     +VGGY  VY+G +TFATVRGAGH+VP + P+RAL+L+  F
Sbjct  426   INTMKLPIKTPWHAWY-LYGEVGGYTQVYKGDITFATVRGAGHQVPSYQPKRALSLVKHF  484

Query  1577  L  1579
             L
Sbjct  485   L  485



>ref|XP_003557804.1| PREDICTED: serine carboxypeptidase 24-like [Brachypodium distachyon]
Length=500

 Score =   460 bits (1183),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 237/461 (51%), Positives = 303/461 (66%), Gaps = 10/461 (2%)
 Frame = +2

Query  218   DQARRIMWLR--RAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPSNV  391
             DQA RI+     R +MQ  H        S ++    V    G  E D ++  LPGQP   
Sbjct  36    DQAARILQFSTSRMEMQCHHQDSKVHRRSHIDHAMKVSPQDGMKEADKVSE-LPGQPGRA  94

Query  392   KFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFG  571
              F QYAGYV V+ T+G++LFYYFAE+A+ P TKPL+LWLNGGPGCSSLG GA +E+GPF 
Sbjct  95    LFDQYAGYVTVNSTSGKALFYYFAEAAEDPSTKPLVLWLNGGPGCSSLG-GAMLEIGPFF  153

Query  572   VNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNW  751
             VN D +TL + ++AWN VAN LFLESPAGVGFSYSNT+SDY+ +GD  TA D+Y FLVNW
Sbjct  154   VNSDNRTLSTNKYAWNNVANMLFLESPAGVGFSYSNTTSDYNNTGDSSTATDSYTFLVNW  213

Query  752   FKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDT  931
              +RFP YK RDF+I GESY G YIP+LA+ I+  N +      I LKG+ IGN  ++D+T
Sbjct  214   LERFPEYKGRDFFITGESYGGHYIPQLANTILSNNKITNAPF-INLKGVAIGNAYLDDNT  272

Query  932   DVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSIDFYNIYGPL  1105
             + R   DY W+HA+IS E H  + ++C  N  ++  C     AA +E+G ID YNIY  +
Sbjct  273   NTRATMDYFWTHAMISREAHQAVQKNCSFNGTYTGGCRTAITAANMELGIIDPYNIYASV  332

Query  1106  CLDSESSRKVK-RRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVIT--Y  1276
             C ++ + +++       DPCA  Y+ +YLN P+VQ+ALHAN T L   W  CS++IT   
Sbjct  333   CWNASNPQELHGMAANTDPCALYYIQTYLNNPEVQRALHANTTGLKRPWTDCSDIITPEN  392

Query  1277  WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDT  1456
             WKD   +M P  RRLI+S     L+SGDVDSV PVTST+YS+D + L     W  W  D 
Sbjct  393   WKDAPVSMLPSIRRLISSEVSTWLYSGDVDSVCPVTSTQYSLDLLGLPTNSSWRSWYSDD  452

Query  1457  KQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              QVGGY + Y+GL FATVRGAGH VP + PRRALTL + FL
Sbjct  453   DQVGGYVIGYKGLVFATVRGAGHMVPTYQPRRALTLFSSFL  493



>ref|XP_003592238.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 ref|XP_003601335.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 gb|AES71586.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   459 bits (1182),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 234/409 (57%), Positives = 282/409 (69%), Gaps = 11/409 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV VD   GR LFYYF ES     TKPL+LW NGGPGCSSLG GA
Sbjct  82    LPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPYNSSTKPLVLWFNGGPGCSSLGYGA  141

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTLY   +AWN+VAN LFLESPAGVGFSYSNT+SDYD SGD+ TAKD
Sbjct  142   FQELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTTSDYDNSGDKSTAKD  201

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+NW +RFP YKTR FYI GESYAG Y+P+LA  I+  N +   T  I LKGI IG
Sbjct  202   AYVFLINWLERFPQYKTRAFYITGESYAGHYVPQLASTILHNNKLYNNT-TINLKGISIG  260

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHFERAAGIEIGSI  1078
             N  ++D T +RG +DYLW+HAL SD+TH+ + ++C     N S  C +    A +E G I
Sbjct  261   NAWIDDATGLRGLFDYLWTHALNSDQTHELIEKYCDFTSENVSSICINATHKAFLEQGKI  320

Query  1079  DFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
             D YNIY PLC DS         +   FDPC++ Y  +YLN P+VQKALHA     P  W 
Sbjct  321   DSYNIYAPLCHDSSLKNGSTGYVTNDFDPCSDYYGAAYLNTPEVQKALHAK----PTNWT  376

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
              C+ ++T WKD   T+ P  + LI SG K+ ++SGD DSVVPVTS+RYS++ +KL +   
Sbjct  377   HCTHLLTDWKDSPITILPTVKYLIDSGIKLWIYSGDTDSVVPVTSSRYSINTLKLPINAA  436

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             W PW    K++GGY V Y+GLTF TVRGAGH VP + P RALTL++ FL
Sbjct  437   WRPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTLISSFL  484



>ref|XP_007224802.1| hypothetical protein PRUPE_ppa023729mg, partial [Prunus persica]
 gb|EMJ26001.1| hypothetical protein PRUPE_ppa023729mg, partial [Prunus persica]
Length=485

 Score =   459 bits (1180),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 232/421 (55%), Positives = 284/421 (67%), Gaps = 14/421 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I G LPGQP  V F QY GYV VD   GR+LFYYF ES Q   TKPL+LWLNG
Sbjct  65    GLKEADKI-GALPGQPQGVDFDQYGGYVTVDPQAGRALFYYFVESPQNSSTKPLVLWLNG  123

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS G GA  ELGPF VN D KTL+   +AWN VAN LFLESPAGVGFSYSNT+SDY
Sbjct  124   GPGCSSFGYGAMEELGPFRVNSDRKTLFQNEYAWNHVANVLFLESPAGVGFSYSNTTSDY  183

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             +  GD+RTA+D+YKFL+NW +RFP YKTRDF+I GESYAG Y+P+LA  I++ N     T
Sbjct  184   ENVGDKRTAQDSYKFLINWLERFPQYKTRDFFITGESYAGHYVPQLASTILQHNKATNQT  243

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHF  1045
               I LKGI IGN  ++D T   G YDYLWSHAL SDET+ G+ ++C     N S  C+ +
Sbjct  244   NIINLKGIAIGNAWIDDSTGQLGIYDYLWSHALNSDETNAGIHKYCDFASDNSSSSCDKY  303

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSES---SRKVKRRLGFDPCAEDYVYSYLNLPKVQKAL  1216
             +  AG E G++D YNIY PLC  S++   S       GFDPC++ YV +YLNL +VQ AL
Sbjct  304   QNQAGDEAGNVDIYNIYAPLCKISQAKSPSSSTGSVNGFDPCSDYYVDTYLNLVEVQAAL  363

Query  1217  HANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRY  1396
             H      P  W  C  V   W D  +TM P  ++LIASG  + ++SGD D  VP TS+RY
Sbjct  364   HVK----PTNWSACGGVG--WTDSPTTMLPTIKQLIASGISLWIYSGDNDGRVPFTSSRY  417

Query  1397  SVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMF  1576
             ++  +KL +   W PW  +T +VGGY   Y+GLTFAT+RGAGH VP + P+RALT ++ F
Sbjct  418   ALSTLKLPLQTTWRPWYSNT-EVGGYVAGYKGLTFATIRGAGHMVPSYQPQRALTFISSF  476

Query  1577  L  1579
             L
Sbjct  477   L  477



>ref|XP_004502015.1| PREDICTED: serine carboxypeptidase-like 40-like [Cicer arietinum]
Length=489

 Score =   459 bits (1181),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 232/408 (57%), Positives = 282/408 (69%), Gaps = 10/408 (2%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F  Y+GYV VD   GR LFYYFAES   P +KPLILWLNGGPGCSSLG GA
Sbjct  77    LPGQPYGVDFDHYSGYVTVDPKAGRELFYYFAESPYFPSSKPLILWLNGGPGCSSLGYGA  136

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTLY  ++AWN+VAN LFLESPAGVGFSYS+T+SDYD SGD+RTA D
Sbjct  137   FEELGPFRVNSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSDTTSDYDKSGDKRTAND  196

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N +   T+ I LKGI IG
Sbjct  197   AYVFLINWLERFPQYKTRDFYITGESYAGHYVPQLAYTILSNNKLYNKTI-INLKGISIG  255

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHFERAAGIEIGSI  1078
             N  ++D T ++G YDY W+HAL SD+TH+ + ++C       S  C +    A IE G I
Sbjct  256   NAWIDDATSLKGLYDYFWTHALNSDQTHELIDKYCDFTSEKISAICVNATEKALIEKGHI  315

Query  1079  DFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             DFYNIY P C DS   +        FDPC+++Y  +YLN P+VQKALHA     P  W  
Sbjct  316   DFYNIYAPQCHDSSLKNGSTGSVYEFDPCSDNYGIAYLNRPEVQKALHAK----PTNWTH  371

Query  1256  CSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             CS+VI  W D   T+ P  + LI SG K+ ++SGD D+ VPVTS+RYS++ +KL +   W
Sbjct  372   CSDVILKWNDSPVTILPTIKYLIDSGIKLWIYSGDTDARVPVTSSRYSINTLKLPITAAW  431

Query  1436  HPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PW    K+VGGY   Y+GLT  TVRGAGH VP + P RALTL++ F+
Sbjct  432   RPWYSG-KEVGGYVEGYKGLTLVTVRGAGHLVPSWQPARALTLISSFI  478



>ref|XP_006438918.1| hypothetical protein CICLE_v10031327mg [Citrus clementina]
 gb|ESR52158.1| hypothetical protein CICLE_v10031327mg [Citrus clementina]
Length=497

 Score =   459 bits (1181),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 235/481 (49%), Positives = 315/481 (65%), Gaps = 17/481 (4%)
 Frame = +2

Query  164   LLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSe--meeeemVFDDVG  337
               II++ ++   H      Q +R+  L +AK+++ + G+    +          +    G
Sbjct  13    FFIIVSCYIAETHAKK---QEQRLGHLYKAKLKE-NSGVDTSLFKTIHNVSRATIHSQDG  68

Query  338   SMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGG  517
               E+D I   LPGQP  V+F QY GYV VD++ GR+++YYF E+ ++  + PL+LWLNGG
Sbjct  69    LKENDRIEK-LPGQPE-VEFSQYGGYVTVDESAGRAMYYYFVEAQKSKDSAPLLLWLNGG  126

Query  518   PGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYD  697
             PGCSSL  GA  ELGPF V  DGK+L+  R++WN  AN LFLESPAGVGFSYSN +SDYD
Sbjct  127   PGCSSLAYGAMQELGPFRVRSDGKSLFRNRYSWNNAANVLFLESPAGVGFSYSNRTSDYD  186

Query  698   MSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTL  877
              SGDR+TA D Y FLVNW +RFP YK R+FYI GESYAG Y P+LA  I+  N    TT+
Sbjct  187   ESGDRKTAADNYMFLVNWLERFPEYKGREFYISGESYAGHYAPQLAHTILYHNKKANTTI  246

Query  878   KIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHF  1045
              I LKGIMIGN ++ND+TDVRG Y+Y  SHALISDE    + ++C        S +C   
Sbjct  247   -INLKGIMIGNAVINDETDVRGMYEYFQSHALISDEAAYQIQKYCDFSPNATRSDECNAA  305

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKALH  1219
                A   I  +D YNIY PLC +S  + + K+     FDPC++ YVY+YLN P VQ+ALH
Sbjct  306   TEEAEENISHLDIYNIYAPLCSNSSLTARPKKASITNFDPCSDYYVYAYLNRPDVQQALH  365

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             AN TKL + WE CS+++  W+D  ST+ P+ R  + +G ++ +FSGD D  +PVTST+ S
Sbjct  366   ANVTKLDHDWEPCSDILRKWQDSPSTIIPLLREFMENGLRLWIFSGDTDGRIPVTSTKNS  425

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMF  1576
             ++ MKL +  PWH W     +VGGY  +Y+G +TFATVRGAGH+VP + P+RAL+L+  F
Sbjct  426   INTMKLPIKTPWHAWY-LYGEVGGYTQMYKGDITFATVRGAGHQVPSYQPKRALSLVKHF  484

Query  1577  L  1579
             L
Sbjct  485   L  485



>ref|XP_003592240.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score =   459 bits (1181),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 231/413 (56%), Positives = 285/413 (69%), Gaps = 15/413 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV V+   GR LFYYF ES     TKPL+LWLNGGPGCSSLG GA
Sbjct  79    LPGQPYGVNFDQYSGYVTVNPEAGRELFYYFVESPYNSSTKPLVLWLNGGPGCSSLGYGA  138

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF +N DGKTLY  ++AWN+VAN LFLESPAGVGFSYSNT+SDYD SGD+ TAKD
Sbjct  139   FQELGPFRINSDGKTLYRNQYAWNEVANVLFLESPAGVGFSYSNTTSDYDKSGDKSTAKD  198

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL+NW +RFP YKTR FYI GESYAG Y+P+LA  I+  N +   T+ I LKGI IG
Sbjct  199   SYVFLINWLERFPQYKTRAFYIAGESYAGHYVPQLASTILHNNKLYNNTV-INLKGISIG  257

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC--VVNF-----SIKCEHFERAAGIE  1066
             N  ++D T ++G +DY W+HAL SD+TH+ + ++C   V+F     S  C +    A  E
Sbjct  258   NAWIDDATSLKGLFDYFWTHALNSDQTHELIEKYCDFTVDFTSGNTSAICNNVTDRAYTE  317

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRLG--FDPCAEDYVYSYLNLPKVQKALHANNTKLP  1240
              G IDFYNIY PLC DS         +   FDPC++ Y  +YLN P+VQ+ALHA     P
Sbjct  318   KGKIDFYNIYAPLCHDSSLKNGSTGYVSNDFDPCSDYYGIAYLNRPEVQQALHAK----P  373

Query  1241  YTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLK  1420
               W  CSE+ + WKD   T+ P  + LI SG K+ ++SGD D  VPVTS+RYS++ +KL 
Sbjct  374   TNWSYCSEINSKWKDSPITVLPTIKYLIDSGIKLWIYSGDTDGRVPVTSSRYSINTLKLP  433

Query  1421  VIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +   WHPW    K++GGY V Y+GLTF TVRGAGH VP + P RALTL++ FL
Sbjct  434   INDAWHPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTLISSFL  485



>ref|XP_004303115.1| PREDICTED: serine carboxypeptidase-like 40-like [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   459 bits (1181),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 235/426 (55%), Positives = 291/426 (68%), Gaps = 15/426 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWL  508
             G  E D I   LPGQP  V F QY GYV VDK  GR+ FYYFAE+   Q   + PL+LWL
Sbjct  72    GLKEKDRITS-LPGQPK-VNFNQYGGYVTVDKKAGRAFFYYFAEAEDQQAKDSLPLLLWL  129

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             NGGPGCSSL  GA +ELGPF ++ DGKTLY  RF+WN  AN LFLESPAGVGFSYSNT+S
Sbjct  130   NGGPGCSSLAYGAMLELGPFRIHSDGKTLYRNRFSWNYAANVLFLESPAGVGFSYSNTTS  189

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
             DYD SGDRRTA D Y FLVNW +RFP YK R+FYI GESYAG Y+P+LA  I+  N    
Sbjct  190   DYDKSGDRRTAADNYVFLVNWLERFPEYKGREFYISGESYAGHYVPQLAQTILHHNKKAN  249

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC------VVNFSI  1030
              T+ I LKGI+IGN ++ND+TD +G YDYL +HALISDE  + + ++C        + + 
Sbjct  250   KTI-INLKGIIIGNAVINDETDTKGMYDYLATHALISDEIANQVHKYCDFSPNSTTDETK  308

Query  1031  KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKV  1204
             +C     A       ID YNIY PLC  S  + K K+   L FDPC+E+Y Y+YLN P V
Sbjct  309   ECGDAMDAIDRATYYIDIYNIYAPLCTSSNLTVKPKKASILKFDPCSENYAYAYLNRPDV  368

Query  1205  QKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             Q+ALHAN TKL + WE CS+VIT+W D ++T+ P+    + +G ++ +FSGD D  VPVT
Sbjct  369   QEALHANVTKLSHDWEPCSDVITHWGDSSTTILPLLHEFMDNGLRVWIFSGDTDGRVPVT  428

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALT  1561
             ST+YS++ M L +   WH W   + QVGGY  VYEG +TFATVR AGH+VP + P RAL+
Sbjct  429   STKYSLEKMNLPIKTAWHAWF-LSGQVGGYTQVYEGDITFATVREAGHQVPSYQPARALS  487

Query  1562  LLNMFL  1579
             L+  FL
Sbjct  488   LIKHFL  493



>gb|EYU42662.1| hypothetical protein MIMGU_mgv1a022120mg [Erythranthe guttata]
Length=489

 Score =   458 bits (1178),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 244/467 (52%), Positives = 308/467 (66%), Gaps = 19/467 (4%)
 Frame = +2

Query  200   HGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQ  379
             +G    D     + ++RAK    +    DE  S       V +  G  E D I   LPGQ
Sbjct  24    YGGRGFDPLGEFVEVQRAKTSLNN---LDENLSIKRSTIYVENQEGYKEVDRILS-LPGQ  79

Query  380   PSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIEL  559
             P  V F QY+GYV VD + GR+LFYYFAES  +  TKPL+LWLNGGPGCSSLG GA  EL
Sbjct  80    PE-VSFDQYSGYVTVDASAGRALFYYFAESENSSSTKPLVLWLNGGPGCSSLGAGAMTEL  138

Query  560   GPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKF  739
             GPF VNPDGKTL+  + +WN +AN +FLESPAGVGFSYSNTSSDY ++GDR+TA DAY F
Sbjct  139   GPFRVNPDGKTLWHNKNSWNILANVIFLESPAGVGFSYSNTSSDY-ITGDRKTAADAYTF  197

Query  740   LVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIM  919
             LVNW KRFP YK RDFYI GESYAG Y+P+LAD+I+K N +   T+ I LKGI IGN  +
Sbjct  198   LVNWLKRFPDYKHRDFYIAGESYAGHYVPQLADLILKNNEIANKTV-INLKGIAIGNAYI  256

Query  920   NDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK------CEHFERAAGIEIGSID  1081
             + +   +G YDY W+HALISDE H GLIE+C  NFS        C  F + A    G++ 
Sbjct  257   DIEDQNKGVYDYYWTHALISDEIHKGLIENC--NFSSGGPQTELCRGFRKQAREAKGNVF  314

Query  1082  FYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCS  1261
              Y+IY PLC  S +S       GFDPC+  Y Y+YLN  +VQ+ALHAN   +P  W+ CS
Sbjct  315   DYDIYAPLC--STTSSNTPSISGFDPCSGYYAYAYLNTREVQEALHANVAGIPKPWDECS  372

Query  1262  EVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWH  1438
             + +   W+D   T+ P  +RL+ASG ++ ++SGD DSVVPVT+TRYS+  +   V  PW+
Sbjct  373   DYVGNNWQDSPLTVLPTIKRLMASGIRVWIYSGDTDSVVPVTTTRYSMPKLGAAVKTPWY  432

Query  1439  PWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             PW +   +VGGY V Y+ +TF T+RGAGH VP + P+RALT  + FL
Sbjct  433   PWYNQ-GEVGGYAVEYQNITFVTIRGAGHFVPSYQPQRALTFFSSFL  478



>ref|XP_009399958.1| PREDICTED: serine carboxypeptidase II-3-like [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   458 bits (1179),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 238/432 (55%), Positives = 292/432 (68%), Gaps = 15/432 (3%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES-AQTPHTKPL  496
             V D+ G  E D I   LPGQP  V F QYAGYV VD  +GR+LFYYFAE+  +   +KPL
Sbjct  70    VHDNDGLKEKDKIVK-LPGQPQGVDFDQYAGYVTVDARSGRALFYYFAEAVGRDNSSKPL  128

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LW NGGPGCSS G GA  ELGPF V  DG+TLY   +AWN VAN LFLESPAGVGFSYS
Sbjct  129   LLWFNGGPGCSSFGYGAMEELGPFRVMSDGRTLYRNPYAWNAVANVLFLESPAGVGFSYS  188

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NT+SDYD SGD+RTA+DAY FL+NW +RFP YK RDFY+ GESYAG Y+P+LA  I++  
Sbjct  189   NTTSDYDKSGDQRTAEDAYVFLLNWMERFPEYKGRDFYLAGESYAGHYVPQLALTILQHE  248

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI--  1030
                 +   I LKGI IGN  ++ ++D RG YD+ W+HALISD T D + +HC  NFS   
Sbjct  249   NRSASAAAINLKGIAIGNAAIDMESDNRGMYDFFWTHALISDATVDAIHKHC--NFSSED  306

Query  1031  -----KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYL  1189
                  +C    + A      +D YNIY P C  S  S   K+     FDPC+  Y+ +YL
Sbjct  307   DTQPPQCAQALQDAERVFEELDIYNIYAPRCSSSSLSPTPKKPEIDNFDPCSGVYIKAYL  366

Query  1190  NLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDS  1369
             N P VQKALHAN TKL Y W  CS+VI  WKD  ST+ PI R++ A+G ++L++SGD+D 
Sbjct  367   NDPDVQKALHANVTKLDYPWSGCSQVIPNWKDSPSTILPIIRQIQANGVQVLVYSGDIDG  426

Query  1370  VVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTP  1546
              VPVTST YS+  +KL V  PW  W  +  QVGGY VVY+G LTFATVRGAGHEVP + P
Sbjct  427   RVPVTSTTYSLSLLKLPVKAPWRSWTVN-DQVGGYAVVYDGNLTFATVRGAGHEVPSYQP  485

Query  1547  RRALTLLNMFLS  1582
              R+L ++  FL+
Sbjct  486   ARSLEMIKSFLN  497



>ref|XP_003592237.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 ref|XP_003601334.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 gb|AES71585.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   458 bits (1178),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 235/421 (56%), Positives = 288/421 (68%), Gaps = 13/421 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G M+ D I+  LPGQP  V F QY+GYV VD   GR LFYYF ES     TKPL+LWLNG
Sbjct  71    GLMQADKIDT-LPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPYNSSTKPLVLWLNG  129

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GAF ELGPF +N DGKTLY   +AWN+VAN LFLESPAGVGFSYSNT+SDY
Sbjct  130   GPGCSSLGYGAFQELGPFRINSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTTSDY  189

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D SGD+ TAKD Y FLVNW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N +   T
Sbjct  190   DKSGDKSTAKDTYVFLVNWLERFPQYKTRDFYITGESYAGHYVPQLASTILHNNKLYNNT  249

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKC-EH  1042
             + + LKGI IGN  ++D T ++G +DYLW+HAL SD+TH+ + ++C     N S  C  +
Sbjct  250   I-VNLKGISIGNAWIDDATSLKGFFDYLWTHALNSDQTHELIEKYCDFTTENVSAICINN  308

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG--FDPCAEDYVYSYLNLPKVQKAL  1216
                 A  E G ID YNIY PLC DS         +   FDPC++ Y  +YLN P+VQKAL
Sbjct  309   VTLKAFFEHGKIDLYNIYAPLCHDSSLKNGSTGYVSNDFDPCSDYYGSAYLNRPEVQKAL  368

Query  1217  HANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRY  1396
             HA     P  W  CS ++T WKD   T+ P  + LI SG K+ ++SGD D+VV VTS+RY
Sbjct  369   HAK----PTNWTHCSRLLTDWKDSPITILPTVKYLINSGIKLWIYSGDTDAVVSVTSSRY  424

Query  1397  SVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMF  1576
             S++ +KL +   W PW    K++GGY V Y+GLTF TVRGAGH VP + P RALT+++ F
Sbjct  425   SINTLKLPINAAWSPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTMISSF  483

Query  1577  L  1579
             L
Sbjct  484   L  484



>ref|XP_010041326.1| PREDICTED: serine carboxypeptidase II-3-like [Eucalyptus grandis]
 gb|KCW44445.1| hypothetical protein EUGRSUZ_L02059 [Eucalyptus grandis]
Length=482

 Score =   457 bits (1176),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 234/422 (55%), Positives = 284/422 (67%), Gaps = 19/422 (5%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G ME D I   LPGQP  V F QYAGYV V+   GR+LFYYF ES Q   TKPL+LWLNG
Sbjct  65    GLMEADKITA-LPGQPDGVDFDQYAGYVTVNPKAGRALFYYFVESPQNSSTKPLVLWLNG  123

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GA  ELGPF V+ DGKTLY   +AWN VAN +FLESPAGVGFSYSNTSSDY
Sbjct  124   GPGCSSLGYGAMEELGPFRVHSDGKTLYRNNYAWNNVANVIFLESPAGVGFSYSNTSSDY  183

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
               +GD  TA D+Y FLVNW  RFP YKTRDFYI GESYAG Y+P+LA  IV RN  P  T
Sbjct  184   AKAGDNSTADDSYTFLVNWLDRFPQYKTRDFYITGESYAGHYVPQLAYTIVSRNKNPNQT  243

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHF  1045
               I LKGI IGN  ++D+  ++G Y+Y W+HAL SDETH G++++C       SI C+ +
Sbjct  244   -HINLKGIAIGNAWIDDNMCLKGMYEYFWTHALNSDETHAGIMKNCDFVTGKSSIACDQY  302

Query  1046  ERAAGIEIGSIDFYNIYGPLCL----DSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKA  1213
                +  E G +D YNIY P C      S SS  V     FDPC+++YV SYLN P+VQ A
Sbjct  303   TSESAQEHGDLDIYNIYAPFCKPTGPKSSSSGSVND---FDPCSDNYVDSYLNRPEVQAA  359

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             LHA     P  W  C++    W D  +T+ P  ++LIASG  + ++SGD+D  VPVTS+R
Sbjct  360   LHAK----PTQWSACTDFP--WTDSPATILPTIQQLIASGIDVWVYSGDIDGRVPVTSSR  413

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNM  1573
             YS++A+KL V   W PW  +  +VGGY + Y+G+T  TVRGAGH VP + P RALTL+  
Sbjct  414   YSLNALKLPVKTAWRPWHSN-GEVGGYVIGYKGVTLTTVRGAGHTVPSYEPERALTLIAA  472

Query  1574  FL  1579
             FL
Sbjct  473   FL  474



>ref|XP_007219043.1| hypothetical protein PRUPE_ppa004618mg [Prunus persica]
 gb|EMJ20242.1| hypothetical protein PRUPE_ppa004618mg [Prunus persica]
Length=499

 Score =   458 bits (1178),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 231/422 (55%), Positives = 288/422 (68%), Gaps = 11/422 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I+  LPGQP +V F QY GYV VDK  GR+LFYYF E+ +   +  L+LWLNG
Sbjct  70    GLKEKDRIDS-LPGQP-HVNFSQYGGYVTVDKEAGRALFYYFVEAEKAKDSSRLLLWLNG  127

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GA +ELGPF ++ DGKTLY  RF+WN  AN LFLESPAGVGFSYSN +SDY
Sbjct  128   GPGCSSLGYGAMLELGPFRIHSDGKTLYRNRFSWNYAANVLFLESPAGVGFSYSNKTSDY  187

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D SGDR TA D Y FLVNW +RFP YK R+FYI GESYAG Y+P+LA  I+  N     T
Sbjct  188   DASGDRITAADNYVFLVNWLERFPEYKDREFYISGESYAGHYVPQLAHTILYHNKRANKT  247

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCE  1039
             + I LKGIMIGN ++ND+TD RG YDYL SHA+ISD+T + + ++C           +C 
Sbjct  248   I-INLKGIMIGNAVINDETDSRGMYDYLASHAVISDQTANKINKYCDFSPNATTQPKECT  306

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKA  1213
                 AA  +   ID YNIY   C+ S  + K K+     FDPC+E Y Y+YLN P VQ+A
Sbjct  307   DATDAAAKDTYYIDIYNIYASSCVSSNVTAKPKKASIFEFDPCSEYYAYAYLNRPDVQQA  366

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             LHAN TKL + WE CS+VIT W D AST+ P+ +  +A+  ++ +FSGD+D+ VPVTST+
Sbjct  367   LHANVTKLTHDWEPCSDVITNWSDGASTVLPLLKEFLANDVRVWIFSGDIDARVPVTSTK  426

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNM  1573
             YS++ + L +   WH W     +VGGY  VY  LTFATVRGAGH+VP + P R L+L+  
Sbjct  427   YSIEKLNLPIKTEWHAWFLG-GEVGGYTQVYGELTFATVRGAGHQVPSYQPARGLSLIKH  485

Query  1574  FL  1579
             FL
Sbjct  486   FL  487



>ref|XP_011008273.1| PREDICTED: serine carboxypeptidase-like 40 [Populus euphratica]
Length=496

 Score =   457 bits (1177),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 232/423 (55%), Positives = 291/423 (69%), Gaps = 12/423 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP  V+F QY GYV VDK+ GR+L+YYF E+  +  + PL+LWLNG
Sbjct  67    GLKEKDRIES-LPGQP-KVEFSQYGGYVTVDKSAGRALYYYFVEAQHSKESSPLLLWLNG  124

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA  ELGPF V  DGK LY  R++WN  AN LFLESPAGVGFSYSNT+SDY
Sbjct  125   GPGCSSLAYGAMQELGPFRVYSDGKKLYKNRYSWNYAANVLFLESPAGVGFSYSNTTSDY  184

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + SGD+RTA+D Y FLVNW +RF  YK R+FYI GESYAG Y+PELA  I+  N   + T
Sbjct  185   EKSGDKRTAEDNYVFLVNWLERFSEYKDREFYISGESYAGHYVPELAHTILYHNKKAKKT  244

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF-----SIKCE  1039
             + I LKGI+IGN ++N +TD  G YDYL SHA+ISDE    +  HC  +F     S +C 
Sbjct  245   I-INLKGILIGNAVINPETDRIGMYDYLGSHAIISDELVHKVRTHCNFSFNATPQSDECN  303

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR--RLGFDPCAEDYVYSYLNLPKVQKA  1213
                     +   ID YNIY P C    ++ K K+   + FDPC++ YVY+YLN P VQ+A
Sbjct  304   EAVDEVRRDTHHIDIYNIYAPSCFHKSTTAKPKKPSLMNFDPCSDYYVYAYLNRPDVQEA  363

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             +HAN TKL + WE CS+VIT W D  ST+ P+ + L+A+G ++ +FSGD D+ VPVTST+
Sbjct  364   MHANVTKLTHDWEPCSDVITSWSDSPSTIIPLLQELMANGLRVWIFSGDTDARVPVTSTQ  423

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLN  1570
             YS++ MKL+V   WHPW     +VGGY  VY G +TFATVRGAGH+VP + P RAL+L+ 
Sbjct  424   YSINKMKLQVKTEWHPWYLK-GEVGGYTQVYRGDMTFATVRGAGHQVPTYQPLRALSLIK  482

Query  1571  MFL  1579
              FL
Sbjct  483   HFL  485



>ref|XP_008783277.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=499

 Score =   457 bits (1177),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 231/416 (56%), Positives = 284/416 (68%), Gaps = 19/416 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT-PHTKPLILWLNGGPGCSSLGVG  544
             LPGQP  V F QY GYV VDK  GR+LFYY  E+A   P ++PL+LWLNGGPGCSS G+G
Sbjct  86    LPGQPEGVDFDQYGGYVTVDKEAGRALFYYLTEAATADPSSRPLVLWLNGGPGCSSFGIG  145

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             A  ELGPF V  DGKTL+   +AWN+VAN LFLESPAGVGFSYSNT+SDY  SGD +TAK
Sbjct  146   AMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYSNTTSDYGNSGDSKTAK  205

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMI  904
             DAY FLVNW +RFP YK RDFYI GESY G Y+P+LA  I++         KI LKGIMI
Sbjct  206   DAYVFLVNWMERFPEYKGRDFYIAGESYGGHYVPQLAHTILQHKKS-----KINLKGIMI  260

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI-------KCEHFERAAGI  1063
             GNG++N +TD +G +DY W+HALISDE  D +  +C  NFS        +C      A  
Sbjct  261   GNGVINTETDGKGMFDYFWTHALISDEAIDVIHNYC--NFSPNASSQPKQCLQAVDVAAE  318

Query  1064  EIGSIDFYNIYGPLCLDSESSRKVK--RRLGFDPCAEDYVYSYLNLPKVQKALHANNTKL  1237
              +G+I+ YNIY PLC     +R  K      FDPC  DYV +YLN  +VQ ALHAN T+L
Sbjct  319   SLGTINLYNIYAPLCTSPTITRSPKGYSIENFDPCTADYVSAYLNTAEVQMALHANVTRL  378

Query  1238  PYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKL  1417
              YTW  CS+V+T W D   T+ P+ +  +A   ++L++SGDVD  VPVTS+RYS++ +KL
Sbjct  379   NYTWSGCSQVLTQWTDSPFTVLPLIKESMAHDVQVLVYSGDVDGRVPVTSSRYSLNQLKL  438

Query  1418  KVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             +V   W PW     +VGGY VVY+G LTFATVRGAGH+VP +   RAL L+  FL+
Sbjct  439   RVKTQWQPWFIK-NEVGGYSVVYDGNLTFATVRGAGHQVPSYQALRALVLIKFFLN  493



>gb|KDP43605.1| hypothetical protein JCGZ_16892 [Jatropha curcas]
Length=498

 Score =   457 bits (1177),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 228/426 (54%), Positives = 293/426 (69%), Gaps = 12/426 (3%)
 Frame = +2

Query  326   DDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILW  505
             DD+GS E+D I   LPGQP NV+F QY GYV VDK+ GR+ +YYF E+  +  + PL+LW
Sbjct  66    DDIGSKENDRI-VRLPGQP-NVRFSQYGGYVTVDKSAGRAFYYYFVEAQHSKDSLPLLLW  123

Query  506   LNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTS  685
             LNGGPGCSSL  GA  ELGPF V+ DGKTLY  R++WN  AN LFLESPAGVGFSYSN +
Sbjct  124   LNGGPGCSSLAYGAMQELGPFRVHSDGKTLYKNRYSWNYAANVLFLESPAGVGFSYSNRT  183

Query  686   SDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMP  865
             SDYD +GD++TA+D Y FLVNW KRFP YK RDFYI GESYAG Y+P+LA  I+  N   
Sbjct  184   SDYDNNGDKKTAEDNYIFLVNWLKRFPEYKDRDFYISGESYAGHYVPQLAHTILYNNKKA  243

Query  866   ETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSI  1030
             + T+ I LKGI+IGN ++ND+TD  G YDY   HAL+S++  + + +HC         S 
Sbjct  244   KKTI-INLKGILIGNAVINDETDNIGMYDYFAGHALVSNDAVNNIKKHCDFSPNATTQSA  302

Query  1031  KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVK--RRLGFDPCAEDYVYSYLNLPKV  1204
              C         +I  +D YNIY PLC    ++ K K      FDPC++ YVY+YLN P+V
Sbjct  303   TCISANNQIERDISHLDIYNIYAPLCFSPTTTAKPKIASLENFDPCSDYYVYAYLNTPEV  362

Query  1205  QKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             Q+A+HAN TKL + WE CS+VI+ W D ++T+ P+ +  +A+G ++ ++SGD D  VP T
Sbjct  363   QEAMHANVTKLKHDWEPCSDVISQWLDSSATVLPLLQEFMANGLRVWIYSGDTDGRVPFT  422

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALT  1561
             ST YS+D + L +   WHPW     +VGGY  VY+G LTFATVRGAGHEVP F P RAL+
Sbjct  423   STIYSIDKLNLPIKTEWHPWY-LKGEVGGYTQVYKGDLTFATVRGAGHEVPSFQPLRALS  481

Query  1562  LLNMFL  1579
             L+  F+
Sbjct  482   LIKHFV  487



>ref|XP_002281988.1| PREDICTED: serine carboxypeptidase II-3-like [Vitis vinifera]
Length=488

 Score =   457 bits (1175),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 235/489 (48%), Positives = 316/489 (65%), Gaps = 17/489 (3%)
 Frame = +2

Query  137   MSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeee  316
             M   F ++ + +     L   HG ++ D   ++M  +R+K Q    G + E+ S      
Sbjct  1     MKAAFFLILISLTCLVALVQCHGGSRYDLLGKLMQAQRSKRQS--EGHSIESMSTEYSPV  58

Query  317   mVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
              +    G  + D I   LPGQP+ +   QY+GYV VD   GR+LFYYF ES Q   +KPL
Sbjct  59    YMGSQDGLKDGDRIQA-LPGQPNGLNLDQYSGYVTVDPQAGRALFYYFVES-QNSSSKPL  116

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSSLG GA +ELGPF VN DG TL    +AW+ VAN LFLESPAGVGFSYS
Sbjct  117   VLWLNGGPGCSSLGSGAMMELGPFRVNGDGNTLSYNEYAWSNVANILFLESPAGVGFSYS  176

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NT+SDYD SGD++TA+D Y FL+NW +RFP YKTRDF+I GESYAG Y+P+L+  I++ N
Sbjct  177   NTTSDYDKSGDKQTAEDNYTFLLNWLERFPEYKTRDFFITGESYAGHYVPQLSQKILQNN  236

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK-  1033
              +   T+ I LKGI IGN  ++ +T ++G YD+ W+H+LISDE ++G+  +C  NFS + 
Sbjct  237   KITNQTV-INLKGIAIGNAWIDYETGLKGMYDFFWTHSLISDEINEGINLNC--NFSSET  293

Query  1034  -----CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLP  1198
                  CE +  AA   +G I  Y+IY PLC  S SS   +    FDPC+EDY+ +YLN+P
Sbjct  294   TISDVCEQYLDAADAAVGYIYIYDIYAPLC--SSSSNSTRPISVFDPCSEDYIQTYLNIP  351

Query  1199  KVQKALHANNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVV  1375
             +VQK++HAN T +P  WE C++ I Y WKD   T+ P+   L+ SG  + ++SGD D  V
Sbjct  352   EVQKSMHANVTNIPGPWESCNDAIFYGWKDMPLTVLPVIEELMVSGISVWIYSGDTDGRV  411

Query  1376  PVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRA  1555
             P TSTRYS++ +   V  PW+PW     +VGGY V Y+ L+F T+RGAGH VP + P RA
Sbjct  412   PTTSTRYSINNLGTSVKTPWYPWYTQ-GEVGGYAVGYKNLSFVTIRGAGHFVPSYQPTRA  470

Query  1556  LTLLNMFLS  1582
             L   + FL+
Sbjct  471   LAFFSSFLA  479



>ref|XP_008783276.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=485

 Score =   457 bits (1175),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 233/428 (54%), Positives = 288/428 (67%), Gaps = 18/428 (4%)
 Frame = +2

Query  323   FDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLIL  502
             +   G  E+D I   LPGQP  V F +YAGYV VD+  GR+LFYYF  +     +KPL+L
Sbjct  62    YSQQGLKENDRIEY-LPGQPGGVDFDEYAGYVTVDQKAGRALFYYFVLAVGDSSSKPLLL  120

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSSLG GA  ELGPF V  DGKTL+   FAWN+VAN LFLESPAGVGFSYSNT
Sbjct  121   WLNGGPGCSSLGYGAMQELGPFRVMSDGKTLFRNPFAWNRVANVLFLESPAGVGFSYSNT  180

Query  683   SSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM  862
             +SDY   GDRRTA+D Y FLVNW +RFP YK RDFYI GESYAG ++P+LA +I++    
Sbjct  181   TSDYSKGGDRRTAEDNYVFLVNWMERFPEYKGRDFYIAGESYAGHFVPQLATIILQ----  236

Query  863   PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFS  1027
              +    I LKGIM+GN ++ND TD RG +DYLW+HALISDET D + ++C       N  
Sbjct  237   -QKNAVINLKGIMVGNAVINDATDSRGMFDYLWTHALISDETIDAIHKYCNFSPNTTNQE  295

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL---GFDPCAEDYVYSYLNLP  1198
              +C H    A     +++ YNIY PLC  S       +RL    FDPC+E+YVY YLN  
Sbjct  296   YRCGHAMSVAREVSRTLNIYNIYAPLC--SGGITNTPKRLSIRNFDPCSENYVYVYLNSA  353

Query  1199  KVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVP  1378
             +VQ+ LHAN TKL YTW  CS+VI  W D  ST+ P+ + LI    ++ ++SGD+D  VP
Sbjct  354   EVQQKLHANVTKLNYTWSGCSQVIQQWSDSPSTILPLIKELIDRNIRVWIYSGDIDGRVP  413

Query  1379  VTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRA  1555
             VTSTRYS++ + L V   W+PW   +K  GGY V Y G LTFATVRGAGHEVP +  ++A
Sbjct  414   VTSTRYSINQLMLLVKTQWYPWYIGSK-AGGYSVSYHGNLTFATVRGAGHEVPSYQAQQA  472

Query  1556  LTLLNMFL  1579
             L L+  FL
Sbjct  473   LQLVTFFL  480



>ref|XP_004984185.1| PREDICTED: serine carboxypeptidase II-3-like isoform X3 [Setaria 
italica]
Length=499

 Score =   457 bits (1175),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 247/504 (49%), Positives = 318/504 (63%), Gaps = 26/504 (5%)
 Frame = +2

Query  92    CSPSALFMGKKQDSLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLH  271
             CSP A    K +    + +F   F LI++   L         D+A R+    R++M+  H
Sbjct  7     CSPLA---SKIRRDAFAIQF---FCLILIQASLA--------DEAGRLHEFSRSRMEMQH  52

Query  272   GGITDE---AWSemeeeemVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGR  442
               I ++   +WS      +   D G  + D I+  LPGQP    F QYAGYV VD T+G+
Sbjct  53    DRIDNKMLTSWSMDHPIYVGPQD-GLKKVDKISE-LPGQPGKAVFDQYAGYVTVDATSGK  110

Query  443   SLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNK  622
             +LFYYFAE+A+ P TKPL+LWLNGGPGCSSLG GA +E+GPF VN D KTL   ++AWN 
Sbjct  111   ALFYYFAEAAEEPSTKPLVLWLNGGPGCSSLG-GAMLEIGPFFVNRDNKTLSRNKYAWNN  169

Query  623   VANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGE  802
             VAN LFLESPAGVGFSYSN +SDY+ +GDR T  DAY FL+NW +RFP YK   F+I GE
Sbjct  170   VANMLFLESPAGVGFSYSNRTSDYNNTGDRSTTADAYTFLINWLERFPEYKGHSFFITGE  229

Query  803   SYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISD  982
             SY G YIP+LA+ I+  N +   T+ I LKGI IGN  +NDDT+ R   DY W+HA+IS 
Sbjct  230   SYGGHYIPQLANTILSNNKIMNITM-INLKGIAIGNAYLNDDTNTRATIDYYWTHAMISK  288

Query  983   ETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL-GF  1153
             ETH  + E+C  N  ++  C     AA  E G ID  NIY   C D+ + R+    +   
Sbjct  289   ETHKAVQENCSFNGTYTGLCRTAIEAANNEKGLIDQSNIYASFCWDASAPRQHHASVTNT  348

Query  1154  DPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVIT--YWKDRASTMFPIYRRLIA  1327
             DPCA  Y+ SYLN  +VQ+A HAN T L   W  CS +I+   WKD   +M P  ++LI+
Sbjct  349   DPCASYYMRSYLNRQEVQRAFHANTTGLKQPWLDCSHIISPENWKDAQVSMLPSIQQLIS  408

Query  1328  SGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFAT  1507
             SG +  L+SGD+D+V PVTST YS+D + L++  PW  W  D  +VGGY V Y+GL FAT
Sbjct  409   SGIRTWLYSGDIDAVCPVTSTLYSLDILGLQINSPWRAWYSDDGEVGGYVVEYKGLVFAT  468

Query  1508  VRGAGHEVPQFTPRRALTLLNMFL  1579
             VRGAGH VP + P+RALTL + FL
Sbjct  469   VRGAGHMVPTYQPQRALTLFSSFL  492



>ref|XP_003601337.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score =   457 bits (1175),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 230/413 (56%), Positives = 284/413 (69%), Gaps = 15/413 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV V+   GR LFYYF ES     TKPL+LWLNGGPGCSSLG GA
Sbjct  79    LPGQPYGVNFDQYSGYVTVNPEAGRELFYYFVESPYNSSTKPLVLWLNGGPGCSSLGYGA  138

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF +N DGKTLY  ++AW +VAN LFLESPAGVGFSYSNT+SDYD SGD+ TAKD
Sbjct  139   FQELGPFRINSDGKTLYRNQYAWTEVANVLFLESPAGVGFSYSNTTSDYDKSGDKSTAKD  198

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL+NW +RFP YKTR FYI GESYAG Y+P+LA  I+  N +   T+ I LKGI IG
Sbjct  199   SYVFLINWLERFPQYKTRAFYIAGESYAGHYVPQLASTILHNNKLYNNTV-INLKGISIG  257

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC--VVNF-----SIKCEHFERAAGIE  1066
             N  ++D T ++G +DY W+HAL SD+TH+ + ++C   V+F     S  C +    A  E
Sbjct  258   NAWIDDATSLKGLFDYFWTHALNSDQTHELIEKYCDFTVDFTSGNTSAICNNVTDRAYTE  317

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRLG--FDPCAEDYVYSYLNLPKVQKALHANNTKLP  1240
              G IDFYNIY PLC DS         +   FDPC++ Y  +YLN P+VQ+ALHA     P
Sbjct  318   KGKIDFYNIYAPLCHDSSLKNGSTGYVSNDFDPCSDYYGIAYLNRPEVQQALHAK----P  373

Query  1241  YTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLK  1420
               W  CSE+ + WKD   T+ P  + LI SG K+ ++SGD D  VPVTS+RYS++ +KL 
Sbjct  374   TNWSYCSEINSKWKDSPITVLPTIKYLIDSGIKLWIYSGDTDGRVPVTSSRYSINTLKLP  433

Query  1421  VIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +   WHPW    K++GGY V Y+GLTF TVRGAGH VP + P RALTL++ FL
Sbjct  434   INDAWHPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTLISSFL  485



>gb|KHG12237.1| Serine carboxypeptidase-like 40 [Gossypium arboreum]
Length=502

 Score =   457 bits (1175),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/416 (55%), Positives = 293/416 (70%), Gaps = 14/416 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP +V+F QY GYV VDK  GR+L+YYF E+  +  + PL+LWLNGGPGCSSL  GA
Sbjct  79    LPGQP-HVRFSQYGGYVTVDKKAGRALYYYFVEAHHSKESLPLLLWLNGGPGCSSLAYGA  137

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               E+GPF V+ +GKT+Y  R++WN  AN LFLESPAGVGFSYSNT+SDYD SGD +TA D
Sbjct  138   MEEIGPFRVHSNGKTVYRNRYSWNHAANVLFLESPAGVGFSYSNTTSDYDKSGDSKTAVD  197

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
              Y FL+NW +RFP YK RDFYI GESYAG Y+P+LA  I+  N    TTL I LKGI+IG
Sbjct  198   NYVFLINWLERFPEYKERDFYISGESYAGHYVPQLAHTILLHNKKANTTL-INLKGIIIG  256

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEIG-  1072
             N ++ND+TDV+G YD+  SHALISDET   + ++C +    N   +     +AA  E+  
Sbjct  257   NAVINDETDVKGMYDFFKSHALISDETAYRISKYCNLESENNMDAESSTECKAATDEVNR  316

Query  1073  ---SIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKALHANNTKL  1237
                +ID YNIY PLC DS    + K    + FDPC+++YVY+YLN   VQ+A+HAN TKL
Sbjct  317   DTYNIDIYNIYAPLCHDSSLRVQPKEPSVVNFDPCSDNYVYAYLNRADVQEAIHANVTKL  376

Query  1238  PYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKL  1417
              + WE CS +IT W D  ST+ P+ R L+A+  ++ +FSGD+D  +PVTST+YS+  M L
Sbjct  377   DHGWEPCSNIITTWGDSPSTVIPLLRELMANRLRVWIFSGDIDGRIPVTSTKYSIQKMNL  436

Query  1418  KVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
              +   WHPW  D  +VGGY  VY+G LT ATVRGAGH+VP + P+RAL+L+  FL+
Sbjct  437   PIKTKWHPWYLDG-EVGGYTQVYKGDLTLATVRGAGHQVPSYQPKRALSLIKHFLA  491



>ref|XP_002517750.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF44557.1| serine carboxypeptidase, putative [Ricinus communis]
Length=513

 Score =   457 bits (1175),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 232/426 (54%), Positives = 292/426 (69%), Gaps = 13/426 (3%)
 Frame = +2

Query  329   DVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQ-TPHTKPLILW  505
             D GS E D I   LPGQP +V+F QY GYV  DK+ GR+L+YYF E+      + PL+LW
Sbjct  81    DAGSKEKDRIER-LPGQP-DVEFTQYGGYVTTDKSAGRALYYYFVEAQHYAKESFPLLLW  138

Query  506   LNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTS  685
             LNGGPGCSSLG GA  ELGPF V+ DGKTLY  R++WN  AN LFLESPAGVGFSYSNTS
Sbjct  139   LNGGPGCSSLGYGAMQELGPFRVHSDGKTLYKNRYSWNYAANVLFLESPAGVGFSYSNTS  198

Query  686   SDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMP  865
             SDY+  GD+ TA+D Y FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I+  N   
Sbjct  199   SDYEKCGDKATAEDNYLFLVNWLERFPEYKDRDFYISGESYAGHYVPQLAHTILYHNKKA  258

Query  866   ETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSI  1030
             + T+ I LKGI+IGN ++ND+TD  G YDY  +HALIS E    + +HC         S 
Sbjct  259   KKTI-IDLKGILIGNAVINDETDNIGMYDYFATHALISQEAISSIKKHCDFSPNATTQSD  317

Query  1031  KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKV  1204
             +C      A  +   +D YNIY PLC    ++ K K+     FDPC++ YVY+YLNLP+V
Sbjct  318   ECNSATYQASKDTAFLDIYNIYAPLCTSQNTTAKPKKASLAEFDPCSDYYVYAYLNLPEV  377

Query  1205  QKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             Q+A+HAN TKL + WE CS+VI  W D  +T+ P+ +  +A+G ++ +FSGD D  VPVT
Sbjct  378   QEAMHANITKLEHDWEPCSDVIKNWLDSPATIIPLLQEFMANGLRVWIFSGDTDGRVPVT  437

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALT  1561
             ST+YS++ MKL +   WHPW     +VGGY  VY+G LTFATVRGAGH+VP + P RAL+
Sbjct  438   STQYSINEMKLPIKTEWHPWYLK-GEVGGYTQVYKGDLTFATVRGAGHQVPSYKPLRALS  496

Query  1562  LLNMFL  1579
             L+  FL
Sbjct  497   LIKHFL  502



>ref|XP_009368057.1| PREDICTED: serine carboxypeptidase-like 40 [Pyrus x bretschneideri]
Length=502

 Score =   456 bits (1173),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 284/413 (69%), Gaps = 13/413 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP NVKF QY GYV VDK  GR++FYY  E+ Q   + PL+LWLNGGPGCSSL  GA
Sbjct  82    LPGQP-NVKFSQYGGYVTVDKKAGRAMFYYLVEAEQAKDSSPLLLWLNGGPGCSSLAYGA  140

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF ++ DGKTLY  RF+WN  AN LFLESPAGVGFSYSN +SDYD SGDR TA D
Sbjct  141   MLELGPFRIHSDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNRTSDYDASGDRNTAAD  200

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
              Y FLVNW +RFP YK R+FYI GESYAG Y+P+LA  I+  N     T+ I LKGI+IG
Sbjct  201   NYVFLVNWLERFPEYKGREFYISGESYAGHYVPQLAHTILYHNKRANKTI-INLKGIIIG  259

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK------CEHFERAAGIEI  1069
             N ++ND+TD +G YDYL SHA+ISD+T + +  +C    ++K      C      A  + 
Sbjct  260   NAVINDETDTKGMYDYLASHAIISDKTANVINNYCNFAPNVKTDQRKECSDATDDAAKDT  319

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKALHANNTKLPY  1243
               +D YNIY P CL +  + K KR     FDPC+EDYVY+YLN P VQ+ALHAN TKL +
Sbjct  320   YYVDIYNIYAPSCLSTNLTAKPKRTSIFKFDPCSEDYVYAYLNRPDVQQALHANVTKLSH  379

Query  1244  TWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKV  1423
              WE CS+VIT W D AST+ P+    + +G ++ +FSGD+D  VPVTST+YS+D M L V
Sbjct  380   DWEPCSDVIT-WGDSASTVLPLLHEFLENGLRLWIFSGDIDGRVPVTSTKYSLDKMNLPV  438

Query  1424  IKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
                WH W   + +V GY   ++ GLTFATVR AGH+VP + P R L+L+  FL
Sbjct  439   KTEWHAWF-LSGEVAGYTQEFKGGLTFATVRQAGHQVPSYQPARGLSLIKHFL  490



>ref|XP_010103278.1| Serine carboxypeptidase-like 40 [Morus notabilis]
 gb|EXB95303.1| Serine carboxypeptidase-like 40 [Morus notabilis]
Length=505

 Score =   455 bits (1171),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 246/476 (52%), Positives = 306/476 (64%), Gaps = 22/476 (5%)
 Frame = +2

Query  200   HGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDV--------GSMEDDL  355
             HG  K  QA+ ++ L + K++Q++G  T         +  V D+V        G  E D 
Sbjct  26    HGSQK--QAKSLVHLSKPKLKQIYGVDTSLFAVNTHGDHDVDDNVEEKNGIHEGLKERDR  83

Query  356   INGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSL  535
               G LPGQP  V F QY GYV VDKT GRSL+YYFAE+     + PL+LWLNGGPGCSSL
Sbjct  84    T-GRLPGQP-RVNFTQYGGYVTVDKTAGRSLYYYFAEAHYHQDSLPLLLWLNGGPGCSSL  141

Query  536   GVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRR  715
               GA  ELGPF V  DGKTLY+ +++WN  AN LFLESPAGVGFSYSN SSDY  SGD++
Sbjct  142   AYGAMQELGPFRVYSDGKTLYTNKYSWNYAANVLFLESPAGVGFSYSNRSSDYADSGDKK  201

Query  716   TAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKG  895
             TA+D Y+FLVNW KRFP YK RDFYI GESYAG Y+P+LA  I+  N     T+ I LKG
Sbjct  202   TAEDNYRFLVNWLKRFPEYKGRDFYISGESYAGHYVPQLAHTILHHNKRANKTI-INLKG  260

Query  896   IMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCEHFERAAG  1060
             I+IGN ++ND+TD +G YDYL +HALISD   + +  HC         S  C      A 
Sbjct  261   ILIGNAVINDETDEKGMYDYLANHALISDHAANIIQSHCDFSPNATKQSPACSDAVDEAN  320

Query  1061  IEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKALHANNTK  1234
              ++  ID YNIY P C  S  + K K+     FDPC++ YV +YLN   VQ ALHAN TK
Sbjct  321   KDLYYIDIYNIYAPSCASSNLTAKPKKASLRNFDPCSDYYVLAYLNREDVQAALHANVTK  380

Query  1235  LPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMK  1414
             LPY WE CS+V+  W D  ST+ P+ R  +A G ++ +FSGD+D  VPVTST+YS+  M 
Sbjct  381   LPYDWEPCSDVLKKWNDSPSTIIPLLREFMAKGLRVWIFSGDIDGRVPVTSTKYSIAKMN  440

Query  1415  LKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             L V   WHPW     +VGG+  VY+G LTFAT+R AGH+VP + P RAL+L+  FL
Sbjct  441   LPVKTEWHPWF-FGGEVGGFTEVYKGDLTFATIREAGHQVPSYQPARALSLVKHFL  495



>ref|XP_011025504.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Populus 
euphratica]
Length=498

 Score =   455 bits (1170),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 229/423 (54%), Positives = 291/423 (69%), Gaps = 12/423 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP  V+F QY GYV VD++ GR+L+YYFAE+  +  + PL+LWLNG
Sbjct  69    GLKEKDRIES-LPGQP-KVEFSQYGGYVTVDESAGRALYYYFAEAQHSKESLPLLLWLNG  126

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA  ELGPF V  DG+ LY  R +WN  AN LFLESPAGVGFSYSNT+SDY
Sbjct  127   GPGCSSLSYGAMQELGPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDY  186

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
               SGD+ TA+D Y FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I+  N   + T
Sbjct  187   KKSGDKMTAEDNYVFLVNWLERFPEYKDRDFYISGESYAGHYVPQLAHTILYHNNKAKKT  246

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCE  1039
             + + LKGI+IGN ++ND+TD  G Y Y  +HALISDE    +++ C       + S +C 
Sbjct  247   I-VNLKGILIGNAVINDETDSIGMYSYFGNHALISDEMVQKILKSCDFSPNATSQSDECN  305

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKA  1213
                 AAG +   I+ YNIYGPLCL   ++   K+   + FDPC++ YVY+YLN P VQ+A
Sbjct  306   QAAEAAGKDTSYINIYNIYGPLCLREGTTANPKKPSLVDFDPCSDYYVYAYLNRPDVQEA  365

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             +HAN TKL + WE CS++I  W D  ST+ P+ +  +A+G ++ LFSGD D  VP TST+
Sbjct  366   IHANVTKLTHDWEPCSDIIPSWSDSPSTIIPLLQEFMANGLRVWLFSGDTDGRVPFTSTQ  425

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLN  1570
             YS++ MKL+V   WHPW     +VGGY  VY+G LTFATVRGAGH+VP + P RAL+L+ 
Sbjct  426   YSINKMKLQVKTEWHPWY-VKGEVGGYTQVYKGDLTFATVRGAGHQVPSYQPLRALSLVK  484

Query  1571  MFL  1579
              FL
Sbjct  485   HFL  487



>ref|XP_008231545.1| PREDICTED: serine carboxypeptidase-like 40 [Prunus mume]
Length=500

 Score =   455 bits (1170),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 238/462 (52%), Positives = 307/462 (66%), Gaps = 13/462 (3%)
 Frame = +2

Query  221   QARRIMWLRRAKMQQLHGGITDEAWSemeee-emVFDDVGSMEDDLINGGLPGQPSNVKF  397
             Q++ +  L ++K+++  G  T +  + +      +    G  E D I+  LPGQP +V F
Sbjct  31    QSQALAQLYKSKLKEGAGIDTSQFEAILHANGAKIHPQEGLKEKDRIDS-LPGQP-HVNF  88

Query  398   KQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVN  577
              QY GYV VDK  GR+LFYYFAE+ +   + PL+LWLNGGPGCSSL  GA +ELGPF ++
Sbjct  89    SQYGGYVTVDKEAGRALFYYFAEAEKAKDSSPLLLWLNGGPGCSSLAYGAMLELGPFRIH  148

Query  578   PDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFK  757
              DGKTLY  +F+WN  AN LFLESPAGVGFSYSN +SDYD +GDRRTA D Y FLVNW +
Sbjct  149   SDGKTLYQNKFSWNYAANVLFLESPAGVGFSYSNKTSDYDANGDRRTAADNYVFLVNWLE  208

Query  758   RFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDV  937
             RFP +K R+FYI GESYAG Y+P+LA  I+  N     T+ I LKGIMIGN ++N +TD 
Sbjct  209   RFPEHKDREFYISGESYAGHYVPQLAHAILYHNKRANKTI-INLKGIMIGNAVINYETDS  267

Query  938   RGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCEHFERAAGIEIGSIDFYNIYGP  1102
             RG YDYL SHALISD+T + + ++C           +C     AA  +   ID YNIY  
Sbjct  268   RGMYDYLASHALISDQTANKINKYCDFSPNATKQPKECIDAADAAAKDTYYIDIYNIYAS  327

Query  1103  LCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITY  1276
              C+ S  + K K+     FDPC+E Y Y+Y N P VQ+ALHAN TKL + WE CS+VIT 
Sbjct  328   SCVSSNLTAKPKKASIFEFDPCSEYYAYAYFNRPYVQQALHANVTKLTHDWEPCSDVITN  387

Query  1277  WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDT  1456
             W D AST+ P+ +  +A+  ++ +FSGD+D VVPVTST+YS++ + L V   WH W    
Sbjct  388   WADSASTVVPLLKEFLANDVRVWIFSGDIDGVVPVTSTKYSIEKLNLPVKTEWHAWFIG-  446

Query  1457  KQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              +VGGY  VYEG LTFATVRGAGH+VP + P R L+L+  FL
Sbjct  447   GEVGGYTQVYEGELTFATVRGAGHQVPSYQPARGLSLIKHFL  488



>ref|XP_002314061.1| hypothetical protein POPTR_0009s06080g [Populus trichocarpa]
 gb|EEE88016.1| hypothetical protein POPTR_0009s06080g [Populus trichocarpa]
Length=499

 Score =   454 bits (1169),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 231/424 (54%), Positives = 292/424 (69%), Gaps = 13/424 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT-PHTKPLILWLN  511
             G  E D I   LPGQP  V+F QY GYV VDK+ GR+L+YYFAE+  +   + PL+LWLN
Sbjct  69    GLKEKDRIES-LPGQP-KVEFSQYGGYVTVDKSTGRALYYYFAEAQHSNKESLPLLLWLN  126

Query  512   GGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSD  691
             GGPGCSSL  GA  ELGPF V  DG+ LY  R +WN  AN LFLESPAGVGFSYSNT+SD
Sbjct  127   GGPGCSSLSYGAMQELGPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSD  186

Query  692   YDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPET  871
             Y  SGD+ TA+D Y FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I+  N   + 
Sbjct  187   YKKSGDKMTAEDNYVFLVNWLERFPEYKDRDFYISGESYAGHYVPQLAHTILYHNNKAKK  246

Query  872   TLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKC  1036
             T+ + LKGI+IGN ++ND+TD  G Y Y  +HALISDE    +++ C       + S +C
Sbjct  247   TI-VNLKGILIGNAVINDETDSIGMYSYFGNHALISDEMVQKILKSCDFSPNATSQSDEC  305

Query  1037  EHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQK  1210
                  AAG +   I+ YNIYGPLCL   ++ K K+   + FDPC++ YVY+YLN P VQ+
Sbjct  306   NQAAEAAGKDTSYINIYNIYGPLCLREGTTAKPKKPSLVDFDPCSDYYVYAYLNRPDVQE  365

Query  1211  ALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTST  1390
             A+HAN TKL + WE CS++I  W D  ST+ P+ +  +A+G ++ LFSGD D  VP TST
Sbjct  366   AMHANVTKLTHDWEPCSDIIPSWSDSPSTIIPLLQEFMANGLRVWLFSGDTDGRVPFTST  425

Query  1391  RYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLL  1567
             +YS++ MKL+V   WHPW     +VGGY  VY+G LTFATVRGAGH+VP + P RAL+L+
Sbjct  426   QYSINKMKLQVKTEWHPWY-VKGEVGGYTQVYKGDLTFATVRGAGHQVPSYQPLRALSLV  484

Query  1568  NMFL  1579
               FL
Sbjct  485   KHFL  488



>gb|ABF96315.1| Serine carboxypeptidase II-3 precursor, putative, expressed [Oryza 
sativa Japonica Group]
Length=503

 Score =   454 bits (1169),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 232/476 (49%), Positives = 298/476 (63%), Gaps = 23/476 (5%)
 Frame = +2

Query  218   DQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPSNVKF  397
             DQA R++   R++M+      T E  S+    ++       +++      LPGQP    F
Sbjct  22    DQAARVLEFSRSRMEMRDDQYTTEHTSQRANHQLYMSSQDGLKEADKVSELPGQPGRAGF  81

Query  398   KQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGG-----------------PGC  526
              QYAGYV V+ T+G++LFYYFAE+   P TKPL+LWLNGG                 PGC
Sbjct  82    DQYAGYVTVNATSGKALFYYFAEATDDPSTKPLVLWLNGGLTCEFYRMTKLYLEISGPGC  141

Query  527   SSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSG  706
             SSLG GA +E+GPF VN D +TL   R+AWN VAN LFLESPAGVGFSYSNT+SDYD +G
Sbjct  142   SSLGDGAMLEIGPFLVNGDNRTLSINRYAWNNVANMLFLESPAGVGFSYSNTTSDYDNTG  201

Query  707   DRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIP  886
             D  TA DAY FL NW +RFP YK RDF+I GESY G YIP+LA+ I+  N +   T+ I 
Sbjct  202   DTSTAADAYTFLTNWLERFPEYKGRDFFITGESYGGHYIPQLANAILSNNNITNVTI-IN  260

Query  887   LKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAG  1060
             LKG+ IGN  ++D T+ R   DY W+HALIS ETH  +  +C  N  +  +C +    A 
Sbjct  261   LKGVAIGNAYLDDSTNTRATIDYYWTHALISKETHLAVQRNCSFNGTYMAQCRNALAEAD  320

Query  1061  IEIGSIDFYNIYGPLCLDSESSRKVK-RRLGFDPCAEDYVYSYLNLPKVQKALHANNTKL  1237
              E G ID YNIY PLC ++ + R++    +  DPC+  YV SYLN P+VQ+ LHAN T L
Sbjct  321   TEKGVIDPYNIYAPLCWNASNPRQLHGSAINVDPCSRYYVESYLNRPEVQRTLHANTTGL  380

Query  1238  PYTWEVCSEVIT--YWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAM  1411
                W  CS +IT   WKD   +M P  + LI+SG    L+SGD+D+V PVTST YS+D +
Sbjct  381   KQPWSGCSNIITPENWKDAPVSMLPSIQGLISSGVSTWLYSGDIDAVCPVTSTLYSLDIL  440

Query  1412  KLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +L +   W PW  D  +V GY V Y+GL FATVR +GH VP + P+RALTL + FL
Sbjct  441   ELPINSSWRPWYSDDNEVAGYVVGYKGLVFATVRESGHMVPTYQPQRALTLFSSFL  496



>ref|NP_001148004.1| serine carboxypeptidase precursor [Zea mays]
 gb|ACG29366.1| serine carboxypeptidase [Zea mays]
Length=498

 Score =   454 bits (1168),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 238/481 (49%), Positives = 308/481 (64%), Gaps = 18/481 (4%)
 Frame = +2

Query  158   LFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVG  337
             L  L++  T L         D+A R+    R++M+  H  +  E WS  +   +   D G
Sbjct  24    LLCLVLTQTSLA--------DEAGRLQEFSRSRMEMRHYSLDSEMWSMDQPVYVGLQD-G  74

Query  338   SMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESA-QTPHTKPLILWLNG  514
               + D I+  LPGQP    F QYAGYV VD T+G++LFYYF E+A + P TKPL+LWLNG
Sbjct  75    LKKADKISE-LPGQPGKATFDQYAGYVTVDATSGKALFYYFVEAAAEDPSTKPLVLWLNG  133

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GA  E+GPF VN D KTL   ++AWN VAN LFLESPAGVGFSYSN +SDY
Sbjct  134   GPGCSSLG-GAMHEIGPFFVNRDNKTLSKNKYAWNSVANMLFLESPAGVGFSYSNRTSDY  192

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + +GDR TA DAY FLVNW +RFP YK   F++ GESY G YIP+LA+ I+  N +  TT
Sbjct  193   NNTGDRSTAADAYTFLVNWLERFPEYKGHSFFLTGESYGGHYIPQLANTILSNNKIINTT  252

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFE  1048
             + I L+G+ IGN  ++DDT+ R   DY W+HA+IS ETH  + E+C  N  ++  C    
Sbjct  253   M-INLQGVAIGNAYLDDDTNTRAIIDYYWTHAMISKETHTAVQENCGFNGTYTGLCRTAI  311

Query  1049  RAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYLNLPKVQKALHAN  1225
               A  E G ID  NIY P C ++   +K    +   DPCA  Y+ SYLN  +VQ+ALHAN
Sbjct  312   EEANNEKGLIDESNIYAPFCWNASDPQKQHASVTNNDPCASYYMRSYLNRQEVQRALHAN  371

Query  1226  NTKLPYTWEVCSEVIT--YWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
              T+L   W  CS +I+   WKD   +M P  ++LI+SG    L+SGD+D+V PVTST YS
Sbjct  372   TTRLKQPWSDCSNIISPENWKDAQVSMLPSIQQLISSGVSTWLYSGDIDAVCPVTSTLYS  431

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +D + LK+   W  W  D  +VGGY V Y+GL FATVRGAGH VP + P+RAL+L + FL
Sbjct  432   LDILGLKINSSWRAWYSDDGEVGGYVVEYKGLIFATVRGAGHMVPTYQPQRALSLFSAFL  491

Query  1580  S  1582
             +
Sbjct  492   N  492



>ref|XP_009794620.1| PREDICTED: putative serine carboxypeptidase-like 23 [Nicotiana 
sylvestris]
Length=512

 Score =   454 bits (1169),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 242/495 (49%), Positives = 321/495 (65%), Gaps = 23/495 (5%)
 Frame = +2

Query  122   KQDSLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSe  301
             K  S++S    +L  L     + G    ++K  +ARR   L   ++   +    DE   +
Sbjct  25    KVHSVLSLSLIILCYLSAQQCNAGEADVLSKFLKARRANHLHTTRIT--NSLAADE--KQ  80

Query  302   meeeemVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTP  481
                   +   VGS E+D I+  LPGQPS V F QY+GYV VD   GR+LFYYF ES Q P
Sbjct  81    RSVSGFLVPQVGSKEEDKISA-LPGQPSGVNFDQYSGYVTVDADAGRALFYYFTESTQDP  139

Query  482   HTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGV  661
              TKPL+LWLNGGPGCSSLG GA +ELGPF VN DGKTL+   FAWN VAN LFLESPAGV
Sbjct  140   STKPLVLWLNGGPGCSSLGAGAMMELGPFRVNKDGKTLWLNPFAWNNVANILFLESPAGV  199

Query  662   GFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADV  841
             GFSYSNTSSDY ++GD +T +D++ FLVNW +RFP YK RDFYI GESYAG Y+P+LA +
Sbjct  200   GFSYSNTSSDY-ITGDEKTRQDSFTFLVNWMERFPEYKHRDFYITGESYAGHYVPQLAQL  258

Query  842   IVKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN  1021
             ++  +   E  L I L+G+  GNG+++D+T   G YD+ W+HALISDE H+G++ +C  N
Sbjct  259   VLS-HMKTEPNLVINLQGVATGNGVIDDETATSGSYDFYWTHALISDEIHEGIVSNC--N  315

Query  1022  FSIK------CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVY  1180
             FS +      C  +   A    G+I  YNIY  LC    SS      + GFDPC+ DYV 
Sbjct  316   FSAETSTTEACNKYTGQADSSQGNIYTYNIYSQLC---NSSAYFSLPIDGFDPCSADYVD  372

Query  1181  SYLNLPKVQKALHANNTKLPYTWEVCSEVIT-YWKDRASTMFPIYRRLIASGQKILLFSG  1357
             +YLN   VQKAL  N   +P++W+ C+  I   W+D   TM PI++ L+ +G ++L++SG
Sbjct  373   NYLNTVGVQKAL--NVKDIPHSWDSCNGYIQGSWQDSPHTMLPIFQELMQNGIRVLIYSG  430

Query  1358  DVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQ  1537
             DVD ++PVT++RY++D +K  V  PW+PW     +VGGY V Y+ LTF TVRGAGH VP 
Sbjct  431   DVDHILPVTTSRYAIDKIKTPVKTPWYPWFFQ-GEVGGYAVEYQNLTFVTVRGAGHFVPS  489

Query  1538  FTPRRALTLLNMFLS  1582
             + P RALT+ + F++
Sbjct  490   YQPGRALTMFSSFIN  504



>ref|XP_010694765.1| PREDICTED: serine carboxypeptidase-like 40 [Beta vulgaris subsp. 
vulgaris]
Length=523

 Score =   455 bits (1170),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 224/412 (54%), Positives = 287/412 (70%), Gaps = 10/412 (2%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY GYV VD   G++ +YYF E+ +  ++ PL+LWLNGGPGCSSL  GA
Sbjct  101   LPGQPP-VNFTQYGGYVTVDSKAGKAFYYYFVEAPKNKNSLPLLLWLNGGPGCSSLAYGA  159

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF V  DGKTL+  +FAWN  AN LFLESPAGVGFSYSN++SDYD +GD +TA +
Sbjct  160   MEELGPFRVKSDGKTLFRNKFAWNHAANVLFLESPAGVGFSYSNSTSDYDSNGDSKTAAE  219

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
              Y FL+NWF+RFP YK RDFYI GESYAG Y+P+LA  I++ NT       I LKGI+IG
Sbjct  220   NYIFLLNWFERFPEYKGRDFYISGESYAGHYVPQLAHAILQHNTN-TNNSIINLKGIIIG  278

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCEHFERAAGIEIG  1072
             N ++ND+TD++G Y+Y W+HALISDE  D L +HC      +N S++C        ++  
Sbjct  279   NAVINDETDLKGMYEYFWTHALISDEVKDDLTKHCDFTPNAINQSVECSLAADQVEVDTQ  338

Query  1073  SIDFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTW  1249
              +D YNIY P+C  S  + K K+     DPC++ YV++YLN P+VQKALHAN TKL + W
Sbjct  339   YLDIYNIYAPVCHSSNLTVKPKKLTPDLDPCSDHYVHAYLNSPEVQKALHANVTKLSHDW  398

Query  1250  EVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIK  1429
             E CS +I+ W D  ST+ P+ + L+  G ++ +FSGD D  +PVTSTR S++ M L +  
Sbjct  399   EPCSSIISKWSDSPSTVIPLLKELMTKGLRVWIFSGDTDGRIPVTSTRQSLNKMGLSIKT  458

Query  1430  PWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
              WHPW     +VGGY  VYEG LTFATVRGAGH+VP F P RALTL++ FL+
Sbjct  459   KWHPWF-IKGEVGGYTQVYEGNLTFATVRGAGHQVPSFQPLRALTLISHFLA  509



>ref|XP_002272961.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Vitis 
vinifera]
Length=504

 Score =   454 bits (1168),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 247/489 (51%), Positives = 317/489 (65%), Gaps = 18/489 (4%)
 Frame = +2

Query  155   MLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHG------GITDEAWSemeeee  316
             ++FLL I ++ L   HG   + Q   +  L++AK+    G       + +       E  
Sbjct  10    VVFLLFIFSSFLAESHG-KTMKQIEALDILQKAKLHGNSGIDTNLFEVNEVENGAETESH  68

Query  317   mVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
              +    G  E D I+  LPGQP +V F QY GYV +D++ G++L+YYFAE+  +  + PL
Sbjct  69    KIHPQEGLKEKDRIDM-LPGQP-HVGFSQYGGYVTIDESKGKALYYYFAEAPLSKKSLPL  126

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSSL  GA  ELGPF V+ +GKTLY  ++AWNKVAN LFLESPAGVGFSYS
Sbjct  127   LLWLNGGPGCSSLAYGAMQELGPFRVHSEGKTLYRNQYAWNKVANVLFLESPAGVGFSYS  186

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NT+SDY   GDR+TAKD Y FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I+  N
Sbjct  187   NTTSDYRNGGDRKTAKDNYAFLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHN  246

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVN  1021
                +  + I LKGI+IGN ++ND+TD  G Y Y  SHAL+S++T   + +HC       +
Sbjct  247   KKADGPI-INLKGIIIGNAVINDETDELGMYQYFGSHALVSEKTIRQMEKHCNFSPGAAS  305

Query  1022  FSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYLNLP  1198
              S +C          I  ID YNIY PLC ++  + K K+    FDPC++ YVY+YLN  
Sbjct  306   QSKECTKASDEVDDNIDVIDIYNIYAPLCFNTNLTVKPKKVTPEFDPCSDYYVYAYLNRA  365

Query  1199  KVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVP  1378
              VQKALHAN TKL Y WE CS+VI  W D  ST+ P+    + +G ++ +FSGD D  VP
Sbjct  366   DVQKALHANVTKLKYDWEPCSDVIQNWTDSPSTIIPLLHEFMENGLRVWVFSGDTDGRVP  425

Query  1379  VTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRA  1555
             VTST  S+D MKL V  PWHPW     +VGGY  VY+G LTFATVRGAGH+VP F P+RA
Sbjct  426   VTSTMASIDTMKLSVKTPWHPWF-VAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRA  484

Query  1556  LTLLNMFLS  1582
             L+L++ FLS
Sbjct  485   LSLISHFLS  493



>gb|AES71588.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score =   453 bits (1166),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 228/413 (55%), Positives = 283/413 (69%), Gaps = 15/413 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV V+   GR LFYYF ES     TKPL+LWLNGGPGCSSLG GA
Sbjct  79    LPGQPYGVNFDQYSGYVTVNPEAGRELFYYFVESPYNSSTKPLVLWLNGGPGCSSLGYGA  138

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF +N DGKTLY  ++AW +VAN LFLESPAGVGFSYSNT+SDYD SGD+ TAKD
Sbjct  139   FQELGPFRINSDGKTLYRNQYAWTEVANVLFLESPAGVGFSYSNTTSDYDKSGDKSTAKD  198

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL+NW +RFP YKTR FYI GESYAG Y+P+LA  I+  N +   T+ I LKGI + 
Sbjct  199   SYVFLINWLERFPQYKTRAFYIAGESYAGHYVPQLASTILHNNKLYNNTV-INLKGISVW  257

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC--VVNF-----SIKCEHFERAAGIE  1066
             N  ++D T ++G +DY W+HAL SD+TH+ + ++C   V+F     S  C +    A  E
Sbjct  258   NAWIDDATSLKGLFDYFWTHALNSDQTHELIEKYCDFTVDFTSGNTSAICNNVTDRAYTE  317

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRLG--FDPCAEDYVYSYLNLPKVQKALHANNTKLP  1240
              G IDFYNIY PLC DS         +   FDPC++ Y  +YLN P+VQ+ALHA     P
Sbjct  318   KGKIDFYNIYAPLCHDSSLKNGSTGYVSNDFDPCSDYYGIAYLNRPEVQQALHAK----P  373

Query  1241  YTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLK  1420
               W  CSE+ + WKD   T+ P  + LI SG K+ ++SGD D  VPVTS+RYS++ +KL 
Sbjct  374   TNWSYCSEINSKWKDSPITVLPTIKYLIDSGIKLWIYSGDTDGRVPVTSSRYSINTLKLP  433

Query  1421  VIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +   WHPW    K++GGY V Y+GLTF TVRGAGH VP + P RALTL++ FL
Sbjct  434   INDAWHPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTLISSFL  485



>ref|XP_006473369.1| PREDICTED: serine carboxypeptidase II-3-like [Citrus sinensis]
Length=485

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 233/468 (50%), Positives = 302/468 (65%), Gaps = 26/468 (6%)
 Frame = +2

Query  206   VNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDV------GSMEDDLINGG  367
              N+ID   R++  ++++  Q       E W++  +   V   V      G ME D I   
Sbjct  26    ANQIDNLNRLINSKKSRNPQ-----RTEPWTDQSKVRNVMSPVDSGPQEGMMEADKIKT-  79

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QYAGY+ VD   GR+LFYYF ES Q+  TKPL+LWLNGGPGCSSLG GA
Sbjct  80    LPGQPQGVDFDQYAGYLTVDPKAGRALFYYFVESPQSSSTKPLVLWLNGGPGCSSLGYGA  139

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DGKTLY   +AWN VAN LFLE+PAGVGFSYSNTSSDY   GD  TA+D
Sbjct  140   MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAED  199

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FLVNWF+RFP YK RDF+I GESYAG Y+P+LA  I+ +NT   +   I LKGI IG
Sbjct  200   SYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAHTILSKNT---SKTIINLKGIAIG  256

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHFERAAGIEIGSI  1078
             N  ++D+   +G +D+ W+HAL SDET+  + ++C       S  C+ ++     E G I
Sbjct  257   NAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREFGQI  316

Query  1079  DFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             D YN+Y PLC  S         +  +DPC++ YV SYLNL +VQ ALHA +T     W  
Sbjct  317   DLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTN----WST  372

Query  1256  CSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             CS++   W D  ST+ P  ++LIASG ++ ++SGD D  VPVTS+RYS++A+ L V   W
Sbjct  373   CSDLT--WTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAW  430

Query  1436  HPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +PW  D  +VGGY + Y+G+ F TVRGAGH VP + P+RAL +++ FL
Sbjct  431   YPWYAD-GEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFL  477



>gb|EEC75382.1| hypothetical protein OsI_11848 [Oryza sativa Indica Group]
Length=482

 Score =   452 bits (1164),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 230/459 (50%), Positives = 298/459 (65%), Gaps = 10/459 (2%)
 Frame = +2

Query  218   DQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPSNVKF  397
             DQA R++   R++M+      T E  S+    ++       +++      LPGQP    F
Sbjct  22    DQAARVLEFSRSRMEMRDDQYTTEHTSQRANHQLYMSSQDGLKEADKVSELPGQPGRAGF  81

Query  398   KQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVN  577
              QYAGYV V+ T+G++LFYYFAE+   P TKPL+LWLNGGPGCSSLG GA +E+GPF VN
Sbjct  82    DQYAGYVTVNATSGKALFYYFAEATDDPSTKPLVLWLNGGPGCSSLGDGAMLEIGPFFVN  141

Query  578   PDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFK  757
              D +TL   R+AWN VAN LFLESPAGVGFSYSNT+SDYD +GD  TA DAY FL NW +
Sbjct  142   GDNRTLSINRYAWNNVANMLFLESPAGVGFSYSNTTSDYDNTGDTSTAADAYTFLTNWLE  201

Query  758   RFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDV  937
             RFP YK RDF+I GESY G YIP+LA+ I+  N +   T+ I LKG+ IGN  ++D T+ 
Sbjct  202   RFPEYKGRDFFITGESYGGHYIPQLANAILSNNNITNVTI-INLKGVAIGNAYLDDSTNT  260

Query  938   RGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSIDFYNIYGPLCL  1111
             R   DY W+HALIS ETH  +  +C  N  +  +C +    A  E G ID YNIY PLC 
Sbjct  261   RATIDYYWTHALISKETHLAVQRNCSFNGTYMAQCRNALAEADTEKGVIDPYNIYAPLCW  320

Query  1112  DSESSRKVK-RRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVIT--YWK  1282
             ++ + R++    +  DPC+  YV SYLN P+VQ+ LHAN T L    + C+ +IT   WK
Sbjct  321   NASNPRQLHGSAINVDPCSRYYVESYLNRPEVQRTLHANTTGLK---QPCN-IITPENWK  376

Query  1283  DRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQ  1462
             D   +M P  + LI+SG    L+SGD+D+V PVTST YS+D ++L +   W PW  D  +
Sbjct  377   DAPVSMLPSIQGLISSGVSTWLYSGDIDAVCPVTSTLYSLDILELPINSSWRPWYSDDNE  436

Query  1463  VGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             V GY V Y+GL FATVR +GH VP + P+RALTL + FL
Sbjct  437   VAGYVVGYKGLVFATVRESGHMVPTYQPQRALTLFSSFL  475



>gb|EEE59169.1| hypothetical protein OsJ_11092 [Oryza sativa Japonica Group]
Length=482

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 230/459 (50%), Positives = 298/459 (65%), Gaps = 10/459 (2%)
 Frame = +2

Query  218   DQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPSNVKF  397
             DQA R++   R++M+      T E  S+    ++       +++      LPGQP    F
Sbjct  22    DQAARVLEFSRSRMEMRDDQYTTEHTSQRANHQLYMSSQDGLKEADKVSELPGQPGRAGF  81

Query  398   KQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVN  577
              QYAGYV V+ T+G++LFYYFAE+   P TKPL+LWLNGGPGCSSLG GA +E+GPF VN
Sbjct  82    DQYAGYVTVNATSGKALFYYFAEATDDPSTKPLVLWLNGGPGCSSLGDGAMLEIGPFLVN  141

Query  578   PDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFK  757
              D +TL   R+AWN VAN LFLESPAGVGFSYSNT+SDYD +GD  TA DAY FL NW +
Sbjct  142   GDNRTLSINRYAWNNVANMLFLESPAGVGFSYSNTTSDYDNTGDTSTAADAYTFLTNWLE  201

Query  758   RFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDV  937
             RFP YK RDF+I GESY G YIP+LA+ I+  N +   T+ I LKG+ IGN  ++D T+ 
Sbjct  202   RFPEYKGRDFFITGESYGGHYIPQLANAILSNNNITNVTI-INLKGVAIGNAYLDDSTNT  260

Query  938   RGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSIDFYNIYGPLCL  1111
             R   DY W+HALIS ETH  +  +C  N  +  +C +    A  E G ID YNIY PLC 
Sbjct  261   RATIDYYWTHALISKETHLAVQRNCSFNGTYMAQCRNALAEADTEKGVIDPYNIYAPLCW  320

Query  1112  DSESSRKVK-RRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVIT--YWK  1282
             ++ + R++    +  DPC+  YV SYLN P+VQ+ LHAN T L    + C+ +IT   WK
Sbjct  321   NASNPRQLHGSAINVDPCSRYYVESYLNRPEVQRTLHANTTGLK---QPCN-IITPENWK  376

Query  1283  DRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQ  1462
             D   +M P  + LI+SG    L+SGD+D+V PVTST YS+D ++L +   W PW  D  +
Sbjct  377   DAPVSMLPSIQGLISSGVSTWLYSGDIDAVCPVTSTLYSLDILELPINSSWRPWYSDDNE  436

Query  1463  VGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             V GY V Y+GL FATVR +GH VP + P+RALTL + FL
Sbjct  437   VAGYVVGYKGLVFATVRESGHMVPTYQPQRALTLFSSFL  475



>ref|XP_008231546.1| PREDICTED: serine carboxypeptidase-like 40 [Prunus mume]
Length=500

 Score =   453 bits (1165),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 240/464 (52%), Positives = 308/464 (66%), Gaps = 17/464 (4%)
 Frame = +2

Query  221   QARRIMWLRRAKMQQLHGGITDEAWSemeee-emVFDDVGSMEDDLINGGLPGQPSNVKF  397
             Q++ +  L ++K+++  G  T +  + +      +    G  E D I G LPGQP +V F
Sbjct  31    QSQALAQLYKSKLKEGAGIDTSQFEAILHANGAKIHPQEGLKEKDRI-GSLPGQP-HVNF  88

Query  398   KQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVN  577
              QY GYV VDK  GR+LFYYF E+ +T  +  L+LWLNGGPGCSSLG GA +ELGPF ++
Sbjct  89    SQYGGYVTVDKEAGRALFYYFVEAEKTKDSSRLLLWLNGGPGCSSLGYGAMLELGPFRIH  148

Query  578   PDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFK  757
              DGKTLY  RF+WN  AN LFLESPAGVGFSYSN +SDYD SGDR TA D Y FLVNW +
Sbjct  149   SDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNKTSDYDASGDRITAADNYVFLVNWLE  208

Query  758   RFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDV  937
             RFP YK R+FYI GESYAG Y+P+LA  I+  N     T+ I LKGI+IGN ++ND+TD 
Sbjct  209   RFPEYKDREFYISGESYAGHYVPQLAHTILYHNKRANKTI-INLKGIVIGNAVINDETDS  267

Query  938   RGGYDYLWSHALISDETHDGLIEHCVVNFSIK-------CEHFERAAGIEIGSIDFYNIY  1096
             RG YDYL SHALISD+T + + ++C  +FS         C     AA  +   ID YNIY
Sbjct  268   RGMYDYLASHALISDQTANKINKYC--DFSPNATKQPKACSDAADAAAKDTYYIDIYNIY  325

Query  1097  GPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVI  1270
                C+ S  + K K+     FDPC+E Y Y+Y N P VQ+ALHAN TKL + WE CS+VI
Sbjct  326   ASSCVSSNLTAKPKKASIFEFDPCSEYYAYAYFNRPDVQQALHANVTKLTHDWEPCSDVI  385

Query  1271  TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWED  1450
               W D AST+ P+ +  +A+  ++ +FSGD+D+ VPVTST+YS++ + L +   WH W  
Sbjct  386   ANWADGASTVLPLLKEFLANDVRLWIFSGDIDARVPVTSTKYSIEKLNLPIKTEWHAWFL  445

Query  1451  DTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
                +VGGY  VYEG LTFATVRGAGH+VP + P R L+L+  FL
Sbjct  446   G-GEVGGYTQVYEGELTFATVRGAGHQVPSYQPARGLSLVKHFL  488



>ref|XP_003592242.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003601339.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=494

 Score =   452 bits (1164),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 225/409 (55%), Positives = 285/409 (70%), Gaps = 11/409 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV V+   GR+LFYYF ES     TKPL+LWLNGGPGCSSLG GA
Sbjct  81    LPGQPDGVDFDQYSGYVTVEPEAGRALFYYFVESPYNSSTKPLVLWLNGGPGCSSLGYGA  140

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTLY  ++AW++VAN LFLESPAGVGFSYSNT+SDY  +GD+ TAKD
Sbjct  141   FEELGPFRVNSDGKTLYRNQYAWSEVANILFLESPAGVGFSYSNTTSDYKKAGDKSTAKD  200

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  + +   T+ I LKGI IG
Sbjct  201   AYVFLINWLERFPQYKTRDFYITGESYAGHYVPQLASTILHHHKLYNKTI-INLKGISIG  259

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHFERAAGIEIGSI  1078
             N  ++D T  +G +DY W+HAL SD+TH+ + ++C     N+S  C +    A IE G I
Sbjct  260   NAWIDDATGDKGLFDYFWTHALNSDQTHELIEKYCDFTKQNYSTICINVTDWAFIEKGKI  319

Query  1079  DFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
             DFYNIY PLC DS         +   FDPC+++Y  +YLN P+VQKALHA     P  W 
Sbjct  320   DFYNIYAPLCHDSSLKNGSTGYVTNDFDPCSDNYGIAYLNRPEVQKALHAK----PTNWS  375

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
              C ++IT+W D   T+ P  + LI S  K+ ++SGD D+ VPVT++RY+++ +KL +   
Sbjct  376   HCGDLITHWNDSPITILPTIKYLIESNIKLWIYSGDTDARVPVTTSRYAINTLKLPINAS  435

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             W PW    K++GGY V Y+GLTF TVRGAGH VP + P RALT+++ FL
Sbjct  436   WRPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTMISSFL  483



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   451 bits (1161),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 228/417 (55%), Positives = 284/417 (68%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESA--QTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV F QY+GYV V++  GR+LFY+F ES   + P T+PLILWLNGGPGCSS+  
Sbjct  35    LPGQPKNVDFNQYSGYVTVNEEAGRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAY  94

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTLY   +AWNK+ANTLFLESPAGVGFSY+NT+SD   SGD+RTA
Sbjct  95    GAAEEIGPFRIRPDGKTLYFNPYAWNKLANTLFLESPAGVGFSYTNTTSDLYTSGDKRTA  154

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNW +RFP YK RDFYI GESYAG Y+P+LA ++ +RN   +  + I  KG M
Sbjct  155   EDAYVFLVNWLERFPQYKYRDFYIAGESYAGHYVPQLAQIVYERNKGVQIPV-INFKGFM  213

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S +C      A  E 
Sbjct  214   VGNAVTDDYHDFVGTFEYWWTHGLISDSTYRNLQVACDMGSATHPSSECTTALEVAEAEQ  273

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C D+ S R+  R         FDPC E Y   Y N P+VQKALHAN T
Sbjct  274   GNIDPYSIFTQPCADTTSLRRNLRGHYPWMSRAFDPCTERYSKEYFNRPEVQKALHANVT  333

Query  1232  KLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              +PY WE CS+VI Y W D   +M PIY+ LIA+G +I ++SGD D+VVPVT+TRYS+DA
Sbjct  334   GIPYQWETCSDVIGYNWTDSPLSMLPIYQELIAAGIRIWVYSGDTDAVVPVTATRYSIDA  393

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  WHPW ++ K VGG+   Y+GLTF TV GAGHEVP   PR+A  L   FL
Sbjct  394   LKLPTINKWHPWYENGK-VGGWSQEYKGLTFVTVTGAGHEVPLHRPRQAFILFRSFL  449



>ref|XP_002298413.2| putative serine carboxypeptidase family protein [Populus trichocarpa]
 gb|EEE83218.2| putative serine carboxypeptidase family protein [Populus trichocarpa]
Length=496

 Score =   452 bits (1163),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 231/423 (55%), Positives = 289/423 (68%), Gaps = 12/423 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP  V+F QY GYV VDK+ GR+L+YYF E+  +  + PL+LWLNG
Sbjct  67    GLKEKDRIES-LPGQP-KVEFSQYGGYVTVDKSAGRALYYYFVEAQHSKESSPLLLWLNG  124

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA  ELGPF V  DGK LY  R++WN  AN LFLESPAGVGFSYSNT+SDY
Sbjct  125   GPGCSSLAYGAMQELGPFRVYSDGKKLYKNRYSWNYAANVLFLESPAGVGFSYSNTTSDY  184

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + SGD+RTA+D Y FLVNW +RF  YK R+FYI GESYAG Y+PELA  I+  N   +  
Sbjct  185   EKSGDKRTAEDNYVFLVNWLERFSEYKDREFYISGESYAGHYVPELAHTILYHNKKAKKA  244

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF-----SIKCE  1039
             + I LKGI+IGN ++N +TD  G YDYL SHA+ISD     +  HC  +F     S +C 
Sbjct  245   I-INLKGILIGNAVINPETDRIGMYDYLGSHAIISDVLVHKVRTHCNFSFNATPQSDECN  303

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR--RLGFDPCAEDYVYSYLNLPKVQKA  1213
                     +   ID YNIY P C    ++ K K+   + FDPC++ YVY+YLN P VQ+A
Sbjct  304   EAVDEVRKDTHHIDIYNIYAPSCFYKSTTAKPKKPSLVNFDPCSDYYVYAYLNRPDVQEA  363

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             +HAN TKL + WE CS+VIT W D  ST+ P+ + L+A+G ++ +FSGD D+ VPVTST+
Sbjct  364   MHANVTKLTHDWEPCSDVITSWSDSPSTIIPLLQELMANGLRVWIFSGDTDARVPVTSTQ  423

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLN  1570
             YS++ MKL+V   WHPW     +VGGY  VY G LTFATVRGAGH+VP + P RAL+L+ 
Sbjct  424   YSINKMKLQVKTEWHPWYLK-GEVGGYTQVYRGDLTFATVRGAGHQVPTYQPLRALSLIK  482

Query  1571  MFL  1579
              FL
Sbjct  483   HFL  485



>emb|CBI32446.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   451 bits (1161),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 308/466 (66%), Gaps = 17/466 (4%)
 Frame = +2

Query  206   VNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPS  385
             +N+ D   ++M  +R+K Q    G + E+ S       +    G  + D I   LPGQP+
Sbjct  13    MNRYDLLGKLMQAQRSKRQS--EGHSIESMSTEYSPVYMGSQDGLKDGDRIQA-LPGQPN  69

Query  386   NVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGP  565
              +   QY+GYV VD   GR+LFYYF ES Q   +KPL+LWLNGGPGCSSLG GA +ELGP
Sbjct  70    GLNLDQYSGYVTVDPQAGRALFYYFVES-QNSSSKPLVLWLNGGPGCSSLGSGAMMELGP  128

Query  566   FGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLV  745
             F VN DG TL    +AW+ VAN LFLESPAGVGFSYSNT+SDYD SGD++TA+D Y FL+
Sbjct  129   FRVNGDGNTLSYNEYAWSNVANILFLESPAGVGFSYSNTTSDYDKSGDKQTAEDNYTFLL  188

Query  746   NWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMND  925
             NW +RFP YKTRDF+I GESYAG Y+P+L+  I++ N +   T+ I LKGI IGN  ++ 
Sbjct  189   NWLERFPEYKTRDFFITGESYAGHYVPQLSQKILQNNKITNQTV-INLKGIAIGNAWIDY  247

Query  926   DTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK------CEHFERAAGIEIGSIDFY  1087
             +T ++G YD+ W+H+LISDE ++G+  +C  NFS +      CE +  AA   +G I  Y
Sbjct  248   ETGLKGMYDFFWTHSLISDEINEGINLNC--NFSSETTISDVCEQYLDAADAAVGYIYIY  305

Query  1088  NIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEV  1267
             +IY PLC  S SS   +    FDPC+EDY+ +YLN+P+VQK++HAN T +P  WE C++ 
Sbjct  306   DIYAPLC--SSSSNSTRPISVFDPCSEDYIQTYLNIPEVQKSMHANVTNIPGPWESCNDA  363

Query  1268  ITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPW  1444
             I Y WKD   T+ P+   L+ SG  + ++SGD D  VP TSTRYS++ +   V  PW+PW
Sbjct  364   IFYGWKDMPLTVLPVIEELMVSGISVWIYSGDTDGRVPTTSTRYSINNLGTSVKTPWYPW  423

Query  1445  EDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
                  +VGGY V Y+ L+F T+RGAGH VP + P RAL   + FL+
Sbjct  424   YTQ-GEVGGYAVGYKNLSFVTIRGAGHFVPSYQPTRALAFFSSFLA  468



>emb|CBI19568.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   468 bits (1205),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 238/419 (57%), Positives = 295/419 (70%), Gaps = 13/419 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G M+DD I   LPGQP  V F QYAGYV VD   GR+LFYYF ES +   TKPL+LWLNG
Sbjct  600   GLMQDDKIES-LPGQPEGVNFDQYAGYVTVDPKAGRALFYYFVESPEDSSTKPLVLWLNG  658

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GA  ELGPF VNPDGKTL+   +AWN V+N +FLESPAGVGFSYSNTSSDY
Sbjct  659   GPGCSSLGYGAMEELGPFRVNPDGKTLFRNEYAWNNVSNVIFLESPAGVGFSYSNTSSDY  718

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
                GD++TA+D+Y FL+NW +RFP YKTRDF+I GESY+G Y+P+LA  I+  N     T
Sbjct  719   VNVGDKKTAEDSYTFLINWLERFPQYKTRDFFITGESYSGHYVPQLAYTILSNNNKTNQT  778

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHF  1045
             + I LKGI IGN  ++D+T ++G YDY+W+HAL SDE++ G+ ++C     NFS KC  +
Sbjct  779   V-INLKGIAIGNAWIDDNTSLKGIYDYIWTHALSSDESNAGIQKYCDFTTGNFSTKCLDY  837

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDS-ESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
                A  E+G+ID YNIY PLC  S  +SR V     FDPC++ YV SYLNL +VQKALHA
Sbjct  838   TYQAEGEVGNIDIYNIYAPLCHSSGPTSRSVGSVNDFDPCSDYYVESYLNLAEVQKALHA  897

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
              NT    TW  CS V   W D  +T+ P  ++L+ASG  + ++SGD D  VPVTS+RYS+
Sbjct  898   RNT----TWGACSGV--GWTDSPTTILPTIKQLMASGISVWIYSGDTDGRVPVTSSRYSI  951

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +  KL V   W PW  + K+VGGY V Y+G+ FATVRGAGH VP + P RALT++  FL
Sbjct  952   NTFKLPVKTAWRPWYYN-KEVGGYVVEYKGVVFATVRGAGHLVPSYQPGRALTMIASFL  1009


 Score =   402 bits (1032),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 214/436 (49%), Positives = 275/436 (63%), Gaps = 39/436 (9%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP+ V F Q++GYV VD   GR+LFYYF ES Q   TKPL+LWLNGGPGCSS G+GA
Sbjct  91    LPGQPNGVDFDQFSGYVTVDSLAGRALFYYFVESPQNSTTKPLVLWLNGGPGCSSFGIGA  150

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF VN DG+TLY  + AWNK AN +FLESPAGVGFSYS+T+SDY+ SGD RTA D
Sbjct  151   MMELGPFRVNKDGETLYLNKHAWNKEANIIFLESPAGVGFSYSDTASDYNSSGDYRTASD  210

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL++W + FP YKTRDF+I GE YAG Y+P+LA  I+  N++P+  + I L+GI +G
Sbjct  211   SYIFLLSWLEIFPEYKTRDFFIAGEGYAGHYVPQLAQTILLFNSIPDLPI-INLRGIAMG  269

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEIGS  1075
             N  ++ +T  +G  DY WSHALISDE +  LI +C V    + S +C  +   A   +G+
Sbjct  270   NPYVDRETAFKGIVDYYWSHALISDEIYMELILNCNVSSEESASEECIAWLLQADNAMGN  329

Query  1076  IDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             I+ Y+IY PLC  S  S  V     FDPC+ +Y+++YLN+P+VQ+ALHAN T LP  WE 
Sbjct  330   INVYDIYAPLCNSSADSNSVS---AFDPCSGNYIHAYLNIPQVQEALHANVTGLPCPWEF  386

Query  1256  C---------------------------SEVITYWKDRASTMFPIYRRLIASGQKILLFS  1354
             C                           + V    +D     F +   L  S    L+ S
Sbjct  387   CRQCHPTKCNIYSSNYAAQHSGADEQRNTSVDIQARDLNQNEFEVLWILTKSN---LICS  443

Query  1355  GDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVP  1534
             GD D VVPVTS+RY +  +   V  PWHPW     +VGGY V Y+ LTF TVRG+GH VP
Sbjct  444   GDTDGVVPVTSSRYFIKKLGTLVRTPWHPWYTH-GEVGGYAVEYQNLTFVTVRGSGHFVP  502

Query  1535  QFTPRRALTLLNMFLS  1582
              + P R+L L   FL+
Sbjct  503   SYQPARSLQLFCSFLN  518



>emb|CDP08509.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   451 bits (1161),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 228/409 (56%), Positives = 280/409 (68%), Gaps = 10/409 (2%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP+ V F QY+GYV VD   GR+LFYYFAES Q    KPL+LWLNGGPGCSS+G GA
Sbjct  75    LPGQPNAVNFDQYSGYVTVDPKAGRALFYYFAES-QNSSAKPLVLWLNGGPGCSSIGAGA  133

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DG TL+   +AWN VAN LFLESPAGVGFSYSNTSSDY ++GD +TA D
Sbjct  134   MTELGPFRVNKDGSTLWLNPYAWNTVANVLFLESPAGVGFSYSNTSSDY-ITGDTKTAAD  192

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FLVNW +RFP YKTRDF I GESYAG Y+P+LA +I+  N +   T+ I LKGI IG
Sbjct  193   SYTFLVNWLERFPEYKTRDFLITGESYAGHYVPQLAQLILHNNKITNQTV-INLKGIAIG  251

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHFERAAGIEIGSI  1078
             N  ++ +T   G YDY W+HALISDE H G+  +C     N S  C+ +E  A   IG+I
Sbjct  252   NPYVDIETQGSGTYDYYWTHALISDEIHQGIFSNCNFSSENTSDACQTYEDQADSAIGNI  311

Query  1079  DFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVC  1258
             D YNIY PLC  S SS        FDPC++ YVY+YLN P+VQK+LHAN T +P  W+ C
Sbjct  312   DDYNIYAPLC--SSSSNTPTTISEFDPCSDHYVYTYLNTPQVQKSLHANTTVIPGPWDSC  369

Query  1259  SEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             ++ I   W D   T+ P  + L  SG  + ++SGD DSV  VT+T+Y+++ + L V  PW
Sbjct  370   NDYIHLNWDDEPDTVLPTIKELTESGISVWIYSGDTDSVCSVTTTKYALNKLGLSVKNPW  429

Query  1436  HPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             + W     +VGGY V YE LTF TVRGAGH VP + P RALTL + FL+
Sbjct  430   YAWYTQ-GEVGGYAVEYENLTFVTVRGAGHFVPSYQPSRALTLFSSFLA  477



>ref|XP_006578498.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=545

 Score =   453 bits (1165),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 285/420 (68%), Gaps = 14/420 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP  V F QY+GYV VD   GR+LFYYF ES+  P TKPL+LWLNG
Sbjct  122   GQKEADKI-VALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKPLVLWLNG  180

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GAF ELGPF +N DGKTLY  ++AWN VAN LFLESPAGVGFSYSNT SDY
Sbjct  181   GPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAWNVVANVLFLESPAGVGFSYSNTISDY  240

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + SGD+ TAKDAY FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N   +  
Sbjct  241   EHSGDKSTAKDAYVFLINWLERFPEYKTRDFYITGESYAGHYVPQLAYTILVNNKFSQQ-  299

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHF  1045
               I LKGI IGN  ++D T ++G YDY+W+HAL SD+TH+ + ++C     N S  C + 
Sbjct  300   -NINLKGIAIGNAWIDDVTSLKGIYDYIWTHALSSDQTHELIEKYCDFTSENVSAICANA  358

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG--FDPCAEDYVYSYLNLPKVQKALH  1219
              R A  E G+ID YNIY PLC DS         +   FDPC++ Y  +YLN P+VQ ALH
Sbjct  359   TRTAFEENGNIDPYNIYAPLCQDSSLKNGSTGSVSNDFDPCSDYYGEAYLNRPEVQLALH  418

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             A     P  W  CS++I  W D  +++ P+ + LI S   + ++SGD DSVVPVTS+RYS
Sbjct  419   AK----PTNWTHCSDIIN-WNDSPASILPVIKYLIDSDIGLWIYSGDTDSVVPVTSSRYS  473

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             ++ +KL +  PW PW     +VGGY V Y G+TF TVRGAGH VP + P R LTL+  FL
Sbjct  474   INTLKLPIQVPWRPWYSG-NEVGGYVVKYNGVTFVTVRGAGHLVPSWQPSRTLTLIFSFL  532



>gb|EYU37705.1| hypothetical protein MIMGU_mgv1a005479mg [Erythranthe guttata]
Length=482

 Score =   450 bits (1158),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 243/468 (52%), Positives = 310/468 (66%), Gaps = 21/468 (4%)
 Frame = +2

Query  200   HGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeee-emVFDDVGSMEDDLINGGLPG  376
             +G  K D  R ++  RRAK       ++++A S  E     V +  G  E D I   LPG
Sbjct  21    YGGRKYDPLRELIKARRAKRSSSVNYVSEDATSSAEYSPVYVQNQYGLKEVDKI-LSLPG  79

Query  377   QPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIE  556
             QP  V F QY+GYV VD   GR+LFYYF ES  +  TKPL+LWLNGGPGCSSLG GA  E
Sbjct  80    QP-QVNFSQYSGYVTVDPIAGRALFYYFTESEDS-STKPLVLWLNGGPGCSSLGAGAMTE  137

Query  557   LGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYK  736
             LGPF VNPDGKTL+  + AWN  AN +FLESPAGVGFSYSN SSDY ++GD++TA DAY 
Sbjct  138   LGPFRVNPDGKTLWLNKNAWNNEANVVFLESPAGVGFSYSNRSSDY-ITGDKQTAADAYT  196

Query  737   FLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGI  916
             F+VNW +RFP YKTRDFYI GESYAG Y+P+LAD+I+K N +   T+ I LKGI IGN +
Sbjct  197   FVVNWLERFPEYKTRDFYITGESYAGHYVPQLADLILKNNKITNQTV-INLKGIAIGNAL  255

Query  917   MNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI-----KCEHFERAAGIEIGSID  1081
             +ND+    G YDYLW+HALISDETH+G++++C  NFS       C+++   A   +  I 
Sbjct  256   INDEDWWNGQYDYLWTHALISDETHNGIVKNC--NFSSPDISEACDNYAGEADDAVEDIY  313

Query  1082  FYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCS  1261
             FY+IY PLC  S ++  +     FDPC+ DY Y+YLN P+VQKALHA+      TWE C+
Sbjct  314   FYDIYAPLCSSSSNAPSIST---FDPCSGDYAYTYLNTPEVQKALHAHVNG---TWESCN  367

Query  1262  -EVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWH  1438
              EV   W+D  +T+ P    L+ASG ++ ++SGD D  VPVT+T YS+  +   +  PW+
Sbjct  368   FEVHANWQDWQTTLLPTIEELMASGIRVWIYSGDTDRAVPVTTTSYSLTKIGAPITTPWY  427

Query  1439  PWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             PW     +VGGY V Y+ LTF TVRG+GH VP + P RAL L   FL+
Sbjct  428   PWYSQ-GEVGGYAVGYQNLTFVTVRGSGHFVPSYQPERALVLFTSFLA  474



>ref|XP_006593897.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=490

 Score =   451 bits (1159),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 233/422 (55%), Positives = 288/422 (68%), Gaps = 18/422 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  + D I   LPGQP  V F QY+GYV VD   GR+LFYYF ES   P TKPL+LWLNG
Sbjct  67    GQKQADKI-AALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNG  125

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GAF ELGPF +N DGKTLY  ++AWN+VAN LFLESPAGVGFSYSNT+SDY
Sbjct  126   GPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDY  185

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D SGD+ TAKDAY FL+NW +RFP YKTR+FYI GESYAG Y+P+LA  I+  N   +  
Sbjct  186   DHSGDKPTAKDAYVFLINWLERFPEYKTRNFYITGESYAGHYVPQLAYTILVNNKFSQQN  245

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHF  1045
             +   LKGI IGN  ++D T  +G  DYLW+HAL SD+TH+ + ++C     N S  C + 
Sbjct  246   IN--LKGIAIGNAWIDDVTGTKGIVDYLWTHALNSDQTHELIEKYCDYSSENISQICSNA  303

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG----FDPCAEDYVYSYLNLPKVQKA  1213
              R A  E G+IDFYNIY PLC D  SS K +   G    FDPC++ Y  +YLN P+VQ A
Sbjct  304   TRRALTEKGNIDFYNIYAPLCHD--SSLKNESSSGSVYDFDPCSDYYGEAYLNRPEVQLA  361

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             LHA     P  W  CS++I  W D  +T+ P+ + L  S   + ++SGD D+ VPVTS+R
Sbjct  362   LHAK----PTNWSHCSDLID-WNDSPTTILPVIKYLTDSNIVLWIYSGDTDARVPVTSSR  416

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNM  1573
             Y+++ +KL +  PW PW     +VGGY V Y+G+TF TVRGAGH VP + P RALTL+  
Sbjct  417   YAINTLKLPIQVPWRPWYSG-NEVGGYVVKYKGVTFVTVRGAGHLVPSWQPARALTLIFS  475

Query  1574  FL  1579
             FL
Sbjct  476   FL  477



>ref|XP_004514571.1| PREDICTED: serine carboxypeptidase-like 40-like [Cicer arietinum]
Length=498

 Score =   450 bits (1158),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 243/501 (49%), Positives = 316/501 (63%), Gaps = 26/501 (5%)
 Frame = +2

Query  113   MGKKQDSLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEA  292
             M K   SL+   F  +  L+      G  HG     Q+R +  L+++K         D++
Sbjct  1     MNKSICSLLLISFLTITFLV------GETHGT---KQSRALDKLQKSKFNA--NSKIDKS  49

Query  293   WSemeeeemVFDDV-----GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYY  457
               + ++  +V D+V     G  E D+I   LPGQP NVKF QY GYV VDK  GR+ +YY
Sbjct  50    HFKTQKNNIVVDEVVHSQDGMKEKDMI-VKLPGQP-NVKFSQYGGYVTVDKLVGRAFYYY  107

Query  458   FAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTL  637
             F E+  +  T PL+LWLNGGPGCSSL  GA  ELGPF VN DGKTL+   ++WN  AN L
Sbjct  108   FVEAHHSKETLPLLLWLNGGPGCSSLAYGAMEELGPFRVNSDGKTLHKNNYSWNYAANVL  167

Query  638   FLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGF  817
             FLESPAGVGFSYSN + DYD +GDRRTA+D Y FL+NW +RFP YK RDFYI GESYAG 
Sbjct  168   FLESPAGVGFSYSNKTFDYDTNGDRRTARDNYVFLLNWLERFPEYKNRDFYIAGESYAGH  227

Query  818   YIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDG  997
             Y+P+LA  I+  N     T+ + LKGIMIGN ++ND+TD +G YDYL SHA+ISD+T   
Sbjct  228   YVPQLAHNILYYNKKANRTI-VNLKGIMIGNAVINDETDNQGMYDYLASHAIISDQTAHN  286

Query  998   LIEHC----VVNFSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR-RLGFDPC  1162
             +   C      N S +C             +D YNIY P+C +   +   K+  +  DPC
Sbjct  287   INTFCNFSSTSNQSTECNEAASEVYRNTLFLDVYNIYAPICTNHNLTTLSKKISVALDPC  346

Query  1163  AEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKI  1342
             ++DYV +YLN   VQ+ALHAN TKL Y WE CS +I+ W D  ST+ P+    + +G ++
Sbjct  347   SDDYVQAYLNRDDVQEALHANVTKLKYDWEPCSSIISKWGDSPSTIIPLLHEFLNNGLRV  406

Query  1343  LLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGA  1519
              +FSGD+D  VPVTST+YS+  MKL +   W+PW  +  QVGGY  VY+ GLTFATVR A
Sbjct  407   WVFSGDIDGRVPVTSTKYSIKKMKLPIETTWYPWFLN-GQVGGYAEVYKGGLTFATVREA  465

Query  1520  GHEVPQFTPRRALTLLNMFLS  1582
             GH+VP + P RAL+L+  FL+
Sbjct  466   GHQVPSYQPARALSLIKHFLN  486



>ref|XP_009370169.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Pyrus 
x bretschneideri]
Length=505

 Score =   449 bits (1156),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 225/420 (54%), Positives = 288/420 (69%), Gaps = 14/420 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I G LPGQP  V F QYAGYV VD+  GR+LFYYF ES Q   TKPL+LWLNG
Sbjct  87    GLKEADKI-GSLPGQPQGVNFDQYAGYVTVDQKAGRALFYYFVESPQDSSTKPLLLWLNG  145

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GA  E+GPF VN D KTL+   +AWN VAN +FLESPAGVGFSYS T+SDY
Sbjct  146   GPGCSSLGYGAMEEIGPFRVNNDRKTLFRNDYAWNNVANVIFLESPAGVGFSYSYTTSDY  205

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
                GD+RTA+D+YKFLVNW +RFP YKTRDF+I GESYAG Y+P+LA  I+  N + + T
Sbjct  206   GDVGDKRTAEDSYKFLVNWLERFPQYKTRDFFITGESYAGHYVPQLASTILLNNKVTKQT  265

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHF  1045
              KI LKGI IGN  ++D T   G YDY+W+H++ SDET+ G+ ++C     NFS  C+ +
Sbjct  266   -KINLKGIAIGNAWIDDSTGELGIYDYVWTHSMNSDETNAGIHKYCDFSSGNFSSACDKY  324

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKVQKALH  1219
                   E+G++D YNIY P C  SE ++ + +     FDPC+++YV +YLNL +VQ ALH
Sbjct  325   RSQVEEELGNVDIYNIYAPPCKTSEPTKSLSKSSIDDFDPCSDNYVKTYLNLKEVQAALH  384

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             A     P  W  C  V   W D  +T+ P  ++LIASG  + ++SGD+D  VPVTS+RY+
Sbjct  385   AK----PTEWSACGGV--GWTDSPTTILPTIKQLIASGISLWIYSGDIDGRVPVTSSRYA  438

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             ++  KL +  PW  W  +  QVGGY   Y+GLTF T+RGAGH VP + P+R+LT ++ FL
Sbjct  439   INTFKLPLQTPWRAWYSN-GQVGGYVAGYKGLTFTTIRGAGHMVPSYQPQRSLTFISSFL  497



>ref|XP_008802653.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase II-3-like 
[Phoenix dactylifera]
Length=490

 Score =   449 bits (1155),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 229/430 (53%), Positives = 288/430 (67%), Gaps = 18/430 (4%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHT--KP  493
             ++   G  E+D I+  LPGQP  V F QY GYV VD  +GR+LFYYFAE+A +  T  KP
Sbjct  62    IYPQQGLKENDKISK-LPGQPEGVDFDQYGGYVTVDAESGRALFYYFAEAAASADTSSKP  120

Query  494   LILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSY  673
             L+LWLNGGPGCSSLG GA  ELGPF V  DGKTL+   +AWN+VAN LFLESPAGVGFSY
Sbjct  121   LVLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSY  180

Query  674   SNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKR  853
             SNT+SDYD SGD RTA DAY FL NW +RFP YK RDF+I GESY G Y+P+LA  I++ 
Sbjct  181   SNTTSDYDKSGDSRTAADAYVFLENWMERFPEYKGRDFFIAGESYGGHYVPQLAHTILQH  240

Query  854   NTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VV  1018
             N        I L+GIMIGNG++N +TD +G +DY W+HALISDET D + ++C      V
Sbjct  241   NNT-----SINLRGIMIGNGVINAETDSKGMFDYFWTHALISDETIDAIHKYCNFSPDAV  295

Query  1019  NFSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLN  1192
             N   +C+           ++D YNIY PLC  S  +   KR     FDPC +DYV +YLN
Sbjct  296   NQPKQCDQALEVTNNVFETLDIYNIYAPLCFSSGVTPSPKRYSIKNFDPCTDDYVSAYLN  355

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
             + +VQ+A HAN TKL YTW  C   +  W D   T+ P+ +  +A+  ++ ++SGDVD  
Sbjct  356   IAEVQEAFHANVTKLNYTWSACRHFMQ-WTDSPYTVLPLIKECMANDIRVWVYSGDVDGR  414

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVY-EGLTFATVRGAGHEVPQFTPR  1549
             VPVTS+RYS++ + L V   W PW  + K+VGGY V+Y + LTFATVRGAGHEVP +   
Sbjct  415   VPVTSSRYSLNQLNLLVKTEWQPWFIN-KEVGGYSVIYDDNLTFATVRGAGHEVPSYQAL  473

Query  1550  RALTLLNMFL  1579
             R L L+  FL
Sbjct  474   RVLVLVKFFL  483



>ref|XP_010279512.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Nelumbo 
nucifera]
Length=480

 Score =   448 bits (1153),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 240/487 (49%), Positives = 320/487 (66%), Gaps = 34/487 (7%)
 Frame = +2

Query  155   MLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAW----SemeeeemV  322
             ++  L+ ++ ++   HG     QA  +  L +AK+Q   G     ++    +++  E  V
Sbjct  7     VICFLLSLSCYVAQSHG----RQADALARLYQAKLQNKAGIDLTSSYEMKMTQIINEAEV  62

Query  323   FDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLIL  502
                 G  E D+I   LPGQP  V FKQY GYV VD++ GR+LFYYF E AQ P +KPL+L
Sbjct  63    LPQEGLKEKDMIER-LPGQPP-VGFKQYGGYVTVDESAGRALFYYFVE-AQDPKSKPLLL  119

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSSLG GA  ELGPF V+ DGKTLY  R++WN+             GFSYSN 
Sbjct  120   WLNGGPGCSSLGYGAMEELGPFRVHSDGKTLYENRYSWNR-------------GFSYSNR  166

Query  683   SSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM  862
             +SDY   GD+ TA+D Y FLVNW +RFP YKTRDFYI GESYAG Y+P+ A  I++ N +
Sbjct  167   TSDYATRGDQSTAEDNYVFLVNWLERFPEYKTRDFYIAGESYAGHYVPQFAHTILQHNKI  226

Query  863   PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFS  1027
              +  + I LKGIMIGN ++ND+TD +G YDY W+HAL SDET+  + ++C      + +S
Sbjct  227   EQNNI-INLKGIMIGNAVINDETDQKGMYDYAWTHALSSDETNIAINKYCNFSESELEWS  285

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPK  1201
              +C +    A +    ID YNIYG  C  S  + K K+   + FDPC+++YV +YLN P 
Sbjct  286   DECINSTNEAFMNEVLIDIYNIYGSQCFSSNLTEKPKKASLMNFDPCSDNYVVAYLNQPD  345

Query  1202  VQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPV  1381
             VQ+ALHAN TKL Y W+ CS+V+T W D  ST+  + +  + +G ++L+FSGDVD  VPV
Sbjct  346   VQEALHANITKLKYDWQPCSDVLTKWNDSPSTVVYLLQEFMDNGIRVLVFSGDVDGRVPV  405

Query  1382  TSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRAL  1558
             TSTRYS++ ++L+V   W+PW    ++VGGY VVY+G LTFATVRGAGHEVP + P RAL
Sbjct  406   TSTRYSLNKLQLQVNTSWYPWYT-KREVGGYTVVYKGGLTFATVRGAGHEVPSYQPLRAL  464

Query  1559  TLLNMFL  1579
             TL+N FL
Sbjct  465   TLVNYFL  471



>gb|KHN46300.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=445

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 229/428 (54%), Positives = 285/428 (67%), Gaps = 17/428 (4%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSN-VKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
             V +  G ME D +   LPGQPS  V F QYAGYV VD   GR+LFYYF ES      KPL
Sbjct  17    VKEQSGLMEGDKVKA-LPGQPSQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPL  75

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSS G GA  ELGPF VN DGKTLY  ++AWN VAN +FLESPAGVGFSYS
Sbjct  76    VLWLNGGPGCSSFGYGAMQELGPFRVNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYS  135

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NTSSDY  +GD+ TA D+Y FL+NW +RFP YKTRD +I GESYAG Y+P+LAD I+  N
Sbjct  136   NTSSDYTKTGDKSTAMDSYTFLLNWLERFPQYKTRDLFITGESYAGHYVPQLADTILTYN  195

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFS  1027
              +   T+ I LKGI +GNG ++D+   +G Y+Y W+HAL SDETH+G+  +C     N +
Sbjct  196   KLTNHTV-INLKGIAVGNGWIDDNMCGKGMYEYFWTHALNSDETHEGIQRYCDFESGNLT  254

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSE----SSRKVKRRLGFDPCAEDYVYSYLNL  1195
              +C  ++     EIGSID Y+IY P C  +     SS        FDPC++DY  SYLNL
Sbjct  255   GECSKYQSRGDTEIGSIDIYDIYAPPCDSAAKKAGSSPATNYDSNFDPCSDDYTNSYLNL  314

Query  1196  PKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVV  1375
              +VQ+ALHA  +     W  C  V   W D  +T+ P   RLI+SG    ++SGD D  V
Sbjct  315   AEVQEALHAKAS----VWYPCRGVG--WTDSPATILPTINRLISSGINTWIYSGDTDGRV  368

Query  1376  PVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRA  1555
             P+TS+RYSV+A+KL V   W PW   + +VGGY V Y+GLT  TVRGAGH VP + P+RA
Sbjct  369   PITSSRYSVNALKLPVETTWRPWY-SSNEVGGYLVGYKGLTLITVRGAGHMVPSYQPQRA  427

Query  1556  LTLLNMFL  1579
             LT+++ FL
Sbjct  428   LTMISFFL  435



>ref|XP_007160822.1| hypothetical protein PHAVU_001G019500g [Phaseolus vulgaris]
 gb|ESW32816.1| hypothetical protein PHAVU_001G019500g [Phaseolus vulgaris]
Length=486

 Score =   448 bits (1152),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/416 (53%), Positives = 281/416 (68%), Gaps = 14/416 (3%)
 Frame = +2

Query  341   MEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGP  520
             MEDD + G LPG+P  V F QY GYV VD   GR LFYYF ES      KPL+LWLNGGP
Sbjct  72    MEDDKVKG-LPGEPEGVDFDQYGGYVTVDAKAGRRLFYYFVESPHNASNKPLVLWLNGGP  130

Query  521   GCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDM  700
             GCSSLG GA  ELGPF VN DG+TL    +AWN VAN +FLESPAGVGFSYSNTSSDY  
Sbjct  131   GCSSLGYGAMQELGPFRVNSDGRTLRKNEYAWNNVANVIFLESPAGVGFSYSNTSSDYSD  190

Query  701   SGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLK  880
             SGD+ TA D+Y FL+NW  RFPHYK+RD +I GESYAG Y+P+LA  I+  N +   TL 
Sbjct  191   SGDKSTAMDSYTFLINWLNRFPHYKSRDLFITGESYAGHYVPQLAHTILTHNNLTNHTL-  249

Query  881   IPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHFER  1051
             + LKG+ IGNG ++D+   +G Y+Y W+HA+ SDETH+G+  HC     N + +C  ++R
Sbjct  250   LNLKGVAIGNGWIDDNMCGKGMYEYFWTHAMNSDETHEGIERHCDFESGNLTSECNKYQR  309

Query  1052  AAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
                 EIG ID Y+IY PLC    +++       FDPC+++Y  SYLNL +VQ+ALHA  +
Sbjct  310   RGDDEIGVIDIYDIYAPLC--DPAAQTPPSDSNFDPCSDEYTKSYLNLAQVQEALHAKVS  367

Query  1232  KLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAM  1411
             +    W  CS V   W D  +T+ P    LI+SG +  ++SGD D  VP+TS+RYSV+A+
Sbjct  368   E----WSSCSPV--GWTDSPATILPTISGLISSGIRTWIYSGDTDGRVPITSSRYSVNAL  421

Query  1412  KLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             KL V   W PW     +VGGY + Y+GLT  TVRGAGH VP + P+RALT+++ FL
Sbjct  422   KLPVETTWRPWYSG-NEVGGYLIGYKGLTLITVRGAGHMVPSYQPKRALTMISFFL  476



>gb|KHN12757.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=445

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 226/429 (53%), Positives = 288/429 (67%), Gaps = 19/429 (4%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSN-VKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
             V +  G ME D +   LPGQP+  V F QYAGYV VD   GR+LFYYF ES      KPL
Sbjct  17    VKEQSGLMEGDKVKA-LPGQPAQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPL  75

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSS G GA  ELGPF VN DG+TLY+ ++AWN VAN +FLESPAGVGFSYS
Sbjct  76    VLWLNGGPGCSSFGYGAMQELGPFRVNSDGRTLYTNQYAWNNVANVIFLESPAGVGFSYS  135

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NTSSDY  +GD+ TA D+Y FL+NW +RFP YKTRD +I GESYAG Y+P+LAD I+  N
Sbjct  136   NTSSDYTKTGDKSTAMDSYTFLLNWLERFPQYKTRDLFITGESYAGHYVPQLADTILTYN  195

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFS  1027
              +   T+ I LKGI +GNG ++D+   +G Y+Y W+HAL SDETH+G+  HC     N +
Sbjct  196   KLTNHTV-INLKGIAVGNGWIDDNMCGKGMYEYFWTHALNSDETHEGIQRHCDFENGNLT  254

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSR-----KVKRRLGFDPCAEDYVYSYLN  1192
              +C  ++    IEIG+ID Y IY P C DS +++            +DPC++DY  SYLN
Sbjct  255   SECSKYQIRGDIEIGTIDIYGIYAPPC-DSAATKAGASPATNSDSNYDPCSDDYTNSYLN  313

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
             L +VQ+ALHA  +     W  C  V   W D  +T+ P   RLI+SG    ++SGD D  
Sbjct  314   LAEVQEALHAKAS----VWYPCRGVG--WTDSPATILPTINRLISSGINTWIYSGDTDGR  367

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRR  1552
             VP+TS+RYS+++MKL V   W PW   + +VGGY V Y+GLT  TVRGAGH VP + P+R
Sbjct  368   VPITSSRYSINSMKLPVETTWRPWY-SSNEVGGYLVGYKGLTLITVRGAGHMVPSYQPQR  426

Query  1553  ALTLLNMFL  1579
             ALT+++ FL
Sbjct  427   ALTMISFFL  435



>ref|XP_004292825.1| PREDICTED: serine carboxypeptidase II-3-like [Fragaria vesca 
subsp. vesca]
Length=495

 Score =   448 bits (1152),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 249/501 (50%), Positives = 314/501 (63%), Gaps = 34/501 (7%)
 Frame = +2

Query  137   MSTKFHMLFLLIIMATHLGF--GHGVNKIDQARRIMWLRR------AKMQQLHGGITDEA  292
             M    +  FLLI +   L F      N+ID   +++  R+      A++   +  + D+ 
Sbjct  1     MKLSVYTCFLLISIC-QLSFLRTCDANQIDNLNKLIKSRKSANSPQAELSWENDFLADDR  59

Query  293   WSemeeeemVFDDVGSMEDDLINGGLPGQPSN-VKFKQYAGYVNVDKTNGRSLFYYFAES  469
             +        V    G M  D I+  LPGQP   + FKQYAGYV+V+   GR LFYYF ES
Sbjct  60    F----LPVYVGSQAGLMGADEIDA-LPGQPGEGMGFKQYAGYVSVEPKAGRELFYYFVES  114

Query  470   AQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLES  649
                  TKPL+LWLNGGPGCSS G GA  ELGPF VN DGKTL+   +AWN VAN LFLES
Sbjct  115   PHNSSTKPLLLWLNGGPGCSSFGYGALEELGPFRVNSDGKTLFPNDYAWNNVANILFLES  174

Query  650   PAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPE  829
             PAGVGFSYSNT SDY+  GD+RTA D+Y FLVNW  RFP YKTRDF+I GESYAG Y+P+
Sbjct  175   PAGVGFSYSNTKSDYESVGDKRTALDSYTFLVNWLDRFPQYKTRDFFIAGESYAGHYVPQ  234

Query  830   LADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEH  1009
             LA  IV +N +   T KI LKGI IGN  ++D+    G ++YLW+HAL SDET++G+ ++
Sbjct  235   LAYTIVTKNKVTNQT-KINLKGIAIGNAWIDDNHGEMGIFEYLWTHALNSDETYEGINKY  293

Query  1010  CVV---NFSIKCEHFERAAGIEIGSIDFYNIYGPLC-LDSESSRKVKRRL------GFDP  1159
             C     NFS KC  +   A  E+G +D YNIY PLC L S SS  +   +      GFDP
Sbjct  294   CDFVSGNFSSKCTKYLNQASDELGDVDIYNIYAPLCNLSSSSSDTIYISVGSAVVNGFDP  353

Query  1160  CAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQK  1339
             C++ YVY+YLNL +VQ ALH      P  W  CS V   W D   T+ P  + L+ SG  
Sbjct  354   CSDYYVYAYLNLKEVQAALHVK----PTNWSACSGVG--WTDSPPTILPTIKHLLESGIT  407

Query  1340  ILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRG  1516
             + ++SGD D  VPVTS+RYS+  + L +  PW PW  D K+VGGY   Y+ GL FATVRG
Sbjct  408   VWIYSGDTDGRVPVTSSRYSLHNLSLPIQAPWRPWYSD-KEVGGYVTGYKGGLAFATVRG  466

Query  1517  AGHEVPQFTPRRALTLLNMFL  1579
             AGHEVP + P+RALT+++ FL
Sbjct  467   AGHEVPSYQPKRALTMISSFL  487



>ref|XP_004292824.1| PREDICTED: serine carboxypeptidase II-3-like [Fragaria vesca 
subsp. vesca]
Length=492

 Score =   448 bits (1152),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 252/492 (51%), Positives = 307/492 (62%), Gaps = 32/492 (7%)
 Frame = +2

Query  134   LMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQ----LHGGITDEAWSe  301
             L    + + FLL   A         N+ID   R++  RR K  +    L   ++D    E
Sbjct  10    LFFCSYQLTFLLPCNA---------NQIDNLNRLIKTRRFKTNRSPHSLSFAVSDVEDHE  60

Query  302   meeeemVFDDVGSMEDDLINGGLPGQPS---NVKFKQYAGYVNVDKTNGRSLFYYFAESA  472
                   V    G  E D I+  LPGQP      +F QYAGYV VD   GR+LFYYF ES 
Sbjct  61    FSSPVCVAPQDGLKEADKIDT-LPGQPKLNPGEEFNQYAGYVRVDHVAGRALFYYFVESP  119

Query  473   QTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESP  652
             Q   TKPL+LWLNGGPGCSS G GA  ELGPF VN DGKTL+    AWN VAN LFLESP
Sbjct  120   QNSSTKPLVLWLNGGPGCSSFGYGAMEELGPFRVNSDGKTLFRNDHAWNNVANVLFLESP  179

Query  653   AGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPEL  832
             AGVGFSYSN  SDY+  GD+RTA+D+YKFLVNW +RFP Y+ RDF+I GESYAG Y P+L
Sbjct  180   AGVGFSYSNNKSDYENVGDKRTAEDSYKFLVNWLERFPEYRDRDFFITGESYAGHYAPQL  239

Query  833   ADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC  1012
             A  I+ +N   + T KI LKGI IGN  ++++    G YDYLW+H L SDETH G+ ++C
Sbjct  240   ARTILSKNNSTKKT-KINLKGIAIGNPWIDENDGTLGEYDYLWTHDLNSDETHAGIHKNC  298

Query  1013  VV---NFSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYS  1183
                  N S  C  +   +  EIG ID YNIY P C D  S  KV     FDPC++ YV +
Sbjct  299   DFASGNKSETCIIYMNKSEDEIGDIDPYNIYAPKC-DMSSGTKVN---SFDPCSDKYVEA  354

Query  1184  YLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDV  1363
             YLNL +V+ ALHA     P  W  CS+V   W D   T+ P  +RLIASG ++ ++SGD 
Sbjct  355   YLNLAEVRAALHAK----PTNWTFCSDV--GWIDAPITILPGIKRLIASGIRLWMYSGDT  408

Query  1364  DSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFT  1543
             D+ VP TSTRYS+  +KL + KPW PW  D  +VGGY + Y GLTFATVRGAGH VP + 
Sbjct  409   DANVPGTSTRYSIKRLKLPIKKPWRPWNSD-GEVGGYVIGYRGLTFATVRGAGHLVPSYQ  467

Query  1544  PRRALTLLNMFL  1579
             PRRALTL++ FL
Sbjct  468   PRRALTLISSFL  479



>ref|XP_003542323.2| PREDICTED: serine carboxypeptidase-like 40-like isoform X1 [Glycine 
max]
 ref|XP_006593895.1| PREDICTED: serine carboxypeptidase-like 40-like isoform X2 [Glycine 
max]
Length=488

 Score =   447 bits (1151),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 225/409 (55%), Positives = 282/409 (69%), Gaps = 13/409 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+G+V VD   GRSLFYYF ES      KPL+LWLNGGPGCSSLG GA
Sbjct  77    LPGQPHGVNFDQYSGHVTVDPKTGRSLFYYFVESPHNSSAKPLVLWLNGGPGCSSLGYGA  136

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTL+  ++AWN+VAN LFLESPAGVGFSYSNT+SDYD SGD+ TAKD
Sbjct  137   FEELGPFRVNSDGKTLFHNKYAWNEVANVLFLESPAGVGFSYSNTTSDYDRSGDKSTAKD  196

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+NW +RFP YKTR+FYI GESYAG Y+P+LA  I+  N   + ++   LKGI IG
Sbjct  197   AYVFLINWLERFPEYKTREFYITGESYAGHYVPQLAYTILVNNKFSQQSIN--LKGIAIG  254

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHFERAAGIEIGSI  1078
             N +++D T ++G +DY W+HAL SD+TH  + ++C     N S  C +   ++ +E GSI
Sbjct  255   NALIDDVTTIKGIFDYFWTHALNSDQTHHLIKKYCDFTSENISAACINATISSILEKGSI  314

Query  1079  DFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             D  NIY PLC DS   +        FDPC+  YV +YLN P+VQKALHA     P  W  
Sbjct  315   DSSNIYAPLCYDSSLKNGSTGSVYDFDPCSAYYVEAYLNRPEVQKALHAK----PTNWTH  370

Query  1256  CSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             CS     WKD  +T+ PI   LIAS  K+ ++SGD D+ VPVTS+RYS++ ++L +   W
Sbjct  371   CSGFD--WKDSPTTILPIIEYLIASHIKLWIYSGDTDATVPVTSSRYSINTLRLPIQVDW  428

Query  1436  HPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             HPW     +VGGY V Y+ +TF TVRGAGH VP + P R+LT+++ FLS
Sbjct  429   HPWYSG-NEVGGYVVGYKAVTFVTVRGAGHFVPSWQPARSLTMISSFLS  476



>ref|XP_006346529.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum tuberosum]
Length=463

 Score =   446 bits (1148),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 230/466 (49%), Positives = 308/466 (66%), Gaps = 24/466 (5%)
 Frame = +2

Query  212   KIDQARRIMWLRRAKMQQL--HGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPS  385
             ++D  R  +  RR K   +  HG    E   +    E     VGS E+D I+  LPGQPS
Sbjct  5     EVDVLREFLKARRVKTTNVIRHGVAVAE--KQKSVSEFKVPQVGSKENDKISA-LPGQPS  61

Query  386   NVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGP  565
              + F QY+GYV V+  NGR+LFYY AES+  P TKPL+LWLNGGPGCSS G G  +ELGP
Sbjct  62    GINFAQYSGYVTVNADNGRALFYYLAESSADPTTKPLVLWLNGGPGCSSFGNGGMVELGP  121

Query  566   FGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLV  745
             F VN DGKTL+  +FAWN VAN LFLESPAGVGFSYSNTSSDY  SGD +T +D++ FLV
Sbjct  122   FRVNKDGKTLWLNQFAWNNVANILFLESPAGVGFSYSNTSSDY-TSGDEKTRRDSFTFLV  180

Query  746   NWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMND  925
             NW +RFP YK RDFYI+GESYAG Y+P+LA +I+      E  L I L+GI  GN +++D
Sbjct  181   NWMERFPEYKNRDFYIVGESYAGHYVPQLAQLILSHKKS-EPNLVINLQGIATGNALLDD  239

Query  926   DTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK------CEHFERAAGIEIGSIDFY  1087
             +T   G YD+ WSHALISDE H+G++++C  NFS +      C+ +   A     +I  Y
Sbjct  240   ETSNSGSYDFYWSHALISDEVHEGIVKNC--NFSTETTTSEACDEYTSEADSCQANIYSY  297

Query  1088  NIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSE  1264
             N Y  LC  S  +S  +    GFDPC+ DYV++YLN  +VQKAL+  +  +P +WE CS 
Sbjct  298   NTYSQLCYSSAYTSLPID---GFDPCSADYVFNYLNTAEVQKALNVRD--IPQSWESCSG  352

Query  1265  VITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPW  1444
             +   W+D   T+ PI++ L+ SG ++ ++SGD+D ++PVT++RY ++ +K  +   W+PW
Sbjct  353   IS--WEDSPHTVLPIFQELMQSGIRVWIYSGDIDHILPVTTSRYGINKIKTPIKTAWYPW  410

Query  1445  EDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
                  +VGGY V Y+ LTF TVRGAGH VP + P RALT+ + F++
Sbjct  411   FFQ-GEVGGYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFSSFIN  455



>ref|XP_006434836.1| hypothetical protein CICLE_v10000968mg [Citrus clementina]
 gb|ESR48076.1| hypothetical protein CICLE_v10000968mg [Citrus clementina]
Length=485

 Score =   447 bits (1150),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 232/471 (49%), Positives = 301/471 (64%), Gaps = 26/471 (6%)
 Frame = +2

Query  206   VNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDV------GSMEDDLINGG  367
              N+ID   R++  ++++  Q       E W++  +   V   V      G ME D I   
Sbjct  26    ANQIDNLNRLINSKKSRNPQ-----RTEPWTDQSKVRNVMSPVDIGPQEGMMEADKIKT-  79

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QYAGY+ VD   GR+LFYYF ES Q+  +KPL+LWLNGGPGCSSLG GA
Sbjct  80    LPGQPEGVDFDQYAGYLTVDPKAGRALFYYFVESPQSSSSKPLVLWLNGGPGCSSLGYGA  139

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DGKTLY   +AWN VAN LFLE+PAGVGFSYSNTSSDY   GD  TA+D
Sbjct  140   MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNLGDNNTAED  199

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FLVNWF+RFP YK RDF+I GESYAG Y+P+LA  I+ +NT   +   I LKGI IG
Sbjct  200   SYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNT---SKTIINLKGIAIG  256

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHFERAAGIEIGSI  1078
             N  ++D+   +G +D+ W+HAL SDET+  + ++C       S  C+ ++     E G I
Sbjct  257   NAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQI  316

Query  1079  DFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             D YN+Y PLC  S         +  +DPC++ YV SYLNL +VQ ALHA +T     W  
Sbjct  317   DLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTN----WTT  372

Query  1256  CSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             C ++   W D  ST+ P  ++LIASG ++ ++SGD D  VPVTS+RYS++A+ L V   W
Sbjct  373   CGDL--RWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAW  430

Query  1436  HPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLSTN  1588
             +PW  D  +VGGY + Y+G+ F TVRGAGH VP   P+RAL +++ FL  N
Sbjct  431   YPWYTD-GEVGGYVLGYKGVVFTTVRGAGHMVPTNQPQRALIMISSFLEGN  480



>ref|XP_010315498.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum lycopersicum]
Length=506

 Score =   447 bits (1151),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 233/507 (46%), Positives = 322/507 (64%), Gaps = 36/507 (7%)
 Frame = +2

Query  137   MSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeee  316
             +S+   ++ +L  ++    +     ++D  R  +  RR K   +       A  +    E
Sbjct  3     ISSVLSVILILCYLSARQCYA---GEVDVLREFLKARRTKTTNVISQGVAVAEKQRSVSE  59

Query  317   mVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
              +   VGS E+D I+  LPGQPS + F QY+GYV V+  +GR+LFYY AES+  P TKPL
Sbjct  60    FIVPQVGSKENDKISA-LPGQPSGINFAQYSGYVTVNADSGRALFYYLAESSNDPATKPL  118

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSS G G  +ELGPF VN DGKTL+  +FAWN VAN LFLESPAGVGFSYS
Sbjct  119   VLWLNGGPGCSSFGNGGMVELGPFRVNKDGKTLWLNQFAWNNVANVLFLESPAGVGFSYS  178

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NTSSDY  SGD +T +D++ FLVNW +RFP YK RDFYI+GESYAG Y+P+LA +I+   
Sbjct  179   NTSSDY-TSGDEKTKRDSFTFLVNWMERFPEYKNRDFYIVGESYAGHYVPQLAQLILSHK  237

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK-  1033
                E  L I L+GI  GN +++D+T   G YD+ WSHALISDE H+G+I++C  NFS + 
Sbjct  238   K-SEPNLVINLQGIATGNALLDDETSNSGSYDFYWSHALISDEVHEGIIKNC--NFSTET  294

Query  1034  -----CEHFERAAGIEIGSIDFYNIYGPLCLDSE-SSRKVKRRL-GFDPCAEDYVYSYLN  1192
                  C+ F   A     ++  YN Y  LC  S  +S  V  ++ GFDPC+ DYV++YLN
Sbjct  295   TISEACDEFTSEADSCQANLYDYNTYSQLCNSSAYTSLPVSSQIDGFDPCSADYVFNYLN  354

Query  1193  LPKVQKALHANNTKLPYTWEVCS------EVITY-----------WKDRASTMFPIYRRL  1321
               +VQKAL+  +  +P +WE C        +IT+           W+D   T+ PI++ L
Sbjct  355   TAEVQKALNVRD--IPQSWESCRLIPLAINLITFLNILNLSSGISWEDSPHTVLPIFQEL  412

Query  1322  IASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTF  1501
             + SG ++ ++SGD+D ++PVT++RY++D +K  +   W+PW     +VGGY V Y+ LTF
Sbjct  413   MQSGIRVWIYSGDIDHILPVTTSRYAIDKIKTPIKTAWYPWFFQ-GEVGGYAVEYQNLTF  471

Query  1502  ATVRGAGHEVPQFTPRRALTLLNMFLS  1582
              TVRGAGH VP + P RALT+ + F++
Sbjct  472   VTVRGAGHFVPSYQPGRALTMFSSFIN  498



>gb|KHN05141.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=490

 Score =   447 bits (1149),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 231/422 (55%), Positives = 287/422 (68%), Gaps = 18/422 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  + D I   LPGQP  V F QY+GYV VD   GR+LFYYF ES   P TKPL+LWLNG
Sbjct  67    GQKQADKI-AALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNG  125

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GAF ELGPF +N DGKTLY  ++AWN+VAN LFLESPAGVGFSYSNT+SDY
Sbjct  126   GPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDY  185

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D SGD+ TAKDAY FL+NW +RFP YKTR+FYI GESYAG Y+P+LA  I+  N   +  
Sbjct  186   DHSGDKPTAKDAYVFLINWLERFPEYKTRNFYITGESYAGHYVPQLAYTILVNNKFSQQN  245

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHF  1045
             +   LKGI + N  ++D T  +G  DYLW+HAL SD+TH+ + ++C     N S  C + 
Sbjct  246   IN--LKGIAVWNAWIDDVTGTKGIVDYLWTHALNSDQTHELIEKYCDYSSENISQICSNA  303

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG----FDPCAEDYVYSYLNLPKVQKA  1213
              R A  E G+IDFYNIY PLC D  SS K +   G    FDPC++ Y  +YLN P+VQ A
Sbjct  304   TRRALTEKGNIDFYNIYAPLCHD--SSLKNESSSGSVYDFDPCSDYYGEAYLNRPEVQLA  361

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             LHA     P  W  CS++I  W D  +T+ P+ + L  S   + ++SGD D+ VPVTS+R
Sbjct  362   LHAK----PTNWSHCSDLID-WNDSPTTILPVIKYLTDSNIVLWIYSGDTDARVPVTSSR  416

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNM  1573
             Y+++ +KL +  PW PW     +VGGY V Y+G+TF TVRGAGH VP + P RALTL+  
Sbjct  417   YAINTLKLPIQVPWRPWYSG-NEVGGYVVKYKGVTFVTVRGAGHLVPSWQPARALTLIFS  475

Query  1574  FL  1579
             FL
Sbjct  476   FL  477



>ref|XP_006658912.1| PREDICTED: serine carboxypeptidase II-3-like [Oryza brachyantha]
Length=466

 Score =   445 bits (1145),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 231/429 (54%), Positives = 289/429 (67%), Gaps = 27/429 (6%)
 Frame = +2

Query  362   GGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHT---KPLILWLNGGPGCSS  532
              GLPGQPS V F QYAGYV V+ T GR+LFYY AE+  +      KPL+LWLNGGPGCSS
Sbjct  30    AGLPGQPSGVDFAQYAGYVTVNATAGRALFYYLAEANGSAAAASSKPLLLWLNGGPGCSS  89

Query  533   LGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDR  712
             LG GA  ELGPF V  DGK LY   ++WN VAN LFLESP GVGFSYSNT++DY + GD 
Sbjct  90    LGYGAMEELGPFRVMSDGKKLYRNPYSWNNVANVLFLESPVGVGFSYSNTTADYSLMGDT  149

Query  713   RTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPET----TLK  880
              TA+DAY+FLVNW +RFP YK RDFY+ GESYAG Y+P+LA  I++ ++   T    +  
Sbjct  150   STAEDAYRFLVNWMERFPEYKGRDFYLAGESYAGHYVPQLAHAILRHSSAAGTGKPSSSP  209

Query  881   IPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFS------IKCEH  1042
             I LKGIMIGN ++ND TD +G YD+ W+HALISDE +DG+ +HC  NFS        C++
Sbjct  210   INLKGIMIGNAVINDWTDTKGMYDFFWTHALISDEANDGIAKHC--NFSDAAPDNALCDN  267

Query  1043  FERAAGIEIGSIDFYNIYGPLC-----LDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQ  1207
                 AG  + +ID YNIY P C     +    +  V R   FDPC + YV +YLN P VQ
Sbjct  268   ATTLAGEALQNIDIYNIYAPNCQSAGLVSPPVAPSVDR---FDPCTDYYVDAYLNNPDVQ  324

Query  1208  KALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTS  1387
             KALHAN TKL + W  CS+V+  W D AST+ PI R L+ +  ++ ++SGD D  VPVTS
Sbjct  325   KALHANVTKLDHPWSACSDVLRSWVDSASTVLPIIRELLKNNIRVWVYSGDTDGRVPVTS  384

Query  1388  TRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRA  1555
             +RYSV+ + L V   W PW  +T+    VGGY V Y+G L+  TVRGAGHEVP + P+RA
Sbjct  385   SRYSVNQLNLAVTDKWRPWFSNTEGAGDVGGYVVQYKGNLSLVTVRGAGHEVPSYQPQRA  444

Query  1556  LTLLNMFLS  1582
             L L+  FL+
Sbjct  445   LVLVQNFLA  453



>ref|XP_010932885.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Elaeis 
guineensis]
Length=450

 Score =   444 bits (1142),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/419 (53%), Positives = 287/419 (68%), Gaps = 13/419 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I+  LPGQP  V F QYAGYV V+  +GR+LFYYF ES + P  KPL+LWLNG
Sbjct  34    GLKELDKIDA-LPGQPKGVNFDQYAGYVMVEPQHGRTLFYYFVESPRDPERKPLLLWLNG  92

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GA  ELGPF V  DGKTL+  + AWN VAN +FLESPAGVGFSY+ TSSDY
Sbjct  93    GPGCSSLGGGAMQELGPFRVQSDGKTLHRNKHAWNNVANVVFLESPAGVGFSYTKTSSDY  152

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             +  GD+RTA+D Y FLVNW +RFP YKTRDF++ GESYAG Y+P+LA +IV  N  P   
Sbjct  153   ENRGDKRTAEDTYTFLVNWLERFPEYKTRDFFVTGESYAGHYVPQLASLIVLNNKKPNKP  212

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFE  1048
               I L+GI IGN  ++ +T + G Y++LW HA+ SD T+  +   C ++  +S +CE+  
Sbjct  213   -TINLRGIAIGNAYIDTNTTLMGMYEFLWMHAMYSDRTYRLIRRKCKISDMYSSECENAT  271

Query  1049  RAAGIEIGSIDFYNIYGPLCLDS--ESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
               A  EIGSID +N+Y PLC     + +      + FDPCA +YVY+YLNLP+VQK+LHA
Sbjct  272   NLADFEIGSIDRFNVYVPLCTKKLHQPTSVTSSNVEFDPCAGNYVYAYLNLPEVQKSLHA  331

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
                 +P+ W  CS     W+D   TM P+ ++L  SG ++ L+SGD+DSVV VTST+Y +
Sbjct  332   ----IPFLWTYCSR--GGWRDSPYTMLPMIKQLATSGIRMWLYSGDMDSVVSVTSTKYFL  385

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
               + L +  PW PW+ ++ +V GY V Y GLTF TVRGAGHEVP + P R+L +++ FL
Sbjct  386   RMLGLPIKSPWRPWQANS-EVAGYVVAYNGLTFVTVRGAGHEVPSYQPERSLIMISAFL  443



>ref|XP_010067792.1| PREDICTED: serine carboxypeptidase-like 40 [Eucalyptus grandis]
 gb|KCW65996.1| hypothetical protein EUGRSUZ_G03286 [Eucalyptus grandis]
Length=496

 Score =   446 bits (1147),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 227/429 (53%), Positives = 287/429 (67%), Gaps = 12/429 (3%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
             ++   G  E D I   LPGQPS VKF  Y GYV V+++ GR+ +YYFAE  +   + PL+
Sbjct  65    IYSQEGLREKDRIKR-LPGQPS-VKFDHYGGYVTVNESAGRAFYYYFAEGVRNKESMPLL  122

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSSLG GA  ELGPF V+ DGKTLY  +FAWN  AN LFLESPAGVGFSYSN
Sbjct  123   LWLNGGPGCSSLGYGAMQELGPFRVHSDGKTLYKNKFAWNNAANVLFLESPAGVGFSYSN  182

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
             T++DY  SGD  TA D Y FL+NW +RFP YK RDFYI GESYAG Y+P+LA  I+  N 
Sbjct  183   TTADYSSSGDSETAADNYVFLLNWLERFPEYKDRDFYISGESYAGHYVPQLAHNILSNNK  242

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNF  1024
                 TL I LKGI+IGN ++ND+TD RG Y+Y  +HALISDET   + ++C       + 
Sbjct  243   RANKTL-INLKGIIIGNAVINDETDQRGMYEYFATHALISDETGFAIQKYCDFSPNATSQ  301

Query  1025  SIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLP  1198
               +C    + A  ++ ++D YNIY PLC  S  +   K+   +  DPC + YV +Y+N  
Sbjct  302   VSQCLSAAQDASNDVSALDIYNIYAPLCFSSNLTSHPKKTNIMDLDPCGDIYVQAYMNRE  361

Query  1199  KVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVP  1378
              VQ+ALHAN TKL + WE CS VI  W D  ST+ P+ R  ++SG ++ + SGD D  VP
Sbjct  362   DVQEALHANVTKLDHDWEGCSSVIQAWVDSPSTVLPLLREFMSSGLRVWVISGDTDGRVP  421

Query  1379  VTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRA  1555
             VTSTR S+  MKL    PW PW     +VGGY  VY+G LTFATVRGAGH+VP + P+RA
Sbjct  422   VTSTRRSLSKMKLPTKSPWRPWFLG-GEVGGYVQVYKGDLTFATVRGAGHQVPSYQPKRA  480

Query  1556  LTLLNMFLS  1582
             L+L++ FL+
Sbjct  481   LSLISHFLA  489



>ref|XP_009592794.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=499

 Score =   446 bits (1146),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 222/423 (52%), Positives = 290/423 (69%), Gaps = 10/423 (2%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLN  511
             V   E+D I   LPGQP  V+F+QY GYV VD++ GR+ +YYF E+ ++  + PL+LWLN
Sbjct  72    VSQKENDKIQK-LPGQP-RVRFEQYGGYVTVDESAGRAFYYYFVEAQRSKDSLPLLLWLN  129

Query  512   GGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSD  691
             GGPGCSSL  GAF ELGPF VN DGKTL+  +FAWN  AN LFLESPAGVGFSYSNTSSD
Sbjct  130   GGPGCSSLAYGAFQELGPFRVNSDGKTLHKNKFAWNHAANVLFLESPAGVGFSYSNTSSD  189

Query  692   YDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPET  871
               + GDR+TAKD Y+FLVNW +RFP YK +DFYI GESYAG Y+P+LA  I+  N     
Sbjct  190   VKIGGDRKTAKDNYQFLVNWLERFPEYKDKDFYISGESYAGHYVPQLAHTILYHNKKANK  249

Query  872   TLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI---KCEH  1042
             T+ + LKGI+IGN ++ND+TD RG Y+Y  SHALISDE    + + C    S    +C+ 
Sbjct  250   TM-VNLKGILIGNAVINDETDTRGMYEYFASHALISDELEAQIQKQCKFTESSESDECKL  308

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR-RLGFDPCAEDYVYSYLNLPKVQKALH  1219
                 A      ID YNIY PLC ++  + K K+  L  DPC++ Y  +Y+N P VQ +LH
Sbjct  309   ARSKAEYNTDPIDIYNIYAPLCHNTNLTAKPKKPSLVIDPCSDYYTIAYMNRPDVQNSLH  368

Query  1220  ANNTKLPYT-WEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRY  1396
             AN T + Y+ W+ CS+V+T W D +ST+ P+ R  + +G ++ +FSGD D  VPVTST+ 
Sbjct  369   ANVTNIKYSNWQPCSDVLTNWTDSSSTIIPLLREFMTNGLRVWIFSGDTDGRVPVTSTKN  428

Query  1397  SVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNM  1573
             S+  MKL +   WHPW   + +VGGY  VY+G +TFATVRGAGH+VP +   R+L+L+  
Sbjct  429   SIKIMKLPIKTAWHPWY-LSAEVGGYTQVYKGDMTFATVRGAGHQVPSYEAARSLSLVMH  487

Query  1574  FLS  1582
             FL+
Sbjct  488   FLA  490



>ref|XP_003544446.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Glycine 
max]
Length=495

 Score =   446 bits (1146),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 228/428 (53%), Positives = 285/428 (67%), Gaps = 17/428 (4%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSN-VKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
             V +  G ME D +   LPGQPS  V F QYAGYV VD   GR+LFYYF ES      +PL
Sbjct  67    VKEQSGLMEGDKVKA-LPGQPSQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNRPL  125

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSS G GA  ELGPF VN DGKTLY  ++AWN VAN +FLESPAGVGFSYS
Sbjct  126   VLWLNGGPGCSSFGYGAMQELGPFRVNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYS  185

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NTSSDY  +GD+ TA D+Y FL+NW +RFP YKTRD +I GESYAG Y+P+LAD I+  N
Sbjct  186   NTSSDYTKTGDKSTAMDSYTFLLNWLERFPQYKTRDLFITGESYAGHYVPQLADTILTYN  245

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFS  1027
              +   T+ I LKGI +GNG ++D+   +G Y+Y W+HAL SDETH+G+  +C     N +
Sbjct  246   KLTNHTV-INLKGIAVGNGWIDDNMCGKGMYEYFWTHALNSDETHEGIQRYCDFESGNLT  304

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSE----SSRKVKRRLGFDPCAEDYVYSYLNL  1195
              +C  ++     EIGSID Y+IY P C  +     SS        FDPC++DY  SYLNL
Sbjct  305   GECSKYQSRGDTEIGSIDIYDIYAPPCDSAAKKPGSSPATNYDSNFDPCSDDYTNSYLNL  364

Query  1196  PKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVV  1375
              +VQ+ALHA  +     W  C  V   W D  +T+ P   RLI+SG    ++SGD D  V
Sbjct  365   AEVQEALHAKAS----VWYPCRGVG--WTDSPATILPTINRLISSGINTWIYSGDTDGRV  418

Query  1376  PVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRA  1555
             P+TS+RYSV+A+KL V   W PW   + +VGGY V Y+GLT  TVRGAGH VP + P+RA
Sbjct  419   PITSSRYSVNALKLPVETTWRPWY-SSNEVGGYLVGYKGLTLITVRGAGHMVPSYQPQRA  477

Query  1556  LTLLNMFL  1579
             LT+++ FL
Sbjct  478   LTMISFFL  485



>ref|XP_010932884.1| PREDICTED: putative serine carboxypeptidase-like 23 isoform X1 
[Elaeis guineensis]
Length=483

 Score =   444 bits (1143),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/419 (53%), Positives = 287/419 (68%), Gaps = 13/419 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I+  LPGQP  V F QYAGYV V+  +GR+LFYYF ES + P  KPL+LWLNG
Sbjct  67    GLKELDKIDA-LPGQPKGVNFDQYAGYVMVEPQHGRTLFYYFVESPRDPERKPLLLWLNG  125

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GA  ELGPF V  DGKTL+  + AWN VAN +FLESPAGVGFSY+ TSSDY
Sbjct  126   GPGCSSLGGGAMQELGPFRVQSDGKTLHRNKHAWNNVANVVFLESPAGVGFSYTKTSSDY  185

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             +  GD+RTA+D Y FLVNW +RFP YKTRDF++ GESYAG Y+P+LA +IV  N  P   
Sbjct  186   ENRGDKRTAEDTYTFLVNWLERFPEYKTRDFFVTGESYAGHYVPQLASLIVLNNKKPNKP  245

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFE  1048
               I L+GI IGN  ++ +T + G Y++LW HA+ SD T+  +   C ++  +S +CE+  
Sbjct  246   -TINLRGIAIGNAYIDTNTTLMGMYEFLWMHAMYSDRTYRLIRRKCKISDMYSSECENAT  304

Query  1049  RAAGIEIGSIDFYNIYGPLCLDS--ESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
               A  EIGSID +N+Y PLC     + +      + FDPCA +YVY+YLNLP+VQK+LHA
Sbjct  305   NLADFEIGSIDRFNVYVPLCTKKLHQPTSVTSSNVEFDPCAGNYVYAYLNLPEVQKSLHA  364

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
                 +P+ W  CS     W+D   TM P+ ++L  SG ++ L+SGD+DSVV VTST+Y +
Sbjct  365   ----IPFLWTYCSR--GGWRDSPYTMLPMIKQLATSGIRMWLYSGDMDSVVSVTSTKYFL  418

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
               + L +  PW PW+ ++ +V GY V Y GLTF TVRGAGHEVP + P R+L +++ FL
Sbjct  419   RMLGLPIKSPWRPWQANS-EVAGYVVAYNGLTFVTVRGAGHEVPSYQPERSLIMISAFL  476



>ref|XP_006446687.1| hypothetical protein CICLE_v10015024mg [Citrus clementina]
 gb|ESR59927.1| hypothetical protein CICLE_v10015024mg [Citrus clementina]
Length=493

 Score =   445 bits (1144),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 276/409 (67%), Gaps = 12/409 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QYAGYV VD   GRSLFYYFAES Q   T PL+LWLNGGPGCSSLG GA
Sbjct  83    LPGQPDGVDFDQYAGYVTVDPKTGRSLFYYFAESPQNSSTNPLLLWLNGGPGCSSLGYGA  142

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DGKTL+   +AWN VAN +FLESPAGVGFSYS+T SDY+++GD+ TA+D
Sbjct  143   MSELGPFRVNKDGKTLFRNNYAWNNVANVVFLESPAGVGFSYSSTKSDYELNGDKLTAQD  202

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FLVNW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N   + T+ I LKGI IG
Sbjct  203   SYTFLVNWLERFPQYKTRDFYIAGESYAGHYVPQLAYTILLNNKNTKNTV-INLKGIAIG  261

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEIGS  1075
             N +++  T   G Y+ LW+HAL SD TH G+  +C      N + +CE F   A  EIG 
Sbjct  262   NALIDGPTRSMGVYENLWTHALNSDHTHKGIFTYCDFAREGNDTKECETFLEKASDEIGD  321

Query  1076  IDFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
             ID YNIY P+C++    +  +     +DPC + YV +YLN  +VQ  LH      P  W 
Sbjct  322   IDIYNIYAPICINPAFQNGSIGSVYNYDPCTDYYVEAYLNAREVQTVLHVK----PTNWT  377

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
              CS +   W D  ST+ P  + LIASG ++ ++SGDVD +VP T++RYS++A+ L V  P
Sbjct  378   ACSNLFN-WTDSPSTVLPTIKNLIASGIRVWIYSGDVDGIVPTTASRYSINALNLPVEIP  436

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             W+PW  +  +VGGY   Y+GLT  TVRGAGH VP   P RALTL++ FL
Sbjct  437   WYPWYTN-DEVGGYVEAYQGLTLVTVRGAGHLVPSDQPERALTLISSFL  484



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   443 bits (1140),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 295/417 (71%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQPSN+ F+QY+GY+ V++ +GR+LFY+  ES  T  P ++PL+LWLNGGPGCSS+  
Sbjct  39    LPGQPSNIDFRQYSGYITVNQEHGRALFYWLVESPLTRVPKSRPLVLWLNGGPGCSSVAY  98

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V  DGKTLYS+ +AWNK+AN LFLESPAGVGFSY+NT+SD  ++GD+RTA
Sbjct  99    GAAEEIGPFRVGSDGKTLYSKLYAWNKLANLLFLESPAGVGFSYTNTTSDLYITGDQRTA  158

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y+FLVNWF+RFP YK RDFYI+GESYAG ++P+L+ ++ +RN   +    I LKG M
Sbjct  159   EDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSKLVHERNKGFKNP-AINLKGFM  217

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN +++D  D  G ++Y W+H LISD T+  L   C      + S++C    R A +E 
Sbjct  218   VGNAVIDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSVSSQHPSMQCMEALRNAELEQ  277

Query  1070  GSIDFYNIYGPLCLDS-ESSRKVKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++ +  R +K R       +DPC E Y   Y N  +VQKALHAN T
Sbjct  278   GNIDPYSIFTKPCNNTVQLKRFLKGRYPWMSRAYDPCTERYSNVYFNRVEVQKALHANVT  337

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +LPY W+ CS+++ +YW D   +M PIYR LI +G KI +FSGD D+VVPVT+TRYS+DA
Sbjct  338   RLPYPWKSCSDIVGSYWTDSPVSMLPIYRELITAGLKIWVFSGDTDAVVPVTATRYSIDA  397

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL+ I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  L   FL
Sbjct  398   LKLETITNWYPWYDHGK-VGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFL  453



>ref|XP_011088288.1| PREDICTED: serine carboxypeptidase II-3-like [Sesamum indicum]
Length=483

 Score =   444 bits (1141),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 309/471 (66%), Gaps = 24/471 (5%)
 Frame = +2

Query  191   GFGHGVNKIDQARRIMWLRRAKMQQLH-GGITDEAWSemeeeemVFDDVGSMEDDLINGG  367
             G+ HG +  +  R+++   RA++ +     +TDE  S       +    G  E D I+  
Sbjct  20    GYYHGGSGFEPLRKLI---RARLSRRSVNSVTDEGASTEHSPVYLAPQEGLKEVDKIST-  75

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQPS V F QYAGYV VD   GR+LFYYF ES ++  T+PL+LWLNGGPGCSSL  GA
Sbjct  76    LPGQPS-VNFDQYAGYVTVDPAAGRALFYYFTES-ESSSTRPLVLWLNGGPGCSSLAGGA  133

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF VNPDGKTL+   +AWN +AN LFLESPAGVGFSYSNTS +Y   GD++TA D
Sbjct  134   MMELGPFRVNPDGKTLWHNEYAWNNLANVLFLESPAGVGFSYSNTSVEY---GDKQTAAD  190

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL+NWF+RFP YKTRDFYI GESYAG Y+P+LA  I+K N +   T+ I LKGI IG
Sbjct  191   SYTFLLNWFERFPEYKTRDFYIAGESYAGHYVPQLASFILKNNKITNHTV-INLKGIAIG  249

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF------SIKCEHFERAAGIEI  1069
             N  ++ + ++ G YDY W+HALISDE H  ++ +C  NF      S  C      A   +
Sbjct  250   NAEIDFEDELSGMYDYYWTHALISDEHHKAILSNC--NFSSSASVSAVCNSVLDQADAAL  307

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTW  1249
             G++ +Y+IY PLC  S +S  V    GFDPC+ +YV++YLN P VQKALHAN T +   W
Sbjct  308   GTVYYYDIYAPLCNASSNSPLVS---GFDPCSSNYVFTYLNRPDVQKALHANVTGITGPW  364

Query  1250  EVCSE-VITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVI  1426
             + C+  V   W DR  T+ P  + L+A G ++ ++SGD D  VPVTSTRYS++ +   V 
Sbjct  365   DACNNTVFLNWNDRPDTILPTIKELMAGGIRVWIYSGDTDKRVPVTSTRYSLEKLGTPVK  424

Query  1427  KPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PW PW +   +VGGY V Y+ +TF ++RGAGH VP + P+RAL + + FL
Sbjct  425   TPWFPWYNQ-GEVGGYAVEYQNVTFVSIRGAGHFVPSYQPQRALVVFSSFL  474



>ref|XP_006346531.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum tuberosum]
Length=464

 Score =   442 bits (1138),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 305/464 (66%), Gaps = 17/464 (4%)
 Frame = +2

Query  212   KIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPSNV  391
             ++D  R  +  RR K + +       A  +    E +   VGS E+D I   LPGQPS +
Sbjct  3     EVDVLREFLKARRTKTKNVISQGLAVAEKQRSVSEFIVPQVGSKENDKI-LALPGQPSGI  61

Query  392   KFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFG  571
              F QY+GYV V+   GR+LFYY AES+  P TKPL+LWLNGGPGCSS G G  +ELGPF 
Sbjct  62    NFAQYSGYVTVNADAGRALFYYLAESSNDPSTKPLVLWLNGGPGCSSFGNGGMVELGPFR  121

Query  572   VNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNW  751
             VN DGKTL+  +FAWN VAN LFLESPAGVGFSYSNTSSDY  +GD +T +D++ FLVNW
Sbjct  122   VNKDGKTLWLNQFAWNNVANVLFLESPAGVGFSYSNTSSDY-TTGDEKTRRDSFTFLVNW  180

Query  752   FKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDT  931
              +RFP YK RDFYI+GESYAG Y+P+LA +I+      E  L I L+GI  GN +++D+T
Sbjct  181   MERFPEYKNRDFYIVGESYAGHYVPQLAQLILSHKKT-EPNLVINLQGIAAGNALLDDET  239

Query  932   DVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK------CEHFERAAGIEIGSIDFYNI  1093
                G YD+ W+HALISDE H+G++++C  NFS +      C+ +   A     +I  YN 
Sbjct  240   WNSGSYDFYWTHALISDEVHEGIVKNC--NFSTETSTSEACDEYTSEADSCQANIYNYNT  297

Query  1094  YGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVI-  1270
             Y  LC  + S+       GFDPC+ DYV +YLN  +VQKAL+  +  +P++WE CS  I 
Sbjct  298   YSQLC--NSSAYTSLPIDGFDPCSPDYVDNYLNTAEVQKALNVRD--IPHSWESCSGYIH  353

Query  1271  TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWED  1450
               W+D   T+ PIY+ L+ SG ++ ++SGD+D ++PVT++RY +D +K  V   W+PW  
Sbjct  354   GLWQDSPDTVLPIYKELMQSGIRVWIYSGDIDHILPVTTSRYGIDKIKTPVKTAWYPWFF  413

Query  1451  DTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
                +VGGY V Y+ LTF TVRGAGH VP + P RALT+ + F++
Sbjct  414   Q-GEVGGYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFSSFIN  456



>emb|CDP16362.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   443 bits (1140),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 232/427 (54%), Positives = 293/427 (69%), Gaps = 18/427 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTK--PLILWL  508
             G  E D+I+  LPGQP  V FKQY GY+ ++ T GR+L+YYF E+  T   K  PL+LWL
Sbjct  64    GLKEKDIIHK-LPGQPP-VSFKQYGGYITINATVGRALYYYFTEAQDTMVAKDLPLLLWL  121

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
              GGPGCSSLG+GA  ELGPF V  DGKTLY  ++AWN VAN LFLESPAGVGFSYSNT+S
Sbjct  122   AGGPGCSSLGIGAMQELGPFRVGSDGKTLYKNQYAWNHVANVLFLESPAGVGFSYSNTTS  181

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
             D+   GDR+TA D Y F++NW +RFP YK RDFYI GESYAG Y+P+LA  IV  N    
Sbjct  182   DFMKVGDRKTAADNYIFILNWLERFPEYKNRDFYIAGESYAGHYVPQLAHNIVYHNKKAN  241

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIKCEHFE  1048
              T+ I LKGI++GN ++ND+TD  G  DY  SHALIS E+   L  +C  NFS   E  +
Sbjct  242   RTI-INLKGILVGNALINDETDTLGLIDYFASHALISSESSRKL-HNC--NFSSNAETSD  297

Query  1049  RAAGI------EIGSIDFYNIYGPLCLDSESSRKVKR--RLGFDPCAEDYVYSYLNLPKV  1204
                 I        G+I+ YNIY PLCLD   +   KR   + FDPC   YVYSYLNLP V
Sbjct  298   ECHDIVKKLKNVAGNINIYNIYYPLCLDGNLTSIPKRFSIMEFDPCTVYYVYSYLNLPVV  357

Query  1205  QKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             Q+A+HAN TKL Y W+ CSEV+ +W+DR+ST+ P  + L+ +G ++ +FSGDVD  +PVT
Sbjct  358   QEAIHANVTKLYYDWQPCSEVLKHWEDRSSTVLPFIQELMENGVRVWIFSGDVDGRMPVT  417

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVY-EGLTFATVRGAGHEVPQFTPRRALT  1561
             ST+YS++ M +  + PWH W  D  +VGGY   Y + LTF TVRGAGHEVP + P RAL+
Sbjct  418   STQYSIEVMNVTTLNPWHAWYRD-GEVGGYVQEYRDNLTFVTVRGAGHEVPSYKPDRALS  476

Query  1562  LLNMFLS  1582
             L++ F++
Sbjct  477   LVSNFIA  483



>gb|KDO47634.1| hypothetical protein CISIN_1g011108mg [Citrus sinensis]
Length=493

 Score =   443 bits (1139),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 276/409 (67%), Gaps = 12/409 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QYAGYV VD   GRSLFYYFAES Q   T PL+LWLNGGPGCSSLG GA
Sbjct  83    LPGQPDGVDFDQYAGYVTVDPKTGRSLFYYFAESPQNSSTNPLLLWLNGGPGCSSLGYGA  142

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DGKTL+   +AWN VAN +FLESPAGVGFSYS+T SDY+++GD+ TA+D
Sbjct  143   MSELGPFRVNKDGKTLFRNNYAWNNVANVVFLESPAGVGFSYSSTKSDYELNGDKLTAQD  202

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I+  N   + T+ I LKGI IG
Sbjct  203   SYTFLVNWLERFPQYKKRDFYIAGESYAGHYVPQLAYTILLNNKNTKNTV-INLKGIAIG  261

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEIGS  1075
             N +++  T   G Y+ LW+HAL SD+TH G+  +C      N + +CE F   A  EIG 
Sbjct  262   NALIDGPTRSMGVYENLWTHALNSDQTHKGIFTYCDFAREGNDTKECETFLEKASDEIGD  321

Query  1076  IDFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
             ID YNIY P+C++    +  +     +DPC + YV +YLN  +VQ  LH      P  W 
Sbjct  322   IDIYNIYAPICINPAFQNGSIGSVHNYDPCTDYYVEAYLNTREVQTVLHVK----PTNWT  377

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
              CS +   W D  ST+ P  + LIASG ++ ++SGDVD +VP T++RYS++A+ L V  P
Sbjct  378   ACSNLFN-WTDSPSTVLPTIKNLIASGIRVWIYSGDVDGIVPTTASRYSINALNLPVEIP  436

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             W+PW  +  +VGGY   Y+GLT  TVRGAGH VP   P RALTL++ FL
Sbjct  437   WYPWYTN-DEVGGYVEAYQGLTLVTVRGAGHLVPSDQPERALTLISSFL  484



>ref|XP_008809533.1| PREDICTED: putative serine carboxypeptidase-like 23 [Phoenix 
dactylifera]
Length=735

 Score =   451 bits (1160),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/427 (54%), Positives = 287/427 (67%), Gaps = 14/427 (3%)
 Frame = +2

Query  326   DDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILW  505
               VG ME D I   LPGQP  V F QYAGYV VD    R+LFYYF ES     TKPL+LW
Sbjct  3     SQVGLMEADKIEA-LPGQPEGVNFNQYAGYVTVDPKKERALFYYFVESPYNSSTKPLVLW  61

Query  506   LNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTS  685
             LNGGPGCSS G GA  ELGPF V  DGKTL   ++AWN VAN LFLESPAGVGFSYSNTS
Sbjct  62    LNGGPGCSSFGYGAMQELGPFRVERDGKTLSRNQYAWNNVANVLFLESPAGVGFSYSNTS  121

Query  686   SDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMP  865
             +DY  +GD+RTAKD+Y FLVNW +RFP YK+RDF+I GESY G Y P+LA VI+++N +P
Sbjct  122   TDYTSNGDKRTAKDSYTFLVNWLERFPQYKSRDFFITGESYVGHYAPQLASVILQQNKLP  181

Query  866   ETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF------S  1027
               T+ I L+GI IGN  ++  T+ +G YD+LWSHALISDE +  +++ C  NF      S
Sbjct  182   NHTV-INLQGIAIGNAYVDTKTNDQGEYDFLWSHALISDEAYAEVLQAC--NFSSTEEDS  238

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG-FDPCAEDYVYSYLNLPKV  1204
               C      A    G+ID YNIY P+CL +E+  K    +  FDPC EDYV SYLN PKV
Sbjct  239   TSCLTAANNARATSGNIDEYNIYAPICLHAENRTKSSLAMADFDPCTEDYVTSYLNNPKV  298

Query  1205  QKALHANNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQ-KILLFSGDVDSVVP  1378
              +ALH + TK    W+ CS+ + Y WKD  +++ P+ ++LI S + +I L+SGDVD V  
Sbjct  299   HEALHVDITKSTIPWQGCSDAVGYSWKDAPASVLPLIKKLIGSNETRIWLYSGDVDGVCS  358

Query  1379  VTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRAL  1558
               +T+Y++  +KL V   W  W  + +QVGGY V Y+GL F TVRGAGH VP + P RAL
Sbjct  359   TAATKYAIKELKLPVRDSWKAWYYN-EQVGGYVVGYQGLVFVTVRGAGHMVPSYQPERAL  417

Query  1559  TLLNMFL  1579
              L++ F+
Sbjct  418   ALISSFI  424



>gb|AES71590.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=503

 Score =   443 bits (1139),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 224/418 (54%), Positives = 285/418 (68%), Gaps = 20/418 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV V+   GR+LFYYF ES     TKPL+LWLNGGPGCSSLG GA
Sbjct  81    LPGQPDGVDFDQYSGYVTVEPEAGRALFYYFVESPYNSSTKPLVLWLNGGPGCSSLGYGA  140

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTLY  ++AW++VAN LFLESPAGVGFSYSNT+SDY  +GD+ TAKD
Sbjct  141   FEELGPFRVNSDGKTLYRNQYAWSEVANILFLESPAGVGFSYSNTTSDYKKAGDKSTAKD  200

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  + +   T+ I LKGI IG
Sbjct  201   AYVFLINWLERFPQYKTRDFYITGESYAGHYVPQLASTILHHHKLYNKTI-INLKGISIG  259

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHFERAAGIEIGSI  1078
             N  ++D T  +G +DY W+HAL SD+TH+ + ++C     N+S  C +    A IE G I
Sbjct  260   NAWIDDATGDKGLFDYFWTHALNSDQTHELIEKYCDFTKQNYSTICINVTDWAFIEKGKI  319

Query  1079  DFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
             DFYNIY PLC DS         +   FDPC+++Y  +YLN P+VQKALHA     P  W 
Sbjct  320   DFYNIYAPLCHDSSLKNGSTGYVTNDFDPCSDNYGIAYLNRPEVQKALHAK----PTNWS  375

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLF---------SGDVDSVVPVTSTRYSVD  1405
              C ++IT+W D   T+ P  + LI S  K+ ++         +GD D+ VPVT++RY+++
Sbjct  376   HCGDLITHWNDSPITILPTIKYLIESNIKLWIYRQVQFHYCINGDTDARVPVTTSRYAIN  435

Query  1406  AMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              +KL +   W PW    K++GGY V Y+GLTF TVRGAGH VP + P RALT+++ FL
Sbjct  436   TLKLPINASWRPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTMISSFL  492



>emb|CAN63486.1| hypothetical protein VITISV_017087 [Vitis vinifera]
Length=488

 Score =   442 bits (1137),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 237/489 (48%), Positives = 314/489 (64%), Gaps = 17/489 (3%)
 Frame = +2

Query  137   MSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeee  316
             M   F +  L +     L   HG ++ D   ++M  +R+K Q    G + E+ S      
Sbjct  1     MKAAFFLTLLSLTCLVALVQCHGGSRYDLLGKLMQAQRSKRQS--EGHSVESMSTEYSPV  58

Query  317   mVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
              +    G  + D I   LPGQP+ +   QY+GYV VD   GR+LFYYF ES Q   +KPL
Sbjct  59    YMGSQDGLKDGDRIQA-LPGQPNGLNLDQYSGYVTVDPQAGRALFYYFVES-QNSSSKPL  116

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSSLG GA +ELGPF VN DG TL    +AW+ VAN LFLESPAGVGFSYS
Sbjct  117   VLWLNGGPGCSSLGSGAMMELGPFRVNSDGNTLSYNEYAWSNVANILFLESPAGVGFSYS  176

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NT+SDYD SGD++TA+D Y FL+NW +RFP YKTRDF+I GESYAG Y+P+L+  I++ N
Sbjct  177   NTTSDYDKSGDKQTAEDNYTFLLNWLERFPEYKTRDFFITGESYAGHYVPQLSQKILQNN  236

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK-  1033
              +   TL I LKGI IGN  ++ +T ++G YD+ W+H+LISDE ++G+  +C  NFS + 
Sbjct  237   KITNQTL-INLKGIAIGNAWIDYETGLKGMYDFFWTHSLISDEINEGINLNC--NFSSET  293

Query  1034  -----CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLP  1198
                  CE +   A   IG I  Y+IY PLC  S SS   +    FDPC+EDY+ +YLN+P
Sbjct  294   TISDACEQYLDDADAAIGYIYIYDIYAPLC--SSSSNSTRPISVFDPCSEDYIQTYLNIP  351

Query  1199  KVQKALHANNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVV  1375
             +VQK++HAN T +P  WE C++ I Y WKD   T+ P+   L+ SG  + ++SGD D  V
Sbjct  352   EVQKSMHANVTNIPGPWESCNDAIFYGWKDMPLTVLPVIEELMVSGISVWIYSGDTDGRV  411

Query  1376  PVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRA  1555
             P TSTRYS++ +   V  PW+PW     +VGGY V Y+ L+F T+RGAGH VP + P RA
Sbjct  412   PTTSTRYSINNLGTSVKTPWYPWYTQ-GEVGGYAVGYKNLSFVTIRGAGHFVPSYQPARA  470

Query  1556  LTLLNMFLS  1582
             L   + FL+
Sbjct  471   LAFFSSFLA  479



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   443 bits (1139),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 223/415 (54%), Positives = 283/415 (68%), Gaps = 14/415 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV V+   GR+LFY+F E+       PL+LWLNGGPGCSS+  GA
Sbjct  59    LPGQPP-VGFSQYSGYVTVNARAGRALFYWFIEAPPATQPAPLVLWLNGGPGCSSIAYGA  117

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               E+GPF ++PDGKTL+   +AWN  AN LFL+SPAGVGFSYSNTSSD   +GD+RTA D
Sbjct  118   SEEIGPFRIHPDGKTLFLNPYAWNSEANLLFLDSPAGVGFSYSNTSSDLYTAGDQRTAID  177

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AYKFL+NWF+RFP YK RDFYI GESYAG Y+P+L+ ++ ++N   +  + I  KG M+G
Sbjct  178   AYKFLLNWFERFPQYKYRDFYISGESYAGHYVPQLSQIVYRKNKGNKNPI-INFKGFMVG  236

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI----KCEHFERAAGIEIGS  1075
             NG++ D  D  G ++Y W+H LISD+T+  L+  C +  S     +C     AA IE G 
Sbjct  237   NGVIEDYHDFVGTFEYWWTHGLISDDTYHDLMVTCDLQSSTHPSAECVKVLDAATIEQGH  296

Query  1076  IDFYNIYGPLCLDSES-SRKVKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNTKL  1237
             ID Y+IY   C D+ S  RK++         +DPC E+Y   Y N P+VQKALHAN T +
Sbjct  297   IDPYSIYTSPCTDATSLKRKIRGHYPWMSRAYDPCTENYARVYYNHPEVQKALHANVTGI  356

Query  1238  PYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMK  1414
             PY W+ CS ++  YW D   +M PIYR LIA+G +I +FSGD DSVVP+T+TRYS+DA+ 
Sbjct  357   PYPWDTCSNIVGIYWADSPRSMLPIYRELIAAGLRIWVFSGDTDSVVPLTATRYSIDALN  416

Query  1415  LKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             L  +  W+PW D  K VGG+  VYEGLTF TVRGAGHEVP   PR+AL L   FL
Sbjct  417   LSTVISWYPWYDHGK-VGGWTQVYEGLTFVTVRGAGHEVPLHRPRQALILFRHFL  470



>ref|XP_002517751.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF44558.1| serine carboxypeptidase, putative [Ricinus communis]
Length=507

 Score =   443 bits (1139),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 231/427 (54%), Positives = 287/427 (67%), Gaps = 14/427 (3%)
 Frame = +2

Query  329   DVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWL  508
             + GS E D I   LPGQP  VKF QY GYV VDK  GR+ +YYF E A+   + PL+LWL
Sbjct  77    ETGSKEADRI-VRLPGQPQ-VKFSQYGGYVTVDKVAGRAYYYYFVE-AEISKSLPLLLWL  133

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             NGGPGCSSL  GA  ELGPF V+ DGKTLYS +FAWN VAN LFLESPAGVGFSYSN +S
Sbjct  134   NGGPGCSSLAYGAMQELGPFRVHSDGKTLYSNQFAWNNVANVLFLESPAGVGFSYSNRTS  193

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
             DY+ SGDR TA D Y FL+ W +RFP YK RDFYI GESYAG Y+P+LA  I+  N    
Sbjct  194   DYNNSGDRHTAADNYMFLLRWLERFPEYKDRDFYISGESYAGHYVPQLAHNILYHNRKAG  253

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV------NFSI  1030
               + I LKGI IGN ++ND+TD  G YDY  +HAL S E    + +HC        N S 
Sbjct  254   KNI-INLKGIAIGNAVINDETDSIGMYDYFATHALTSPENVQNIKQHCNFSPQFKNNQSS  312

Query  1031  KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKV  1204
             +C    R +  +  +ID YNIY PLC +S  + K KR     FDPC++ Y ++Y N   V
Sbjct  313   ECLAATRKSDRDTVNIDIYNIYAPLCHNSNLAAKPKRASLTEFDPCSDYYSFAYFNRADV  372

Query  1205  QKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             Q+A+HAN TKL + W++CS V+  WKD  ST+ P+ +  ++SG ++ ++SGD D  VPVT
Sbjct  373   QEAMHANVTKLNHVWDLCSVVLGDWKDSPSTILPLLQEFMSSGLRVWVYSGDTDGRVPVT  432

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALT  1561
             ST+YS++ M L    PW+PW  D  +VGGY  VY+G LTFATVRGAGHEVP + P RAL+
Sbjct  433   STQYSINKMNLPTKTPWYPWALD-GEVGGYAQVYKGDLTFATVRGAGHEVPAYQPARALS  491

Query  1562  LLNMFLS  1582
             L+  FLS
Sbjct  492   LIKNFLS  498



>ref|XP_010938507.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Elaeis 
guineensis]
Length=492

 Score =   442 bits (1137),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 227/424 (54%), Positives = 284/424 (67%), Gaps = 17/424 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES-AQTPHTKPLILWLN  511
             G  E D I+  LPGQP  + F QY GYV VD   GR+LFYYF E+ +  P +KPL+LWLN
Sbjct  70    GLKESDKISK-LPGQPEGIDFDQYGGYVTVDAEAGRALFYYFTEAVSDDPSSKPLVLWLN  128

Query  512   GGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSD  691
             GGPGCSSLG GA  ELGPF V  DGKTL+   +AWN VAN LFLESPAGVGFSYSNT+SD
Sbjct  129   GGPGCSSLGYGAMEELGPFRVMSDGKTLFRNPYAWNTVANVLFLESPAGVGFSYSNTTSD  188

Query  692   YDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPET  871
             Y  +GD RTA+D+Y FLVNW  RFP YK RDF+I GESYAG Y+P+LA  I++ N     
Sbjct  189   YGENGDSRTAEDSYVFLVNWMDRFPEYKGRDFFIAGESYAGHYVPQLAHTILQHNNT---  245

Query  872   TLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKC  1036
                I LKGIMIGNG +ND+TD +G  DYLW+HALISDET D + ++C       N + +C
Sbjct  246   --HINLKGIMIGNGAINDETDNKGLCDYLWTHALISDETIDAIHKYCNFSPDASNQTNQC  303

Query  1037  EHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKVQK  1210
                         ++D YNIY PLC  S  +   KR     FDPC++ YV +YLN  +VQ+
Sbjct  304   YQAVGVVNQVFDTLDIYNIYAPLCFSSGVTPSPKRYSIENFDPCSDYYVSAYLNSAQVQE  363

Query  1211  ALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTST  1390
             ALHAN TKL YTW  C +    W D  ST+ P+ +  +A+  ++ ++SGDVD  +PVTS+
Sbjct  364   ALHANVTKLNYTWSACRQ-FAQWTDSPSTVLPLIKECMANDVRVWVYSGDVDGRIPVTSS  422

Query  1391  RYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLL  1567
             RYS++ + L V   W PW  + K+VGGY ++Y+G LTF TVRGAGHEVP +   RAL L+
Sbjct  423   RYSLNQLNLSVKTKWQPWFVN-KEVGGYSIIYDGNLTFVTVRGAGHEVPSYQALRALVLI  481

Query  1568  NMFL  1579
               FL
Sbjct  482   KFFL  485



>ref|XP_009801012.1| PREDICTED: serine carboxypeptidase II-3-like [Nicotiana sylvestris]
Length=489

 Score =   442 bits (1137),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 232/484 (48%), Positives = 311/484 (64%), Gaps = 23/484 (5%)
 Frame = +2

Query  149   FHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFD  328
             F +L  L     H G      + D  R+ +  RRA  + ++ GI           + +  
Sbjct  10    FLILCYLSAQQCHAG------EADNLRQFLKARRATTR-INRGIAAAEKQIRSASKFIVP  62

Query  329   DVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWL  508
              VGS E+D I+  LPGQPS V F QY+GYV VD   GR+LFY+F ES Q P T+PL+LWL
Sbjct  63    QVGSKENDKISA-LPGQPSGVNFDQYSGYVTVDANAGRALFYHFTESTQDPSTRPLVLWL  121

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             NGGPGCSS G G   ELGPF VN DGKTL+   FAWN VAN LFLESPAGVGFSYSNTSS
Sbjct  122   NGGPGCSSFGNGGMTELGPFRVNKDGKTLWLNPFAWNNVANVLFLESPAGVGFSYSNTSS  181

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
             DY ++GD +T +D++ FL+NW +RFP YK RDFYIIGESYAG Y+P+LA +I+      E
Sbjct  182   DY-VTGDEKTKQDSFTFLINWMERFPEYKRRDFYIIGESYAGHYVPQLAQLILSHKK-SE  239

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK-----  1033
               L I L+GI  GN +++D+    G YD+ W+HALISDE H+G++ +C  NFS +     
Sbjct  240   PNLVINLQGIATGNALLDDEAMNSGSYDFYWTHALISDEVHEGIVSNC--NFSAEFTTEA  297

Query  1034  CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKA  1213
             C+ +   A    G+I  YNIY  LC  + S+       GFDPC+ DYV +YLN  +VQKA
Sbjct  298   CDEYTDQADSSQGNIYTYNIYSQLC--NSSAYFSLPESGFDPCSADYVDNYLNTVEVQKA  355

Query  1214  LHANNTKLPYTWEVCS-EVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTST  1390
             L+  +  +P +W  C+ E+   W+D   T+ PI++ L+ SG ++ ++SGDVD ++ VT+T
Sbjct  356   LNVRD--IPQSWGSCNDEIHGSWQDSPDTVLPIFQELMQSGIRVWIYSGDVDHILSVTTT  413

Query  1391  RYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLN  1570
             RY+++ +K  V   W+PW     +VGGY V Y+ LTF TVRGAGH VP + P RALT+ +
Sbjct  414   RYAINKIKTPVKTAWYPWFFQ-GEVGGYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFS  472

Query  1571  MFLS  1582
              F++
Sbjct  473   SFIN  476



>ref|XP_002983919.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ14931.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=460

 Score =   441 bits (1134),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 222/425 (52%), Positives = 284/425 (67%), Gaps = 24/425 (6%)
 Frame = +2

Query  368   LPGQPSNV-KFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVG  544
             LPG  +N+  F QYAGYV V+++ GR+LFY+F ++   P +KPL+LWLNGGPGCSS+  G
Sbjct  33    LPGSDANLYHFDQYAGYVTVNQSAGRALFYWFTQATHDPASKPLVLWLNGGPGCSSIAYG  92

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             A  ELGP+ +   G  L   +F+WN+VAN LFLESPAGVGFSYSNTSSD    GD+ TA+
Sbjct  93    AMQELGPYRITKSG--LSHNKFSWNRVANVLFLESPAGVGFSYSNTSSDLKFPGDKNTAR  150

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMI  904
             D+Y FL  W +RFP YK RDFYI GESYAG Y+P+LA+VI  +N   E    I LKG M+
Sbjct  151   DSYIFLERWLERFPEYKKRDFYITGESYAGHYVPQLANVIYNKNKKKENP-DINLKGFMV  209

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI-----KCEHFE-RAAGIE  1066
             GN +++ + D  G  D+ WSHALIS  T+  ++ +C +         +C      A   E
Sbjct  210   GNALLDHEKDRIGRVDFWWSHALISHNTYRSIVRYCNLKGETNGTQDQCSKIVLYAYQHE  269

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRL------------GFDPCAEDYVYSYLNLPKVQK  1210
              G++D YNIY P+CL + SS++   R             G+DPC +DYV  Y N P VQ+
Sbjct  270   FGTMDRYNIYAPVCLRASSSQRTFTRFFSDPVSRVHQYSGYDPCGDDYVEVYFNRPDVQQ  329

Query  1211  ALHANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTS  1387
             ALHAN T +PY W  CSE I T W+D   TM PIYR+LI +G +I ++SGDVDSVVPVTS
Sbjct  330   ALHANVTGIPYNWTGCSETINTNWQDSDETMLPIYRKLIKAGLRIWVYSGDVDSVVPVTS  389

Query  1388  TRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLL  1567
             +RYSV+ +KL   KPW+PW  + KQVGGY  +Y+GL F TVRGAGHEVP F P RA TL+
Sbjct  390   SRYSVEKLKLNTTKPWYPWYRN-KQVGGYTEIYDGLAFVTVRGAGHEVPMFQPGRAFTLI  448

Query  1568  NMFLS  1582
               FL+
Sbjct  449   KSFLA  453



>ref|XP_006345489.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=460

 Score =   441 bits (1133),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 224/434 (52%), Positives = 290/434 (67%), Gaps = 18/434 (4%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
             V    G  + D I   LPGQP  VKFKQY GYV V+K+ GR+LFYYF E+ +   + PL+
Sbjct  8     VLSQKGLKDKDQIKK-LPGQPF-VKFKQYGGYVTVNKSAGRALFYYFVEAHENFKSLPLL  65

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSSL  GA  E+GPF ++ DGKTLY   ++WN+ AN LFLESPAGVGFSYSN
Sbjct  66    LWLNGGPGCSSLAYGAMEEIGPFRIHKDGKTLYRNNYSWNQAANLLFLESPAGVGFSYSN  125

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
              SS+   +GDR TA D   FL+NW +RFP YK RDFYI GESYAG ++P+LA++I++ N 
Sbjct  126   ISSEVKSNGDRNTAIDNIIFLLNWIQRFPEYKNRDFYIAGESYAGHFVPQLAEIILQHNK  185

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK--  1033
             + +  L I LKGIMIGN ++N +TD +G Y+Y  SH LI DE  + +  +C  NFS K  
Sbjct  186   LAKKNL-INLKGIMIGNAVINFETDEKGMYEYHASHGLIPDEIFEQIDRYC--NFSDKAL  242

Query  1034  -----CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKV-----KRRLGFDPCAEDYVYS  1183
                  C++    A  +   ID YNIY PLC  S+          K     DPC++DY+ +
Sbjct  243   PQPHQCDNAIDIAIADTDPIDLYNIYAPLCPKSDDLSTTYYTSNKNSQEIDPCSDDYLIA  302

Query  1184  YLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDV  1363
             Y+N P VQKALHAN TK+ Y W+ CSEVI  WKD   ++ P+ ++++A+G ++ +FSGD 
Sbjct  303   YMNRPDVQKALHANVTKIKYNWQPCSEVIESWKDSPLSIVPVIKKVMANGIRVWIFSGDT  362

Query  1364  DSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQF  1540
             D +VPVTST+ S+  MKL+V  PW+PW     +VGGY  VY G LTFATVRGAGH+VP +
Sbjct  363   DGIVPVTSTKKSIKKMKLRVETPWYPWFHKDYEVGGYAQVYRGNLTFATVRGAGHQVPSY  422

Query  1541  TPRRALTLLNMFLS  1582
              P RA TL   FL+
Sbjct  423   EPARAFTLAKHFLA  436



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   441 bits (1133),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 222/430 (52%), Positives = 282/430 (66%), Gaps = 20/430 (5%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLN  511
             + +  +D I   LPGQP N  F QY+GYV VDK+ GR+LFY+  ES   P TKPL+LWLN
Sbjct  23    IANQNNDRITW-LPGQPENTNFAQYSGYVTVDKSAGRTLFYWLTESPSNPETKPLVLWLN  81

Query  512   GGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSD  691
             GGPGCSS+  GA  E+GPF +  DGKTL+   ++WN  AN LFLESPAGVGFSYSN SSD
Sbjct  82    GGPGCSSIAYGAAEEIGPFHIQSDGKTLFLNPYSWNNEANLLFLESPAGVGFSYSNRSSD  141

Query  692   YDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPET  871
                 GD RTAKD+YKFLV WF RFP YK R+FYI GESYAG Y+P+L+ +I +RN     
Sbjct  142   LYTVGDSRTAKDSYKFLVRWFNRFPQYKYREFYIAGESYAGHYVPQLSQLIYRRNKGIAE  201

Query  872   TLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCE  1039
                I  KG M+GN + +D  D  G ++Y W+H LISD T+  L   C+     + SI C 
Sbjct  202   PF-INFKGFMVGNAVTDDYYDYIGTFEYWWTHGLISDSTYKTLRTACLSGSSQHPSIICN  260

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL---------GFDPCAEDYVYSYLN  1192
                 AA  E G+ID Y+IY   C   +S+  +KR L          +DPC E Y   Y N
Sbjct  261   TALEAADSEFGNIDPYSIYTRPC---KSTASMKRSLNGRYPWMSRAYDPCTERYSTEYFN  317

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDS  1369
              P VQ ALHAN+TK+ Y W  CS+++  YW +   TM PIY+ LIA+G +I ++SGD D+
Sbjct  318   RPDVQLALHANSTKISYPWSTCSDIVGNYWSESPLTMLPIYQELIAAGLRIWVYSGDTDA  377

Query  1370  VVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPR  1549
             VVP+T+TRYS+DA+KL  +  W+PW D+ + VGG+  VYEGLTF T++GAGHEVP   PR
Sbjct  378   VVPITATRYSIDALKLPTVTNWYPWYDNGR-VGGWSQVYEGLTFVTIKGAGHEVPLHRPR  436

Query  1550  RALTLLNMFL  1579
             +A  L N FL
Sbjct  437   QAFILFNHFL  446



>ref|XP_004292826.1| PREDICTED: serine carboxypeptidase II-3-like [Fragaria vesca 
subsp. vesca]
Length=497

 Score =   442 bits (1136),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 233/488 (48%), Positives = 305/488 (63%), Gaps = 22/488 (5%)
 Frame = +2

Query  155   MLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAK-----MQQLHGGITDEAWSemeeeem  319
             +L LL    T L       +ID   +++   R         Q    I  +   +      
Sbjct  9     LLLLLSFQFTFLNISCRAKQIDTLNKLLQQSRKSGLNPPRSQSSTDIVFDVEDDQYSPVY  68

Query  320   VFDDVGSMEDDLINGGLPGQPSN-VKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
             +    G+ E D I+  LPGQP+   +F QY+GYV V+   GR+LFYYF ES Q   +KPL
Sbjct  69    IGSQDGAKEADKIDA-LPGQPTEGAEFNQYSGYVTVNPKAGRALFYYFVESPQDSSSKPL  127

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSS G GA  ELGPF VN D  +L++  +AWN VAN LFLESPAGVGFSYS
Sbjct  128   VLWLNGGPGCSSFGYGAMEELGPFRVNNDKISLFANDYAWNNVANVLFLESPAGVGFSYS  187

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NTSSDY   GD+RTA+D+Y FLVNW +RFP YK RDF+I GESYAG Y+P+LA  IV++N
Sbjct  188   NTSSDYGNVGDKRTAEDSYAFLVNWLERFPEYKNRDFFITGESYAGHYVPQLAYTIVQQN  247

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFS  1027
              +   T KI LKGI IGN  ++D+T   G  DYLW+HAL SDET+ G+ ++C     N S
Sbjct  248   KITNQT-KINLKGIAIGNAWIDDNTSAWGIVDYLWTHALSSDETNAGIHKYCDFTSENSS  306

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG----FDPCAEDYVYSYLNL  1195
               C+++      E G ID YNIY PLCL+ + S+     +G    FDPC+++YV +YLNL
Sbjct  307   DLCDNYVHQLYKEKGQIDIYNIYAPLCLE-DGSKTTPSSVGSVFEFDPCSDEYVEAYLNL  365

Query  1196  PKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVV  1375
              +VQ ALH      P  W  C  V   W D   T+ P  + LI +G ++ ++SGD D+ V
Sbjct  366   AEVQAALHVK----PTQWTACGGV--GWTDSPETILPTIQSLIETGIRVWIYSGDTDARV  419

Query  1376  PVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRA  1555
             PVT++RYS++ + L V  PW PW     +VGGY V Y+GLTFATVRGAGH+VP + P+R+
Sbjct  420   PVTASRYSINTLNLPVETPWRPWNSTPDEVGGYVVGYKGLTFATVRGAGHKVPSYQPQRS  479

Query  1556  LTLLNMFL  1579
             L  ++ FL
Sbjct  480   LVFISSFL  487



>ref|XP_010906017.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=485

 Score =   441 bits (1135),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 227/416 (55%), Positives = 277/416 (67%), Gaps = 17/416 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F +YAGYV VD+  GR+LFYYF ++     +KPL+LWLNGGPGCSSLG GA
Sbjct  76    LPGQPEGVDFDEYAGYVTVDQKAGRALFYYFVQAVGDSSSKPLLLWLNGGPGCSSLGYGA  135

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               E+GPF V  DGKTL+   FAWN VAN LFLESPAGVGFSYSNT+SDY  SGD RTA+D
Sbjct  136   MQEIGPFRVMSDGKTLFRNPFAWNGVANVLFLESPAGVGFSYSNTTSDYSKSGDSRTAED  195

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
              Y FLVNW +RFP YK RDFYI GESYAG  +P+LA  I++     +    I L GIMIG
Sbjct  196   NYVFLVNWMERFPEYKGRDFYIAGESYAGHLVPDLATTILQ-----QKNTNINLNGIMIG  250

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCEHFERAAGIEIG  1072
             N ++ND TD RG +DYLW+HALISDET D + ++C       N   +C      A     
Sbjct  251   NAVINDATDNRGMFDYLWTHALISDETIDAIHKYCSFSPNATNQEYRCGDAMSVAREVST  310

Query  1073  SIDFYNIYGPLCLDSESSRKVKRRLG---FDPCAEDYVYSYLNLPKVQKALHANNTKLPY  1243
              ++ YNIY P C  S       +RL    FDPC+ DYV +YLN  +VQ+ LHAN TKL Y
Sbjct  311   VLNIYNIYAPPC--SSGITNTPKRLSIKNFDPCSVDYVDTYLNRAEVQQKLHANVTKLNY  368

Query  1244  TWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKV  1423
             TW  CS+VI  W D  ST+ P+ + L+AS  ++ ++SGDVD  VPVTSTRYS++ + L V
Sbjct  369   TWSGCSQVIQQWLDSPSTVLPLIKNLMASNIQVWIYSGDVDGRVPVTSTRYSINELLLPV  428

Query  1424  IKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLSTN  1588
              K W+PW    K   GY V Y G LTFATV+GAGHEVP +  ++AL L+  FL  N
Sbjct  429   KKQWYPWYIGNKAC-GYGVTYHGNLTFATVKGAGHEVPSYKAQQALQLVKFFLEGN  483



>ref|XP_010067796.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Eucalyptus 
grandis]
 gb|KCW66004.1| hypothetical protein EUGRSUZ_G03295 [Eucalyptus grandis]
Length=502

 Score =   442 bits (1137),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 224/415 (54%), Positives = 285/415 (69%), Gaps = 15/415 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V+F  Y GYV VDK  GR+ FYYF E+ +   + PL+LWLNGGPGCSSL  GA
Sbjct  84    LPGQPP-VEFNHYGGYVTVDKLAGRAFFYYFVEALRDKDSLPLLLWLNGGPGCSSLAYGA  142

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF V+ DGKTLY  +FAWN  AN LFLESPAGVGFSYSNT+SDY  +GDR+TA+D
Sbjct  143   MQELGPFRVHSDGKTLYRNKFAWNIAANVLFLESPAGVGFSYSNTTSDYSTNGDRKTAED  202

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
              Y F++NW +RFP YK RD Y+ GESYAG Y+P+LA  I+  N     T+ I LKGI+IG
Sbjct  203   NYVFILNWLERFPEYKNRDLYLSGESYAGHYVPQLAHDILHHNKEANRTV-INLKGIIIG  261

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI-------KCEHFERAAGIE  1066
             N +++D+ D+RG YDYL +HALI DET   + ++C  NFS        +C      A  +
Sbjct  262   NAVIDDEADLRGMYDYLVTHALIPDETWSKIQKYC--NFSANASAQSSRCISAADDADDD  319

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKALHANNTKLP  1240
             + S+D YNIY PLC  S  +   K+   + FDPC+EDYV++Y+N  +VQ+ LHAN TKL 
Sbjct  320   VSSLDMYNIYAPLCSSSNLTSIPKKASIMKFDPCSEDYVHAYMNRAEVQERLHANVTKLK  379

Query  1241  YTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLK  1420
             + WE CS+VI  W D   T+ P+   L++ G ++ +FSGD D VVPVTST+ S+  M L 
Sbjct  380   FDWEPCSDVIQKWGDSPHTILPLLHELLSHGLRVWVFSGDTDGVVPVTSTKKSLHKMGLP  439

Query  1421  VIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
               +PW PW     +VGGY  VYEG LTF TVRGAGH+VP + PRRAL+L++ FLS
Sbjct  440   TKRPWRPWYVGG-EVGGYVQVYEGDLTFVTVRGAGHQVPSYQPRRALSLVSHFLS  493



>ref|XP_004984183.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Setaria 
italica]
 ref|XP_004984184.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Setaria 
italica]
Length=526

 Score =   443 bits (1139),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 247/531 (47%), Positives = 318/531 (60%), Gaps = 53/531 (10%)
 Frame = +2

Query  92    CSPSALFMGKKQDSLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLH  271
             CSP A    K +    + +F   F LI++   L         D+A R+    R++M+  H
Sbjct  7     CSPLA---SKIRRDAFAIQF---FCLILIQASLA--------DEAGRLHEFSRSRMEMQH  52

Query  272   GGITDE---AWSemeeeemVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGR  442
               I ++   +WS      +   D G  + D I+  LPGQP    F QYAGYV VD T+G+
Sbjct  53    DRIDNKMLTSWSMDHPIYVGPQD-GLKKVDKISE-LPGQPGKAVFDQYAGYVTVDATSGK  110

Query  443   SLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNK  622
             +LFYYFAE+A+ P TKPL+LWLNGGPGCSSLG GA +E+GPF VN D KTL   ++AWN 
Sbjct  111   ALFYYFAEAAEEPSTKPLVLWLNGGPGCSSLG-GAMLEIGPFFVNRDNKTLSRNKYAWNN  169

Query  623   ---------------------------VANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
                                        VAN LFLESPAGVGFSYSN +SDY+ +GDR T 
Sbjct  170   GRLIPTRLHMAVNTLNTSVLTDHSWMTVANMLFLESPAGVGFSYSNRTSDYNNTGDRSTT  229

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
              DAY FL+NW +RFP YK   F+I GESY G YIP+LA+ I+  N +   T+ I LKGI 
Sbjct  230   ADAYTFLINWLERFPEYKGHSFFITGESYGGHYIPQLANTILSNNKIMNITM-INLKGIA  288

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGS  1075
             IGN  +NDDT+ R   DY W+HA+IS ETH  + E+C  N  ++  C     AA  E G 
Sbjct  289   IGNAYLNDDTNTRATIDYYWTHAMISKETHKAVQENCSFNGTYTGLCRTAIEAANNEKGL  348

Query  1076  IDFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
             ID  NIY   C D+ + R+    +   DPCA  Y+ SYLN  +VQ+A HAN T L   W 
Sbjct  349   IDQSNIYASFCWDASAPRQHHASVTNTDPCASYYMRSYLNRQEVQRAFHANTTGLKQPWL  408

Query  1253  VCSEVIT--YWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVI  1426
              CS +I+   WKD   +M P  ++LI+SG +  L+SGD+D+V PVTST YS+D + L++ 
Sbjct  409   DCSHIISPENWKDAQVSMLPSIQQLISSGIRTWLYSGDIDAVCPVTSTLYSLDILGLQIN  468

Query  1427  KPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PW  W  D  +VGGY V Y+GL FATVRGAGH VP + P+RALTL + FL
Sbjct  469   SPWRAWYSDDGEVGGYVVEYKGLVFATVRGAGHMVPTYQPQRALTLFSSFL  519



>gb|KEH40059.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   442 bits (1136),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 233/489 (48%), Positives = 307/489 (63%), Gaps = 16/489 (3%)
 Frame = +2

Query  122   KQDSLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSe  301
             K  S++S K  +  L+ ++         + K  Q++R    + + ++     I DE  S+
Sbjct  16    KMSSMLSQKVLLWSLIFLVCKANQQSEYLYKFIQSKRSQ-QKPSHVESYSSTIVDEHVSK  74

Query  302   meeeemVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTP  481
             +     V   +  MEDD +   LPGQP  V F QYAGYV VD   GR LFYYF ES+   
Sbjct  75    VHV---VEQQLRLMEDDKVKA-LPGQPKGVDFDQYAGYVTVDSKGGRELFYYFVESSLNS  130

Query  482   HTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGV  661
              TKPLILWLNGGPGCSS G GA  ELGPF VN DG TL   + AWNKVAN +FLESPAGV
Sbjct  131   STKPLILWLNGGPGCSSFGYGAMQELGPFRVNSDGTTLSLNKDAWNKVANIIFLESPAGV  190

Query  662   GFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADV  841
             GFSYS  S DY   GD  TAKD+Y FL+NW +RFP YKTRDF+I GESY G Y+P+LA +
Sbjct  191   GFSYSKNSLDYSNIGDNSTAKDSYIFLLNWLERFPQYKTRDFFIAGESYGGHYVPQLAHL  250

Query  842   IVKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---  1012
             I+  N   +   +I L+GI +GNG ++D+   +G YDY W   L SDETH+G+ + C   
Sbjct  251   ILSNNKKLKNHTRINLRGIAVGNGWIDDNLCTKGMYDYFWMAGLNSDETHEGIDKLCDFG  310

Query  1013  VVNFSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLN  1192
               N++ +C  ++  A  E+G+ID YNIY P C +S +++       FDPC+EDY  +YLN
Sbjct  311   NFNYTNECNLYQSRANDELGNIDIYNIYAPFC-NSSATKTSYSGSDFDPCSEDYTNAYLN  369

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
             LPKVQ+ALH   TK    W  CS++   W D  +++ P    LI+SG  I ++SGD+D  
Sbjct  370   LPKVQEALHVKPTK----WSSCSDL--SWTDSPASILPTINGLISSGISIWIYSGDIDGR  423

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRR  1552
             VP+TST+YS++++KL V   W PW    K+VGGY + Y+GL   TVRGAGH VP   P R
Sbjct  424   VPITSTKYSINSLKLPVHTAWRPWYTG-KEVGGYVIGYKGLALVTVRGAGHMVPSDQPYR  482

Query  1553  ALTLLNMFL  1579
             ALT+++ FL
Sbjct  483   ALTMISSFL  491



>ref|XP_007015556.1| Serine carboxypeptidase II-3, expressed, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33175.1| Serine carboxypeptidase II-3, expressed, putative isoform 1 [Theobroma 
cacao]
Length=496

 Score =   441 bits (1135),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 231/421 (55%), Positives = 285/421 (68%), Gaps = 17/421 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             GSME D I G LPGQP+ V F  YAGYV VD   GR+LFYYFAES +   T PL+LWLNG
Sbjct  80    GSMEADKI-GALPGQPNAVDFDHYAGYVTVDSQAGRALFYYFAESPENSSTNPLVLWLNG  138

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA  ELGPF VN DGKTL+   +AWN VAN +FLESPAGVGFSYSNTSSDY
Sbjct  139   GPGCSSL-TGAMTELGPFRVNSDGKTLFRNIYAWNNVANVIFLESPAGVGFSYSNTSSDY  197

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D +GD+ TA+DAY FLVNW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N     T
Sbjct  198   DRTGDKSTAEDAYTFLVNWLERFPQYKTRDFYITGESYAGHYVPQLAYTILLNNKNSNQT  257

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK----CEH  1042
               I LKGI +GNG++ D T   G +D+LW+HAL SDET+ G+  +C   F+ K    C+ 
Sbjct  258   -AINLKGIAVGNGLIEDITFYLGRFDFLWTHALNSDETNKGIHTYCHY-FNGKDPKQCDD  315

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKVQKAL  1216
             F+  A  E G ID YNIY PLC +   S K  +     FDPC+  Y+ SYLN P+VQ AL
Sbjct  316   FQNRAYDEAGDIDGYNIYAPLCQEYSVSNKGSQGSVNSFDPCSGAYMISYLNRPEVQTAL  375

Query  1217  HANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRY  1396
             HA  ++    W  CS     W D  +T+ PI + L+ASG ++ L+SGDVD+VVP+T+TRY
Sbjct  376   HAKLSE----WHQCSSFD--WADSPATVLPIIKSLMASGLRVWLYSGDVDAVVPITTTRY  429

Query  1397  SVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMF  1576
              ++ +   +   W  W ++  +VGGY V YEGLT  TVR AGH VP + P RALT+++ F
Sbjct  430   GINILNPPIKTAWRSWSNN-DEVGGYVVEYEGLTLVTVREAGHFVPSYQPARALTMISSF  488

Query  1577  L  1579
             L
Sbjct  489   L  489



>ref|XP_006473888.1| PREDICTED: serine carboxypeptidase-like 40-like [Citrus sinensis]
Length=490

 Score =   441 bits (1134),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 220/410 (54%), Positives = 280/410 (68%), Gaps = 10/410 (2%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYVNVD  +GRSLFYYF ES Q   +KPL+LWLNGGPGCSS G GA
Sbjct  79    LPGQPLGVNFDQYSGYVNVDSQDGRSLFYYFVESPQNSSSKPLVLWLNGGPGCSSFGAGA  138

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF VN DGKTLY   +AWNK AN +FLESPAGVGFSYSN +SDY ++GD RTA+D
Sbjct  139   MMELGPFRVNKDGKTLYQNEYAWNKDANIIFLESPAGVGFSYSNITSDYKVNGDIRTARD  198

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FLVNW +RFP YKTRDF+I GESYAG YIP+LA  I+  N     T+ I L+GI +G
Sbjct  199   SYTFLVNWLERFPEYKTRDFFIAGESYAGHYIPQLAQAILYNNQHDNQTI-INLRGIAMG  257

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIK-CEHFERAAGIEIGS  1075
             N +++ +T ++G  D+ W+HAL+ DE + G+   C    +N S + C  F        G+
Sbjct  258   NALIDLETMMKGTVDFYWTHALMPDEIYYGVTSSCNFASLNSSDEVCLEFIDQGDAAAGN  317

Query  1076  IDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             I  Y+IY PLC    SS K      FDPC+E+Y+ +YLN+P+VQ+ALHAN T LPY  + 
Sbjct  318   IYSYDIYAPLC---NSSSKFNTVSTFDPCSENYIETYLNIPRVQEALHANVTGLPYPLQS  374

Query  1256  CS-EVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
             CS E+   WKD+  T+ PI + L+A G +I ++SGD D  +PVT TRY+V  +   V   
Sbjct  375   CSGEINRNWKDKPQTVLPIIQELMAEGIRIWVYSGDTDGALPVTCTRYAVKKLGTPVRTA  434

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             W+PW     +VGGY V Y+ LTF TVRGAGH VP + P RAL L + F++
Sbjct  435   WYPWYTQ-GEVGGYAVGYQNLTFVTVRGAGHFVPSYQPARALVLFSSFIN  483



>ref|XP_003539875.1| PREDICTED: serine carboxypeptidase-like 40-like [Glycine max]
Length=496

 Score =   441 bits (1135),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 233/431 (54%), Positives = 288/431 (67%), Gaps = 16/431 (4%)
 Frame = +2

Query  320   VFDDV-----GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPH  484
             V+DD+     G  E D I   LPGQP  V F QY GYV VDK  GR+ +YYF E+ ++  
Sbjct  58    VYDDIAHSQEGLKEKDRIES-LPGQPP-VSFSQYGGYVTVDKVAGRAFYYYFVEAQRSKQ  115

Query  485   TKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVG  664
             T PL+LWLNGGPGCSSLG GA  ELGPF VN DGKTL+   F+WNKVAN LFLESPAGVG
Sbjct  116   TLPLLLWLNGGPGCSSLGYGAMQELGPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVG  175

Query  665   FSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVI  844
             FSYSN S DYD +GD++TA D Y FLVNW +R+P YK RDFYI GESYAG Y+P+LA  I
Sbjct  176   FSYSNKSKDYDNNGDKKTAADNYLFLVNWLERYPEYKDRDFYIAGESYAGHYVPQLAHTI  235

Query  845   VKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF  1024
             +  N      + I LKGI+IGN ++N++TD  G YDYL SHA+ISD+    L + C  + 
Sbjct  236   LYHNKKANKKI-INLKGILIGNAVINEETDSDGLYDYLASHAIISDKAA-YLNKACQSSS  293

Query  1025  SIKCEHFERAAGIEIGS----IDFYNIYGPLCLDSESSRKVKRR-LGFDPCAEDYVYSYL  1189
             S   E    AAG E+G     ID YNIY PLC ++  +   KR  +  DPC+E YVY+YL
Sbjct  294   SKIQESVCDAAGDEVGDDIEYIDLYNIYAPLCKNANLTSLPKRNSIVTDPCSEYYVYAYL  353

Query  1190  NLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDS  1369
             N   VQ+ALHAN T L + WE CS+VIT W D+AST+ P+    + +  ++ +FSGD D 
Sbjct  354   NRKDVQEALHANVTNLKHDWEPCSDVITKWVDQASTVLPLLHEFLNNSLRVWIFSGDTDG  413

Query  1370  VVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTP  1546
              VP+TST+YSV  M L +   WHPW     +VGGY  +Y+ GL  ATVR AGH+VP + P
Sbjct  414   RVPITSTKYSVKKMNLPIKTAWHPWF-SYGEVGGYVEIYKGGLRLATVREAGHQVPSYQP  472

Query  1547  RRALTLLNMFL  1579
              RALTL+  FL
Sbjct  473   ARALTLIKYFL  483



>gb|KHN11708.1| Serine carboxypeptidase-like 40 [Glycine soja]
Length=496

 Score =   441 bits (1134),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 233/431 (54%), Positives = 288/431 (67%), Gaps = 16/431 (4%)
 Frame = +2

Query  320   VFDDV-----GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPH  484
             V+DD+     G  E D I   LPGQP  V F  Y GYV VDK  GR+ +YYF E+ ++  
Sbjct  58    VYDDIVHSQEGLKEKDRIES-LPGQPP-VSFSHYGGYVTVDKEAGRAFYYYFVEAQRSKQ  115

Query  485   TKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVG  664
             T PL+LWLNGGPGCSSLG GA  ELGPF VN DGKTL+   F+WNKVAN LFLESPAGVG
Sbjct  116   TLPLLLWLNGGPGCSSLGYGAMQELGPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVG  175

Query  665   FSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVI  844
             FSYSN S DYD +GD++TA D Y FLVNW +R+P YK RDFYI GESYAG Y+P+ A  I
Sbjct  176   FSYSNKSKDYDTNGDKKTAADNYLFLVNWLERYPEYKERDFYIAGESYAGHYVPQFAHTI  235

Query  845   VKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF  1024
             +  N      + I LKGI+IGN ++N++TD  G YDYL SHA+ISD+    L + C  + 
Sbjct  236   LYHNKKANKKI-INLKGILIGNAVINEETDSDGLYDYLASHAIISDKAA-YLNKACDSSS  293

Query  1025  SIKCEHFERAAGIEIGS----IDFYNIYGPLCLDSESSRKVKRR-LGFDPCAEDYVYSYL  1189
             S   E    AAG E+G     ID YNIY PLC ++  +   KR  +  DPC+E+YVY+YL
Sbjct  294   SKIQESVCDAAGDELGEDIEYIDLYNIYAPLCKNANLTALPKRNTIVTDPCSENYVYAYL  353

Query  1190  NLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDS  1369
             N   VQ+ALHAN T L + WE CS+VIT W D+AST+ P+    + +  ++ +FSGD D 
Sbjct  354   NRKDVQEALHANVTNLKHDWEPCSDVITKWVDQASTVLPLLHEFLNNSLRVWIFSGDTDG  413

Query  1370  VVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTP  1546
              VP+TST+YSV  M L +   WHPW     +VGGY  VY+ GLT ATVR AGH+VP + P
Sbjct  414   RVPITSTKYSVKKMNLPIKSVWHPWF-SYGEVGGYVEVYKGGLTLATVREAGHQVPSYQP  472

Query  1547  RRALTLLNMFL  1579
              RALTL+  FL
Sbjct  473   ARALTLIKYFL  483



>gb|KHN35601.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=495

 Score =   441 bits (1134),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 231/424 (54%), Positives = 283/424 (67%), Gaps = 18/424 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP  V F QY+GYV VD   GR+LFYYF ES+  P TKPL+LWLNG
Sbjct  68    GQKEADKI-VALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKPLVLWLNG  126

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GAF ELGPF +N DGKTLY  ++AWN VAN LFLESPAGVGFSYSNT SDY
Sbjct  127   GPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAWNVVANVLFLESPAGVGFSYSNTISDY  186

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + SGD+ TAKDAY FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N   +  
Sbjct  187   EHSGDKSTAKDAYVFLINWLERFPEYKTRDFYITGESYAGHYVPQLAYTILVNNKFSQQ-  245

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHF  1045
               I LKGI + N  ++D T ++G YDY+W+HAL SD+TH+ + ++C     N S  C + 
Sbjct  246   -NINLKGIAVWNAWIDDVTSLKGIYDYIWTHALSSDQTHELIEKYCDFTSENVSAICANA  304

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
              R A  E G+ID YNIY PLC DS   +        FDPC++ Y  +YLN P+VQ ALHA
Sbjct  305   TRTAFEENGNIDPYNIYAPLCQDSSLKNGSTGSVYDFDPCSDYYGEAYLNRPEVQLALHA  364

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILL-----FSGDVDSVVPVTS  1387
                  P  W  CS++I  W D  +++ P+ + LI S   + +     F GD DSVVPVTS
Sbjct  365   K----PTNWTHCSDIIN-WNDSPASILPVIKYLIDSDIGLWIYRQVQFLGDTDSVVPVTS  419

Query  1388  TRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLL  1567
             +RYS++ +KL +  PW PW     +VGGY V Y G+TF TVRGAGH VP + P R LTL+
Sbjct  420   SRYSINTLKLPIQVPWRPWYSG-NEVGGYVVKYNGVTFVTVRGAGHLVPSWQPSRTLTLI  478

Query  1568  NMFL  1579
               FL
Sbjct  479   FSFL  482



>ref|XP_002960751.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ38290.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=461

 Score =   440 bits (1131),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 221/425 (52%), Positives = 284/425 (67%), Gaps = 24/425 (6%)
 Frame = +2

Query  368   LPGQPSNV-KFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVG  544
             LPG  +N+  F QYAGYV V+++ GR+LFY+F ++   P +KPL+LWLNGGPGCSS+  G
Sbjct  33    LPGSDANLYHFDQYAGYVTVNQSAGRALFYWFTQATHDPASKPLVLWLNGGPGCSSIAYG  92

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             A  ELGP+ +   G  L   +F+WN+VAN LFLESPAGVGFSYSNTSSD    GD+ TA+
Sbjct  93    AMQELGPYRITKSG--LSHNKFSWNRVANVLFLESPAGVGFSYSNTSSDLKFPGDKNTAR  150

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMI  904
             D+Y FL  W +RFP YK RDFYI GESYAG Y+P+LA+VI  +N   E    I LKG M+
Sbjct  151   DSYIFLERWLERFPEYKKRDFYITGESYAGHYVPQLANVIYNKNKKKENP-DINLKGFMV  209

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI-----KCEHFE-RAAGIE  1066
             GN +++ + D  G  D+ WSHALIS  T+  ++ +C +         +C      A   E
Sbjct  210   GNALLDHEKDRIGRVDFWWSHALISHNTYRSIVRYCNLKGETNGTQDQCSKIVLYAYQHE  269

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRL------------GFDPCAEDYVYSYLNLPKVQK  1210
              G++D YNIY P+CL + SS++   R             G+DPC +DYV  Y N P VQ+
Sbjct  270   FGTMDRYNIYAPVCLRASSSQRTFTRFFSDPVSRIYQYSGYDPCGDDYVEVYFNRPDVQQ  329

Query  1211  ALHANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTS  1387
             ALHAN T +PY W  CSE I T W+D   TM PIYR+L+ +G +I ++SGDVDSVVPVTS
Sbjct  330   ALHANVTGIPYNWTGCSETINTNWQDSDETMLPIYRKLMKAGLRIWVYSGDVDSVVPVTS  389

Query  1388  TRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLL  1567
             +RYSV+ +KL   KPW+PW  + KQVGGY  +Y+GL F TVRGAGHEVP F P RA TL+
Sbjct  390   SRYSVEKLKLNTTKPWYPWYRN-KQVGGYTEIYDGLAFVTVRGAGHEVPMFQPGRAFTLI  448

Query  1568  NMFLS  1582
               FL+
Sbjct  449   KSFLA  453



>ref|NP_001242872.1| uncharacterized protein LOC100820473 precursor [Glycine max]
 gb|ACU18820.1| unknown [Glycine max]
Length=496

 Score =   441 bits (1133),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 286/429 (67%), Gaps = 19/429 (4%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSN-VKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
             V +  G ME D +   LPGQP+  V F QYAGYV VD   GR+LFYYF ES      KPL
Sbjct  68    VKEQSGLMEGDKVKA-LPGQPAQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPL  126

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSS G GA  ELGPF VN DG+TLY+ ++AWN VAN +FLESPAGVGFSYS
Sbjct  127   VLWLNGGPGCSSFGYGAMQELGPFRVNSDGRTLYTNQYAWNNVANVIFLESPAGVGFSYS  186

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NTSSDY  +GD+ TA D+Y FL+NW +RFP YKTRD +I GESYAG Y+P+LAD I+  N
Sbjct  187   NTSSDYTKTGDKSTAMDSYTFLLNWLERFPQYKTRDLFITGESYAGHYVPQLADTILTYN  246

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFS  1027
              +   T+ I LKGI +GNG ++D+   +G Y+Y W+HAL SDETH+ +  HC     N +
Sbjct  247   KLTNHTV-INLKGIAVGNGWIDDNMCGKGMYEYFWTHALNSDETHEEIQRHCDFENGNLT  305

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSR-----KVKRRLGFDPCAEDYVYSYLN  1192
              +C  ++    IEIG+ID Y IY P C DS +++            +DPC++DY  SYLN
Sbjct  306   SECSKYQIRGDIEIGTIDIYGIYAPPC-DSAATKAGASPATNSDSNYDPCSDDYTNSYLN  364

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
             L +VQ+ALHA  +     W  C  V   W D  +T+ P   RLI+SG    ++SGD D  
Sbjct  365   LAEVQEALHAKAS----VWYPCRGVG--WTDSPATILPTINRLISSGINTWIYSGDTDGR  418

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRR  1552
             VP+TS+RYS+++MKL V   W PW   + +VGGY V Y+GLT  TVRGAGH VP + P+R
Sbjct  419   VPITSSRYSINSMKLPVETTWRPWY-SSNEVGGYLVGYKGLTLITVRGAGHMVPSYQPQR  477

Query  1553  ALTLLNMFL  1579
             ALT+++  L
Sbjct  478   ALTMISFSL  486



>ref|XP_006346528.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum tuberosum]
Length=527

 Score =   441 bits (1134),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 240/505 (48%), Positives = 327/505 (65%), Gaps = 24/505 (5%)
 Frame = +2

Query  92    CSPSALFMGKKQDSLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLH  271
             C+ S+    +K+    S     L L  + A    +     + D  R  +  R AK   + 
Sbjct  32    CTVSSTMSLRKKMRANSVLTLSLILCCLSAQQYCYA---GEADVLREFLKNRWAKTTSII  88

Query  272   GGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPSN-VKFKQYAGYVNVDKTNGRSL  448
                   +  +    E++    GS E+D I+  LP QPS+ V+F QYAGYV VD   GR+L
Sbjct  89    NHSLPASEKQRSVSELIVPQEGSKENDKISA-LPEQPSSAVRFNQYAGYVTVDANAGRAL  147

Query  449   FYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVA  628
             FYY AES+  P TKPL+LWLNGGPGCSSLG GA  ELGPF VN DGKTL+  +FAWN VA
Sbjct  148   FYYLAESSGDPSTKPLVLWLNGGPGCSSLGAGAMDELGPFRVNNDGKTLWLNQFAWNNVA  207

Query  629   NTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESY  808
             N LFLESPAGVGFSYSNTS+DY ++GD +T +D++ FL+NW +RFP YK RDFYI+GESY
Sbjct  208   NILFLESPAGVGFSYSNTSADY-ITGDEKTRQDSFTFLLNWMERFPEYKHRDFYIVGESY  266

Query  809   AGFYIPELADVIVK-RNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDE  985
             AG Y+P+LA +I+  R T P   L I L+GI  GN +++ +T   G YD+ W+HALISDE
Sbjct  267   AGHYVPQLAQLILSHRKTEP--NLVINLQGIATGNALLDFETMQSGSYDFYWTHALISDE  324

Query  986   THDGLIEHCVVNFSIK-----CEHFERAAGIEIGSIDFYNIYGPLC-LDSESSRKVKRRL  1147
              HDG++ +C  NFS +     C  + + A   +G+I  Y+IY PLC  ++ +S  V    
Sbjct  325   VHDGIVLNC--NFSAETTSEACNEYIKQADSSLGNIYAYDIYAPLCDPNANTSLPV---C  379

Query  1148  GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIA  1327
             GFDPC+++YV SYLN  +VQKAL  N  ++PY+W  C+  + +WKD   T+  +++ L+ 
Sbjct  380   GFDPCSDNYVNSYLNSAEVQKAL--NVRRIPYSWAPCASHL-HWKDSPYTVLLVFQELMQ  436

Query  1328  SGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFAT  1507
             SG ++ ++SGD DSV+PVT+TRY ++ +K+ V  PW+ W     +VGGY V YE LTF T
Sbjct  437   SGIRVWIYSGDTDSVLPVTTTRYDINKIKIPVKTPWYSWYFQ-GEVGGYAVEYENLTFVT  495

Query  1508  VRGAGHEVPQFTPRRALTLLNMFLS  1582
             VRGAGH VP + P RALT+ + F++
Sbjct  496   VRGAGHFVPSYQPGRALTMFSSFIN  520



>dbj|BAJ94105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=516

 Score =   441 bits (1133),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 230/434 (53%), Positives = 285/434 (66%), Gaps = 27/434 (6%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWL  508
             G  E D +   LPGQP  V F QYAGYV VD   GR+LFYY AE+        KPL+LWL
Sbjct  79    GRKEADRVEA-LPGQPRGVDFAQYAGYVTVDAAAGRALFYYLAEAVGGNGDKPKPLLLWL  137

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             NGGPGCSSLG GA  ELGPF V  DGKTLYS  ++WN  AN LFLESPAGVG+SYSNT++
Sbjct  138   NGGPGCSSLGYGAMEELGPFRVMSDGKTLYSNPYSWNHAANVLFLESPAGVGYSYSNTTA  197

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
             DY  SGD  TA+DAY+FL NW +RFP YK R+FYI GESYAG Y+P+LA  I+ R+  P 
Sbjct  198   DYGRSGDNGTAEDAYQFLANWLERFPEYKGREFYITGESYAGHYVPQLAHAIL-RHASP-  255

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCV-------VNFS  1027
                 I LKGIMIGN ++ND TD +G YD+ W+HALISDET DG+ ++C        V  +
Sbjct  256   ---AINLKGIMIGNAVINDWTDSKGMYDFFWTHALISDETADGISKNCNFTAYGAGVASN  312

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG-----FDPCAEDYVYSYLN  1192
               C+      G  +  ID YNIY P C   +S + V   +      FDPC + YV +YLN
Sbjct  313   ALCDAASDEVGESLADIDIYNIYAPNC---QSEKLVTPPIAPSIDNFDPCTDYYVEAYLN  369

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
              P VQKALHAN T+L + W  CS+V+T W D A T+ PI + L+ +  ++ ++SGD D  
Sbjct  370   RPDVQKALHANVTRLDHPWSACSDVLTRWVDSAKTVLPIIQELMKNSIRVWVYSGDTDGR  429

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYEG-LTFATVRGAGHEVPQF  1540
             VPVTS+R SV+ ++L V   W PW   TK   +VGGY V Y+G L+  TVRGAGHEVP +
Sbjct  430   VPVTSSRLSVNQLQLPVAAKWRPWFSSTKGAGEVGGYIVQYKGDLSLVTVRGAGHEVPSY  489

Query  1541  TPRRALTLLNMFLS  1582
              PRRAL L+  FL+
Sbjct  490   QPRRALVLVQNFLA  503



>ref|XP_011088748.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase II-3-like 
[Sesamum indicum]
Length=468

 Score =   439 bits (1129),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 216/409 (53%), Positives = 285/409 (70%), Gaps = 13/409 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV VD   GR+LFY+F     +P+ KPL+LWLNGGPGCSS+G GA
Sbjct  59    LPGQP-QVSFSQYSGYVTVDPVAGRALFYWFTXCDDSPN-KPLVLWLNGGPGCSSIGSGA  116

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VNPDGKTL+  +  WN VAN LFLESPAGVGFSYSNTSSDY ++GD RTA D
Sbjct  117   MTELGPFRVNPDGKTLWYNKNGWNTVANILFLESPAGVGFSYSNTSSDY-VTGDTRTAAD  175

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL+NW +RFP YKTRDFYI GESYAG Y+P+LA +I+K N +   T+ I LKGI IG
Sbjct  176   SYTFLLNWLERFPEYKTRDFYITGESYAGHYVPQLAQLILKNNKITNQTV-INLKGIAIG  234

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEIGS  1075
             N  ++ + ++ G YDY W+HAL+SDE HD ++ +C    + + S KC+     A  + GS
Sbjct  235   NAYIDYEDEMSGMYDYFWTHALMSDEHHDAILNNCNFSSMASVSEKCQETMDDADADRGS  294

Query  1076  IDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             + FY+IY PLC  + ++  +     FDPC+++YV+ YLN P+VQKALHAN T +P  W+ 
Sbjct  295   VFFYDIYAPLCGTNSTAPSLSS---FDPCSDNYVFDYLNTPEVQKALHANVTGIPGPWDT  351

Query  1256  CSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
             C++ I + W +   T+ P+ + L+ASG  + ++SGD D  VPVT++RYS+  +   V  P
Sbjct  352   CNDFIFFEWDEAPETVLPVIKDLMASGISVWIYSGDTDGRVPVTTSRYSMSKLGTPVKTP  411

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             W+PW     +VGGY V Y+ +TF T+RGAGH VP + P RALT  + FL
Sbjct  412   WYPWYYQ-GEVGGYAVEYQNVTFVTIRGAGHFVPSYQPERALTFFSSFL  459



>ref|XP_003599510.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES69761.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score =   440 bits (1131),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 222/422 (53%), Positives = 282/422 (67%), Gaps = 10/422 (2%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP NVKF QY GYV +DK  G + +YYF E+  +  T PL+LWLNG
Sbjct  68    GMKEKDKIEK-LPGQP-NVKFSQYGGYVTIDKIAGSAFYYYFVEAHHSKETLPLLLWLNG  125

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA  E+GPF VN DGKTLY   ++WN  AN LFLESPAGVGFSYSN SSDY
Sbjct  126   GPGCSSLAYGAMQEVGPFRVNSDGKTLYKNNYSWNYAANVLFLESPAGVGFSYSNKSSDY  185

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D SGDRRTA D Y FL+NW +RFP YK RDFYI GESYAG Y+P+LA  I+  N     T
Sbjct  186   DTSGDRRTAADNYIFLMNWLERFPEYKNRDFYIAGESYAGHYVPQLAHNILHHNKKANRT  245

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEH  1042
             + I LKGIMIGN ++NDDTD +G YD+L +HA+ISD+T   + + C      N + +C  
Sbjct  246   I-INLKGIMIGNAVINDDTDEQGMYDFLATHAIISDQTAYNIKKFCNFSSTSNQTTECSD  304

Query  1043  FERAAGIEIGSIDFYNIYGPLCLD-SESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALH  1219
                        +D YNIY P+C + S ++R  K     DPC++DY+ +Y N   VQ+ALH
Sbjct  305   AASEVDKNTLFLDIYNIYAPVCTNHSLTNRPKKVSDVLDPCSDDYIQAYFNRGDVQEALH  364

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             AN TKL + WE CS +I+ W D  +T+ P+   L+ +G ++ +FSGD+D  VPVT T+YS
Sbjct  365   ANVTKLEHDWEACSTIISNWGDSPTTIIPLLHELLNNGLRVWIFSGDIDGRVPVTGTKYS  424

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLNMF  1576
             +  MKL +   W+PW     ++GGY  VY+ GLTFATVR AGH+VP + P RAL+L+  F
Sbjct  425   LKKMKLPIETTWYPWFIK-GEIGGYAEVYKGGLTFATVREAGHQVPSYQPARALSLIMHF  483

Query  1577  LS  1582
             L+
Sbjct  484   LN  485



>ref|XP_010315500.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum lycopersicum]
Length=479

 Score =   439 bits (1129),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 230/485 (47%), Positives = 312/485 (64%), Gaps = 27/485 (6%)
 Frame = +2

Query  146   KFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAK-MQQLHGGITDEAWSemeeeemV  322
             +  +  +L  ++T   +     + D  R  +  RR K    ++ G+     +  +   + 
Sbjct  8     QLSLSLILCYLSTQKCYA---GETDVVREFLKARRVKSTPSINSGLA----AAEKRRAVF  60

Query  323   FDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLIL  502
                VGS EDD I+  LPGQPS V F QY+GYV VD  +GR+LFYYF ES Q P TKPL+L
Sbjct  61    VSQVGSKEDDKISA-LPGQPSGVSFDQYSGYVTVDADSGRALFYYFTESTQDPSTKPLVL  119

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSS G GA +ELGPF VN DGKTL+   FAWN VAN LFLESPAGVGFSYSNT
Sbjct  120   WLNGGPGCSSFGAGAMMELGPFRVNKDGKTLWLNPFAWNNVANILFLESPAGVGFSYSNT  179

Query  683   SSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM  862
             SSDY  +GD +T +D++ FL+NW +RFP YK RDFYI GESYAG Y+P+LA +I+     
Sbjct  180   SSDY-TTGDEKTRQDSFTFLINWMERFPEYKHRDFYITGESYAGHYVPQLAQLILSYKKT  238

Query  863   PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK---  1033
              E  L I L+G+  GNGI++D+T   G YD+ W+HALISDE HDG++ +C  NFS +   
Sbjct  239   -EPNLVINLQGLATGNGIIDDETMNSGTYDFYWTHALISDEVHDGIVLNC--NFSAETTS  295

Query  1034  --CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQ  1207
               C  + + A    G+I  YN Y  LC  + S+       GFDPC+ DYV +YLN  +VQ
Sbjct  296   EACNEYIKQADSCQGNIYAYNTYSQLC--NSSAYTSLPIHGFDPCSADYVENYLNTAEVQ  353

Query  1208  KALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTS  1387
             KAL+  +   PY+W+ C  +I    D   ++ P+++ L+ SG ++ ++SGD+D ++ VT+
Sbjct  354   KALNVKDA--PYSWDSCKLII----DSPHSVLPVFQELMQSGIRVWIYSGDIDHMLSVTT  407

Query  1388  TRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLL  1567
             + Y+++ +K  V  PW+PW     +VGGY V YE LTF TVRGAGH VP + P RALT+ 
Sbjct  408   STYAINKIKTPVKTPWYPWFFQ-GEVGGYAVEYENLTFVTVRGAGHFVPSYQPGRALTMF  466

Query  1568  NMFLS  1582
             + F++
Sbjct  467   SSFIN  471



>sp|P52711.1|CBP23_HORVU RecName: Full=Serine carboxypeptidase II-3; AltName: Full=CP-MII.3; 
Contains: RecName: Full=Serine carboxypeptidase II-3 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-3 
chain B; Flags: Precursor [Hordeum vulgare]
 emb|CAA55478.1| serine carboxylase II-3 [Hordeum vulgare subsp. vulgare]
 gb|AAB31589.1| CP-MII.3=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 516 aa]
Length=516

 Score =   440 bits (1132),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 230/434 (53%), Positives = 286/434 (66%), Gaps = 27/434 (6%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWL  508
             G  E D +   LPG P  V F QYAGYV VD   GR+LFYY AE+       TKPL+LWL
Sbjct  79    GRKEADRVEA-LPGHPRGVDFAQYAGYVTVDAAAGRALFYYLAEAVGGNGDKTKPLLLWL  137

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             NGGPGCSSLG GA  ELGPF V  DGKTLYS  ++WN  AN LFLESPAGVG+SYSNT++
Sbjct  138   NGGPGCSSLGYGAMEELGPFRVMSDGKTLYSNPYSWNHAANVLFLESPAGVGYSYSNTTA  197

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
             DY  SGD  TA+DAY+FL NW +RFP YK R+FYI GESYAG Y+P+LA  I+ R+  P+
Sbjct  198   DYGRSGDNGTAEDAYQFLDNWLERFPEYKGREFYITGESYAGHYVPQLAHAIL-RHASPD  256

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCV-------VNFS  1027
                 I LKGIMIGN ++ND TD +G YD+ W+HALISDET DG+ ++C        V  +
Sbjct  257   ----INLKGIMIGNAVINDWTDSKGMYDFFWTHALISDETADGISKNCNFTAYGAGVASN  312

Query  1028  IKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG-----FDPCAEDYVYSYLN  1192
               C+      G  +  ID YNIY P C   +S + V   +      FDPC + YV +YLN
Sbjct  313   ALCDAASDEVGESLADIDIYNIYAPNC---QSEKLVTPPIAPSIDNFDPCTDYYVEAYLN  369

Query  1193  LPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
              P VQKALHAN T+L + W  CS+V+T W D A T+ PI + L+ +  ++ ++SGD D  
Sbjct  370   RPDVQKALHANVTRLDHPWSACSDVLTRWVDSAKTVLPIIQELMKNSIRVWVYSGDTDGR  429

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYEG-LTFATVRGAGHEVPQF  1540
             VPVTS+R SV+ ++L V   W PW   TK   +VGGY V Y+G L+  TVRGAGHEVP +
Sbjct  430   VPVTSSRLSVNQLQLPVAAKWRPWFSSTKGAGEVGGYIVQYKGDLSLVTVRGAGHEVPSY  489

Query  1541  TPRRALTLLNMFLS  1582
              PRRAL L+  FL+
Sbjct  490   QPRRALVLVQNFLA  503



>ref|XP_003534383.1| PREDICTED: serine carboxypeptidase-like 40-like isoform 1 [Glycine 
max]
Length=496

 Score =   439 bits (1130),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 231/426 (54%), Positives = 284/426 (67%), Gaps = 11/426 (3%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
             V    G  E D I   LPGQP  V F  Y GYV VDK  GR+ +YYF E+ ++  T PL+
Sbjct  63    VHSQEGLKEKDRIES-LPGQPP-VSFSHYGGYVTVDKEAGRAFYYYFVEAQRSKQTLPLL  120

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSSLG GA  ELGPF VN DGKTL+   F+WNKVAN LFLESPAGVGFSYSN
Sbjct  121   LWLNGGPGCSSLGYGAMQELGPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVGFSYSN  180

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
              S DYD +GD++TA D Y FLVNW +R+P YK RDFYI GESYAG Y+P+ A  I+  N 
Sbjct  181   KSKDYDTNGDKKTAADNYLFLVNWLERYPEYKERDFYIAGESYAGHYVPQFAHTILYHNK  240

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIKCE  1039
                  + I LKGI+IGN ++N++TD  G YDYL SHA+ISD+    L + C  + S   E
Sbjct  241   KANKKI-INLKGILIGNAVINEETDSDGLYDYLASHAIISDKAA-YLNKACDSSSSKIQE  298

Query  1040  HFERAAGIEIGS----IDFYNIYGPLCLDSESSRKVKRR-LGFDPCAEDYVYSYLNLPKV  1204
                 AAG E+G     ID YNIY PLC ++  +   KR  +  DPC+E+YVY+YLN   V
Sbjct  299   SVCDAAGDELGEDIEYIDLYNIYAPLCKNANLTALPKRNTIVTDPCSENYVYAYLNRKDV  358

Query  1205  QKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             Q+ALHAN T L + WE CS+VIT W D+AST+ P+    + +  ++ +FSGD D  VP+T
Sbjct  359   QEALHANVTNLKHDWEPCSDVITKWVDQASTVLPLLHEFLNNSLRVWIFSGDTDGRVPIT  418

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALT  1561
             ST+YSV  M L +   WHPW     +VGGY  VY+ GLT ATVR AGH+VP + P RALT
Sbjct  419   STKYSVKKMNLPIKSVWHPWF-SYGEVGGYVEVYKGGLTLATVREAGHQVPSYQPARALT  477

Query  1562  LLNMFL  1579
             L+  FL
Sbjct  478   LIKYFL  483



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   438 bits (1126),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 218/417 (52%), Positives = 287/417 (69%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAE--SAQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP +V+F QY+GYV V++ +GR+LFY+  E  +++ P ++PL+LWLNGGPGCSS+  
Sbjct  36    LPGQPGSVEFNQYSGYVTVNQQSGRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAY  95

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTLYS  +AWNK+AN LFLESPAGVGFSYSNTSSD   +GD+RTA
Sbjct  96    GAAEEIGPFRIRPDGKTLYSNPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTA  155

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ ++ ++N   +  + I  KG +
Sbjct  156   EDAYTFLVNWFERFPQYKYRDFYIAGESYAGHYVPQLSQIVYQKNKGIKNPV-INFKGFL  214

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    + A +E 
Sbjct  215   VGNAVTDDYHDYVGTFEYWWTHGLISDSTYRTLRLTCDFVSSTHPSVECMKALKLAELEQ  274

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++ + R   R         +DPC E Y   Y N P+VQKALHAN T
Sbjct  275   GNIDPYSIFTQPCNNTAALRHNLRGHYPWMSRAYDPCTERYSKVYFNRPEVQKALHANVT  334

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              +PY WE CS ++  YW D   +M PIY+ LIA+G +I ++SGD D+VVPVT+TRYS+DA
Sbjct  335   GIPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDA  394

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K VGG+  VY GLTF TV GAGHEVP   PR+A  L   FL
Sbjct  395   LKLPTIINWYPWYDSGK-VGGWSQVYTGLTFVTVTGAGHEVPLRRPRQAFILFMSFL  450



>ref|XP_010685501.1| PREDICTED: serine carboxypeptidase II-3-like [Beta vulgaris subsp. 
vulgaris]
Length=490

 Score =   439 bits (1129),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 226/423 (53%), Positives = 283/423 (67%), Gaps = 14/423 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G M+ D I   LPGQP  V F QYAGYV VD  + ++LFYYFAES +    KPL+LWLNG
Sbjct  72    GLMKADKITS-LPGQPDGVDFDQYAGYVTVDPAHDKALFYYFAESPKNSSLKPLVLWLNG  130

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS G G  +ELGPF V  DGKTL    ++WN  AN +FLESPAGVGFSY N S  Y
Sbjct  131   GPGCSSFGNGGLLELGPFRVKSDGKTLIRNPYSWNNDANVIFLESPAGVGFSYGNESIIY  190

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + +GD  TAKDAY FLVNWF+RFP YKTR+FY+ GESYAG Y+P+LA  I+  N   + T
Sbjct  191   EQTGDMSTAKDAYTFLVNWFERFPQYKTREFYLTGESYAGHYVPQLAYTILHHNKNAKHT  250

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHF  1045
               I LKGI IGN  ++D T+  G YDYLWSHA+ SDET+  + ++C     + S KC+ +
Sbjct  251   -SINLKGIAIGNAWVDDVTNTAGMYDYLWSHAMYSDETYYKIQKYCNFSATSTSQKCQDY  309

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESS--RKVKRRLGFDPCAEDYVYSYLNLPKVQKALH  1219
                AG E+G ID YNIY P+CL S +S  R +     +DPC+ +YV +YLN   VQKALH
Sbjct  310   SEKAGEEVGIIDVYNIYAPVCLTSGNSKARVLDSVEVYDPCSSNYVDTYLNSKDVQKALH  369

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
                TK    W  CS  +  W+D  ST+ P+ ++LIAS   + ++SGDVD  VPVTS++YS
Sbjct  370   VKPTK----WLSCS--LFEWQDSPSTVLPVIQKLIASNISVWVYSGDVDGRVPVTSSKYS  423

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +  +KL +   W PW  D  Q+GGY V YEGL F TVRGAGH VP + P+RALT+L+ FL
Sbjct  424   LKTLKLPIKTAWRPWYSD-HQIGGYVVGYEGLVFVTVRGAGHLVPSYQPQRALTMLSSFL  482

Query  1580  STN  1588
               N
Sbjct  483   QGN  485



>ref|XP_006470156.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Citrus 
sinensis]
Length=493

 Score =   439 bits (1129),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 219/409 (54%), Positives = 274/409 (67%), Gaps = 12/409 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QYAGYV VD   GRSLFYYFAES Q   T PL+LWLNGGPGCSSLG GA
Sbjct  83    LPGQPDGVDFDQYAGYVTVDPKTGRSLFYYFAESPQNSSTNPLLLWLNGGPGCSSLGYGA  142

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DGKTL+   +AWN VAN +FLESPAGVGFSYS+T SDY+++GD+ TA+D
Sbjct  143   MSELGPFRVNKDGKTLFRNNYAWNNVANVVFLESPAGVGFSYSSTKSDYELNGDKLTAQD  202

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL NW +RFP YK RDFYI GESYAG Y+P+LA  I+  N   + T+ I LKGI IG
Sbjct  203   SYTFLANWLERFPQYKKRDFYIAGESYAGHYVPQLAYTILLNNKNTKNTV-INLKGIAIG  261

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEIGS  1075
             N +++  T   G Y+ LW+HAL SD+TH G+  +C      N + +CE F   A  EIG 
Sbjct  262   NALIDGPTRSMGVYENLWTHALNSDQTHKGIFTYCDFAREGNDTKECETFLEKASDEIGD  321

Query  1076  IDFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
             ID YNIY P+C++    +  +     +DPC + YV +YLN  +VQ  LH      P  W 
Sbjct  322   IDIYNIYAPICINPAFQNGSIGSVHNYDPCTDYYVEAYLNTREVQTVLHVK----PTNWT  377

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
              CS +   W D  ST+ P  + LIASG ++ ++SGDVD +VP  ++RYS++A+ L V  P
Sbjct  378   ACSSLFN-WTDSPSTVLPTIKNLIASGIRVWIYSGDVDGIVPTIASRYSINALNLPVEIP  436

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             W+PW  +  +VGGY   Y+GLT  TVRGAGH VP   P RALTL++ FL
Sbjct  437   WYPWYTN-DEVGGYVEAYQGLTLVTVRGAGHLVPSDQPERALTLISSFL  484



>ref|XP_008220190.1| PREDICTED: serine carboxypeptidase II-3-like [Prunus mume]
Length=490

 Score =   439 bits (1129),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 229/420 (55%), Positives = 279/420 (66%), Gaps = 15/420 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP+ V F QYAGYV VD   GR+LFYYF ES     TKPL+LWLNG
Sbjct  73    GLKEADKIEA-LPGQPAGVNFDQYAGYVTVDPKAGRALFYYFVESPHNSSTKPLVLWLNG  131

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSLG GA  ELGPF V+ D +TLY   +AWNKVAN +FLESPAGVGFSYSNTSSDY
Sbjct  132   GPGCSSLGYGAMEELGPFRVSSDNRTLYRNDYAWNKVANVIFLESPAGVGFSYSNTSSDY  191

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             +  GD++TAKD+Y FLVNW +RFP YK RDF+I GESYAG Y+P+LA  I+ +N +   T
Sbjct  192   ESVGDKQTAKDSYTFLVNWLERFPQYKPRDFFIAGESYAGHYVPQLAHTILSQNKITNQT  251

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK----CEH  1042
               I LKGI IGN  ++D     G YDYLW+HAL SDETH  + +HC    S K    C  
Sbjct  252   KIINLKGIAIGNPWVDDYDGDMGVYDYLWTHALNSDETHAAIHKHCADFASDKPSDTCLK  311

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSES-SRKVKRRLGFDPCAEDYVYSYLNLPKVQKALH  1219
             ++  +  E G  D YNIY PLC  SES S        FDPC+ +YV +YLNL +VQ ALH
Sbjct  312   YQLRSDRECG--DIYNIYAPLCRISESKSVSTGSVHHFDPCSSNYVDAYLNLVQVQSALH  369

Query  1220  ANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
                T     W  C  +   W D   ++ P  ++L ASG    ++SGD D  VPVTS+RYS
Sbjct  370   VKATN----WSACGNIG--WTDSPVSLLPTIKQLTASGISFWIYSGDTDGRVPVTSSRYS  423

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             ++ +KL++   W PW  D  +VGGY + Y+GLTFATVRGAGH VP + P+RALTL++ FL
Sbjct  424   INNLKLQLRTSWRPWYSD-GEVGGYVIGYKGLTFATVRGAGHMVPSYQPQRALTLISSFL  482



>gb|KHN30516.1| Serine carboxypeptidase-like 40 [Glycine soja]
Length=496

 Score =   439 bits (1129),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 225/417 (54%), Positives = 281/417 (67%), Gaps = 21/417 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+G+V VD   GRSLFYYF ES      KPL+LWLNGGPGCSSLG GA
Sbjct  77    LPGQPHGVNFDQYSGHVTVDPKTGRSLFYYFVESPHNSSAKPLVLWLNGGPGCSSLGYGA  136

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTL+  ++AWN+VAN LFLESPAGVGFSYSNT+SDYD SGD+ TAKD
Sbjct  137   FEELGPFRVNSDGKTLFHNKYAWNEVANVLFLESPAGVGFSYSNTTSDYDRSGDKSTAKD  196

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+NW +RFP YKTR FYI GESYAG Y+P+LA  I+  N   + ++   LKGI IG
Sbjct  197   AYVFLINWLERFPEYKTRKFYITGESYAGHYVPQLAYTILVNNKFSQQSIN--LKGIAIG  254

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHFERAAGIEIGSI  1078
             N +++D T ++G +DY W+HAL SD+TH  + ++C     N S  C +   ++ +E GSI
Sbjct  255   NALIDDVTTIKGIFDYFWTHALNSDQTHHLIKKYCDFTSENISAACINATISSILEKGSI  314

Query  1079  DFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             D  NIY PLC DS   +        FDPC+  YV +YLN P+VQKALHA     P  W  
Sbjct  315   DSSNIYAPLCYDSSLKNGSTGSVYDFDPCSAYYVEAYLNRPEVQKALHAK----PTNWTH  370

Query  1256  CSEVITYWKDRASTMFPIYRRLIASGQKILLF--------SGDVDSVVPVTSTRYSVDAM  1411
             CS     WKD  +T+ PI   LIAS  K+ ++        SGD D+ VPVTS+RYS++ +
Sbjct  371   CSGFD--WKDSPTTILPIIEYLIASHIKLWIYRQANFNYVSGDTDATVPVTSSRYSINTL  428

Query  1412  KLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             +L +   WHPW     +VGGY V Y+ +TF TVRGAGH VP + P R+LT+++ FLS
Sbjct  429   RLPIQVDWHPWYSG-NEVGGYVVGYKAVTFVTVRGAGHFVPSWQPARSLTMISSFLS  484



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   437 bits (1124),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 216/417 (52%), Positives = 285/417 (68%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV F QY+GYV +++  GR+LFY+  ES  ++ P ++PL+LWLNGGPGCSS+  
Sbjct  31    LPGQPKNVGFNQYSGYVTLNQQAGRALFYWLIESPVSRKPESRPLVLWLNGGPGCSSIAY  90

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTLY  R+AWN +AN LFLESPAGVGFSY+NT+SD   +GD+RTA
Sbjct  91    GAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTNTTSDLYTTGDKRTA  150

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ ++ +RN   +  + I  KG +
Sbjct  151   EDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQLVYERNKGVQNPV-INFKGFL  209

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H L+SD T+  L   C      + S++C +  RAA IE 
Sbjct  210   VGNAVTDDYHDFIGTFEYWWTHGLVSDSTYRSLRVACDLGSSTHPSLECMNALRAAQIEQ  269

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C D+ + R   R         +DPC E Y   Y N  +VQKALHAN T
Sbjct  270   GNIDPYSIFTQPCKDTSTLRHNMRGHYPWMSRAYDPCTERYSKVYFNRLEVQKALHANVT  329

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              L Y W+ CS+++  YW D   +M PIY+ LIA+G +I ++SGD D+VVPVT+TRYS+DA
Sbjct  330   ALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDA  389

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D+ K VGG+   Y+GLT  TV GAGHEVP   PR+A  L   FL
Sbjct  390   LKLPTIINWYPWYDNGK-VGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFL  445



>ref|NP_001132061.1| uncharacterized protein LOC100193473 [Zea mays]
 gb|ACF80746.1| unknown [Zea mays]
Length=413

 Score =   436 bits (1120),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 216/408 (53%), Positives = 274/408 (67%), Gaps = 6/408 (1%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             +PGQ    +F QYAGYV VD   GR+LFYYF E+ Q P  KPL+LWLNGGPGCSS G GA
Sbjct  1     MPGQTVVAEFDQYAGYVTVDAKAGRALFYYFVEALQDPSDKPLVLWLNGGPGCSSFGSGA  60

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF V+ D KTLY RR AWN+VAN LF+E PAGVG+SYSNT+SDY  +GD+RT  D
Sbjct  61    MLELGPFSVHSDNKTLYKRRHAWNRVANMLFIEIPAGVGYSYSNTTSDYYNTGDQRTTDD  120

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FLV W ++FP Y+ RDF+I GESYAG YIPELA++IV +N     T  I LKG+ IG
Sbjct  121   AYTFLVTWLEKFPEYRNRDFFITGESYAGHYIPELANLIVSKNRATNVT-NIKLKGVAIG  179

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSID  1081
             N  ++D+  +R  YDY W HA+IS + +  + + C  N  ++  C +    A  E G++D
Sbjct  180   NADLDDNLTLRASYDYYWMHAMISGKAYTAIKDKCSFNGTYTKDCLNAMNLATREKGNVD  239

Query  1082  FYNIYGPLCLDSESSRKVKRRLGF-DPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVC  1258
              Y+IY P+C D+ ++ K    L F DPC   YV SYLN P+VQ+ALHAN T L Y W  C
Sbjct  240   DYDIYAPICHDASNASKSSDSLLFGDPCTNHYVSSYLNNPEVQRALHANTTGLGYPWMDC  299

Query  1259  SE-VITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             S+ V   WKD   TM P  ++LI+SG +I L+SGD+D+V    ST+Y +D + L V   W
Sbjct  300   SQRVFDNWKDSPVTMLPSIKKLISSGTRIWLYSGDMDAVCSFISTQYVLDNLGLPVEASW  359

Query  1436  HPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PW  D  +V GY + Y+GL FATVRGAGH VP + PR AL L + FL
Sbjct  360   RPWRID-NEVAGYVIGYKGLVFATVRGAGHMVPYYQPRSALALFSSFL  406



>ref|XP_011088290.1| PREDICTED: serine carboxypeptidase II-3-like [Sesamum indicum]
Length=481

 Score =   438 bits (1126),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 222/411 (54%), Positives = 286/411 (70%), Gaps = 17/411 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP+ V F QY+GYV VD T GR+LFYY  E A+   +KPL+LWLNGGPGCSS+G GA
Sbjct  72    LPGQPT-VNFTQYSGYVTVDPTAGRALFYYLTE-AEDSSSKPLVLWLNGGPGCSSIGAGA  129

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VNPD KTL+  ++AWN VAN +FLESPAGVGFSYSN +SDY ++GD++TA D
Sbjct  130   MTELGPFRVNPDAKTLWYNKYAWNNVANIIFLESPAGVGFSYSNRTSDY-VTGDKQTAAD  188

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FLVNW +RFP YKTRDF+I GESYAG Y+P+LAD+I++ N +   T+ I LKGI IG
Sbjct  189   SYTFLVNWLERFPEYKTRDFFITGESYAGHYVPQLADLILQNNKITNQTV-INLKGIAIG  247

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK------CEHFERAAGIEI  1069
             N  ++      G YD+ W+ ALISDETH G+ E+C  NFS        C  ++  A  E 
Sbjct  248   NAYIDYTDRWAGTYDHFWTSALISDETHQGITENC--NFSSDATVSGICNEYQDRAYNEA  305

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTW  1249
             G+I  Y+IY PLC    SS        +DPC++DYV +YLN P+VQKALHAN T LP  W
Sbjct  306   GNIFIYDIYAPLC---GSSATSPSISSYDPCSDDYVLAYLNTPEVQKALHANVTGLPGPW  362

Query  1250  EVCS-EVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVI  1426
             E C+ E+   W+D+  T+ P+ +RL+ASG  + ++SGD D ++PVT+TRYS+  +   V 
Sbjct  363   EDCNYEINGDWQDQPDTVLPVIKRLMASGISVWIYSGDTDGIIPVTTTRYSMPKLGAPVK  422

Query  1427  KPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PW+PW     +VGGY V Y+ +TF T+RGAGH VP + P RALT  + FL
Sbjct  423   TPWYPWYSQ-GEVGGYVVEYQNVTFVTIRGAGHFVPSYQPERALTFFSSFL  472



>ref|XP_009619884.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana tomentosiformis]
Length=508

 Score =   439 bits (1128),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 229/463 (49%), Positives = 303/463 (65%), Gaps = 17/463 (4%)
 Frame = +2

Query  212   KIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDVGSMEDDLINGGLPGQPSNV  391
             + D  R+ +  RRA     HG    E       +  V   VGS E+D I   LPGQPS V
Sbjct  44    EADVLRQFLKARRATTSINHGNAAAEKQRRSSSKFRV-PQVGSKENDKI-LALPGQPSGV  101

Query  392   KFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFIELGPFG  571
              F QY+GYV VD   GR+LFY+F ES Q P ++PL+LWLNGGPGCSS G G   ELGPF 
Sbjct  102   NFDQYSGYVTVDANAGRALFYHFTESTQDPSSRPLVLWLNGGPGCSSFGNGGMTELGPFR  161

Query  572   VNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNW  751
             VN DGKTL+   FAWN VAN LFLESPAGVGFSYSNTSSDY ++GD +T +D++ FL+NW
Sbjct  162   VNKDGKTLWLNPFAWNNVANVLFLESPAGVGFSYSNTSSDY-VTGDEKTRQDSFTFLINW  220

Query  752   FKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDT  931
              +RFP +K RDFYIIGESYAG Y+P+LA +I+      E  L I L+GI  GN  ++D+T
Sbjct  221   MERFPEFKHRDFYIIGESYAGHYVPQLAQLILSHKKS-EPNLVINLQGIATGNAFIDDET  279

Query  932   DVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK-----CEHFERAAGIEIGSIDFYNIY  1096
                G YD+ W+HALISDE H+G++ +C  NFS +     C+ +   A    G+I  YNIY
Sbjct  280   MSSGSYDFYWTHALISDEIHEGIVSNC--NFSAEFTTQACDEYTDQADSSQGNIYTYNIY  337

Query  1097  GPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVI-T  1273
               LC  + S+       GFDPC+ DYV +YLN  +VQKAL+  +  +P +W  C++ I  
Sbjct  338   SQLC--NSSAYFSLPISGFDPCSADYVDNYLNTVEVQKALNVRD--IPQSWGSCNDYIHG  393

Query  1274  YWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDD  1453
              W+D   T+ PI++ L+ SG ++ ++SGDVD +V VT++RY+++ +K  V  PW+PW   
Sbjct  394   SWQDSPDTVLPIFQELMQSGIRVWIYSGDVDHIVSVTTSRYAINKIKTPVKTPWYPWFFQ  453

Query  1454  TKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
               +VGGY V Y+ LTF TVRGAGH VP + P RALT+ + F++
Sbjct  454   -GEVGGYAVEYQNLTFVTVRGAGHFVPSYQPGRALTMFSSFIN  495



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   437 bits (1123),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 223/422 (53%), Positives = 287/422 (68%), Gaps = 22/422 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV F QY+GYV V++  GR+LFY+  ES +   P ++PL+LWLNGGPGCSS+  
Sbjct  35    LPGQP-NVGFAQYSGYVTVNRKAGRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAY  93

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTLY   +AWN +AN LFLESPAGVGFSY+NTSSD   +GD+RTA
Sbjct  94    GAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTA  153

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ +I +RN   +  + I  KG M
Sbjct  154   QDAYAFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQIIYERNKGKQNPI-INFKGFM  212

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y WSH LISD T+  L   C +    + S++C    + A  E 
Sbjct  213   VGNAVTDDYHDFIGTFEYWWSHGLISDSTYRVLRVTCDLGSSQHPSVECMRALKIAETEQ  272

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRRL---------GFDPCAEDYVYSYLNLPKVQKALHA  1222
             G+ID Y+IY   C    S+  +KR L          +DPC E Y   Y N P VQKALHA
Sbjct  273   GNIDPYSIYTRPC---NSTASLKRNLRGHYPWMSRAYDPCTERYSEVYFNRPDVQKALHA  329

Query  1223  NNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N T++ Y W+ CS+++  YW D   ++ PIYR LIA+G +I +FSGD DSVVPVT+TRYS
Sbjct  330   NVTRVSYPWKTCSDIVGNYWADSPLSILPIYRELIAAGLRIWVFSGDTDSVVPVTATRYS  389

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +DA+KL  I  W+PW ++ K VGG+  VY+GLTF TV GAGHEVP   PR A+ L   FL
Sbjct  390   IDALKLPTITNWYPWNNNGK-VGGWSQVYKGLTFVTVTGAGHEVPLHRPRLAVILFRSFL  448

Query  1580  ST  1585
             ++
Sbjct  449   AS  450



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   437 bits (1123),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 217/417 (52%), Positives = 288/417 (69%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAE--SAQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV+F QY+GYV V++  GR+LFY+  E  ++++P ++PL+LWLNGGPGCSS+  
Sbjct  36    LPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPESRPLVLWLNGGPGCSSVAY  95

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTLY   +AWNK+AN LFLESPAGVGFSYSNTSSD   +GD+RTA
Sbjct  96    GAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTA  155

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ V+ ++N   +  + I  KG +
Sbjct  156   EDAYTFLVNWFERFPQYKYRDFYIAGESYAGHYVPQLSQVVYQKNKGIKNPV-INFKGFL  214

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C      A +E 
Sbjct  215   VGNAVTDDYHDYVGTFEYWWTHGLISDSTYQTLRVTCDFESSTHPSVECIKALMLAELEQ  274

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++ + R   R         +DPC E Y   Y N P+VQKALHAN T
Sbjct  275   GNIDPYSIFTQPCNNTAALRHNLRGHYPWMSRAYDPCTERYSKVYFNHPEVQKALHANVT  334

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              +PY W+ CS+++  YW D   +M PIY+ LIA+G +I ++SGD D+VVPVT+TRYS+DA
Sbjct  335   GIPYPWKTCSDIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDA  394

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D+ K VGG+  VY+GL+F TV GAGHEVP   PR+A  L   FL
Sbjct  395   LKLPTIINWYPWYDNGK-VGGWSQVYKGLSFVTVTGAGHEVPLHRPRQAFILFRSFL  450



>dbj|BAC16131.1| putative serine carboxypeptidase II-3 precursor [Oryza sativa 
Japonica Group]
Length=524

 Score =   439 bits (1129),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 228/436 (52%), Positives = 284/436 (65%), Gaps = 23/436 (5%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES---AQTPHTKPLIL  502
             VGS E D +  GLPGQP+ V F QYAGYV VD   GR+LFYY AE+   A      PL+L
Sbjct  78    VGSKEADRV-AGLPGQPAGVGFAQYAGYVTVDAAAGRALFYYLAEADGGAAASSKAPLLL  136

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSSLG GA  ELGPF V  DG +LY   ++WN VAN +FLESP GVGFSYSNT
Sbjct  137   WLNGGPGCSSLGYGAMEELGPFRVKSDGVSLYRNPYSWNNVANVMFLESPIGVGFSYSNT  196

Query  683   SSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM  862
             ++DY   GD  TA+DAYKFLVNW +RFP YK RDFY+ GESYAG Y+P+LA  I++ ++ 
Sbjct  197   TADYSRMGDNSTAEDAYKFLVNWMERFPEYKGRDFYLAGESYAGHYVPQLAHAILRHSSA  256

Query  863   PE----TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI  1030
                   ++  I LKGIMIGN ++ND TD +G YD+ W+HALISDE +DG+ +HC  NF+ 
Sbjct  257   AAGGKPSSSPINLKGIMIGNAVINDWTDTKGMYDFFWTHALISDEANDGITKHC--NFTD  314

Query  1031  K------CEHFERAAGIEIGSIDFYNIYGPLCLDSE---SSRKVKRRLGFDPCAEDYVYS  1183
                    C+     A   +  ID YNIY P C       S         FDPC + YV +
Sbjct  315   GADANSLCDDATSLADDCLQDIDIYNIYAPNCQSPGLVVSPPVTPSIESFDPCTDYYVEA  374

Query  1184  YLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDV  1363
             YLN P VQKALHAN T+L + W  CS V+  W D AST+ PI + L+ +  ++ ++SGD 
Sbjct  375   YLNNPDVQKALHANITRLDHPWSACSGVLRRWVDSASTVLPIIKELLKNNIRVWVYSGDT  434

Query  1364  DSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYEG-LTFATVRGAGHEV  1531
             D  VPVTS+RYSV+ + L V   W PW  +T+    VGGY V Y+G L+  TVRGAGHEV
Sbjct  435   DGRVPVTSSRYSVNQLNLPVAAKWRPWFSNTQGVGDVGGYIVQYKGNLSLVTVRGAGHEV  494

Query  1532  PQFTPRRALTLLNMFL  1579
             P + P+RAL L+  FL
Sbjct  495   PSYQPQRALVLVQYFL  510



>gb|ACN29008.1| unknown [Zea mays]
 tpg|DAA63952.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=524

 Score =   439 bits (1129),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 226/443 (51%), Positives = 283/443 (64%), Gaps = 29/443 (7%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES---AQTPHTKPLIL  502
             VG  EDD ++  LPGQPS V F+QYAGYV VD   GR+LFYY AE+         KPL+L
Sbjct  72    VGRKEDDRVDR-LPGQPSGVDFEQYAGYVTVDAAAGRALFYYLAEAVGGGSASAAKPLLL  130

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSSLG GA  ELGPF V  DGKTLY   +AWN  AN LFLESPAGVGFSYSNT
Sbjct  131   WLNGGPGCSSLGYGAMEELGPFRVKSDGKTLYRNPYAWNNAANVLFLESPAGVGFSYSNT  190

Query  683   SSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM  862
             ++DY  SGD +TA+DA +FL+NW ++FP YK RD Y+ GESYAG Y+P+LA  I+     
Sbjct  191   TADYSRSGDNKTAEDALRFLLNWMEKFPEYKGRDLYLAGESYAGHYVPQLAHAILGHAAA  250

Query  863   --PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI--  1030
               P ++  + L+GIMIGN ++ND TD +G YD+ W+HALISD T D +  HC  NFS   
Sbjct  251   GKPSSSSPLNLRGIMIGNAVINDWTDTKGMYDFFWTHALISDATADAIGRHC--NFSAAA  308

Query  1031  ---------KCEHFERAAGIEIGSIDFYNIYGPLCLDSE--SSRKVKRRLGFDPCAEDYV  1177
                      KC      A   +  ID YNIY P C      S         FDPC++ YV
Sbjct  309   DADAAASNDKCNEATSEADEALQDIDIYNIYAPNCQSPGLVSPPITPSMDRFDPCSDYYV  368

Query  1178  YSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSG  1357
              +YLN P VQ+ALHAN T+L + W  CS+V+  W D A+T+ PI   L+ +  ++ ++SG
Sbjct  369   NAYLNDPDVQRALHANVTRLDHPWSACSDVLRRWTDSATTVLPILTELLNNDIRVWVYSG  428

Query  1358  DVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYEG-----LTFATVR  1513
             D D  VPVTS+RYSV+ ++L V   W  W   T+   +VGGY V Y+G     L+  TVR
Sbjct  429   DTDGRVPVTSSRYSVNQLQLPVAAKWRAWFSSTQGAGEVGGYTVQYKGKEKGSLSLVTVR  488

Query  1514  GAGHEVPQFTPRRALTLLNMFLS  1582
             GAGHEVP + PRRAL L+  FL+
Sbjct  489   GAGHEVPSYQPRRALVLVQGFLA  511



>ref|XP_009777002.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana sylvestris]
Length=492

 Score =   438 bits (1126),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 227/427 (53%), Positives = 292/427 (68%), Gaps = 11/427 (3%)
 Frame = +2

Query  320   VFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLI  499
             +    G  E D I   LPGQP  VKF+QY GYV V+++ GR+L+YYF E A+   + PL+
Sbjct  63    ILSQEGQKEKDWIKK-LPGQPP-VKFQQYGGYVTVNESAGRALYYYFTE-AENSKSLPLL  119

Query  500   LWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSN  679
             LWLNGGPGCSS+  GA  ELGPF V+ DGKTLY  R+AWN VAN LFLESPAGVGFSY+N
Sbjct  120   LWLNGGPGCSSIAFGAMEELGPFRVHSDGKTLYRNRYAWNLVANVLFLESPAGVGFSYTN  179

Query  680   TSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
             TSSD++ +GD+RTA D   FL+NW +RFP YK RDFYI GESYAG Y+P+LA VI+  N 
Sbjct  180   TSSDFNSTGDKRTANDNVVFLLNWLERFPEYKNRDFYISGESYAGHYVPQLAHVILHLNK  239

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF--SIK  1033
                 TL I LKG +IGN ++N+DTD  G Y+Y  SHALISD+T   + ++C  +F    K
Sbjct  240   RANKTL-INLKGFIIGNAVINEDTDNLGMYEYFASHALISDQTFLDIHKYCYSDFYNEKK  298

Query  1034  CEHFERAAGIEIGSIDFYNIYGPLCLDSESSR--KVKRRLGFDPCAEDYVYSYLNLPKVQ  1207
             C      +     ++D YNIY PLC D   ++  K    L FDPC+++Y+Y+YLN   VQ
Sbjct  299   CNKAGAVSDSNTDNLDIYNIYFPLCHDDNLTKHPKFPSTLQFDPCSDNYIYAYLNRRDVQ  358

Query  1208  KALHANNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             +ALHAN T + Y WE CS+ + Y WKD   T+ P+ +  +A+G ++ +FSGD D  VPVT
Sbjct  359   EALHANVTNISYDWEACSDPLFYNWKDSPLTIIPLLQESLANGVRVWIFSGDTDGRVPVT  418

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALT  1561
             S++ S+ AM+L V KPW  W     +VGGY   Y+ GLTFATVRGAGHEVP + P RAL+
Sbjct  419   SSKRSIKAMELTVDKPWRSWLYGG-EVGGYIETYKGGLTFATVRGAGHEVPSYQPARALS  477

Query  1562  LLNMFLS  1582
             L++ FLS
Sbjct  478   LISHFLS  484



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   436 bits (1122),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/426 (53%), Positives = 286/426 (67%), Gaps = 16/426 (4%)
 Frame = +2

Query  341   MEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNG  514
              E D I   LPGQP+NV F QY+GYV V+K  GR+LFY+F ES  ++ P ++PL+LWLNG
Sbjct  31    QERDRIKS-LPGQPANVDFDQYSGYVTVNKKAGRALFYWFIESPASRAPESRPLLLWLNG  89

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS+  GA  E+GPF V PDGKTL+   ++WNK+AN LF+ESPAGVGFSYSNTSSD 
Sbjct  90    GPGCSSVAYGATEEIGPFRVKPDGKTLFFNPYSWNKLANLLFVESPAGVGFSYSNTSSDL  149

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
               +GD+RTA+DAY FLV WF+RFP YK R+FYI GESYAG Y+P+L+ +I +RN   E  
Sbjct  150   YTAGDQRTAEDAYTFLVQWFERFPQYKHREFYIAGESYAGHYVPQLSQIIYERNKGIENP  209

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK----CEH  1042
             + I  KG M+GN + +D  D  G ++Y W+H LISD T+  L E C    S      C  
Sbjct  210   V-INFKGFMVGNAVTDDYHDYIGTFEYWWTHGLISDSTYKVLRETCDTGSSTHPSDDCVK  268

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKV  1204
                 A  E G+ID Y+IY P C  S S R+  R         +DPC E +   Y NLP+V
Sbjct  269   SLLQAEKEQGNIDPYSIYTPPCNASSSLRRRFRVHFPWMPRAYDPCTERHSTVYFNLPEV  328

Query  1205  QKALHANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPV  1381
             Q+A HAN T +PY W+ CS+ +  YW D   ++ PIY+ L+A+G KI +FSGD DSVVP+
Sbjct  329   QEAFHANTTGIPYPWKTCSDTVGIYWTDAPLSVLPIYQGLMAAGLKIWVFSGDTDSVVPI  388

Query  1382  TSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALT  1561
             T+TRYS+DA+KL  I  W+PW D+ K+VGG+  VY+GL F TV GAGHEVP   PR A  
Sbjct  389   TATRYSIDALKLPTITNWYPWYDN-KRVGGWSQVYKGLIFVTVTGAGHEVPLHRPRLAYI  447

Query  1562  LLNMFL  1579
             L   FL
Sbjct  448   LFRSFL  453



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   436 bits (1122),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/420 (52%), Positives = 286/420 (68%), Gaps = 21/420 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESA--QTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV F QY+GYV V++  GR+LFY+  ES   + P  +PL+LWLNGGPGCSS+  
Sbjct  35    LPGQPRNVSFSQYSGYVTVNEQRGRALFYWLTESPVNRVPKARPLVLWLNGGPGCSSVAY  94

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGK+LY   +AWNK+AN LFLESPAGVGFSY+NT+SD   +GD RTA
Sbjct  95    GAAEEIGPFRIRPDGKSLYLNPYAWNKLANLLFLESPAGVGFSYTNTTSDLYTTGDERTA  154

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLV WF+RFP YK RD YI+GESYAG ++P+L+ ++ +RN      + + LKG M
Sbjct  155   EDAYTFLVKWFERFPQYKHRDLYIVGESYAGHFVPQLSKLVYERNKGISNPV-LNLKGFM  213

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y WSH LISD T+  L   C      + S++C    R A +E 
Sbjct  214   VGNAVTDDYHDFVGTFEYWWSHGLISDSTYRKLRIACYSVPSQHPSLQCMEALRTAELEQ  273

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRRL---------GFDPCAEDYVYSYLNLPKVQKALHA  1222
             G+ID Y+I+   C ++ +   +KR L          +DPC E Y  SY N P VQKALHA
Sbjct  274   GNIDPYSIFTRPCNNTVT---LKRFLMGRYPWMSRAYDPCTERYSNSYFNRPNVQKALHA  330

Query  1223  NNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N T+LPY W+ CS+++ +YW D   +M PIY+ LIA+G KI +FSGD D+VVPVT+TRYS
Sbjct  331   NVTRLPYPWKACSDIVGSYWTDSPVSMLPIYKELIAAGVKIWVFSGDTDAVVPVTATRYS  390

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             ++A+KL  I  W+PW D  K VGG+  VY+GLTF +V GAGHEVP   PR+A  L   FL
Sbjct  391   INALKLPTITNWYPWYDQGK-VGGWSQVYKGLTFVSVAGAGHEVPLHRPRQAFILFRSFL  449



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   436 bits (1121),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 218/419 (52%), Positives = 288/419 (69%), Gaps = 19/419 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP+NV+F QY+GYV V++  GR+LFY+  ES  ++ P ++PL+LWLNGGPGCSS+  
Sbjct  35    LPGQPTNVEFNQYSGYVTVNQQAGRALFYWLIESPASRGPESRPLVLWLNGGPGCSSVAY  94

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTL+   +AWNK+AN LFLESPAGVGFSYSNT+SD   +GD+RTA
Sbjct  95    GAAEEIGPFRIKPDGKTLFFNPYAWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTA  154

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y FLVNWF+RFP YK RDFYI+GESYAG Y+P+L+ ++ ++N   +  + I  KG +
Sbjct  155   EDSYAFLVNWFERFPQYKHRDFYIVGESYAGHYVPQLSQIVYQKNKGIQNPV-INFKGFL  213

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF------SIKCEHFERAAGI  1063
             +GN + +D +D  G ++Y W+H LISD T+  L   C  NF      S+ C      A +
Sbjct  214   VGNAVTDDYSDYIGTFEYWWTHGLISDSTYRTLRIAC--NFSSSMHPSVDCIKALYLAQL  271

Query  1064  EIGSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHAN  1225
             E G+ID Y+I+   C ++ S R   R         +DPC E Y   Y N P+VQKALHAN
Sbjct  272   EQGNIDPYSIFTRPCNNTASLRHNLRGHYPWMSRAYDPCTERYSKLYFNRPEVQKALHAN  331

Query  1226  NTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
              T + Y W+ CS+++  YW D   +M PIY+ LIA+G KI ++SGD D+VVPVT+TRYS+
Sbjct  332   ATGISYPWKTCSDIVGNYWADAPLSMLPIYKELIAAGLKIWVYSGDTDAVVPVTATRYSI  391

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             DA+KL  I  W PW D+ K VGG+  VY+GLTF TV GAGHEVP   PR+A  L   FL
Sbjct  392   DALKLPTITNWSPWYDNGK-VGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAFILFKSFL  449



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   436 bits (1121),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/419 (52%), Positives = 289/419 (69%), Gaps = 15/419 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GY+ V++  GR+LFY+  ES  T  P ++PL+LWLNGGPGCSS+  
Sbjct  34    LPGQPSNVDFRQYSGYITVNEERGRALFYWLVESPATRDPKSRPLVLWLNGGPGCSSVAY  93

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V  DGKTL+ + +AWNK+AN LFLESPAGVGFSY+NT+SD   +GD+RTA
Sbjct  94    GAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYTNTTSDLYTTGDQRTA  153

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY+FLVNW +RFP YK RDFYI+GESYAG ++P+L+ ++ +RN   +    + LKG M
Sbjct  154   EDAYRFLVNWLERFPQYKHRDFYIVGESYAGHFVPQLSKLVHERNKGFKNP-ALNLKGFM  212

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCV----VNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C     ++ S++C    R A +E 
Sbjct  213   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSVSSLHPSLQCMVALRNAELEQ  272

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++   +   R         +DPC E Y   Y N  +VQKALHAN T
Sbjct  273   GNIDPYSIFTKPCNNTVQLKSFLRGRYPWMSRAYDPCTERYSNVYFNRVEVQKALHANVT  332

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +LPY W+ CS+++ +YW+D   +M PIYR LI +G KI +FSGD D+VVPVT+TRYS+DA
Sbjct  333   RLPYPWKSCSDIVGSYWRDSPVSMLPIYRELITAGLKIWVFSGDTDAVVPVTATRYSIDA  392

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLST  1585
             +KL  I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  L   FL +
Sbjct  393   LKLATITNWYPWYDHGK-VGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLES  450



>gb|KHN32398.1| Serine carboxypeptidase-like 40 [Glycine soja]
Length=496

 Score =   437 bits (1125),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 232/431 (54%), Positives = 287/431 (67%), Gaps = 16/431 (4%)
 Frame = +2

Query  320   VFDDV-----GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPH  484
             V+DD+     G  E D I   LPGQP  V F  Y GYV VDK  GR+ +YYF E+ ++  
Sbjct  58    VYDDIVHSQEGLKEKDRIES-LPGQPP-VSFSHYGGYVTVDKVAGRAFYYYFVEAQRSKQ  115

Query  485   TKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVG  664
             T PL+LWLNGGPGCSSLG GA  ELGPF VN DGKTL+   F+WNKVAN LFLESPAGVG
Sbjct  116   TLPLLLWLNGGPGCSSLGYGAMQELGPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVG  175

Query  665   FSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVI  844
             FSYSN S DYD +GD++TA D Y FLVNW +R+P YK RDFYI GESYAG Y+P+LA  I
Sbjct  176   FSYSNKSKDYDNNGDKKTAADNYLFLVNWLERYPEYKERDFYIAGESYAGHYVPQLAHNI  235

Query  845   VKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF  1024
             +  N      + I LKGI+IGN ++N++TD  G YDYL SHA+ISD+    L + C  + 
Sbjct  236   LYHNKKANKKI-INLKGILIGNAVINEETDSDGLYDYLASHAIISDKAA-YLNKACHSSS  293

Query  1025  SIKCEHFERAAGIEIGS----IDFYNIYGPLCLDSESSRKVKRR-LGFDPCAEDYVYSYL  1189
             S   E    AAG E+G     ID YNIY PLC ++  +   KR  +  DPC+E YVY+YL
Sbjct  294   SKIQESVCDAAGDEVGDDIEYIDLYNIYAPLCKNANLTSLPKRNSIVTDPCSEYYVYAYL  353

Query  1190  NLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDS  1369
             N   VQ+ALHAN T L + WE CS+VIT W D+AST+ P+    + +  ++ +FSGD D 
Sbjct  354   NRKDVQEALHANVTNLKHDWEPCSDVITKWVDQASTVLPLLHEFLNNSLRVWIFSGDTDG  413

Query  1370  VVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTP  1546
              VP+TST+YSV  M L +   WHPW     +VGGY  +Y+ GL  ATVR AGH+VP + P
Sbjct  414   RVPITSTKYSVKKMNLPIKTAWHPWF-SYGEVGGYVEIYKGGLRLATVREAGHQVPSYQP  472

Query  1547  RRALTLLNMFL  1579
              RALTL+  FL
Sbjct  473   ARALTLIKYFL  483



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   436 bits (1121),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 289/417 (69%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GYV V++  GR+LFY+  ES  T  P ++PL+LWLNGGPGCSS+  
Sbjct  37    LPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWLNGGPGCSSVAY  96

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             G   E+GPF V  DGKTL+ + +AWNK+AN LFLESPAGVGFSYSNTSSD   +GD+RTA
Sbjct  97    GGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSSDLYTTGDQRTA  156

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y+FLV+WF+RFP YK RDFYIIGESYAG ++P+L+ ++ +RN        I LKG M
Sbjct  157   EDSYRFLVSWFERFPQYKHRDFYIIGESYAGHFVPQLSKLVHERNKGFRNP-AINLKGFM  215

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    R A +E 
Sbjct  216   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSVSSQHPSLQCMEALRNAELEQ  275

Query  1070  GSIDFYNIYGPLCLDS-ESSRKVKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++ +  R +K R       +DPC+E Y   Y N  +VQKALHAN T
Sbjct  276   GNIDPYSIFTKPCNNTVQLKRFLKGRYPWMSRAYDPCSERYSNVYFNRVEVQKALHANVT  335

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +LPY W+ CS+++  YW+D   +M PIYR LI +G KI +FSGD D+VVP+T+TRYS+DA
Sbjct  336   RLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVVPITATRYSIDA  395

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  L   FL
Sbjct  396   LKLATITNWYPWYDHGK-VGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFL  451



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   436 bits (1121),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 281/417 (67%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV F QY+GYV VDK  GR+LFY+  E+  ++ P+++PL+LWLNGGPGCSS+  
Sbjct  36    LPGQPKNVDFAQYSGYVTVDKQAGRALFYWLTETPTSRVPNSRPLVLWLNGGPGCSSVAY  95

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDG+TLY   +AWNK+AN LFLESPAGVGFSYSNT+SD   +GD++TA
Sbjct  96    GAAEEIGPFHIKPDGRTLYLNPYAWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQKTA  155

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DA+KFLVNWF+RFP YK RDFYI GESYAG Y+P+L+ +I +RN   +  + I  KG M
Sbjct  156   EDAHKFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQLIYERNKGIQNPV-INFKGFM  214

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L + C      + S +C+     A  E 
Sbjct  215   VGNAVTDDYHDYVGTFEYWWTHGLISDSTYRLLRKACDFGSSQHPSAECKKALTVAEFEQ  274

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+IY   C  + S R   R         +DPC E Y  +Y N P VQKA HAN T
Sbjct  275   GNIDPYSIYTRPCNSTASLRHNLRGHYPWMSRAYDPCTERYSVAYFNHPDVQKAFHANVT  334

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              + Y W  CS+++  YW D   +M PIY+ LI SG +I +FSGD DSVVPVT+TRYS+DA
Sbjct  335   GITYPWSTCSDLVGNYWADSPLSMLPIYQELIVSGIRIWVFSGDTDSVVPVTATRYSIDA  394

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K VGG+  +Y+GLTF TV GAGHEVP   PR A  L   FL
Sbjct  395   LKLPTISNWYPWYDHGK-VGGWSQIYKGLTFVTVAGAGHEVPLHRPREAFILFRSFL  450



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   436 bits (1121),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 221/419 (53%), Positives = 288/419 (69%), Gaps = 15/419 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GYV V++  GR+LFY+  ES  T  P  +PL+LWLNGGPGCSS+  
Sbjct  34    LPGQPSNVDFRQYSGYVTVNEVRGRALFYWLVESPSTRDPKFRPLVLWLNGGPGCSSVAY  93

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V  DGKTL+ + +AWN++AN LFLESPAGVGFSYSNT+SD   +GD+RTA
Sbjct  94    GAAEEIGPFRVGSDGKTLHPKLYAWNQLANLLFLESPAGVGFSYSNTTSDLYTTGDQRTA  153

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y+FLVNWF+RFP YK RDFYI+GESYAG ++P+L+ ++ +RN   +    I LKG M
Sbjct  154   EDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSKLVHERNKGFKNP-AINLKGFM  212

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF----SIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C        S++C    R A +E 
Sbjct  213   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSESSQHPSLQCMVALRNAELEQ  272

Query  1070  GSIDFYNIYGPLCLDSESSRK-VKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C  + + +  +K R       +DPC E Y   Y N   VQKALHAN T
Sbjct  273   GNIDPYSIFTKPCNSTVALKSFLKGRYPWMSRAYDPCTERYSNVYFNRADVQKALHANVT  332

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +LPY W+ CS+++ +YW+D   +M PIYR LI +G KI +FSGD D+VVPVT+TRYSVDA
Sbjct  333   RLPYPWKACSDIVGSYWEDSPLSMLPIYRELITAGLKIWIFSGDTDAVVPVTATRYSVDA  392

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLST  1585
             +KL  I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  L   FL +
Sbjct  393   LKLATITNWYPWYDHGK-VGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLDS  450



>ref|XP_002271490.3| PREDICTED: serine carboxypeptidase-like 40 isoform X3 [Vitis 
vinifera]
Length=501

 Score =   437 bits (1125),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 239/492 (49%), Positives = 306/492 (62%), Gaps = 26/492 (5%)
 Frame = +2

Query  155   MLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHG---------GITDEAWSeme  307
             ++F L I ++ +   HG  +  Q   +  L++AKMQ   G          I  EA S   
Sbjct  9     LVFFLFIFSSFVEQSHGRVR-KQTELLKLLQKAKMQGNSGIDTSLFEVNEIKSEAESYK-  66

Query  308   eeemVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHT  487
                 +    G  E D I   LPGQP +V F QY GYV +D++ G + +YYF E+  +  +
Sbjct  67    ----ILPQKGMKEKDRIER-LPGQP-HVGFSQYGGYVTIDESKGEAFYYYFVEAPTSRES  120

Query  488   KPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGF  667
              PL+LW NGGPGCSSL  GA  ELGPF V+ DGKTLY  ++AWNKVAN LFLESPAGVGF
Sbjct  121   LPLLLWFNGGPGCSSLAYGAMQELGPFRVHSDGKTLYRNQYAWNKVANVLFLESPAGVGF  180

Query  668   SYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIV  847
             SYSNT+SD    GDR+TA + Y FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I+
Sbjct  181   SYSNTTSDNQSGGDRKTANENYAFLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTIL  240

Query  848   KRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----  1012
               N      + I LKGI+IGN +++D+ D  G Y YL SHAL+S++T   + +HC     
Sbjct  241   HHNKKANGPI-INLKGIIIGNAVIDDEADDIGRYQYLGSHALVSEKTIHQMEKHCNFSPG  299

Query  1013  VVNFSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYL  1189
               + S +C          I  ID YNIY PLC ++  + K K+    FDPC++ YV +YL
Sbjct  300   ATSQSKECTEAVDEVHSNIDVIDIYNIYSPLCFNTILTAKPKKVTPEFDPCSDYYVSAYL  359

Query  1190  NLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDS  1369
             N   VQKALHAN TKL Y W  CS++   W D   T+ P+ R  +A+G ++ +FSGD D 
Sbjct  360   NRADVQKALHANVTKLKYEWRPCSDIDKNWTDSPLTIIPLLREFMANGLRVWVFSGDTDG  419

Query  1370  VVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTP  1546
              VPVTST  S+  M+L V  PWHPW     +VGGY  VY+G LTFATVRGAGH+VP F P
Sbjct  420   DVPVTSTMASIGKMRLSVKTPWHPWF-VAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRP  478

Query  1547  RRALTLLNMFLS  1582
             +RAL+L+  FLS
Sbjct  479   KRALSLIVHFLS  490



>ref|XP_004984181.1| PREDICTED: serine carboxypeptidase-like 26-like isoform X1 [Setaria 
italica]
Length=494

 Score =   437 bits (1124),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 214/407 (53%), Positives = 274/407 (67%), Gaps = 5/407 (1%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             +PGQ   V+F QYAGYV VD   GR+LFYYF E+ Q P  KPL+LWLNGGPGCSS G GA
Sbjct  83    MPGQTGVVEFGQYAGYVTVDAKAGRALFYYFVEAPQDPLDKPLVLWLNGGPGCSSFGSGA  142

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF V  D KTLY +R AWN+VAN LF+E PAGVG+SYSNT+SDY  +GD+RT  D
Sbjct  143   MLELGPFSVRNDNKTLYRKRHAWNRVANMLFVEIPAGVGYSYSNTTSDYYNTGDQRTTDD  202

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY F+VNW ++FP Y+ RDF+I GESYAG YIPELA++IV +N     T  + LKG+ IG
Sbjct  203   AYTFIVNWLEKFPEYRDRDFFITGESYAGHYIPELANLIVSKNRASNAT-NVKLKGVAIG  261

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSID  1081
             N  ++D+  +R  +DY W HA+IS + +  + + C  N  ++  C++    A  E G++D
Sbjct  262   NADLDDNLTLRASFDYYWMHAMISRKAYRAIKDKCDFNGTYTKDCQNAMNLATQEKGNVD  321

Query  1082  FYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCS  1261
              Y+IY P C D+ +  K    L  DPC   YV SYLN P+VQKALHAN T L Y W  CS
Sbjct  322   DYDIYAPTCHDASNPSKSSDSLVGDPCTNHYVSSYLNRPEVQKALHANTTGLHYPWMDCS  381

Query  1262  E-VITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWH  1438
             + V   WKD   TM P  ++LI+SG +I L+SGD+D+V    ST+Y +D + L +   W 
Sbjct  382   QHVFDNWKDSPETMLPSIKKLISSGIRIWLYSGDMDAVCSFISTQYVLDILGLPIETSWR  441

Query  1439  PWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             PW  D  +V GY + Y+GL FATVRGAGH VP + PRRAL L + FL
Sbjct  442   PWSIDN-EVAGYVIGYKGLVFATVRGAGHMVPYYQPRRALALFSSFL  487



>ref|XP_006470157.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Citrus 
sinensis]
Length=492

 Score =   437 bits (1124),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 219/409 (54%), Positives = 274/409 (67%), Gaps = 13/409 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QYAGYV VD   GRSLFYYFAES Q   T PL+LWLNGGPGCSSLG GA
Sbjct  83    LPGQPDGVDFDQYAGYVTVDPKTGRSLFYYFAESPQNSSTNPLLLWLNGGPGCSSLGYGA  142

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DGKTL+   +AWN VAN +FLESPAGVGFSYS+T SDY+++GD+ TA+D
Sbjct  143   MSELGPFRVNKDGKTLFRNNYAWNNVANVVFLESPAGVGFSYSSTKSDYELNGDKLTAQD  202

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL NW +RFP YK RDFYI GESYAG Y+P+LA  I+  N   + T+ I LKGI IG
Sbjct  203   SYTFLANWLERFPQYKKRDFYIAGESYAGHYVPQLAYTILLNNKNTKNTV-INLKGIAIG  261

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEIGS  1075
             N +++  T   G Y+ LW+HAL SD+TH G+  +C      N + +CE F   A  EIG 
Sbjct  262   NALIDGPTRSMGVYENLWTHALNSDQTHKGIFTYCDFAREGNDTKECETFLEKASDEIGD  321

Query  1076  IDFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
             ID YNIY P+C++    +  +     +DPC + YV +YLN  +VQ  LH      P  W 
Sbjct  322   IDIYNIYAPICINPAFQNGSIGSVHNYDPCTDYYVEAYLNTREVQTVLHVK----PTNWT  377

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
              CS  +  W D  ST+ P  + LIASG ++ ++SGDVD +VP  ++RYS++A+ L V  P
Sbjct  378   ACS--LFNWTDSPSTVLPTIKNLIASGIRVWIYSGDVDGIVPTIASRYSINALNLPVEIP  435

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             W+PW  +  +VGGY   Y+GLT  TVRGAGH VP   P RALTL++ FL
Sbjct  436   WYPWYTN-DEVGGYVEAYQGLTLVTVRGAGHLVPSDQPERALTLISSFL  483



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   436 bits (1120),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 289/417 (69%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GYV V++  GR+LFY+  ES  T  P ++PL+LWLNGGPGCSS+  
Sbjct  37    LPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWLNGGPGCSSVAY  96

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             G   E+GPF V  DGKTL+ + +AWNK+AN LFLESPAGVGFSYSNTSSD   +GD+RTA
Sbjct  97    GGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSSDLYTTGDQRTA  156

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y+FLVNWF+RFP YK RDFYIIGESYAG ++P+L+ ++ +RN   +    I LKG M
Sbjct  157   EDSYRFLVNWFERFPQYKHRDFYIIGESYAGHFVPQLSKLVHERNKGFKNP-AINLKGFM  215

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + +++C    R A +E 
Sbjct  216   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSVSSQHPTLQCMEALRNAELEQ  275

Query  1070  GSIDFYNIYGPLCLDSESSRK-VKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++   +  +K R       +DPC+E Y   Y N  +VQKALHAN T
Sbjct  276   GNIDPYSIFTKPCNNTVQLKSFLKGRYPWMSRAYDPCSERYSNVYFNRVEVQKALHANVT  335

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +LPY W+ CS+++  YW+D   +M PIYR LI +G KI +FSGD D+VVP+T+TRYS+DA
Sbjct  336   RLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVVPITATRYSIDA  395

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  L   FL
Sbjct  396   LKLTTITNWYPWYDHGK-VGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFL  451



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   436 bits (1121),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 218/425 (51%), Positives = 287/425 (68%), Gaps = 16/425 (4%)
 Frame = +2

Query  344   EDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGG  517
             E D I G LPGQP N  F QY+GYV V++  GR+LFY+  ES  ++ P ++PL+LWLNGG
Sbjct  39    ERDRI-GELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNGG  97

Query  518   PGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYD  697
             PGCSS+  G   E+GPF + PDGKTLYS  +AW+K+AN LFLESPAG+GFSY+NT+SD  
Sbjct  98    PGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDLY  157

Query  698   MSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTL  877
              +GD+RTA+DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ ++ ++N      +
Sbjct  158   TTGDQRTAEDAYAFLVNWFERFPEYKHRDFYIAGESYAGHYVPQLSQLVFEKNKGIRNPI  217

Query  878   KIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHF  1045
              I  KG ++GN + +D  D+ G ++Y W+H LISD T+  L   C      + S  C   
Sbjct  218   -INFKGFLVGNAVTDDYHDLIGTFEYWWTHGLISDSTYHALRAACPHGSSQHPSADCMKA  276

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQ  1207
               AA +E G+ID Y+I+   C  + S R   R         +DPC E Y   Y N P+VQ
Sbjct  277   LDAASVEQGNIDPYSIFTRPCNSTSSLRHNLRGHYPWMSRAYDPCTERYSEVYFNKPEVQ  336

Query  1208  KALHANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             KALHAN T LPY W+ CS+++  YW D   +M PIY+ LIA+G +I ++SGD D+VVPVT
Sbjct  337   KALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSGDTDAVVPVT  396

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTL  1564
             ++RYS+DA+KL  +  W+PW D+ K VGG+  VY+GLTF TV GAGHEVP   PR+A  L
Sbjct  397   ASRYSIDALKLATVINWYPWTDNGK-VGGWSQVYKGLTFVTVTGAGHEVPLLRPRQAFIL  455

Query  1565  LNMFL  1579
                FL
Sbjct  456   FRSFL  460



>ref|NP_001060508.1| Os07g0656900 [Oryza sativa Japonica Group]
 dbj|BAF22422.1| Os07g0656900, partial [Oryza sativa Japonica Group]
Length=444

 Score =   435 bits (1118),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 223/425 (52%), Positives = 278/425 (65%), Gaps = 22/425 (5%)
 Frame = +2

Query  365   GLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES---AQTPHTKPLILWLNGGPGCSSL  535
             GLPGQP+ V F QYAGYV VD   GR+LFYY AE+   A      PL+LWLNGGPGCSSL
Sbjct  8     GLPGQPAGVGFAQYAGYVTVDAAAGRALFYYLAEADGGAAASSKAPLLLWLNGGPGCSSL  67

Query  536   GVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRR  715
             G GA  ELGPF V  DG +LY   ++WN VAN +FLESP GVGFSYSNT++DY   GD  
Sbjct  68    GYGAMEELGPFRVKSDGVSLYRNPYSWNNVANVMFLESPIGVGFSYSNTTADYSRMGDNS  127

Query  716   TAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE----TTLKI  883
             TA+DAYKFLVNW +RFP YK RDFY+ GESYAG Y+P+LA  I++ ++       ++  I
Sbjct  128   TAEDAYKFLVNWMERFPEYKGRDFYLAGESYAGHYVPQLAHAILRHSSAAAGGKPSSSPI  187

Query  884   PLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK------CEHF  1045
              LKGIMIGN ++ND TD +G YD+ W+HALISDE +DG+ +HC  NF+        C+  
Sbjct  188   NLKGIMIGNAVINDWTDTKGMYDFFWTHALISDEANDGITKHC--NFTDGADANSLCDDA  245

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSE---SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKAL  1216
                A   +  ID YNIY P C       S         FDPC + YV +YLN P VQKAL
Sbjct  246   TSLADDCLQDIDIYNIYAPNCQSPGLVVSPPVTPSIESFDPCTDYYVEAYLNNPDVQKAL  305

Query  1217  HANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRY  1396
             HAN T+L + W  CS V+  W D AST+ PI + L+ +  ++ ++SGD D  VPVTS+RY
Sbjct  306   HANITRLDHPWSACSGVLRRWVDSASTVLPIIKELLKNNIRVWVYSGDTDGRVPVTSSRY  365

Query  1397  SVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTL  1564
             SV+ + L V   W PW  +T+    VGGY V Y+G L+  TVRGAGHEVP + P+RAL L
Sbjct  366   SVNQLNLPVAAKWRPWFSNTQGVGDVGGYIVQYKGNLSLVTVRGAGHEVPSYQPQRALVL  425

Query  1565  LNMFL  1579
             +  FL
Sbjct  426   VQYFL  430



>ref|XP_011090479.1| PREDICTED: serine carboxypeptidase II-3-like [Sesamum indicum]
Length=483

 Score =   436 bits (1122),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 225/419 (54%), Positives = 280/419 (67%), Gaps = 13/419 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G M+ D I+  LPGQP NV F QY+GY+ VD   GR+LFYYF ES     T PL+LWLNG
Sbjct  66    GQMQADKIST-LPGQPDNVDFDQYSGYITVDPQAGRALFYYFVESPTNSSTNPLVLWLNG  124

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS G GA  ELGPF VN DGKTL+   +AWN VAN +FLESPAGVGFSYSNTS+DY
Sbjct  125   GPGCSSFGFGAMEELGPFRVNSDGKTLFRNNYAWNNVANVIFLESPAGVGFSYSNTSADY  184

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D +GD RTA DAY FLVNW  RFP YK RDFYI GESYAG Y+P+LA  I+  N     T
Sbjct  185   DTTGDIRTAGDAYTFLVNWLDRFPQYKDRDFYITGESYAGHYVPQLAYTILINNKRTNQT  244

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-VVN--FSIKCEHF  1045
             + I LKGI IGN +++D    +G +D+LW++AL SDETH G++++C  VN   S KC  F
Sbjct  245   V-INLKGIAIGNALVDDSMLGQGFFDHLWTYALNSDETHAGILKYCDFVNGTASDKCFSF  303

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG-FDPCAEDYVYSYLNLPKVQKALHA  1222
              + +  E G  D  NIY P+CL+          +  FDPC++ YV  YLN  +VQ A H 
Sbjct  304   VQKSSDEAGDFDINNIYAPVCLNPVLKNGSTGSVNFFDPCSDTYVKYYLNTAEVQGAFHV  363

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
                  P TW  C     +W D  S + P  + L+ASG ++ L+SGD+D+ VPVTSTRY++
Sbjct  364   R----PTTWSGCRGF--HWTDWQSNVLPTIQDLMASGMRVWLYSGDIDANVPVTSTRYAI  417

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +++KL V   W PW  D  +VGGY V YEGLTF TVRGAGH VP + P+RAL +++ FL
Sbjct  418   NSLKLPVQTAWRPWYLD-DEVGGYVVGYEGLTFVTVRGAGHLVPSYQPQRALAMISSFL  475



>ref|NP_001147904.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACG29071.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=524

 Score =   437 bits (1125),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 226/443 (51%), Positives = 282/443 (64%), Gaps = 29/443 (7%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES---AQTPHTKPLIL  502
             VG  EDD ++  LPGQPS V F+QYAGYV VD   GR+LFYY AE+         KPL+L
Sbjct  72    VGRKEDDRVDR-LPGQPSGVDFEQYAGYVTVDAAAGRALFYYLAEAVGGGSASAAKPLLL  130

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSSLG GA  ELGPF V  DGKTLY   +AWN  AN LFLESPAGVGFSYSNT
Sbjct  131   WLNGGPGCSSLGYGAMEELGPFRVKSDGKTLYRNPYAWNNAANVLFLESPAGVGFSYSNT  190

Query  683   SSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM  862
             + DY  SGD +TA+DA +FL+NW ++FP YK RD Y+ GESYAG Y+P+LA  I+     
Sbjct  191   TEDYSRSGDNKTAEDALRFLLNWMEKFPEYKGRDLYLAGESYAGHYVPQLAHAILGHAAA  250

Query  863   --PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI--  1030
               P ++  + L+GIMIGN ++ND TD +G YD+ W+HALISD T D +  HC  NFS   
Sbjct  251   GKPSSSSPLNLRGIMIGNAVINDWTDTKGMYDFFWTHALISDATADAIGRHC--NFSAAA  308

Query  1031  ---------KCEHFERAAGIEIGSIDFYNIYGPLCLDSE--SSRKVKRRLGFDPCAEDYV  1177
                      KC      A   +  ID YNIY P C      S         FDPC++ YV
Sbjct  309   DADAAASNDKCNEATSEADEALQDIDIYNIYAPNCQSPGLVSPPITPSMDRFDPCSDYYV  368

Query  1178  YSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSG  1357
              +YLN P VQ+ALHAN T+L + W  CS+V+  W D A+T+ PI   L+ +  ++ ++SG
Sbjct  369   NAYLNDPDVQRALHANVTRLDHPWSACSDVLRRWTDSATTVLPILTELLNNDIRVWVYSG  428

Query  1358  DVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYEG-----LTFATVR  1513
             D D  VPVTS+RYSV+ ++L V   W  W   T+   +VGGY V Y+G     L+  TVR
Sbjct  429   DTDGRVPVTSSRYSVNQLQLPVAAKWRAWFSSTQGAGEVGGYVVQYKGKEKGSLSLVTVR  488

Query  1514  GAGHEVPQFTPRRALTLLNMFLS  1582
             GAGHEVP + PRRAL L+  FL+
Sbjct  489   GAGHEVPSYQPRRALVLVQGFLA  511



>emb|CDP16351.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   436 bits (1122),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 224/424 (53%), Positives = 285/424 (67%), Gaps = 12/424 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESA--QTPHTKPLILWL  508
             G  E D I+  LPGQP +V FKQY GY+ +++T GR+ FYYF E+   + P   PL+LWL
Sbjct  66    GLKEKDRIDR-LPGQP-HVGFKQYGGYITINETAGRAFFYYFVEAQGRKKPEDVPLLLWL  123

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             NGGPGCSSL  GAF ELGPF V  +GKTL+  RFAWN VAN LFLESPAGVGFSYSNT+S
Sbjct  124   NGGPGCSSLAYGAFQELGPFRVGSNGKTLFKNRFAWNYVANVLFLESPAGVGFSYSNTTS  183

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
             D+   GDR+TA D Y FL+NW +RFP YK RDFYI GESYAG Y+P+LA  IV  N    
Sbjct  184   DFVSGGDRKTAADNYIFLLNWLERFPEYKNRDFYISGESYAGHYVPQLAHNIVYHNKKAN  243

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCE  1039
              T+ I LKGI+IGN ++ND TD  G YDY  SHALIS ET   + + C       S  C+
Sbjct  244   RTI-INLKGILIGNAVINDATDDPGMYDYFASHALISPETVKKIHKFCNFSEAELSANCQ  302

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKA  1213
             +    A      +D YNIY P C D   +   K+   L FD C+E Y +SY N P VQ+A
Sbjct  303   NILSVADGVFDEVDIYNIYYPRCFDDSLTSVPKQFSILEFDECSEYYGHSYFNHPNVQEA  362

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             LHAN TK+PY W+ CS+V+  W D  ST+ P  +  +A+G K+ +FSGDVD  VPVT ++
Sbjct  363   LHANVTKIPYDWQPCSDVLQNWTDWQSTVLPFLKEFLANGLKVWIFSGDVDGRVPVTGSQ  422

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLN  1570
             Y+++A+ + ++ PW PW  D  +VGGY  +Y+  LTF TVRGAGH+VP + P RAL+L++
Sbjct  423   YAIEALNVSIVTPWQPWYRDL-EVGGYVQIYQDNLTFVTVRGAGHQVPSYKPDRALSLIS  481

Query  1571  MFLS  1582
              F+S
Sbjct  482   HFIS  485



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   435 bits (1119),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 218/417 (52%), Positives = 290/417 (70%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GYV V++  GR+LFY+  ES  T  P ++PL+LWLNGGPGCSS+  
Sbjct  37    LPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAY  96

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V  DGKTLY++ +AWNK+AN LFLESPAGVGFSY+N++SD   +GD+RTA
Sbjct  97    GATEEVGPFRVGSDGKTLYNKLYAWNKLANLLFLESPAGVGFSYTNSTSDLYTTGDQRTA  156

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y+FLVNWF+RFP YK RDFYI+GESYAG ++P+L+ ++ +RN   +    I LKG M
Sbjct  157   EDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSKLVHERNKGFKNP-SINLKGFM  215

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    R+A +E 
Sbjct  216   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSVSSQHPSLQCMEALRSAELEQ  275

Query  1070  GSIDFYNIYGPLCLDSESSRK-VKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++   +  +K R       +DPC E Y   Y N  +VQKALHAN T
Sbjct  276   GNIDPYSIFTKPCNNTVQLKSFLKGRYPWMSRAYDPCTERYSNVYFNRVEVQKALHANVT  335

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +L Y W+ CS+++  YW D   +M PIYR LIA+G KI +FSGD D+VVP+T+TRYS+DA
Sbjct  336   RLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVVPITATRYSIDA  395

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  +   FL
Sbjct  396   LKLATITNWYPWYDHGK-VGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFIIFRSFL  451



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   436 bits (1120),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 226/427 (53%), Positives = 281/427 (66%), Gaps = 15/427 (4%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLN  511
               S E D I   LPGQP  V F QY+GYV VD   GR+LFY+F E+       PLILWLN
Sbjct  42    AASQESDRITW-LPGQPP-VGFSQYSGYVTVDARAGRALFYWFIEAPPAAQPAPLILWLN  99

Query  512   GGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSD  691
             GGPGCSS+  GA  ELGPF ++PDGKTL+   +AWN  AN LFLESPAGVGFSYSNTSSD
Sbjct  100   GGPGCSSIAYGASEELGPFHIHPDGKTLFLNPYAWNSAANLLFLESPAGVGFSYSNTSSD  159

Query  692   YDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPET  871
                +GDRRTA DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ ++ ++N     
Sbjct  160   LYTAGDRRTAMDAYNFLVNWFERFPQYKYRDFYITGESYAGHYVPQLSQIVYRKNKGIRN  219

Query  872   TLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF----SIKCE  1039
              + I  KG M+GNG+ +D  D  G ++Y W+H LISD+T+  L   C +      S  C 
Sbjct  220   PI-INFKGFMVGNGVTDDYHDFVGTFEYWWTHGLISDDTYRDLRVTCDLQSSQHPSAGCL  278

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPK  1201
                 AA  E+G+ID Y+IY   C ++ + ++  R         +DPC E+Y   Y N P+
Sbjct  279   KVLEAAANELGNIDPYSIYTRACNETTTLKRKLRGHYPWMSRAYDPCTENYAEVYYNRPE  338

Query  1202  VQKALHANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVP  1378
             VQ ALHAN T +PY W  CS ++  +W D   +M PIYR LIA+G +I +FSGD DSVVP
Sbjct  339   VQMALHANVTGIPYPWNTCSNIVGNHWADSPRSMLPIYRELIAAGLRIWVFSGDTDSVVP  398

Query  1379  VTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRAL  1558
             VT+TRYS+DA+ L  +  W+PW D+ K VGG+  VYEGLTF TV GAGHEVP   PR+AL
Sbjct  399   VTATRYSIDALNLSTVISWYPWYDNGK-VGGWTQVYEGLTFVTVXGAGHEVPLHRPRQAL  457

Query  1559  TLLNMFL  1579
              L   FL
Sbjct  458   VLFKHFL  464



>ref|XP_002314060.2| hypothetical protein POPTR_0009s06090g [Populus trichocarpa]
 gb|EEE88015.2| hypothetical protein POPTR_0009s06090g [Populus trichocarpa]
Length=501

 Score =   436 bits (1122),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 228/430 (53%), Positives = 293/430 (68%), Gaps = 24/430 (6%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTK----PLIL  502
             GS E D I   LPGQP  V F QY GYV V+++ G +L+YYF E+ Q  H+K    PL+L
Sbjct  77    GSKEKDRIKM-LPGQP-RVNFSQYGGYVTVNESAGSALYYYFVEADQ--HSKESALPLLL  132

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSSLG GA  ELGPF V+ +GKTLY  +++WNKVAN LFLESPAGVGFSYSN 
Sbjct  133   WLNGGPGCSSLGYGAMEELGPFRVHSNGKTLYRNKYSWNKVANVLFLESPAGVGFSYSNA  192

Query  683   SSDYD-MSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
             +SDY   SGDR TA   Y FLVNW +RFP YK RDFYI GESYAG Y+P+LAD I+  N 
Sbjct  193   TSDYTYTSGDRETAAQNYMFLVNWLERFPEYKDRDFYIAGESYAGHYVPQLADTILHYNK  252

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI---  1030
               + ++ + LKGIMIGN ++ND TD++G YD+  +HA+ S+E    +  +C  NFS    
Sbjct  253   KAKRSV-VNLKGIMIGNSVINDHTDMQGMYDFFGTHAITSNENFRKIQHYC--NFSSAGS  309

Query  1031  ---KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNL  1195
                +C+     A  ++  ID YNIYGP C +S  + K K+   + FDPC++ YV +YLN 
Sbjct  310   LYKECQEAMGKADTDVSVIDIYNIYGPSCFNSNLTSKPKKTSPMNFDPCSDSYVLAYLNR  369

Query  1196  PKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVV  1375
             P VQ+A+HAN TKL Y W+ C      W D AST+ P+ +  +A+G ++ +FSGD D  V
Sbjct  370   PDVQEAMHANVTKLAYDWQPCGGF--NWVDSASTVLPLLKEFMANGLRVWVFSGDTDGRV  427

Query  1376  PVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRR  1552
             PVTS++YS++ M L +   WHPW  D ++VGGY  VY+G LTFATVRGAGH VP   P R
Sbjct  428   PVTSSQYSINEMNLPIKTQWHPWFSD-QEVGGYVQVYKGDLTFATVRGAGHMVPSIQPVR  486

Query  1553  ALTLLNMFLS  1582
             AL+L++ FLS
Sbjct  487   ALSLISHFLS  496



>ref|XP_010664592.1| PREDICTED: serine carboxypeptidase-like 40 [Vitis vinifera]
Length=485

 Score =   436 bits (1121),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 217/410 (53%), Positives = 284/410 (69%), Gaps = 10/410 (2%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP+ V F Q++GYV VD   GR+LFYYF ES Q   TKPL+LWLNGGPGCSS G+GA
Sbjct  74    LPGQPNGVDFDQFSGYVTVDSLAGRALFYYFVESPQNSTTKPLVLWLNGGPGCSSFGIGA  133

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF VN DG+TLY  + AWNK AN +FLESPAGVGFSYS+T+SDY+ SGD RTA D
Sbjct  134   MMELGPFRVNKDGETLYLNKHAWNKEANIIFLESPAGVGFSYSDTASDYNSSGDYRTASD  193

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL++W + FP YKTRDF+I GE YAG Y+P+LA  I+  N++P+  + I L+GI +G
Sbjct  194   SYIFLLSWLEIFPEYKTRDFFIAGEGYAGHYVPQLAQTILLFNSIPDLPI-INLRGIAMG  252

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEIGS  1075
             N  ++ +T  +G  DY WSHALISDE +  LI +C V    + S +C  +   A   +G+
Sbjct  253   NPYVDRETAFKGIVDYYWSHALISDEIYMELILNCNVSSEESASEECIAWLLQADNAMGN  312

Query  1076  IDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             I+ Y+IY PLC  S  S  +     FDPC+ +Y+++YLN+P+VQ+ALHAN T LP  WE 
Sbjct  313   INVYDIYAPLCNSSADSNSIS---AFDPCSGNYIHAYLNIPQVQEALHANVTGLPCPWEF  369

Query  1256  CS-EVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
             CS  +   WKD  +TM P  + L++SG ++ ++SGD D VVPVTS+RY +  +   V  P
Sbjct  370   CSVNIFGMWKDSPATMLPSIQELMSSGIQVWIYSGDTDGVVPVTSSRYFIKKLGTLVRTP  429

Query  1433  WHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             WHPW     +VGGY V Y+ LTF TVRG+GH VP + P R+L L   FL+
Sbjct  430   WHPWYTH-GEVGGYAVEYQNLTFVTVRGSGHFVPSYQPARSLQLFCSFLN  478



>ref|XP_010067798.1| PREDICTED: serine carboxypeptidase-like 40 [Eucalyptus grandis]
 gb|KCW66000.1| hypothetical protein EUGRSUZ_G03290 [Eucalyptus grandis]
Length=496

 Score =   436 bits (1122),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 234/484 (48%), Positives = 305/484 (63%), Gaps = 14/484 (3%)
 Frame = +2

Query  155   MLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDV  334
             +LF L I+++ L   HG  K  +    ++  ++K   +   +   +      +  ++   
Sbjct  12    LLFSLCILSS-LVHIHG-KKQGEVLDSLYRAKSKKSGIDTSLFQASVHPEILDSKIYHQE  69

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP  VKF  Y GYV VD+  GR+ +YYF+E+ +     PL+LWLNG
Sbjct  70    GLKEKDRIKM-LPGQPP-VKFDHYGGYVTVDELAGRAFYYYFSEAERNKELMPLLLWLNG  127

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA  E GPF V+ DGKTL+  +F WN  AN LFLESPAGVGFSYSNT+SDY
Sbjct  128   GPGCSSLAYGAMQEHGPFRVHSDGKTLFRNKFGWNAAANVLFLESPAGVGFSYSNTTSDY  187

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + +GD +TA D Y FL+NW +RFP YK RDFYI GESYAG Y+P+LA  I+  N     T
Sbjct  188   NANGDSKTAADNYVFLLNWLERFPEYKNRDFYISGESYAGHYVPQLAHNILSNNKKANKT  247

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCE  1039
             L I LKGI+IGN ++ND+TD  G Y+Y  +HAL SDET   + ++C     V N   +C 
Sbjct  248   L-INLKGIIIGNAVINDETDQSGMYEYFATHALASDETWYAIQKYCNFSPNVTNQVDQCN  306

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNLPKVQKA  1213
                  A  ++ SID YNIY PLC  S  +   K+   L FDPC + YVY+YLN   VQ+A
Sbjct  307   AALNEADNDVSSIDIYNIYAPLCFSSNLTSLPKKANILNFDPCGDYYVYAYLNREDVQEA  366

Query  1214  LHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             LHAN TKL + WE CS+VI  W D  ST+ P+ +  +++G ++ +FSGD D  VPVTST+
Sbjct  367   LHANVTKLNHDWEPCSDVIQQWGDSPSTIIPLLQEFMSNGLRVWVFSGDTDGRVPVTSTQ  426

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLN  1570
              S+  M L     W PW     +VGGY  VYEG LTFATVRGAGH VP + P+RAL+L++
Sbjct  427   RSLSKMSLPTKSKWRPWF-FKGEVGGYVQVYEGDLTFATVRGAGHMVPSYQPKRALSLIS  485

Query  1571  MFLS  1582
              FL+
Sbjct  486   HFLA  489



>ref|XP_006830191.1| hypothetical protein AMTR_s00173p00045470 [Amborella trichopoda]
 gb|ERM97607.1| hypothetical protein AMTR_s00173p00045470 [Amborella trichopoda]
Length=489

 Score =   436 bits (1121),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 220/411 (54%), Positives = 275/411 (67%), Gaps = 17/411 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F+QY+GYV VD T GR+LFYYF ES     TKPL++WLNGGPGCSSLG GA
Sbjct  81    LPGQPQGVDFEQYSGYVTVDPTAGRALFYYFVESPADSATKPLVIWLNGGPGCSSLGYGA  140

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF V  DGKTL+   +AWN+VAN LFLESPAGVGFSYSNTSSDY +SGD+RTA+D
Sbjct  141   MEELGPFRVMSDGKTLFRNPYAWNQVANMLFLESPAGVGFSYSNTSSDYKLSGDKRTARD  200

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FLVNW +RFP YKTRDF+I GESYAG Y+P+LA  I+  N        I  KGI IG
Sbjct  201   AYTFLVNWLERFPEYKTRDFFITGESYAGHYVPQLAYTILTSNNS-----NIKFKGIAIG  255

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAA-GIEIG  1072
             N  ++D+T+  G YDY W+HALISD+T   +  +C        S  C+    AA  +   
Sbjct  256   NAWIDDETNTLGMYDYFWTHALISDDTIGAIHTYCDFSPNATNSDHCDAAVNAANSVFYD  315

Query  1073  SIDFYNIYGPLCLDSESSRKVKRRLG-FDPCAEDYVYSYLNLPKVQKALHANNTKLPYTW  1249
              ID YNIY PLC  + ++      +  FDPC+  YV +YLNL +VQ ALHA     P +W
Sbjct  316   QIDIYNIYAPLCHTANTTLPPTGSIDYFDPCSSTYVENYLNLKEVQAALHAK----PTSW  371

Query  1250  EVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVI  1426
               CS ++  YW D  +T+ P  RRL+ SG  + ++SGD+D  VPVTS+RYSV+++ L  +
Sbjct  372   TACSGIVGAYWNDSPATLLPTIRRLLDSGISVWIYSGDIDGRVPVTSSRYSVNSLNLTKV  431

Query  1427  KPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PWH W  + ++V GY   Y+GL   TVRGAGH VP + P RAL +L+ FL
Sbjct  432   TPWHSWYLN-EEVAGYVEGYKGLALVTVRGAGHTVPSYQPARALAMLSFFL  481



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/417 (52%), Positives = 291/417 (70%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GYV V++  GR+LFY+  ES  T  P ++PL+LWLNGGPGCSS+  
Sbjct  37    LPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAY  96

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V  DGKTL+++ +AWNK+AN LFLESPAGVGFSY+N++SD   +GD+RTA
Sbjct  97    GAAEEVGPFRVGSDGKTLHNKLYAWNKLANLLFLESPAGVGFSYTNSTSDLYTTGDQRTA  156

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y+FLVNWF+RFP YK RDFYI+GESYAG ++P+L+ ++ +RN   +    I LKG M
Sbjct  157   EDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSKLVHERNKGFKNP-SINLKGFM  215

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    R+A +E 
Sbjct  216   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSVSSQHPSLQCMEALRSAELEQ  275

Query  1070  GSIDFYNIYGPLCLDSESSRK-VKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++   +  +K R       +DPC E Y   Y N  +VQKALHAN T
Sbjct  276   GNIDPYSIFTKPCNNTVQLKSFLKGRYPWMSRAYDPCTERYSNVYFNRVEVQKALHANVT  335

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +L Y+W+ CS+++  YW D   +M PIYR LIA+G KI +FSGD D+VVP+T+TRYS+DA
Sbjct  336   RLSYSWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVVPITATRYSIDA  395

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  +   FL
Sbjct  396   LKLATITNWYPWYDHGK-VGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFIIFRSFL  451



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 290/417 (70%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GYV V++  GR+LFY+  ES   ++P ++PL+LWLNGGPGCSS+  
Sbjct  38    LPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWLNGGPGCSSVAY  97

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V  DGKTL+ + +AWNK+AN LFLESPAGVGFSYSNT+SD   +GD+RTA
Sbjct  98    GAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTTSDLYTTGDQRTA  157

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y+FLVNWF+RFP YK RDFYI+GESYAG ++P+L+ ++ +RN   +    I LKG M
Sbjct  158   EDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSKLVHERNKGFKNP-AINLKGFM  216

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    R A +E 
Sbjct  217   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSVSSQHPSLQCMEALRNAELEQ  276

Query  1070  GSIDFYNIYGPLCLDSESSRK-VKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++ + +  +K R       +DPC E Y   Y N  +VQKALHAN T
Sbjct  277   GNIDPYSIFTKPCNNTVALKTFLKGRYPWMSRAYDPCTERYSNVYFNRVEVQKALHANVT  336

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +L Y W+ CS+++ +YW D   +M PIYR LI +G KI +FSGD D+VVPVT+TRYSVDA
Sbjct  337   RLRYPWKACSDIVGSYWTDSPMSMLPIYRELITAGLKIWVFSGDTDAVVPVTATRYSVDA  396

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  L   FL
Sbjct  397   LKLATITNWYPWYDHGK-VGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFKSFL  452



>ref|XP_003592243.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 ref|XP_003601340.1| Serine carboxypeptidase II-3 [Medicago truncatula]
Length=493

 Score =   436 bits (1121),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 227/411 (55%), Positives = 282/411 (69%), Gaps = 17/411 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QY+GYV VD   GR LFYYF ES     TKPL+LWLNGGPGCSSLG GA
Sbjct  81    LPGQPYGVNFDQYSGYVTVDPETGRELFYYFVESPCNSSTKPLVLWLNGGPGCSSLGYGA  140

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTLY   +AWN+VAN LFLESPAG+GFSYSNT+SDYD SGD+ TAKD
Sbjct  141   FQELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGIGFSYSNTTSDYDKSGDKSTAKD  200

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL+NW +RFP YKTRDFYI GESYAG Y+P+LA  I+  N + + T+ I LKGI +G
Sbjct  201   SYVFLINWLERFPQYKTRDFYISGESYAGHYVPQLASTILHNNKLYKNTI-INLKGISLG  259

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV---NFSIKCEHFERAAGIEIGSI  1078
             N  ++D T ++G YD LW+HAL SD+TH+ + ++C     N+S  C +    + IE G I
Sbjct  260   NAWIDDATSLKGLYDNLWTHALNSDQTHELIEKYCDFTKQNYSAICTNAMNMSMIEKGKI  319

Query  1079  DFYNIYGPLCLDSE----SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYT  1246
             D +NIY PLC DS     S+  V   L  DPC++ Y  +YLN P+VQKALHA     P  
Sbjct  320   DSFNIYAPLCHDSTLKNGSTGYVSNDL--DPCSDYYGTAYLNRPEVQKALHAK----PTN  373

Query  1247  WEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVI  1426
             W  CS  +  WKD   T+ P  + LI +G K+ ++SGD D+ V VT +RY ++ +KL + 
Sbjct  374   WSHCSINLN-WKDSPITILPTIKYLIDNGIKLWIYSGDTDA-VGVTISRYPINTLKLPID  431

Query  1427  KPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
               W PW    K++GGY V Y+GLTF TVRGAGH VP + P RALTL++ FL
Sbjct  432   STWRPWYSG-KEIGGYVVGYKGLTFVTVRGAGHLVPSWQPERALTLISSFL  481



>gb|KHN41581.1| Serine carboxypeptidase-like 25 [Glycine soja]
Length=453

 Score =   434 bits (1117),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 225/426 (53%), Positives = 281/426 (66%), Gaps = 25/426 (6%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V FKQ++GYV V+K  GR+LFY+ AE+AQ P TKPL++WLNGGPGCSS+  GA
Sbjct  25    LPGQP-KVSFKQFSGYVTVNKVAGRALFYWLAEAAQNPLTKPLVIWLNGGPGCSSVAYGA  83

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               E+GPF +N     LY  +F+WN VAN LFLE+PAGVGFSY+N SSD   +GDRRTA+D
Sbjct  84    SEEIGPFRINKTASGLYKNKFSWNSVANLLFLEAPAGVGFSYTNRSSDLLDTGDRRTAQD  143

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             + +F++ W +RFP YKTR+ YI GESYAG Y+P+LA  I+  N   +T   I LKGIM+G
Sbjct  144   SLEFVIQWLERFPRYKTRELYITGESYAGHYVPQLAKEIMTYNA--KTKHPINLKGIMVG  201

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF---SIKCEH-FERAAGIEIGS  1075
             N + ++  D  G   Y WSHA+ISD+T   L+  C  +    S +CE  +  A   E G+
Sbjct  202   NAVTDNYYDNLGTVTYWWSHAMISDQTFRQLMSRCDFHRQKESDECESVYSYAMDQEFGN  261

Query  1076  IDFYNIYGPLCLDSE-SSRKVKRRL---------------GFDPCAEDYVYSYLNLPKVQ  1207
             ID YNIY P C +S+ SS    RR                G+DPC E Y   Y N P VQ
Sbjct  262   IDQYNIYAPPCNNSDGSSSSATRRTMRLPHRPHVAFRHWSGYDPCTEKYAEIYYNRPDVQ  321

Query  1208  KALHANNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             KALHAN T +PY W  CSEV+   W D   ++ PIYR LIA G ++ +FSGDVDSVVPVT
Sbjct  322   KALHANKTGIPYRWTACSEVLNRNWNDTDVSVLPIYRELIAHGIRVWVFSGDVDSVVPVT  381

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTL  1564
             +TRY++  +KL    PW+PW     QVGG+  VYEG+TFATVRGAGHEVP F PR AL L
Sbjct  382   ATRYALAQLKLSTKIPWYPWYVKN-QVGGWTEVYEGVTFATVRGAGHEVPLFKPRAALQL  440

Query  1565  LNMFLS  1582
                FL+
Sbjct  441   FTSFLT  446



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   434 bits (1117),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 288/417 (69%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GYV V++  GR+LFY+  ES  T  P ++PL+LWLNGGPGCSS+  
Sbjct  35    LPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWLNGGPGCSSVAY  94

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             G   E+GPF V  DGKTL+ + +AWNK+AN LFLE+PAGVGFSYSNTSSD   +GD+RTA
Sbjct  95    GGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLEAPAGVGFSYSNTSSDLYTTGDQRTA  154

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y+FLVNWF+RFP YK RDFYIIGESYAG ++P+L+ ++ +RN   +    I LKG M
Sbjct  155   EDSYRFLVNWFERFPQYKHRDFYIIGESYAGHFVPQLSKLVHERNKGFKNP-AINLKGFM  213

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    R A +E 
Sbjct  214   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTSCYSVSSQHPSLQCMEALRNAELEQ  273

Query  1070  GSIDFYNIYGPLCLDS-ESSRKVKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++ E    +K R       +DPC+E Y   Y N  +VQKALHAN T
Sbjct  274   GNIDPYSIFTKPCNNTVELKSFLKGRYPWMSRAYDPCSERYSNVYFNRVEVQKALHANVT  333

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +LPY W+ CS+++  YW+D   +M PIYR LI +G KI +FSGD D+VVP+T+TRYS+DA
Sbjct  334   RLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVVPITATRYSIDA  393

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K V G+  VY+GLT  TV GAGHEVP   PR+A  L   FL
Sbjct  394   LKLATITNWYPWYDHGK-VAGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFL  449



>ref|XP_004231124.2| PREDICTED: serine carboxypeptidase-like 40 [Solanum lycopersicum]
Length=527

 Score =   437 bits (1124),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 227/422 (54%), Positives = 287/422 (68%), Gaps = 11/422 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             GS   D IN  LPGQP  VKF+QY GYV V+++ GR+L+YYF E A+     PL+LWLNG
Sbjct  103   GSKAKDWINK-LPGQPP-VKFQQYGGYVTVNQSAGRALYYYFTE-AENSEALPLLLWLNG  159

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS+  GA  ELGPF VN DGKTL+   +AWN+ AN LFLESPAGVGFSY+NTSSD+
Sbjct  160   GPGCSSMAYGAMEELGPFRVNSDGKTLHRNSYAWNRAANVLFLESPAGVGFSYTNTSSDF  219

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + +GD  TA D   FL+NW +RFP YK RDFYI GESYAG Y+P+LA  I+K N     T
Sbjct  220   NTTGDSTTANDNVVFLLNWLERFPEYKKRDFYISGESYAGHYVPQLAHEILKHNKQANRT  279

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV-NFS-IKCEHFE  1048
             L I LKGI+IGN ++NDDTD+ G Y+Y  SHALISDET+  +   C V N++  KC    
Sbjct  280   L-INLKGIIIGNAVINDDTDIIGMYEYFASHALISDETYHDIQNSCFVENYNESKCNSAI  338

Query  1049  RAAGIEIGSIDFYNIYGPLCLDSESSR--KVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
               +   I  +D YNIY PLC +   ++  K+   L  DPC+ DY+Y+YLN   VQ ALHA
Sbjct  339   AISDNNINYLDIYNIYFPLCKNGNLTKHPKIPPPLQIDPCSADYIYAYLNRRDVQDALHA  398

Query  1223  NNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N T + Y WE CS  + Y WKD + T+ P+    + +G ++ +FSGD D  VPVTS++ S
Sbjct  399   NVTNIKYEWESCSNTLFYNWKDSSVTIVPLLIESLENGVRVWIFSGDTDGRVPVTSSKRS  458

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLNMF  1576
             + AM L V +PW  W +   +VGGY   Y+ GLTFATVRGAGHEVP + P RAL+L++ F
Sbjct  459   IQAMNLTVDQPWRSWLNG-GEVGGYVETYKGGLTFATVRGAGHEVPSYQPARALSLISHF  517

Query  1577  LS  1582
             LS
Sbjct  518   LS  519



>ref|XP_002273192.3| PREDICTED: serine carboxypeptidase-like 40 [Vitis vinifera]
Length=497

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 237/471 (50%), Positives = 297/471 (63%), Gaps = 28/471 (6%)
 Frame = +2

Query  221   QARRIMWLRRAKMQQLHG---------GITDEAWSemeeeemVFDDVGSMEDDLINGGLP  373
             Q   +  LR+AKMQ   G          I  EA S       +    G  E D I   LP
Sbjct  32    QTELLNLLRKAKMQGNSGIDTSLFEVNEIESEAESYK-----ILPQKGMKEKDRIER-LP  85

Query  374   GQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFI  553
             GQP +V F QY GYV +D++ G +L+YYF E+  +    PL+LWLNGGPGCSSLG GA  
Sbjct  86    GQP-HVGFSQYGGYVTIDESKGEALYYYFVEAPTSKEYLPLLLWLNGGPGCSSLGAGAMA  144

Query  554   ELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAY  733
             ELGPF V+ DGKTLY  RFAWNK AN LFLE+P+GVGFSYSN S  Y+  GDR+TA   Y
Sbjct  145   ELGPFRVHSDGKTLYRNRFAWNKAANVLFLETPSGVGFSYSNIS--YNYRGDRKTAGANY  202

Query  734   KFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNG  913
              FLVNW +RFP YK RDFYI GESYAG ++P+LA VI+  N     T+ I LKGI IGN 
Sbjct  203   AFLVNWLERFPEYKKRDFYIAGESYAGHFVPQLAHVILHHNKKANRTI-INLKGITIGNA  261

Query  914   IMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCEHFERAAGIEIGSI  1078
              ++D+TD  G Y Y  SHAL+S  T   + +HC     V N + +C          I +I
Sbjct  262   AIHDETDWLGMYQYFGSHALVSPRTTRQIEKHCDFSPGVTNQNKECNAAFEEVDPNIANI  321

Query  1079  DFYNIYGPLCLDSESSRKVKR--RLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
               YNIYGP+CLD+  + K K+   L FDPC+ DYV++YLN P VQ+A HAN TKL Y WE
Sbjct  322   GIYNIYGPVCLDTNLTAKPKKVTPLQFDPCSYDYVHAYLNRPDVQEAFHANVTKLKYDWE  381

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
             +C+ V+  W D A ++  +    + +G ++ ++SGDVD  VPVTST  S+  M+L V  P
Sbjct  382   ICNNVVYNWTDSAWSIITLLHEFMENGLRVWVYSGDVDGRVPVTSTLASLAKMRLTVKTP  441

Query  1433  WHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             WHPW     +VGGY  VY+G LTFATVRGAGH+VP F PRRAL+ +  FL+
Sbjct  442   WHPWFLH-GEVGGYTEVYKGDLTFATVRGAGHQVPSFQPRRALSFIIHFLA  491



>ref|XP_002463311.1| hypothetical protein SORBIDRAFT_02g041610 [Sorghum bicolor]
 gb|EER99832.1| hypothetical protein SORBIDRAFT_02g041610 [Sorghum bicolor]
Length=526

 Score =   437 bits (1123),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/440 (51%), Positives = 284/440 (65%), Gaps = 26/440 (6%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES-AQTPHTKPLILWL  508
             VG  EDD ++  LPGQPS V F+QY+GYV VD   GR+LFYY AE+       KPL+LWL
Sbjct  77    VGRKEDDRVDK-LPGQPSGVDFEQYSGYVTVDAAAGRALFYYLAEAVGGGSAAKPLLLWL  135

Query  509   NGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             NGGPGCSSLG GA  ELGPF V  DGKTLY   +AWN  AN LFLESPAGVGFSYSNT++
Sbjct  136   NGGPGCSSLGYGAMEELGPFRVKSDGKTLYRNPYAWNNAANVLFLESPAGVGFSYSNTTA  195

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM--  862
             DY   GD +TA+DA +FL+NW  +FP YK RDFY+ GESYAG Y+P+LA  I++      
Sbjct  196   DYGRFGDNKTAEDALQFLLNWMDKFPEYKGRDFYLAGESYAGHYVPQLAHAILRHAAATA  255

Query  863   ----PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI  1030
                 P ++  I LKGIMIGN ++ND TD +G YD+ W+HALISD T D +  +C  NFS 
Sbjct  256   GGGKPSSSSPINLKGIMIGNAVINDWTDSKGMYDFFWTHALISDTTADAIGRYC--NFSA  313

Query  1031  ------KCEHFERAAGIEIGSIDFYNIYGPLCLDSE--SSRKVKRRLGFDPCAEDYVYSY  1186
                   KC+     A   +  ID YNIY P C   +  S         FDPC++ YV +Y
Sbjct  314   AAAGSDKCDEATSEADEALEDIDIYNIYAPNCQSDDLVSPPITPSMDNFDPCSDYYVNAY  373

Query  1187  LNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVD  1366
             LN P VQ ALHAN T+L + W  CS+V+  W D A+T+ PI   L+ +  ++ ++SGD D
Sbjct  374   LNDPAVQSALHANVTRLDHPWSACSDVLRRWTDSATTVLPILTELLKNDVRVWVYSGDTD  433

Query  1367  SVVPVTSTRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYEG-----LTFATVRGAG  1522
               VPVTS+RYSV+ ++L V   W  W   T+   +VGGY V Y+G     L+  TVRGAG
Sbjct  434   GRVPVTSSRYSVNQLQLPVAAKWRAWFSSTQGAGEVGGYVVQYKGKEKGSLSLVTVRGAG  493

Query  1523  HEVPQFTPRRALTLLNMFLS  1582
             HEVP + P+RAL L+  FL+
Sbjct  494   HEVPSYQPKRALVLVQNFLA  513



>ref|XP_003559864.1| PREDICTED: serine carboxypeptidase II-3-like [Brachypodium distachyon]
Length=518

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 229/441 (52%), Positives = 288/441 (65%), Gaps = 32/441 (7%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNV-----KFKQYAGYVNVDKTNGRSLFYYFAESAQT----PH  484
             VGS E D +   LPGQP+       +F QYAGYV VD   GR+LFYY AE+  T     +
Sbjct  73    VGSKEADRVEK-LPGQPAAAGDGGSEFAQYAGYVTVDAAAGRALFYYLAEAIGTGNGSSN  131

Query  485   TKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVG  664
             +KPL+LWLNGGPGCSSLG GA  ELGPF V  DGKTLY   ++WN  AN LFLESPAGVG
Sbjct  132   SKPLLLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLYRNPYSWNHAANVLFLESPAGVG  191

Query  665   FSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVI  844
             +SYSNT++DY   GD +TA+DAY FL NW +RFP YK RDFYI GESYAG Y+P+LA  I
Sbjct  192   YSYSNTTADYSRFGDNKTAEDAYLFLANWMERFPEYKGRDFYITGESYAGHYVPQLAHQI  251

Query  845   VKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF  1024
             ++  +       I LKGIMIGN ++ND TD +G YD+ W+HALISD+T D + ++C  NF
Sbjct  252   LRHKSP-----SINLKGIMIGNAVINDWTDSKGMYDFFWTHALISDDTADAINKNC--NF  304

Query  1025  SIK---------CEHFERAAGIEIGSIDFYNIYGPLCLDSE--SSRKVKRRLGFDPCAED  1171
             +           C+     A   +  ID YNIY P+C   +  S         FDPC + 
Sbjct  305   TAAGAGAASSDLCDEASGEANESLRDIDIYNIYAPVCQSDKLVSPPNTPSIESFDPCTDY  364

Query  1172  YVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLF  1351
             YV +YLN P VQKALHAN T+L + W  CS+V+  W D AST+ PI R L+ +  K+ ++
Sbjct  365   YVEAYLNNPDVQKALHANVTRLDHPWSACSDVLRRWVDSASTVLPIIRELMKNNIKVWVY  424

Query  1352  SGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYEG-LTFATVRGA  1519
             SGD D  VPVTS+RYSV+ ++L V + W PW   TK   +VGGY V Y+G L+  TVRGA
Sbjct  425   SGDTDGRVPVTSSRYSVNQLQLPVAEKWRPWFSSTKGTGEVGGYVVQYKGDLSLVTVRGA  484

Query  1520  GHEVPQFTPRRALTLLNMFLS  1582
             GHEVP + P+RAL L+  FL+
Sbjct  485   GHEVPSYQPQRALVLVQSFLA  505



>ref|XP_006345395.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=505

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 218/413 (53%), Positives = 282/413 (68%), Gaps = 12/413 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  VKF+QY GY+ +D++ GR+ +YYF E+  +  + PL+LWLNGGPGCSSL  GA
Sbjct  87    LPGQPL-VKFEQYGGYITIDESAGRAFYYYFVEAQLSNKSLPLLLWLNGGPGCSSLAYGA  145

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTL+   FAWN  AN LF+ESPAGVGFSYSNTSSD  + GDR+TA D
Sbjct  146   FQELGPFRVNSDGKTLHINNFAWNHAANVLFVESPAGVGFSYSNTSSDVKIGGDRKTAND  205

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
              Y+F++NW +RFP YK RDFYI GESYAG Y+P+LA  I+  N      + I LKGI+IG
Sbjct  206   NYRFIINWLERFPEYKDRDFYIAGESYAGHYVPQLAHTILYHNKKANKNI-INLKGILIG  264

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF-----SIKCEHFERAAGIEI-  1069
             N ++ND+TD RG Y+Y  SHALISDE    + + C         S +C+     A  +  
Sbjct  265   NAVINDETDTRGMYEYFASHALISDEVEAEIQKQCKFTIPESEESDECKMAGSIADYDTH  324

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR-RLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPY-  1243
             G ID Y IY PLC ++  + K KR  L  DPC++ Y  +Y+N P VQKALHAN T + Y 
Sbjct  325   GHIDIYAIYAPLCHNTNLTSKPKRPSLVIDPCSDYYTTAYMNRPDVQKALHANVTNIKYS  384

Query  1244  TWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKV  1423
             TW+ CS+V+T W D AST+ P+ +  +A+  ++ +FSGD D  VPVTST+ S+  M L +
Sbjct  385   TWQPCSDVLTNWTDSASTIIPLLKEFMANDIRVWIFSGDTDGRVPVTSTKKSIKIMNLPI  444

Query  1424  IKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
               PWHPW  +  ++GG   VY+G +TFATVRGAGH+VP + P RAL+L+  FL
Sbjct  445   KTPWHPWFLN-GELGGSTQVYKGDMTFATVRGAGHQVPGYEPARALSLIMHFL  496



>ref|XP_007131400.1| hypothetical protein PHAVU_011G010600g [Phaseolus vulgaris]
 gb|ESW03394.1| hypothetical protein PHAVU_011G010600g [Phaseolus vulgaris]
Length=496

 Score =   436 bits (1120),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 227/420 (54%), Positives = 284/420 (68%), Gaps = 10/420 (2%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I G LPGQP  V F QY GYV VDK+ GR+ +YYF E+ ++ HT PL+LWLNG
Sbjct  69    GLKEKDRI-GRLPGQPQ-VSFSQYGGYVTVDKSAGRAFYYYFVEAQRSKHTLPLLLWLNG  126

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA  ELGPF VN DGKTL++  F+WN+VAN LFLESP GVGFSYSN S+DY
Sbjct  127   GPGCSSLAYGAMQELGPFRVNSDGKTLHTNVFSWNRVANVLFLESPTGVGFSYSNKSTDY  186

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             D +GDR+TA D Y FLVNW +RFP YK RDF+I GESYAG Y+P+LA  I+  N  P   
Sbjct  187   DTNGDRKTAADNYLFLVNWLERFPEYKNRDFFIAGESYAGHYVPQLAHTILYHNKRPNKA  246

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIKCEHFERA  1054
             + I  KGI+IGN ++N +TD +G YDYL +HA+ISD+    +   C  +  I+    E A
Sbjct  247   I-INFKGILIGNAVINQETDSQGLYDYLATHAIISDKAA-FVNNACESSPKIQKSECEAA  304

Query  1055  AGI---EIGSIDFYNIYGPLCLDSESSRKVKR-RLGFDPCAEDYVYSYLNLPKVQKALHA  1222
                    I  ID YNIY P+C  +E + + K+  +  DPC+E YV +Y+N   VQ+ALHA
Sbjct  305   EEEVENNIEYIDLYNIYAPICNSTELTPRPKQYSIVTDPCSEYYVQAYMNRKDVQEALHA  364

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
             N T L Y WE CS+VIT W D AST+ PI   L+ +  ++ +FSGD D  VP+TST+YS+
Sbjct  365   NVTNLKYDWEPCSDVITKWVDGASTVLPILHELLNNSLRVWIFSGDTDGRVPITSTKYSI  424

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
               M+L V   WHPW     +VGGY  VY+ GLT ATVR AGH+VP + P RALTL+  FL
Sbjct  425   KKMELPVKTVWHPWFSH-GEVGGYAEVYKGGLTLATVREAGHQVPSYQPARALTLIKYFL  483



>ref|XP_010324807.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Solanum 
lycopersicum]
Length=491

 Score =   435 bits (1119),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/411 (55%), Positives = 282/411 (69%), Gaps = 10/411 (2%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  VKF+QY GYV VD + GR+L+YYF E A+   + PL+LWLNGGPGCSS+  GA
Sbjct  77    LPGQPP-VKFQQYGGYVTVDGSAGRALYYYFTE-AENSKSLPLLLWLNGGPGCSSIAYGA  134

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DGKTL+   +AWN VAN LFLESPAGVGFSY+NTSSD++ +GD RTA D
Sbjct  135   MEELGPFRVNSDGKTLHRNHYAWNLVANVLFLESPAGVGFSYTNTSSDFNTTGDSRTAND  194

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
                FL+NW +RFP YK RDFYI GESYAG Y+P+LA  I+K N     TL I LKGI+IG
Sbjct  195   NVVFLLNWLERFPEYKKRDFYISGESYAGHYVPQLAHEILKHNKQANKTL-INLKGIIIG  253

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK--CEHFERAAGIEIGSID  1081
             N ++NDDTD+ G Y+Y  SHALISDET   + ++C  N   K  C      +   +  ID
Sbjct  254   NAVINDDTDIIGTYEYYASHALISDETFLNIKKYCFDNHYNKSNCNEAVAVSNNNLYDID  313

Query  1082  FYNIYGPLCLDSESSR--KVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
              YNIY PLC D   ++  +V   L F+PC++ YVY+YLN   VQ ALHAN T + Y WE 
Sbjct  314   IYNIYFPLCKDGNLTKYPRVPSPLVFEPCSDQYVYAYLNRRDVQDALHANVTNIKYDWES  373

Query  1256  CSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
             CS+ + Y WKD  +T+ P+    + +G ++ +FSGD D  VPVTST+ S+ AM L V +P
Sbjct  374   CSDPLFYNWKDSPATIIPLLTESLENGVRVWIFSGDTDGSVPVTSTKKSIKAMNLIVDQP  433

Query  1433  WHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             W  W     ++GGY   Y+ GLTFATVRGAGHEVP + P RAL+L++ FLS
Sbjct  434   WRSWLSG-GEIGGYVETYKGGLTFATVRGAGHEVPSYQPARALSLISHFLS  483



>emb|CBI28591.3| unnamed protein product [Vitis vinifera]
Length=516

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 237/471 (50%), Positives = 297/471 (63%), Gaps = 28/471 (6%)
 Frame = +2

Query  221   QARRIMWLRRAKMQQLHG---------GITDEAWSemeeeemVFDDVGSMEDDLINGGLP  373
             Q   +  LR+AKMQ   G          I  EA S       +    G  E D I   LP
Sbjct  51    QTELLNLLRKAKMQGNSGIDTSLFEVNEIESEAESYK-----ILPQKGMKEKDRIER-LP  104

Query  374   GQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFI  553
             GQP +V F QY GYV +D++ G +L+YYF E+  +    PL+LWLNGGPGCSSLG GA  
Sbjct  105   GQP-HVGFSQYGGYVTIDESKGEALYYYFVEAPTSKEYLPLLLWLNGGPGCSSLGAGAMA  163

Query  554   ELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAY  733
             ELGPF V+ DGKTLY  RFAWNK AN LFLE+P+GVGFSYSN S  Y+  GDR+TA   Y
Sbjct  164   ELGPFRVHSDGKTLYRNRFAWNKAANVLFLETPSGVGFSYSNIS--YNYRGDRKTAGANY  221

Query  734   KFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNG  913
              FLVNW +RFP YK RDFYI GESYAG ++P+LA VI+  N     T+ I LKGI IGN 
Sbjct  222   AFLVNWLERFPEYKKRDFYIAGESYAGHFVPQLAHVILHHNKKANRTI-INLKGITIGNA  280

Query  914   IMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCEHFERAAGIEIGSI  1078
              ++D+TD  G Y Y  SHAL+S  T   + +HC     V N + +C          I +I
Sbjct  281   AIHDETDWLGMYQYFGSHALVSPRTTRQIEKHCDFSPGVTNQNKECNAAFEEVDPNIANI  340

Query  1079  DFYNIYGPLCLDSESSRKVKR--RLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
               YNIYGP+CLD+  + K K+   L FDPC+ DYV++YLN P VQ+A HAN TKL Y WE
Sbjct  341   GIYNIYGPVCLDTNLTAKPKKVTPLQFDPCSYDYVHAYLNRPDVQEAFHANVTKLKYDWE  400

Query  1253  VCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKP  1432
             +C+ V+  W D A ++  +    + +G ++ ++SGDVD  VPVTST  S+  M+L V  P
Sbjct  401   ICNNVVYNWTDSAWSIITLLHEFMENGLRVWVYSGDVDGRVPVTSTLASLAKMRLTVKTP  460

Query  1433  WHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             WHPW     +VGGY  VY+G LTFATVRGAGH+VP F PRRAL+ +  FL+
Sbjct  461   WHPWFLH-GEVGGYTEVYKGDLTFATVRGAGHQVPSFQPRRALSFIIHFLA  510



>ref|XP_002274699.1| PREDICTED: serine carboxypeptidase-like 28 [Vitis vinifera]
Length=472

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 222/419 (53%), Positives = 282/419 (67%), Gaps = 14/419 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPG+P NV F QY+GY+ VD   GR+LFY+  E+ ++  P ++PLILWLNGGPGCSS+  
Sbjct  45    LPGEPPNVGFSQYSGYITVDPRAGRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAY  104

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V PDGKTL+   +AWN  AN LFL+SPAGVGFSYSNTSSD    GD+RTA
Sbjct  105   GASEEVGPFRVRPDGKTLHLNPYAWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTA  164

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             KDAYKFL+NW +RFP YK R FYI GESYAG YIPEL+ +IV+RN   +    I  KG +
Sbjct  165   KDAYKFLINWLQRFPQYKHRPFYIAGESYAGHYIPELSQIIVQRNKGMKNP-AINFKGFL  223

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI----KCEHFERAAGIEI  1069
             +GN +++D  D +G +++ WSH LISD T++ L E C  +  +    KC +    A  E 
Sbjct  224   LGNPLIDDYYDNKGTHEFWWSHGLISDSTYEALKEACANDTFLFPKDKCNNALTGAYKEF  283

Query  1070  GSIDFYNIYGPLCLDSES-SRKVKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G ID YNIY   C +  +     K  L     G D C   Y   Y+N  +VQKA HAN T
Sbjct  284   GDIDPYNIYSGPCREVATLGNNSKLPLPWTFRGNDECIVRYTRKYMNRGEVQKAFHANVT  343

Query  1232  KLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              LPY+W  CS ++   W D   +M PI+++LI++G +I LFSGD D+V+P+T+TRYS+ A
Sbjct  344   HLPYSWATCSSIVRRNWSDSPKSMLPIFKQLISAGIRIWLFSGDTDAVLPLTATRYSIKA  403

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLST  1585
             +KLK I  WH W DD ++VGG+  VYEGLTF TVRGAGHEVP   PRRAL LL  FL+ 
Sbjct  404   LKLKTITNWHAWYDDKQEVGGWSQVYEGLTFTTVRGAGHEVPLGQPRRALILLGHFLNN  462



>gb|EMT05424.1| Serine carboxypeptidase II-3 [Aegilops tauschii]
Length=504

 Score =   436 bits (1120),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 231/498 (46%), Positives = 306/498 (61%), Gaps = 30/498 (6%)
 Frame = +2

Query  155   MLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITD--EAWSemeeeemVFD  328
             +L L++ +   L  G       +AR+  +LRR +       + +   A +      +   
Sbjct  5     VLMLVLALVQCLALGCSTAAAARARQGDYLRRLRWSSSLAAVEEPTRATASRRPRSVPAA  64

Query  329   DVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--------AQTPH  484
             +VG  E D ++  LPGQP  V F QYAGYV VD   GR+LFYY AE+          +  
Sbjct  65    EVGRKEADRVDA-LPGQPRGVDFAQYAGYVTVDAAAGRALFYYLAEAVGCHASGDGSSSK  123

Query  485   TKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVG  664
              KPL+LWLNGGPGCSSLG GA  ELGPF V  DGKTLY   ++WN  AN LFLESPAGVG
Sbjct  124   GKPLLLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLYRNPYSWNHAANVLFLESPAGVG  183

Query  665   FSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVI  844
             +SYSNT++DYD SGD RTA+DAY FL +W +RFP YK RDFYI GESYAG + P+LA  +
Sbjct  184   YSYSNTTADYDRSGDNRTAEDAYAFLASWMERFPEYKGRDFYIAGESYAGHFAPQLAHAV  243

Query  845   VKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF  1024
             ++       +L I LKG+MIGN ++N+ TD +G +D+ W+HALISDET  G+ ++C  NF
Sbjct  244   LR-----HASLAINLKGVMIGNAVINEGTDKKGTFDFYWTHALISDETAAGVNQNC--NF  296

Query  1025  SIK------CEHFERAAGIEIGSIDFYNIYGPLC-LDSESSRKVKRRL-GFDPCAEDYVY  1180
             +        C+         +  ID YNIY P C  +   +  +   +  FD C  +YV 
Sbjct  297   TNGAQSNDLCDQANDDVVENLRDIDNYNIYAPNCQTEGLVTPPITPSIESFDTCTSNYVE  356

Query  1181  SYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGD  1360
             +YLN P VQKA HAN T+L + W  CSEV+T W D  +T+ PI R L+ +  ++ ++SGD
Sbjct  357   AYLNKPDVQKAFHANVTRLDHPWLACSEVLTRWIDSTTTVLPIIRELMKNNIRVWVYSGD  416

Query  1361  VDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYE-GLTFATVRGAGHE  1528
              D  VPVT+TRYS++ ++L V   W  W   TK   +VGGY V Y+ GL+  TVRGAGHE
Sbjct  417   TDGNVPVTATRYSINQLQLPVAAKWRRWFSSTKGAGEVGGYVVQYKGGLSLVTVRGAGHE  476

Query  1529  VPQFTPRRALTLLNMFLS  1582
             VP + P+RAL LL  FL+
Sbjct  477   VPSYQPQRALQLLQAFLA  494



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   434 bits (1116),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 280/417 (67%), Gaps = 16/417 (4%)
 Frame = +2

Query  368   LPGQPSNV-KFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVG  544
             LPG+P+NV  F QY+GYV VD+  GR+LFY+  ES   P  +PL+LWLNGGPGCSS+  G
Sbjct  40    LPGEPANVVDFSQYSGYVTVDQNAGRALFYWLTESPTRPSLRPLVLWLNGGPGCSSVAYG  99

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             A  ELGPF +NPDGK+L+   +AWNK+AN LFL+SPAGVGFSYSN+SSD    GD +TA 
Sbjct  100   AAEELGPFHINPDGKSLFLNPYAWNKLANILFLDSPAGVGFSYSNSSSDLKHPGDNQTAA  159

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT-MPETTLKIPLKGIM  901
             DAY FLVNW  RFP YK R+FYI GESYAG Y+P+LA +I +RN  +P   +    KG M
Sbjct  160   DAYAFLVNWLGRFPQYKYREFYIAGESYAGHYVPQLAQLIYQRNKGLPNPIIN--FKGFM  217

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C     ++ S++C      A +E 
Sbjct  218   VGNAVTDDYHDYVGTFEYWWTHGLISDGTYRVLRLACDFGSAMHPSVECIKALDLANLEQ  277

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+IY P C  S + +   R         +DPC E +   Y NLP+VQKALHAN T
Sbjct  278   GNIDPYSIYSPPCNASATLKNKPRGHYPWMSRAYDPCTERHSKVYFNLPEVQKALHANVT  337

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              +PY W  CS+V+   W+D   +M PIY+ LIA+G +I +FSGD DSVVPVT+TRYS+DA
Sbjct  338   GIPYPWATCSDVVGNNWQDSPKSMLPIYQELIAAGFRIWVFSGDTDSVVPVTATRYSLDA  397

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  +  W+PW D+ K VGG+  VY GLTF T+ GAGHEVP   PR+A  L   FL
Sbjct  398   LKLPTLTNWYPWYDNGK-VGGWSQVYRGLTFVTITGAGHEVPLHRPRQAFILFKSFL  453



>emb|CBI31484.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   435 bits (1118),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 222/419 (53%), Positives = 282/419 (67%), Gaps = 14/419 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPG+P NV F QY+GY+ VD   GR+LFY+  E+ ++  P ++PLILWLNGGPGCSS+  
Sbjct  56    LPGEPPNVGFSQYSGYITVDPRAGRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAY  115

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V PDGKTL+   +AWN  AN LFL+SPAGVGFSYSNTSSD    GD+RTA
Sbjct  116   GASEEVGPFRVRPDGKTLHLNPYAWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTA  175

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             KDAYKFL+NW +RFP YK R FYI GESYAG YIPEL+ +IV+RN   +    I  KG +
Sbjct  176   KDAYKFLINWLQRFPQYKHRPFYIAGESYAGHYIPELSQIIVQRNKGMKNP-AINFKGFL  234

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI----KCEHFERAAGIEI  1069
             +GN +++D  D +G +++ WSH LISD T++ L E C  +  +    KC +    A  E 
Sbjct  235   LGNPLIDDYYDNKGTHEFWWSHGLISDSTYEALKEACANDTFLFPKDKCNNALTGAYKEF  294

Query  1070  GSIDFYNIYGPLCLDSES-SRKVKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G ID YNIY   C +  +     K  L     G D C   Y   Y+N  +VQKA HAN T
Sbjct  295   GDIDPYNIYSGPCREVATLGNNSKLPLPWTFRGNDECIVRYTRKYMNRGEVQKAFHANVT  354

Query  1232  KLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              LPY+W  CS ++   W D   +M PI+++LI++G +I LFSGD D+V+P+T+TRYS+ A
Sbjct  355   HLPYSWATCSSIVRRNWSDSPKSMLPIFKQLISAGIRIWLFSGDTDAVLPLTATRYSIKA  414

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLST  1585
             +KLK I  WH W DD ++VGG+  VYEGLTF TVRGAGHEVP   PRRAL LL  FL+ 
Sbjct  415   LKLKTITNWHAWYDDKQEVGGWSQVYEGLTFTTVRGAGHEVPLGQPRRALILLGHFLNN  473



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   434 bits (1115),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 215/417 (52%), Positives = 287/417 (69%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAE--SAQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV+F QY+GYV V++  GR+LFY+  E  ++++P  +PL+LWLNGGPGCSS+  
Sbjct  36    LPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPEARPLVLWLNGGPGCSSVAY  95

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTLY   +AWNK+AN LFLESPAGVGFSYSNTSSD   +GD+RTA
Sbjct  96    GAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTA  155

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ V+ ++N   +  + I  KG +
Sbjct  156   EDAYTFLVNWFERFPQYKYRDFYIAGESYAGHYVPQLSQVVYQKNKGIKNPV-INFKGFL  214

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C      A +E 
Sbjct  215   VGNAVTDDYHDYVGTFEYWWTHGLISDSTYQTLRVTCDFESSTHPSVECIKALMLAELEQ  274

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++ + R   R         +DPC + Y   Y N P+VQKALHAN T
Sbjct  275   GNIDPYSIFTQPCNNTAALRHNLRGHYPWMSRAYDPCTDRYSKVYFNHPEVQKALHANVT  334

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              +PY W+ CS+++  YW D   +M PIY+ L+A+G +I ++SGD D+VVPVT+TRYS+DA
Sbjct  335   GIPYQWKTCSDIVGDYWADSPLSMLPIYKELMAAGLRIWVYSGDTDAVVPVTATRYSIDA  394

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D+ K VGG+  VY+GL+F TV GAGHEVP   PR+A  L   FL
Sbjct  395   LKLPTIINWYPWYDNGK-VGGWSQVYKGLSFVTVTGAGHEVPLHRPRQAFILFRSFL  450



>ref|XP_006345490.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=486

 Score =   435 bits (1118),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 224/420 (53%), Positives = 288/420 (69%), Gaps = 10/420 (2%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G    D IN  LPGQP  VKF+QY GYV V+++ GR+L+YYF E A+  +  PL+LWLNG
Sbjct  65    GLKAKDWINK-LPGQPP-VKFQQYGGYVTVNQSAGRALYYYFTE-AENSNALPLLLWLNG  121

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS+  GA  ELGPF VN DGKTL+  R+AWN  AN LFLESPAGVGFSY+NTSSD 
Sbjct  122   GPGCSSIAYGAMEELGPFRVNSDGKTLHRNRYAWNHAANVLFLESPAGVGFSYTNTSSDL  181

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + +GD RTA D   FL+NW +RFP YK RDFYI GESYAG Y+P+LA  I++ N + + T
Sbjct  182   NTTGDSRTANDNVVFLLNWLERFPEYKNRDFYISGESYAGHYVPQLAHAILQLNKLEKKT  241

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCV-VNFSI-KCEHFE  1048
             L I LKGI+IGN ++NDDTD  G Y+Y  SHALISDET+  ++  C   N++  KC+   
Sbjct  242   L-INLKGIIIGNAVINDDTDTIGMYEYFASHALISDETYHDILNSCYDDNYNQRKCDEAA  300

Query  1049  RAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANN  1228
                   + ++D YNIY PLC D   + K  +    DPC++ Y+Y+Y+N   VQ ALHAN 
Sbjct  301   EITNKNLNNLDIYNIYYPLCKDGNLT-KYPKTPTIDPCSDKYIYAYMNRRNVQDALHANV  359

Query  1229  TKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVD  1405
             T L Y W  CS+ + Y WKD   T+ P+ +  +A+G ++ +FSGD D  VPVTS++ S+ 
Sbjct  360   TNLKYDWTSCSDSLFYDWKDSPVTIIPLLKESLANGVRVWIFSGDTDGRVPVTSSKRSIQ  419

Query  1406  AMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             AM L V +PW  W +   +VGGY   Y+ GLTFATVRGAGHEVP + P RAL+L++ FLS
Sbjct  420   AMNLTVDQPWRSWLNG-GEVGGYVETYKGGLTFATVRGAGHEVPSYQPTRALSLISHFLS  478



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   436 bits (1121),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 218/425 (51%), Positives = 287/425 (68%), Gaps = 16/425 (4%)
 Frame = +2

Query  344   EDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGG  517
             E D I G LPGQP N  F QY+GYV V++  GR+LFY+  ES  ++ P ++PL+LWLNGG
Sbjct  100   ERDRI-GELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNGG  158

Query  518   PGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYD  697
             PGCSS+  G   E+GPF + PDGKTLYS  +AW+K+AN LFLESPAG+GFSY+NT+SD  
Sbjct  159   PGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDLY  218

Query  698   MSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTL  877
              +GD+RTA+DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ ++ ++N      +
Sbjct  219   TTGDQRTAEDAYAFLVNWFERFPEYKHRDFYIAGESYAGHYVPQLSQLVFEKNKGIRNPI  278

Query  878   KIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHF  1045
              I  KG ++GN + +D  D+ G ++Y W+H LISD T+  L   C      + S  C   
Sbjct  279   -INFKGFLVGNAVTDDYHDLIGTFEYWWTHGLISDSTYHALRAACPHGSSQHPSADCMKA  337

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQ  1207
               AA +E G+ID Y+I+   C  + S R   R         +DPC E Y   Y N P+VQ
Sbjct  338   LDAASVEQGNIDPYSIFTRPCNSTSSLRHNLRGHYPWMSRAYDPCTERYSEVYFNKPEVQ  397

Query  1208  KALHANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVT  1384
             KALHAN T LPY W+ CS+++  YW D   +M PIY+ LIA+G +I ++SGD D+VVPVT
Sbjct  398   KALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSGDTDAVVPVT  457

Query  1385  STRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTL  1564
             ++RYS+DA+KL  +  W+PW D+ K VGG+  VY+GLTF TV GAGHEVP   PR+A  L
Sbjct  458   ASRYSIDALKLATVINWYPWTDNGK-VGGWSQVYKGLTFVTVTGAGHEVPLLRPRQAFIL  516

Query  1565  LNMFL  1579
                FL
Sbjct  517   FRSFL  521



>ref|XP_004229673.1| PREDICTED: serine carboxypeptidase-like 40 [Solanum lycopersicum]
Length=504

 Score =   435 bits (1119),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 220/415 (53%), Positives = 283/415 (68%), Gaps = 16/415 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  VKF+QY GY+ +D+  GR+ +YYF E+  +  + PL+LWLNGGPGCSSL  GA
Sbjct  86    LPGQPL-VKFEQYGGYITIDEFAGRAFYYYFVEAQHSKKSLPLLLWLNGGPGCSSLAYGA  144

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DGKTL+   FAWN  AN LF+ESPAGVGFSYSNTSSD  + GDR+TA D
Sbjct  145   FQELGPFRVNSDGKTLHINNFAWNHAANVLFVESPAGVGFSYSNTSSDVKIGGDRKTAND  204

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
              Y F++NW +RFP YK RDFYI GESYAG Y+P+LA  I+  N      + I LKGI+IG
Sbjct  205   NYLFIINWLERFPEYKDRDFYIAGESYAGHYVPQLAHTILYHNKKANKNI-INLKGILIG  263

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI-------KCEHFERAAGIE  1066
             N ++ND+TD RG Y+Y  SHALISDE    + + C   F+I       +C+     A  +
Sbjct  264   NAVINDETDTRGMYEYFASHALISDEVEAEIQKQC--KFTIPESEETDECKMAGSIADYD  321

Query  1067  IGS-IDFYNIYGPLCLDSESSRKVKR-RLGFDPCAEDYVYSYLNLPKVQKALHANNTKLP  1240
               S ID Y IY PLC ++  + K KR  L  DPC++ Y  +Y+N P VQKALHAN T + 
Sbjct  322   AHSHIDIYAIYAPLCHNTNLTSKPKRPSLVIDPCSDYYTTAYMNRPDVQKALHANVTNIK  381

Query  1241  Y-TWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKL  1417
             Y TW+ CS+V+T W D AST+ P+ +  +A+  ++ +FSGD D  VPVTST+ S+  M L
Sbjct  382   YSTWQPCSDVLTNWTDSASTIIPLLKEFMANDIRVWIFSGDTDGRVPVTSTKKSIKKMNL  441

Query  1418  KVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              +  PWHPW  +  ++GGY  VY+G +TFATVRGAGH+VP + P RAL+L+  FL
Sbjct  442   PIKTPWHPWFLN-GELGGYSQVYKGDMTFATVRGAGHQVPGYEPARALSLIMHFL  495



>ref|XP_008658699.1| PREDICTED: lysosomal protective protein isoform X1 [Zea mays]
Length=493

 Score =   435 bits (1118),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 211/408 (52%), Positives = 274/408 (67%), Gaps = 6/408 (1%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             +PGQ    +F QYAGYV VD   GR+LFYYF E+ Q P  KPL+LWLNGGPGCSS G GA
Sbjct  81    MPGQTGVAEFDQYAGYVTVDAKAGRALFYYFVEAPQDPSNKPLVLWLNGGPGCSSFGSGA  140

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF V+ D KTLY +R AWN++AN LF+E PAGVG+SYSNT+SDY  +GD+RT  D
Sbjct  141   MVELGPFSVHSDNKTLYKKRHAWNRMANMLFIEIPAGVGYSYSNTTSDYYNTGDQRTTDD  200

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+ W ++FP Y+ RDF+I GESYAG YIPELA++I+ +N     T  I LKG+ IG
Sbjct  201   AYTFLITWLEKFPEYQDRDFFITGESYAGHYIPELANLILSKNRATNVT-SIKLKGVAIG  259

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSID  1081
             N  ++D+  +R  YDY W HA+IS + +  + + C  N  ++  C++    A  E G+ID
Sbjct  260   NADLDDNLTLRASYDYYWMHAMISGKAYKAVKDKCGFNGTYTEDCQNAMDLATQEKGNID  319

Query  1082  FYNIYGPLCLDSESSRKVKRRLGF-DPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVC  1258
              Y+IY P+C D+ +  K    L F DPC   YV SYLN P+VQ+ALHAN T L Y W  C
Sbjct  320   DYDIYAPICQDASNPSKSSDSLVFGDPCTNHYVSSYLNRPEVQRALHANTTGLGYPWMDC  379

Query  1259  S-EVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             S ++   WKD   TM P  ++LI+SG +I L+SGD+D+V    ST+Y +D + L +   W
Sbjct  380   SQQIFDNWKDSPETMLPSIKKLISSGTRIWLYSGDMDAVCSFISTQYVLDNLGLPIEAAW  439

Query  1436  HPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PW  D  +V GY + Y+GL F TVRGAGH VP + PRRAL L + FL
Sbjct  440   RPWRVD-NEVAGYVIGYKGLVFVTVRGAGHMVPYYQPRRALALFSSFL  486



>ref|XP_010908844.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=462

 Score =   433 bits (1114),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 279/417 (67%), Gaps = 13/417 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP+NV F QY+GYV VD + GR+LFY+  E+       PL+LWLNGGPGCSS+  GA
Sbjct  43    LPGQPTNVAFSQYSGYVTVDPSAGRALFYWLVEAPPAAQPAPLVLWLNGGPGCSSIAYGA  102

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF + PDG TLY  R AWN VAN LFLESPAGVGFSYSN S D   +GDRRTA D
Sbjct  103   SEELGPFRIRPDGYTLYLNRHAWNNVANVLFLESPAGVGFSYSNFSMDLYTAGDRRTATD  162

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FLVNWF+RFP YK R+FYI GESYAG Y+P+L+ VIV++N   +  + I  KG M+G
Sbjct  163   AYVFLVNWFERFPQYKYREFYIAGESYAGHYVPQLSQVIVQKNKDVQNPI-INFKGFMVG  221

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF----SIKCEHFERAAGIEIGS  1075
             N + +D  D  G ++Y W+H LISD T+  L   C +      S +C      AG E G+
Sbjct  222   NAVTDDFHDYVGTFEYWWAHGLISDTTYHNLRATCNLQSSQHPSAECVKNLNIAGSEQGN  281

Query  1076  IDFYNIYGPLCLDSES-SRKVKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNTKL  1237
             ID Y+IY   C DS +  R +K R       +DPC + Y   Y N P+VQ+ALHAN T +
Sbjct  282   IDPYSIYTRPCNDSSALKRNLKGRYPWMSRAYDPCTDRYAKVYYNRPEVQRALHANVTGI  341

Query  1238  PYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMK  1414
              Y W+ CS+++  YW D   +M PIY+ LIA+G +I +FSGD D+VVPVT+TRYS+DA++
Sbjct  342   RYAWDTCSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSGDTDAVVPVTATRYSIDALE  401

Query  1415  LKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLST  1585
             L  ++ W+PW D  K VGG+  VY+GLTF T+ GAGHEVP   PR+AL L   FL  
Sbjct  402   LPTLRRWYPWYDHGK-VGGWSQVYKGLTFVTITGAGHEVPLHRPRQALILFRHFLQN  457



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   433 bits (1113),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 222/422 (53%), Positives = 284/422 (67%), Gaps = 22/422 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV F QY+GYV V++  GR+LFY+  ES +   P ++PL+LWLNGGPGCSS+  
Sbjct  35    LPGQP-NVGFAQYSGYVTVNRKAGRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAY  93

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+G F + PDGKTLY   +AWN +AN LFLESPAGVGFSY+NTSSD   +GD+RTA
Sbjct  94    GAAEEIGAFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTA  153

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ +I +RN   +  + I  KG M
Sbjct  154   EDAYAFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQIIYERNKGKQNPI-INFKGFM  212

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C +    + S++C    + A  E 
Sbjct  213   VGNAVTDDYHDFIGTFEYWWNHGLISDSTYRVLRVTCDLGSSQHPSVECMRALKIAETEQ  272

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRRL---------GFDPCAEDYVYSYLNLPKVQKALHA  1222
             G+ID Y+IY   C    S+  +KR L          +DPC E Y   Y N P VQKALHA
Sbjct  273   GNIDPYSIYTRPC---NSTASLKRNLRGHYPWMSRAYDPCTERYSEVYFNRPDVQKALHA  329

Query  1223  NNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N T++ Y W+ CS+++  YW D   +M PIY+ LIA+G +I +FSGD DSVVPVT+TRYS
Sbjct  330   NVTRVSYPWKTCSDIVGNYWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPVTATRYS  389

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +DA+KL  I  W+PW D+ K VGG+  VY+GLTF TV GAGHEVP   PR A  L   FL
Sbjct  390   IDALKLPTITNWYPWNDNGK-VGGWSQVYKGLTFVTVTGAGHEVPLHRPRLAFILFRSFL  448

Query  1580  ST  1585
              +
Sbjct  449   GS  450



>ref|XP_011075284.1| PREDICTED: serine carboxypeptidase-like 34 [Sesamum indicum]
Length=485

 Score =   434 bits (1115),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 214/432 (50%), Positives = 275/432 (64%), Gaps = 26/432 (6%)
 Frame = +2

Query  362   GGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGV  541
             G LPGQP  V+FKQYAGYV V++T+GR+LFY+F E+ + P  KPL+LWLNGGPGCSS+G 
Sbjct  46    GRLPGQPP-VRFKQYAGYVTVNQTHGRALFYWFFEAIRNPDKKPLLLWLNGGPGCSSIGY  104

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             G   ELGPF        L   +  WNK AN LFLESP GVGFSY+NTSSD    GD  TA
Sbjct  105   GQSEELGPFFPQKGKPELKFNKNTWNKAANLLFLESPVGVGFSYTNTSSDIKQLGDTITA  164

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y FL+ WF+RFP +K+ DFYI GESYAG Y+P+LA+V+  +N        I LKGIM
Sbjct  165   QDSYNFLIGWFRRFPQFKSHDFYIAGESYAGHYVPQLAEVVTDKNKHASDDDYINLKGIM  224

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIKCEHFERAAGIEIG  1072
             +GN +++D+TD +G  DY W HA+ISD  +  +   C     N +  C H          
Sbjct  225   VGNAVLDDETDQKGLIDYAWDHAVISDALYHEIKSKCNFSNANLTDDCNHALDKYFDVYR  284

Query  1073  SIDFYNIYGPLCLDSE----------------------SSRKVKRRLGFDPCAEDYVYSY  1186
              ID Y++Y P C++S                         R+ +   G+DPCA DY   Y
Sbjct  285   IIDMYSLYAPTCVNSNFTTVSKPLSHVKGAVPRLISNIDGRRRRALAGYDPCASDYTEVY  344

Query  1187  LNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVD  1366
              N P VQ ALHAN TK+PY W  CS+ IT+WKD  +++ PI ++LIA+GQ++ +FSGD D
Sbjct  345   FNRPDVQHALHANVTKIPYPWTHCSDSITFWKDAPTSILPIIKKLIAAGQRVWVFSGDTD  404

Query  1367  SVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTP  1546
               VPVT+TRYS+  + L +   W PW  D +QVGG+ V Y+GLTF TVRGAGHEVP F P
Sbjct  405   GRVPVTATRYSLRKLGLNIKHDWTPWYTDKQQVGGWTVEYDGLTFVTVRGAGHEVPTFKP  464

Query  1547  RRALTLLNMFLS  1582
             R+AL L+N FL 
Sbjct  465   RQALQLVNHFLQ  476



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   433 bits (1113),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 217/417 (52%), Positives = 284/417 (68%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAE--SAQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP + +F QY+GYV V K +GR+LFY+  E  +++ P ++PL+LWLNGGPGCSS+  
Sbjct  36    LPGQPGSAEFNQYSGYVTVKKQSGRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAY  95

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF +  DGKTLYS  +AWNK+AN LFLESPAGVGFSYSNTSSD   +GD+RTA
Sbjct  96    GAAEEIGPFRIRRDGKTLYSNPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTA  155

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ ++ ++N   +  + I  KG +
Sbjct  156   EDAYTFLVNWFERFPQYKYRDFYIAGESYAGHYVPQLSQIVYRKNKGIKNPV-INFKGFL  214

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    + A +E 
Sbjct  215   VGNAVTDDYHDYVGTFEYWWTHGLISDSTYRTLRLTCDFVSSTHPSVECMKALKLAELEQ  274

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++ + R   R         +DPC E Y   Y N P+VQKALHAN T
Sbjct  275   GNIDPYSIFTQPCNNTAALRHNLRGHYPWMSRAYDPCTERYSKVYFNRPEVQKALHANVT  334

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              +PY WE CS ++  YW D   +M PIY+ LIA+G +I ++SGD D+VVPVT+TRYS+DA
Sbjct  335   GIPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDA  394

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K VGG+  VY GLTF TV GAGHEVP   PR+A  L   FL
Sbjct  395   LKLPTIINWYPWYDSGK-VGGWSQVYTGLTFVTVTGAGHEVPLHRPRQAFILFMSFL  450



>ref|XP_004505704.1| PREDICTED: serine carboxypeptidase-like 34-like [Cicer arietinum]
Length=475

 Score =   433 bits (1114),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 216/443 (49%), Positives = 290/443 (65%), Gaps = 32/443 (7%)
 Frame = +2

Query  332   VGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLN  511
             V   E+D +   LPGQP +V FKQYAGYV V++T+GR+LFY+F E+   P  KPL+LWLN
Sbjct  28    VTQQEEDRVYE-LPGQP-HVNFKQYAGYVTVNETHGRALFYWFFEAIHQPQQKPLLLWLN  85

Query  512   GGPGCSSLGVGAFIELGPF-GVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSS  688
             GGPGCSS+G G   ELGPF   N     L    ++WNK AN LFLESPAGVGFSY+NT+S
Sbjct  86    GGPGCSSIGYGEAEELGPFFPQNSTQPKLKLNPYSWNKAANLLFLESPAGVGFSYTNTTS  145

Query  689   DYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPE  868
             D    GD  TAKD++ FL+NWFKRFP +K+ DFYI GESYAG Y+P+L+++I+  N  P 
Sbjct  146   DISELGDTITAKDSHTFLINWFKRFPQFKSHDFYIAGESYAGHYVPQLSELILDNNHNPS  205

Query  869   TTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIKCEHFE  1048
                 I  KGIMIGN +++D+TD +G  +Y W HA+ISD+ +  +   C  NFSI  +   
Sbjct  206   KEDYINFKGIMIGNALLDDETDQKGMIEYAWDHAVISDDVYYNITTTC--NFSISIQSQT  263

Query  1049  RAAGIEIGS-------IDFYNIYGPLCLDSESSRKV-------------------KRRLG  1150
                  E+         ID Y++Y P+C  + S+ K                    KR  G
Sbjct  264   NECNTELNKYFDVYKIIDMYSLYTPMCFSNNSNTKREAFVTSSSPHSLSKFDGWHKRLAG  323

Query  1151  FDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIAS  1330
             +DPCA DY   YLN P+VQKALHAN TK+PY W  CS+ IT+W D  ++M P+ ++LIA 
Sbjct  324   YDPCASDYTELYLNRPEVQKALHANVTKIPYPWTHCSDNITFWNDAPASMLPVLKKLIAG  383

Query  1331  GQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATV  1510
             G +I ++SGD D  +PVT+TRY++  + L +++ W PW   ++QVGG+ +VY+GLTF T+
Sbjct  384   GIRIWVYSGDTDGRIPVTATRYTLRKLGLPIVQDWTPWY-TSRQVGGWNIVYDGLTFVTI  442

Query  1511  RGAGHEVPQFTPRRALTLLNMFL  1579
             RGAGH+VP FTP++AL L+  FL
Sbjct  443   RGAGHQVPTFTPKQALQLVRHFL  465



>emb|CDP02317.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   433 bits (1113),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 221/432 (51%), Positives = 286/432 (66%), Gaps = 24/432 (6%)
 Frame = +2

Query  344   EDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPG  523
             E D I   LPGQP  V F+Q++GYV V++   R+LFY+  E+A  P +KPL++WLNGGPG
Sbjct  37    EADRITA-LPGQP-KVSFQQFSGYVTVNEVAARALFYWLTEAADEPSSKPLVVWLNGGPG  94

Query  524   CSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMS  703
             CSS+  GA  E+GPF +N     LY  +F+WNK+AN LFLE+PAGVGFSYSN SSD   +
Sbjct  95    CSSVAYGASEEIGPFRINRTASGLYLNKFSWNKLANLLFLETPAGVGFSYSNRSSDLLDT  154

Query  704   GDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKI  883
             GD+RTA+D+ KFL+ W +RFP YK R+ Y+ GESYAG Y+P+LA+ IV  N+  ++   I
Sbjct  155   GDQRTAEDSLKFLIQWMERFPRYKKRELYLTGESYAGHYVPQLANAIVGYNS--KSKNPI  212

Query  884   PLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF---SIKCEH-FER  1051
              L+G M+GN + ++  D  G   Y WSHA+ISDET+  L+  C       S +CE  +  
Sbjct  213   NLRGFMVGNAVTDNYYDNLGTVTYWWSHAMISDETYRQLVNICDFRRQKESNECESLYYY  272

Query  1052  AAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--------------GFDPCAEDYVYSYL  1189
             A   E G+ID YNIY P C +S+ SR  +  +              G+DPC E Y   Y 
Sbjct  273   AMDKEFGNIDQYNIYAPPCNNSDGSRTTRHSMRLPHQPYPMFRQLSGYDPCTEKYAEVYY  332

Query  1190  NLPKVQKALHANNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVD  1366
             N P VQKALHAN T++PY W  CSE +   W D  S++ PIYR+LIA+G +I +FSGDVD
Sbjct  333   NRPDVQKALHANTTRIPYKWTACSETLNRNWNDTDSSVLPIYRKLIAAGLRIWVFSGDVD  392

Query  1367  SVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTP  1546
             SVVPVT+TRY++  +KL    PW+PW    KQVGG+  VY+GLTFATVRGAGHEVP   P
Sbjct  393   SVVPVTATRYALAQLKLDTDAPWYPWYVK-KQVGGWTEVYKGLTFATVRGAGHEVPLLKP  451

Query  1547  RRALTLLNMFLS  1582
             R AL LL  FL+
Sbjct  452   RAALQLLKSFLA  463



>gb|AES59494.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=490

 Score =   434 bits (1115),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 221/410 (54%), Positives = 272/410 (66%), Gaps = 14/410 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  V F QYAGY+ VD    R LFYYF ES     TKPL+LWLNGGPGCSSLG GA
Sbjct  79    LPGQPKGVNFDQYAGYITVDAKARRKLFYYFVESPSNSSTKPLVLWLNGGPGCSSLGYGA  138

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DG TL   + AWN VAN +FLESPAGVGFSYSN S DY   GD RTA D
Sbjct  139   MQELGPFRVNSDGTTLSLNKDAWNVVANVIFLESPAGVGFSYSNNSLDYSNVGDNRTAID  198

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             +Y FL+NW +RFP YKTRDF+I GESYAG Y+P+LA +I+ +N   +    I LKGI +G
Sbjct  199   SYIFLLNWLERFPQYKTRDFFIAGESYAGHYVPQLAHLILSKNKKRKNHNVINLKGIAVG  258

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCEHFERAAGIEIG  1072
             NG+++D    +G YDY W+HALISDETH G+ ++C     V N   +C  +E  A  E+ 
Sbjct  259   NGLIDDKLSTKGMYDYYWTHALISDETHAGIEKNCGDFRNVTNLR-ECFLYEFKADDELV  317

Query  1073  SIDFYNIYGPLCLDSESSRKVKRRLG-FDPCAEDYVYSYLNLPKVQKALHANNTKLPYTW  1249
              ID YNIY P+C  S +       +   DPCAEDY  +YLNLP+VQKALH      P  W
Sbjct  318   DIDVYNIYAPVCNSSATKNGASYFVSNIDPCAEDYTAAYLNLPEVQKALHVK----PIKW  373

Query  1250  EVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIK  1429
               CS V   W D  +++ P   +LI+SG  I ++SGD+D  VP+TST+YS++++KL V  
Sbjct  374   SHCSGV--GWTDSPTSILPTINQLISSGISIWIYSGDLDGRVPITSTKYSINSLKLPVHT  431

Query  1430  PWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              W PW    K+VGGY + Y+GLT  TVRGAGH VP   P RALT+++ FL
Sbjct  432   AWRPWYTG-KEVGGYVIGYKGLTLVTVRGAGHMVPTDQPYRALTMISSFL  480



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   432 bits (1112),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 217/417 (52%), Positives = 289/417 (69%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQT--PHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GYV V++  GR+LFY+  ES  T  P ++PL+LWLNGGPGCSS+  
Sbjct  37    LPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAY  96

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V  DGKTL+ + +AWNK+AN LFLESPAGVGFSY+N++SD   +GD+RTA
Sbjct  97    GAAEEVGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYTNSTSDLYTTGDQRTA  156

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y+FLVNWF+RFP YK RDFYI+GESYAG ++P+L+ ++ +RN   +    I LKG M
Sbjct  157   EDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSKLVHERNKGFKNP-PINLKGFM  215

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    R+A +E 
Sbjct  216   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSVSSQHPSLQCMEALRSAELEQ  275

Query  1070  GSIDFYNIYGPLCLDSESSRK-VKRRL-----GFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C ++   +  +K R       +DPC E Y   Y N  +VQKALHAN T
Sbjct  276   GNIDPYSIFTKPCNNTVQLKSFLKGRYPWMSRAYDPCTERYSNVYFNRVEVQKALHANVT  335

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             +L Y W+ CS+++  YW D   +M PIYR LIA+G KI +FSGD D+VVP+T+TRYS+DA
Sbjct  336   RLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVVPITATRYSIDA  395

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  +   FL
Sbjct  396   LKLATITNWYPWYDHGK-VGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFIIFRSFL  451



>ref|XP_011025637.1| PREDICTED: serine carboxypeptidase-like 40 [Populus euphratica]
Length=506

 Score =   434 bits (1116),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 228/430 (53%), Positives = 292/430 (68%), Gaps = 24/430 (6%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTK----PLIL  502
             GS E D I   LPGQP  V F QY GYV V+++ G +L+YYF E+ Q  H+K    PL+L
Sbjct  77    GSKEKDRIKM-LPGQPQ-VNFSQYGGYVTVNESAGSALYYYFVEADQ--HSKEAALPLLL  132

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSSLG GA  ELGPF V+ +GKTLY  +++WNKVAN LFLESPAGVGFSYSN 
Sbjct  133   WLNGGPGCSSLGYGAMEELGPFRVHSNGKTLYRNKYSWNKVANVLFLESPAGVGFSYSNA  192

Query  683   SSDYD-MSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNT  859
             +SD    SGDR TA   Y FLVNW +RFP YK RDFYI GESYAG Y+P+LAD I+  N 
Sbjct  193   TSDNTYTSGDRDTAAQNYMFLVNWLERFPEYKDRDFYIAGESYAGHYVPQLADNILHYNK  252

Query  860   MPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI---  1030
               + ++ + LKGIMIGN ++ND TD++G YD+  +HA+ S+E    +  +C  NFS    
Sbjct  253   KAKRSV-VNLKGIMIGNSVINDHTDMQGMYDFFGTHAITSNENLRKIQHYC--NFSSAGS  309

Query  1031  ---KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRR--LGFDPCAEDYVYSYLNL  1195
                +C+     A  ++  ID YNIYGPLC +S  + K K+   + FDPC++ YV +YLN 
Sbjct  310   LYKECQEAMDKADTDVNVIDIYNIYGPLCFNSNLTSKPKKTSPMNFDPCSDSYVLAYLNR  369

Query  1196  PKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVV  1375
             P VQ+A+HAN TKL Y W+ C      W D AST+ P+ +  +ASG ++ +FSGD D  V
Sbjct  370   PDVQEAMHANVTKLAYDWQPCGGF--NWVDSASTVLPLLKEFMASGLRVWVFSGDTDGRV  427

Query  1376  PVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRR  1552
             PVTS++YS++ M L +   WHPW  D K+VGGY  VY+G LT ATVRGAGH VP   P R
Sbjct  428   PVTSSQYSINEMNLPIKTQWHPWFSD-KEVGGYVQVYKGDLTLATVRGAGHMVPSIQPVR  486

Query  1553  ALTLLNMFLS  1582
             AL+L++ FL+
Sbjct  487   ALSLISHFLA  496



>emb|CDP19962.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   440 bits (1132),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 223/412 (54%), Positives = 275/412 (67%), Gaps = 17/412 (4%)
 Frame = +2

Query  365   GLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVG  544
              LPG+P  V F QY+GYV VD   GR+LFYYFAES Q P TKPL+LWLNGGPGCSSLG G
Sbjct  267   ALPGEPKGVNFDQYSGYVTVDPKAGRALFYYFAES-QNPSTKPLVLWLNGGPGCSSLGAG  325

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             A  ELGPF V   GK L+   +AWN VAN +FLESPAGVGFSYSNTSSDY ++GD ++A 
Sbjct  326   AMNELGPFRVTKGGKMLWKNPYAWNNVANIIFLESPAGVGFSYSNTSSDY-ITGDTKSAA  384

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMI  904
             DAY FLVNW +RFP YKTRDF + GESYAG Y+P+LA +I+  N +   T  I LKG+ I
Sbjct  385   DAYTFLVNWLERFPEYKTRDFLMTGESYAGHYVPQLAQLILHNNKITNHT-AINLKGVAI  443

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI------KCEHFERAAGIE  1066
             GNG  + +    G YDY W+HALISDE H G++ +C  NFS        C+ ++  A   
Sbjct  444   GNGYYDIEAQANGSYDYYWTHALISDEIHHGIVSNC--NFSSADPPTEACQAYQSQANSA  501

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYT  1246
             +G+ID  NIY PLC    SS        +DPC+ +Y Y+YLN P VQK+LHAN T +P  
Sbjct  502   LGNIDNDNIYAPLC----SSNTPPWINAYDPCSFNYSYTYLNTPAVQKSLHANTTGIPGP  557

Query  1247  WEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKV  1423
             WE C+  I + W D   T+ P+ + L +SG  + L+SGD DSV  VT+TRY+++ + L V
Sbjct  558   WETCNGYIGSNWDDEPDTVLPLIKELTSSGISVWLYSGDTDSVCSVTTTRYALNKLGLSV  617

Query  1424  IKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
               PW+ W     +VGGY V YE LTF TVRGAGH VP + P RALTL   FL
Sbjct  618   KTPWYAWYTQ-DEVGGYAVEYENLTFVTVRGAGHLVPSYQPARALTLFASFL  668


 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 14/106 (13%)
 Frame = +2

Query  1307  IYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTK---------  1459
             +YR+  ++   IL  SGD D VV  T+TRY ++ + L V  PW+ +              
Sbjct  78    VYRK--STNWNILNCSGDTDIVVSATTTRYVLNKLGLSVKTPWYAYISYISFLVERILYS  135

Query  1460  ---QVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLSTN  1588
                QVGGY V Y+ LTF TVRGAGH VP     RAL L + FL  N
Sbjct  136   MLVQVGGYAVEYDNLTFVTVRGAGHFVPSRQHARALCLFSSFLDGN  181



>ref|XP_004231125.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Solanum 
lycopersicum]
Length=492

 Score =   434 bits (1115),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 225/412 (55%), Positives = 282/412 (68%), Gaps = 11/412 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  VKF+QY GYV VD + GR+L+YYF E A+   + PL+LWLNGGPGCSS+  GA
Sbjct  77    LPGQPP-VKFQQYGGYVTVDGSAGRALYYYFTE-AENSKSLPLLLWLNGGPGCSSIAYGA  134

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF VN DGKTL+   +AWN VAN LFLESPAGVGFSY+NTSSD++ +GD RTA D
Sbjct  135   MEELGPFRVNSDGKTLHRNHYAWNLVANVLFLESPAGVGFSYTNTSSDFNTTGDSRTAND  194

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
                FL+NW +RFP YK RDFYI GESYAG Y+P+LA  I+K N     TL I LKGI+IG
Sbjct  195   NVVFLLNWLERFPEYKKRDFYISGESYAGHYVPQLAHEILKHNKQANKTL-INLKGIIIG  253

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK--CEHFERAAGIEIGSID  1081
             N ++NDDTD+ G Y+Y  SHALISDET   + ++C  N   K  C      +   +  ID
Sbjct  254   NAVINDDTDIIGTYEYYASHALISDETFLNIKKYCFDNHYNKSNCNEAVAVSNNNLYDID  313

Query  1082  FYNIYGPLCLD---SESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
              YNIY PLC D   ++  R   + L F+PC++ YVY+YLN   VQ ALHAN T + Y WE
Sbjct  314   IYNIYFPLCKDGNLTKYPRVPSQPLVFEPCSDQYVYAYLNRRDVQDALHANVTNIKYDWE  373

Query  1253  VCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIK  1429
              CS+ + Y WKD  +T+ P+    + +G ++ +FSGD D  VPVTST+ S+ AM L V +
Sbjct  374   SCSDPLFYNWKDSPATIIPLLTESLENGVRVWIFSGDTDGSVPVTSTKKSIKAMNLIVDQ  433

Query  1430  PWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             PW  W     ++GGY   Y+ GLTFATVRGAGHEVP + P RAL+L++ FLS
Sbjct  434   PWRSWLSG-GEIGGYVETYKGGLTFATVRGAGHEVPSYQPARALSLISHFLS  484



>ref|XP_006345492.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=632

 Score =   438 bits (1127),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 228/422 (54%), Positives = 287/422 (68%), Gaps = 11/422 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             GS   D IN  LPGQP  VKF+QY GYV V+++ GR+ +YYF E A+     PL+LWLNG
Sbjct  208   GSKAKDWINK-LPGQPP-VKFQQYGGYVTVNQSAGRAFYYYFTE-AENSEALPLLLWLNG  264

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS+  GA  ELGPF VN DGKTL+   +AWN+ AN LFLESPAGVGFSY+NTSSD 
Sbjct  265   GPGCSSMAYGAMEELGPFRVNSDGKTLHRNSYAWNRAANVLFLESPAGVGFSYTNTSSDL  324

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             + +GD RTA D   FL+NW +RFP YK RDFYI GESYAG Y+P+LA  I+K N +   T
Sbjct  325   NTTGDSRTANDNVVFLLNWLERFPEYKNRDFYISGESYAGHYVPQLAHEILKHNKLANKT  384

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV-NFS-IKCEHFE  1048
             L I LKGI+IGN ++NDDTD+ G Y+Y  SHALISDET+  +   C V N++  KC    
Sbjct  385   L-INLKGIIIGNAVINDDTDIIGMYEYFASHALISDETYHDIQNSCFVQNYNESKCNSAI  443

Query  1049  RAAGIEIGSIDFYNIYGPLCLDSESSR--KVKRRLGFDPCAEDYVYSYLNLPKVQKALHA  1222
               +   I  +D YNIY PLC +   ++  K+   L  DPC+ DY+Y+YLN   VQ ALHA
Sbjct  444   AISDNNINHLDIYNIYFPLCKNGNLTKYPKIPPPLQIDPCSADYIYAYLNRRDVQDALHA  503

Query  1223  NNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N T + Y WE CS  + Y WKD   T+ P+ R  + +G ++ +FSGD D  VPVTS++ S
Sbjct  504   NVTNIKYEWESCSNSLFYNWKDSPVTIVPLLRESLENGVRVWIFSGDTDGRVPVTSSKRS  563

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLNMF  1576
             + AM L V +PW  W +   +VGGY   Y+ GLTFATVRGAGHEVP + P RAL+L++ F
Sbjct  564   IQAMNLTVDQPWRSWLNG-GEVGGYVETYKGGLTFATVRGAGHEVPSYQPARALSLISHF  622

Query  1577  LS  1582
             LS
Sbjct  623   LS  624



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   432 bits (1111),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 218/417 (52%), Positives = 283/417 (68%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP+NV+F QY+GYV V++  GR+LFY+  ES  ++ P  +PLILWLNGGPGCSS+  
Sbjct  35    LPGQPANVEFNQYSGYVTVNEQAGRALFYWLIESPMSRNPEKRPLILWLNGGPGCSSVAY  94

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF +N DGKTLY   ++WN +AN LFLESPAGVGFSY+NTSSD   +GD+RTA
Sbjct  95    GAAEEIGPFHINSDGKTLYLNPYSWNNLANLLFLESPAGVGFSYTNTSSDLYNAGDQRTA  154

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D Y+FLV WF+RFP YK R+FYI GESYAG Y+P+L+ ++ +RN   +  + I  KG M
Sbjct  155   EDTYQFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQLVYQRNKGIKNPI-INFKGFM  213

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S  C      A  E 
Sbjct  214   VGNAVTDDYHDYIGTFEYWWTHGLISDSTYKLLQITCDKGSSEHPSTDCTKALLLAEQEQ  273

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+IY   C  + S R+  R         +DPC E Y   Y NLP+VQKA HAN T
Sbjct  274   GNIDPYSIYTRPCASTSSLRRNLRGHYPWMSRAYDPCTERYSEVYFNLPEVQKAFHANVT  333

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             K+ Y W+ CS+++  YW D   +M PIY+ LI++G +I +FSGD DSVVPVT+TRYS+DA
Sbjct  334   KVAYPWKTCSDIVGNYWADSPLSMLPIYQELISAGLRIWVFSGDTDSVVPVTATRYSIDA  393

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D+ K+VGG+  VY+GLT  TV GAGHEVP   PR+A  LL  FL
Sbjct  394   LKLPTITNWYPWYDN-KKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFILLRSFL  449



>ref|XP_009592799.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=616

 Score =   437 bits (1125),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 224/414 (54%), Positives = 285/414 (69%), Gaps = 15/414 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPGQP  VKFKQY GYV V+++ GR+LFYYF E A+   + PL+LWLNGGPGCSS+  GA
Sbjct  79    LPGQPP-VKFKQYGGYVTVNESAGRALFYYFVE-AENSKSLPLLLWLNGGPGCSSIAYGA  136

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
               ELGPF V+ +GKTLY   +AWN  AN LFLESPAGVGFSYSNTSSD   +GDR TA D
Sbjct  137   MEELGPFRVHSNGKTLYRNHYAWNHEANVLFLESPAGVGFSYSNTSSDVKSNGDRTTAVD  196

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
                FL+NW +RFP YK RDFYI GESYAG ++P+LA  I+  N +P+ T  I LKGIMIG
Sbjct  197   NVIFLLNWIQRFPEYKNRDFYIAGESYAGHFVPQLAQGILHHNKLPKKTF-INLKGIMIG  255

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK-------CEHFERAAGIE  1066
             N ++N +TD +G Y+Y  SHALI DE  + +  +C  NFS K       C++    A  +
Sbjct  256   NAVINYETDRKGMYEYHASHALIPDEILEQIERYC--NFSDKALPQSQECDNAIDIAIAD  313

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRLG-FDPCAEDYVYSYLNLPKVQKALHANNTKLPY  1243
                ID YNIY PLC +SE + + K+     DPC++DYV +Y+N P VQK LHAN TK+ Y
Sbjct  314   TEPIDVYNIYAPLCSNSELTLQPKKTSQVIDPCSDDYVIAYMNRPDVQKLLHANVTKIKY  373

Query  1244  TWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKV  1423
              W+ CS+VI  W D   T+ P+ + L+ +G ++ +FSGD D +VPVTST+ S+  MKL  
Sbjct  374   NWQPCSDVIESWTDSPLTIIPLLKELMENGVRVWIFSGDTDGIVPVTSTKKSIKKMKLLT  433

Query  1424  IKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
               PW+PW  +  +VGGY  VY G LTFATVRGAGH+VP + P RAL+L+  FL+
Sbjct  434   KTPWYPWFHN-DEVGGYAQVYIGNLTFATVRGAGHQVPSYQPARALSLVKHFLA  486



>ref|XP_004238587.1| PREDICTED: putative serine carboxypeptidase-like 23 [Solanum 
lycopersicum]
Length=483

 Score =   433 bits (1113),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 218/413 (53%), Positives = 278/413 (67%), Gaps = 14/413 (3%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             LPG+P +V F QY+GYV VD + GR+LFYYF ES     +KPL+LWLNGGPGCSSLG GA
Sbjct  70    LPGEPEDVDFNQYSGYVTVDSSAGRALFYYFTESPTHSASKPLVLWLNGGPGCSSLGGGA  129

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
             F ELGPF VN DG TL   +F+W   AN +FLESPAGVGFSY+NTSSD++ SGDR TA D
Sbjct  130   FGELGPFRVNKDG-TLQRNQFSWISEANIIFLESPAGVGFSYTNTSSDFNFSGDRTTAHD  188

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLK-IPLKGIMI  904
             +Y FLVNW +RFP YK  DFY+IGESYAG YIP+LA +I+  N+  + T+  I LKGI I
Sbjct  189   SYTFLVNWLERFPEYKPNDFYLIGESYAGHYIPQLAQLILLHNSNSDETISTINLKGIAI  248

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI------KCEHFERAAGIE  1066
             GN  ++ + +++G  +Y WSHALIS+E ++ +I  C  NFS       KC  +      E
Sbjct  249   GNAYVDFEANMKGTTEYYWSHALISEELYNKIILTC--NFSTPSSVSKKCNAYLDQIDEE  306

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYT  1246
             IG+I  YN+Y PLC +   S      +  DPC   Y+ SY N+P+VQKA+HAN T LPY 
Sbjct  307   IGNIFIYNVYAPLCTNRSPSSTSTSDV--DPCLPSYIQSYFNIPEVQKAMHANVTNLPYP  364

Query  1247  WEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKV  1423
             WE C+  +   WKDR  ++ P+  +L+ SG +I L+SGD+D VVPVT TRY++  + L V
Sbjct  365   WESCNNTLNLNWKDRPLSVLPLLHQLMKSGLRIWLYSGDMDVVVPVTDTRYAIKKLNLSV  424

Query  1424  IKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
                W+PW     +VGGY   YE LTF T+RGAGH VP + P RAL   + FLS
Sbjct  425   KTSWYPWYLQ-GEVGGYVEEYENLTFVTIRGAGHFVPTYQPNRALAFFSQFLS  476



>ref|XP_004288721.1| PREDICTED: serine carboxypeptidase 24-like [Fragaria vesca subsp. 
vesca]
Length=448

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/421 (51%), Positives = 281/421 (67%), Gaps = 20/421 (5%)
 Frame = +2

Query  365   GLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVG  544
              LPGQP  V F QY+GYV V+K +GR+LFY+F E+  +PH KPL+LW NGGPGCSS+  G
Sbjct  25    ALPGQPP-VSFSQYSGYVTVNKKHGRALFYWFTEATASPHNKPLVLWFNGGPGCSSVAYG  83

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             A  E+GPF +N  G +LY  +++WN+ AN LFLESPAGVGFSY+NTS+D   SGD+RTA+
Sbjct  84    ASEEIGPFRINRTGSSLYLNKYSWNREANILFLESPAGVGFSYTNTSADLIDSGDKRTAQ  143

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMI  904
             DA  FL+ W  RFP YK R+FYI GESYAG Y+P+LA  IV  N      + I LKG ++
Sbjct  144   DALTFLLQWLSRFPQYKYREFYISGESYAGHYVPQLAKEIVNYNKAHSHPI-INLKGFIV  202

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF-----SIKCEH-FERAAGIE  1066
             GN + ++  D  G   Y W+H++ISD T+  +++HC  NF     + +C+     A   E
Sbjct  203   GNAVTDNYYDSIGTVAYWWTHSMISDHTYRSILDHC--NFTADKSTTQCDDAVNYAMNYE  260

Query  1067  IGSIDFYNIYGPLCLD--SESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHA  1222
              G ID Y+IY P CL   + S+R ++       R G+DPC+E+Y   Y N P VQKA+HA
Sbjct  261   FGDIDQYSIYTPFCLTQITNSARNLRLKNTLLCRRGYDPCSENYAEKYYNRPDVQKAMHA  320

Query  1223  NNTKLPYTWEVCSE-VITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N TK+PY W  CS+ +I  W D   +M P Y+ L+A+G KI +FSGD DSVVPVT+TR+S
Sbjct  321   NITKIPYKWTACSDTLIKNWNDSEDSMLPTYKELMAAGLKIWVFSGDTDSVVPVTATRFS  380

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +  + L +  PW+PW     QVGG+  VY GLTFAT+RGAGHEVP F P+RA  L   FL
Sbjct  381   LSHLNLTIKTPWYPWYTG-GQVGGWTEVYHGLTFATIRGAGHEVPLFQPKRAFVLFQSFL  439

Query  1580  S  1582
             +
Sbjct  440   A  440



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/417 (52%), Positives = 281/417 (67%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV F QY+GYV VDK  GR+LFY+  E+  ++ P+++PL+LWLNGGPGCSS+  
Sbjct  34    LPGQPKNVDFAQYSGYVTVDKQAGRALFYWLTETPTSRVPNSRPLVLWLNGGPGCSSVAY  93

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDG+TLY   +AWNK+AN LFLESPAGVGFSYSNT+SD   +GD++TA
Sbjct  94    GAAEEIGPFHIKPDGRTLYLNPYAWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQKTA  153

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DA++FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ +I +RN   +  + I  KG M
Sbjct  154   EDAHRFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQLIYERNKGIQNPV-INFKGFM  212

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L + C      + S +C+     A  E 
Sbjct  213   VGNAVTDDYHDYVGTFEYWWTHGLISDSTYRLLRKACDFGSSQHPSAECKKALTIAEFEQ  272

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+IY   C  + S R   R         +DPC E Y  +Y N P VQ+A HAN T
Sbjct  273   GNIDPYSIYTRPCNSTASLRHNLRGHYPWMSRAYDPCTERYSVAYFNHPDVQEAFHANVT  332

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              + Y W  CS+++  YW D   +M PIY+ LI SG +I +FSGD DSVVPVT+TRYS+DA
Sbjct  333   GITYPWSTCSDLVGNYWADSPLSMLPIYQELIGSGIRIWVFSGDTDSVVPVTATRYSIDA  392

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  +  W+PW D  K VGG+  +Y+GLTF TV GAGHEVP   PR A  L   FL
Sbjct  393   LKLPTLSNWYPWYDHGK-VGGWSQIYKGLTFVTVAGAGHEVPLHRPREAFILFRSFL  448



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   435 bits (1119),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/449 (49%), Positives = 288/449 (64%), Gaps = 46/449 (10%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAE--SAQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV+F QY+GYV V++  GR+LFY+  E   +++P T+PL+LWLNGGPGCSSL  
Sbjct  98    LPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVLWLNGGPGCSSLAY  157

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDG+TLY  R+AWN +AN LFLESPAGVGFSYSNT+SD   +GDRRTA
Sbjct  158   GAAEEIGPFHIRPDGRTLYLNRYAWNNLANMLFLESPAGVGFSYSNTTSDLYTAGDRRTA  217

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ ++ +RN   +  + I  KG +
Sbjct  218   EDAYAFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQIVYERNRGVQNPV-INFKGFL  276

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    R A +E 
Sbjct  277   VGNAVTDDYHDFVGTFEYWWTHGLISDSTYRSLRVACDLGSSTHPSLQCMSALRVAEVEQ  336

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+I+   C D+ + ++  R         +DPC E Y   Y NLP+VQKALHAN T
Sbjct  337   GNIDPYSIFTQPCKDTATLKRNMRGHYPWMSRAYDPCTERYSKVYFNLPEVQKALHANVT  396

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              + Y W+ CS+++  YW D   +M PIY+ LIA+G +I ++SGD D+VVPVT+TRYS+DA
Sbjct  397   GISYPWQTCSDLVGNYWADAPLSMLPIYKELIAAGFRIWVYSGDTDAVVPVTATRYSIDA  456

Query  1409  MKLKVIKPWHPWEDDTK--------------------------------QVGGYKVVYEG  1492
             +KL  +  W+PW D+ K                                QVGG+   Y G
Sbjct  457   LKLPTVTNWYPWYDNGKVSTDNVIQFLELVSVEIGLHRCLSHQISHFLIQVGGWSQAYRG  516

Query  1493  LTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             LTF TV GAGHEVP   PR+A  L   FL
Sbjct  517   LTFVTVTGAGHEVPLHRPRQAFILFRSFL  545



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/419 (51%), Positives = 287/419 (68%), Gaps = 19/419 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV F QY+GYV V++ + R+LFY+  E+  ++ P ++PL+LWLNGGPGCSS+  
Sbjct  37    LPGQPKNVGFAQYSGYVTVNEQSERALFYWLVEAPVSRGPRSRPLVLWLNGGPGCSSIAY  96

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDG++LY   +AWNK+AN LFL+SPAGVGFSYSN ++D    GD+RTA
Sbjct  97    GASEEIGPFHIRPDGRSLYLNPYAWNKLANILFLDSPAGVGFSYSNKTADLYTFGDQRTA  156

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK R+FYI GESYAG Y+P+LA ++ ++N   +  + I  KG M
Sbjct  157   EDAYAFLVNWFERFPQYKHREFYIAGESYAGHYVPQLAQIVYQKNKGIQNPV-INFKGFM  215

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF------SIKCEHFERAAGI  1063
             +GN + +D  D  G ++Y W+H L+SD T+  L   C  NF      S++C    R A +
Sbjct  216   VGNAVTDDYHDYVGTFEYWWTHGLVSDSTYKMLKIAC--NFGSSQHPSVQCMQALRVATV  273

Query  1064  EIGSIDFYNIYGPLCLDSESSRK-VKRRL-----GFDPCAEDYVYSYLNLPKVQKALHAN  1225
             E G+ID Y++Y   C ++ S R+ +K R       +DPC E Y  SY N P+VQKA HAN
Sbjct  274   EQGNIDPYSVYTQPCNNTASLRRGLKGRYPWMSRAYDPCTERYSDSYFNRPEVQKAFHAN  333

Query  1226  NTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
              T +PY W+ CS+++  YW D   +M PIY+ LI +G +I ++SGD D+VVPVT+TRYS+
Sbjct  334   VTGIPYEWKACSDIVGNYWTDSPLSMLPIYQELIRAGYRIWVYSGDTDAVVPVTATRYSI  393

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             DA+KL  I  W+PW D  K VGG+  VY+GLT  TVRGAGHEVP   PR A  L + FL
Sbjct  394   DALKLPTIINWYPWYDSGK-VGGWSQVYKGLTMVTVRGAGHEVPLHRPREAFILFSSFL  451



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 223/422 (53%), Positives = 283/422 (67%), Gaps = 22/422 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESA--QTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP+ V F QY+GYV V++  GR+LFY+  ES   + P ++PL+LWLNGGPGCSS+  
Sbjct  35    LPGQPT-VGFAQYSGYVTVNRKAGRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAY  93

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTLY   +AWN +AN LFLESPAGVGFSY+NTSSD   +GD+RTA
Sbjct  94    GAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTA  153

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ +I +RN   +  + I  KG M
Sbjct  154   EDAYAFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQIIYERNKEKKNPI-INFKGFM  212

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    + A +E 
Sbjct  213   VGNAVTDDYHDYVGTFEYWWNHGLISDSTYRLLRVTCDSGSSQHPSVECMRVLKLAEMEQ  272

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRRL---------GFDPCAEDYVYSYLNLPKVQKALHA  1222
             G+ID Y+IY   C    S+  +KR L          +DPC E Y   Y N P VQKALHA
Sbjct  273   GNIDPYSIYTRPC---NSTASLKRNLRGHYPWMSRAYDPCTERYSEVYFNRPDVQKALHA  329

Query  1223  NNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N TK+ Y W+ CS+++  YW D   +M PIY+ LIA+G KI +FSGD DSVVPVT+TRYS
Sbjct  330   NVTKVSYPWQTCSDIVGNYWADSPLSMLPIYKELIAAGLKIWVFSGDTDSVVPVTATRYS  389

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +DA+KL  I  W PW D+ K VGG   +Y+GLTF TV GAGHEVP   PR A  L   FL
Sbjct  390   IDALKLPTITNWFPWNDNGK-VGGRCQIYKGLTFVTVTGAGHEVPLHRPRLAFILFRSFL  448

Query  1580  ST  1585
              +
Sbjct  449   ES  450



>ref|XP_008460255.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Cucumis 
melo]
Length=467

 Score =   432 bits (1111),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 223/438 (51%), Positives = 286/438 (65%), Gaps = 27/438 (6%)
 Frame = +2

Query  335   GSMEDDLING----GLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLIL  502
             GS  DD         LPGQP  V F+Q++GYV V++  GR+LFY+  E++  P +KPL++
Sbjct  26    GSQPDDGAAADRIWALPGQPE-VSFEQFSGYVTVNRAAGRALFYWLTEASIQPLSKPLVI  84

Query  503   WLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNT  682
             WLNGGPGCSS+  GA  E+GPF +N     L   +F+WN +AN LFLE+PAGVGFSY+N 
Sbjct  85    WLNGGPGCSSIAYGASEEIGPFRINNKASGLVPNKFSWNSLANLLFLETPAGVGFSYTNR  144

Query  683   SSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTM  862
             SSD   +GDRRTAKD+ +FLV W  RFP YKTRD +I GESYAG Y+P+LA  I+  N  
Sbjct  145   SSDLLNTGDRRTAKDSLEFLVRWLNRFPWYKTRDIFITGESYAGHYVPQLAREILAYNA-  203

Query  863   PETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF---SIK  1033
              +++  I LKG+M+GN + ++  D  G   Y WSHA+ISD+T+  LI  C  +    S +
Sbjct  204   -KSSHPIHLKGVMVGNAVTDNYYDNLGTVTYWWSHAMISDKTYHELINTCDFSRQKESNE  262

Query  1034  CEH-FERAAGIEIGSIDFYNIYGPLCLDSESS--------------RKVKRRLGFDPCAE  1168
             CE  +  A   E G+ID YNIY P C +S+ S              R  +++ G+DPC E
Sbjct  263   CESLYTYAMDKEFGNIDQYNIYAPPCNNSDGSLATRQSTMRLPHRTRAFRQKAGYDPCTE  322

Query  1169  DYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKIL  1345
              Y   Y N P VQKALHAN TK+PY W  CSE++   W D   ++ PIYR LI+SG ++ 
Sbjct  323   KYAEIYFNRPDVQKALHANITKIPYRWTACSELLNRNWNDTDVSILPIYRELISSGMRVW  382

Query  1346  LFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGH  1525
             +FSGDVDSVVPVT+TRYS+  +KL+   PW+PW     QVGG+  VYEGLTFATVRGAGH
Sbjct  383   VFSGDVDSVVPVTATRYSISQLKLRTKVPWYPWYVK-NQVGGWTEVYEGLTFATVRGAGH  441

Query  1526  EVPQFTPRRALTLLNMFL  1579
             EVP F PR AL L   FL
Sbjct  442   EVPLFKPRAALQLFKSFL  459



>ref|NP_191906.1| serine carboxypeptidase-like 40 [Arabidopsis thaliana]
 sp|Q0WRX3.2|SCP40_ARATH RecName: Full=Serine carboxypeptidase-like 40; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87800.1| serin carboxypeptidase-like protein [Arabidopsis thaliana]
 gb|AAM65131.1| serin carboxypeptidase-like protein [Arabidopsis thaliana]
 gb|AEE80489.1| serine carboxypeptidase-like 40 [Arabidopsis thaliana]
Length=502

 Score =   433 bits (1114),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/426 (52%), Positives = 283/426 (66%), Gaps = 18/426 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  + DLI   LPGQP  V F QY GYV V+++ GRS FYYF E++++  + PL+LWLNG
Sbjct  75    GLRKRDLIRR-LPGQPP-VSFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLLWLNG  132

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA  ELGPF V+ DGKTL+  R+AWN  AN LFLESPAGVGFSY+NT+SD 
Sbjct  133   GPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSDL  192

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
             +  GDR TA D Y FLVNW +RFP YK RD YI GESYAG Y+P+LA  I+  +      
Sbjct  193   EKHGDRNTAADNYIFLVNWLERFPEYKGRDLYIAGESYAGHYVPQLAHTILLHHRS----  248

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN------FSIKC  1036
                 LKGI+IGN ++ND+TD+ G YD+  SHALIS+++   L  +C +        + +C
Sbjct  249   -FFNLKGILIGNAVINDETDLMGMYDFFESHALISEDSLARLKSNCDLKTESASVMTEEC  307

Query  1037  EHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG---FDPCAEDYVYSYLNLPKVQ  1207
                     ++   +D YNIY PLCL+S  +R+ KR      FDPC++ YV +YLN P+VQ
Sbjct  308   AVVSDQIDMDTYYLDIYNIYAPLCLNSTLTRRPKRGTTIREFDPCSDHYVQAYLNRPEVQ  367

Query  1208  KALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTS  1387
              ALHAN TKLPY W+ CS VI  W D  +T+ P+ + L+  G ++ +FSGD D  +PVTS
Sbjct  368   AALHANATKLPYEWQPCSSVIKKWNDSPTTVIPLIKELMGQGVRVWVFSGDTDGRIPVTS  427

Query  1388  TRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTL  1564
             T+YS+  M L     WHPW     +VGGY   Y+G LTFATVRGAGH+VP F P+R+L+L
Sbjct  428   TKYSLKKMNLTAKTAWHPWYLG-GEVGGYTEEYKGKLTFATVRGAGHQVPSFQPKRSLSL  486

Query  1565  LNMFLS  1582
                FL+
Sbjct  487   FIHFLN  492



>ref|XP_010315499.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum lycopersicum]
Length=505

 Score =   433 bits (1114),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 231/500 (46%), Positives = 312/500 (62%), Gaps = 36/500 (7%)
 Frame = +2

Query  155   MLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeeemVFDDV  334
              L L  I A     G      D  R  +  RR K + +       A  ++   + +   V
Sbjct  10    FLILCYISAQQCYAGEA----DVLREFLKARRTKTRNVMSQGLAVADKQISVSKFIVPQV  65

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             GS ++D I+  LPGQP  + F QY+GYV VD   GR+LFYYFAES+  P TKPL+LWLNG
Sbjct  66    GSKKNDKISA-LPGQPKGINFAQYSGYVTVDANAGRALFYYFAESSNDPSTKPLVLWLNG  124

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS G G   ELGPF VN DGKTL+   FAWNKVAN LFLESPAGVGFSYSNTSSDY
Sbjct  125   GPGCSSFGNGGMAELGPFRVNEDGKTLWLNPFAWNKVANVLFLESPAGVGFSYSNTSSDY  184

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
               +GD +T +D++ FLVNW +RF  YK R FYIIGESYAG Y+P+LA +I+ +    +  
Sbjct  185   -TTGDEKTRQDSFTFLVNWMERFSEYKNRYFYIIGESYAGHYVPQLAQLILSQKKT-KHN  242

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK------C  1036
             L I L+GI  GN +++D+T   G YD+ W+HALISDE HDG++++C  NFS +      C
Sbjct  243   LVINLQGIATGNALLDDETWNSGSYDFYWTHALISDEVHDGIVKNC--NFSTETSTSEAC  300

Query  1037  EHFERAAGIEIGSIDFYNIYGPLCLDSE-SSRKVKRRLGFDPCAEDYVYSYLNLPKVQKA  1213
             + +   A    G+I  YN Y  LC  S  +S  V    GFDPC+ DYV +YLN  +VQKA
Sbjct  301   DKYTSEADSCQGNIYSYNTYSQLCNSSSYTSLPVSSIDGFDPCSADYVENYLNTAEVQKA  360

Query  1214  LHANNTKLPYTWEVC-----------------SEVITYWKDRASTMFPIYRRLIASGQKI  1342
             L   +  +P++WE C                  ++  YW+D  +T+ PI++ L+ SG ++
Sbjct  361   LKVRD--IPHSWESCRYFPINLITCFNPHLCSDDIGGYWQDSPNTVLPIFQELMQSGIRV  418

Query  1343  LLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAG  1522
              ++SGDVD ++ VT++RY+++ +K  +   W+PW  +  +VGGY V Y+ LTF TVRGAG
Sbjct  419   WIYSGDVDHILSVTTSRYAINKIKTPIKTAWYPWFFN-GEVGGYAVEYQNLTFVTVRGAG  477

Query  1523  HEVPQFTPRRALTLLNMFLS  1582
             H VP + P RALT+ + F++
Sbjct  478   HLVPSYQPGRALTMFSSFIN  497



>gb|ACG38162.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG38177.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=463

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/422 (53%), Positives = 283/422 (67%), Gaps = 22/422 (5%)
 Frame = +2

Query  362   GGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTP-HTKPLILWLNGGPGCSSLG  538
             G LPGQP  V F  Y+GYV VD   GR+LFY+F E+A  P  + PL+LWLNGGPGCSS+G
Sbjct  33    GRLPGQPP-VNFSMYSGYVTVDAAAGRALFYWFIEAAGVPAESAPLVLWLNGGPGCSSVG  91

Query  539   VGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRT  718
              GA  ELG F +N DG+TLY   + WNKVAN LFL+SPAGVG+SYSN++SD   +GD +T
Sbjct  92    YGASEELGAFRINADGRTLYLNPYPWNKVANMLFLDSPAGVGYSYSNSTSDLYTAGDNKT  151

Query  719   AKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGI  898
             A D+Y FLVNW +RFP YK RDFYI GESYAG Y+P+L+ ++ + N   E  + +  KG 
Sbjct  152   AHDSYNFLVNWLERFPQYKHRDFYITGESYAGHYVPQLSQLVYRNNKGIEKPI-LNFKGF  210

Query  899   MIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF----SIKCEHFERAAGIE  1066
             M+GN +++D  D  G ++YLW+H LISDET++ L   C  +     S +C      A  E
Sbjct  211   MVGNAVIDDYHDFIGTFEYLWTHGLISDETYEKLRLACQFDVSEHASKECNKVFDIAEAE  270

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRL----------GFDPCAEDYVYSYLNLPKVQKAL  1216
              G+ID Y+IY P C   + +   KRRL          G+DPC E Y   Y NLP+VQ+AL
Sbjct  271   EGNIDAYSIYTPTC---KKTSLHKRRLIRGRTPWLPRGYDPCTEKYSTKYYNLPEVQRAL  327

Query  1217  HANNTKLPYTWEVCSE-VITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             HAN T +PY W  CS+ V  +WKD   +M PIYR LIA+G +I +FSGD DSVVP+T+TR
Sbjct  328   HANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATR  387

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNM  1573
             YS+DA+ L  I  W+PW DD ++VGG+  VYEGLT  TVRGAGHEVP   PR+ L L   
Sbjct  388   YSIDALFLPTITNWYPWYDD-EEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLFEH  446

Query  1574  FL  1579
             FL
Sbjct  447   FL  448



>ref|XP_008654560.1| PREDICTED: uncharacterized protein LOC100273202 isoform X1 [Zea 
mays]
 gb|ACF86547.1| unknown [Zea mays]
 gb|AFW80078.1| serine carboxypeptidase K10B2.2 [Zea mays]
Length=463

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/422 (53%), Positives = 283/422 (67%), Gaps = 22/422 (5%)
 Frame = +2

Query  362   GGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTP-HTKPLILWLNGGPGCSSLG  538
             G LPGQP  V F  Y+GYV VD   GR+LFY+F E+A  P  + PL+LWLNGGPGCSS+G
Sbjct  33    GRLPGQPP-VNFSMYSGYVTVDAAAGRALFYWFIEAAGVPAESAPLVLWLNGGPGCSSVG  91

Query  539   VGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRT  718
              GA  ELG F +N DG+TLY   + WNKVAN LFL+SPAGVG+SYSN++SD   +GD +T
Sbjct  92    YGASEELGAFRINADGRTLYLNPYPWNKVANMLFLDSPAGVGYSYSNSTSDLYTAGDNKT  151

Query  719   AKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGI  898
             A D+Y FLVNW +RFP YK RDFYI GESYAG Y+P+L+ ++ + N   E  + +  KG 
Sbjct  152   AHDSYNFLVNWLERFPQYKHRDFYITGESYAGHYVPQLSQLVYRNNKGIEKPI-LNFKGF  210

Query  899   MIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF----SIKCEHFERAAGIE  1066
             M+GN +++D  D  G ++YLW+H LISDET++ L   C  +     S +C      A  E
Sbjct  211   MVGNAVIDDYHDFIGTFEYLWTHGLISDETYEKLRLACQFDVSEHASKECNKVFDIAEAE  270

Query  1067  IGSIDFYNIYGPLCLDSESSRKVKRRL----------GFDPCAEDYVYSYLNLPKVQKAL  1216
              G+ID Y+IY P C   + +   KRRL          G+DPC E Y   Y NLP+VQ+AL
Sbjct  271   EGNIDAYSIYTPTC---KKTSLHKRRLIRGRTPWLPRGYDPCTEKYSTKYYNLPEVQRAL  327

Query  1217  HANNTKLPYTWEVCSE-VITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             HAN T +PY W  CS+ V  +WKD   +M PIYR LIA+G +I +FSGD DSVVP+T+TR
Sbjct  328   HANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATR  387

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNM  1573
             YS+DA+ L  I  W+PW DD ++VGG+  VYEGLT  TVRGAGHEVP   PR+ L L   
Sbjct  388   YSIDALFLPTITNWYPWYDD-EEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLFEH  446

Query  1574  FL  1579
             FL
Sbjct  447   FL  448



>emb|CBI28593.3| unnamed protein product [Vitis vinifera]
Length=963

 Score =   447 bits (1151),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 234/423 (55%), Positives = 292/423 (69%), Gaps = 11/423 (3%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I+  LPGQP +V F QY GYV +D++ G++L+YYFAE+  +  + PL+LWLNG
Sbjct  47    GLKEKDRIDM-LPGQP-HVGFSQYGGYVTIDESKGKALYYYFAEAPLSKKSLPLLLWLNG  104

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSSL  GA  ELGPF V+ +GKTLY  ++AWNKVAN LFLESPAGVGFSYSNT+SDY
Sbjct  105   GPGCSSLAYGAMQELGPFRVHSEGKTLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDY  164

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
                GDR+TAKD Y FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I+  N   +  
Sbjct  165   RNGGDRKTAKDNYAFLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKADGP  224

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCE  1039
             + I LKGI+IGN ++ND+TD  G Y Y  SHAL+S++T   + +HC       + S +C 
Sbjct  225   I-INLKGIIIGNAVINDETDELGMYQYFGSHALVSEKTIRQMEKHCNFSPGAASQSKECT  283

Query  1040  HFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYLNLPKVQKAL  1216
                      I  ID YNIY PLC ++  + K K+    FDPC++ YVY+YLN   VQKAL
Sbjct  284   KASDEVDDNIDVIDIYNIYAPLCFNTNLTVKPKKVTPEFDPCSDYYVYAYLNRADVQKAL  343

Query  1217  HANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRY  1396
             HAN TKL Y WE CS+VI  W D  ST+ P+    + +G ++ +FSGD D  VPVTST  
Sbjct  344   HANVTKLKYDWEPCSDVIQNWTDSPSTIIPLLHEFMENGLRVWVFSGDTDGRVPVTSTMA  403

Query  1397  SVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNM  1573
             S+D MKL V  PWHPW     +VGGY  VY+G LTFATVRGAGH+VP F P+RAL+L++ 
Sbjct  404   SIDTMKLSVKTPWHPWF-VAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLISH  462

Query  1574  FLS  1582
             FLS
Sbjct  463   FLS  465


 Score =   432 bits (1112),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 234/470 (50%), Positives = 295/470 (63%), Gaps = 25/470 (5%)
 Frame = +2

Query  221   QARRIMWLRRAKMQQLHG---------GITDEAWSemeeeemVFDDVGSMEDDLINGGLP  373
             Q   +  L++AKMQ   G          I  EA S       +    G  E D I   LP
Sbjct  492   QTELLKLLQKAKMQGNSGIDTSLFEVNEIKSEAESYK-----ILPQKGMKEKDRIER-LP  545

Query  374   GQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGAFI  553
             GQP +V F QY GYV +D++ G + +YYF E+  +  + PL+LW NGGPGCSSL  GA  
Sbjct  546   GQP-HVGFSQYGGYVTIDESKGEAFYYYFVEAPTSRESLPLLLWFNGGPGCSSLAYGAMQ  604

Query  554   ELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAY  733
             ELGPF V+ DGKTLY  ++AWNKVAN LFLESPAGVGFSYSNT+SD    GDR+TA + Y
Sbjct  605   ELGPFRVHSDGKTLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDNQSGGDRKTANENY  664

Query  734   KFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIGNG  913
              FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I+  N      + I LKGI+IGN 
Sbjct  665   AFLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKANGPI-INLKGIIIGNA  723

Query  914   IMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVNFSIKCEHFERAAGIEIGSI  1078
             +++D+ D  G Y YL SHAL+S++T   + +HC       + S +C          I  I
Sbjct  724   VIDDEADDIGRYQYLGSHALVSEKTIHQMEKHCNFSPGATSQSKECTEAVDEVHSNIDVI  783

Query  1079  DFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             D YNIY PLC ++  + K K+    FDPC++ YV +YLN   VQKALHAN TKL Y W  
Sbjct  784   DIYNIYSPLCFNTILTAKPKKVTPEFDPCSDYYVSAYLNRADVQKALHANVTKLKYEWRP  843

Query  1256  CSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             CS++   W D   T+ P+ R  +A+G ++ +FSGD D  VPVTST  S+  M+L V  PW
Sbjct  844   CSDIDKNWTDSPLTIIPLLREFMANGLRVWVFSGDTDGDVPVTSTMASIGKMRLSVKTPW  903

Query  1436  HPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             HPW     +VGGY  VY+G LTFATVRGAGH+VP F P+RAL+L+  FLS
Sbjct  904   HPWF-VAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLIVHFLS  952



>ref|XP_010659210.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Vitis 
vinifera]
Length=504

 Score =   433 bits (1113),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 239/489 (49%), Positives = 310/489 (63%), Gaps = 18/489 (4%)
 Frame = +2

Query  155   MLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHG------GITDEAWSemeeee  316
             ++FLL I ++ L   HG   + Q   +  L++AK+    G       + +       E  
Sbjct  10    VVFLLFIFSSFLAESHG-KTMKQIEALDILQKAKLHGNSGIDTNLFEVNEVENGAETESH  68

Query  317   mVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
              +    G  E D I+  LPGQP +V F QY GYV +D++ G++L+YYFAE+  +  + PL
Sbjct  69    KIHPQEGLKEKDRIDM-LPGQP-HVGFSQYGGYVTIDESKGKALYYYFAEAPLSKKSLPL  126

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSSL  GA  ELGPF V+ DGKTLY  ++AWNKVAN LFLESPAGVGFSYS
Sbjct  127   LLWLNGGPGCSSLAYGAMQELGPFRVHSDGKTLYRNQYAWNKVANVLFLESPAGVGFSYS  186

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN  856
             NT+SD    GDR+TA + Y FLVNW +RFP YK RDFYI GESYAG Y+P+LA  I+  N
Sbjct  187   NTTSDNQSGGDRKTANENYAFLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHN  246

Query  857   TMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC-----VVN  1021
                   + I LKGI+IGN +++D+ D  G Y YL SHAL+S++T   + +HC       +
Sbjct  247   KKANGPI-INLKGIIIGNAVIDDEADDIGRYQYLGSHALVSEKTIHQMEKHCNFSPGATS  305

Query  1022  FSIKCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL-GFDPCAEDYVYSYLNLP  1198
              S +C          I  ID YNIY PLC ++  + K K+    FDPC++ YV +YLN  
Sbjct  306   QSKECTEAVDEVHSNIDVIDIYNIYSPLCFNTILTAKPKKVTPEFDPCSDYYVSAYLNRA  365

Query  1199  KVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVP  1378
              VQKALHAN TKL Y W  CS++   W D   T+ P+ R  +A+G ++ +FSGD D  VP
Sbjct  366   DVQKALHANVTKLKYEWRPCSDIDKNWTDSPLTIIPLLREFMANGLRVWVFSGDTDGDVP  425

Query  1379  VTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRA  1555
             VTST  S+  M+L V  PWHPW     +VGGY  VY+G LTFATVRGAGH+VP F P+RA
Sbjct  426   VTSTMASIGKMRLSVKTPWHPWF-VAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRA  484

Query  1556  LTLLNMFLS  1582
             L+L+  FLS
Sbjct  485   LSLIVHFLS  493



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   431 bits (1109),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/420 (52%), Positives = 283/420 (67%), Gaps = 21/420 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESA--QTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP NV F QY+GY+ V++ +GR+LFY+  E+   + P ++PL+LWLNGGPGCSS+  
Sbjct  40    LPGQPQNVGFNQYSGYITVNQQSGRALFYWLTEAPAYRGPDSRPLVLWLNGGPGCSSVAY  99

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF +N DGKTLY   ++WNK+AN LFLESPAGVGFSYSNTSSD    GD+RTA
Sbjct  100   GAAEEIGPFRINSDGKTLYLNPYSWNKLANLLFLESPAGVGFSYSNTSSDLYTVGDQRTA  159

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLV WF+RFP YK RDFYI GESYAG Y+P+L+ +I +RN   +  + I  KG M
Sbjct  160   EDAYAFLVGWFERFPQYKYRDFYIAGESYAGHYVPQLSQIIYQRNKGIQNPV-INFKGFM  218

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK----CEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C +  S      C      A  E+
Sbjct  219   VGNAVTDDYHDYIGTFEYWWTHGLISDSTYKILRRTCDLGSSTHPSSDCVKSLDLADKEM  278

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRRL---------GFDPCAEDYVYSYLNLPKVQKALHA  1222
             G+ID Y+IY   C    S+  ++RRL          +DPC E Y   Y NLP+VQ ALHA
Sbjct  279   GNIDPYSIYTRPC---NSASSLRRRLRGHYPWMSRAYDPCTERYSEIYFNLPEVQNALHA  335

Query  1223  NNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N T++ Y W+ CS+++  YW D   ++ PIY+ LIA+G +I +FSGD D+VVPVT+TRYS
Sbjct  336   NVTRISYPWQSCSDIVGNYWADTPLSVLPIYQELIAAGHRIWVFSGDTDAVVPVTATRYS  395

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +DA+KL  I  W+PW D+ K VGG+  VY+GLT  TV GAGHEVP   PR+A  L   FL
Sbjct  396   IDALKLPTITKWYPWYDNGK-VGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFL  454



>sp|O82229.2|SCP23_ARATH RecName: Full=Putative serine carboxypeptidase-like 23; Flags: 
Precursor [Arabidopsis thaliana]
Length=454

 Score =   431 bits (1108),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/423 (52%), Positives = 276/423 (65%), Gaps = 13/423 (3%)
 Frame = +2

Query  344   EDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPG  523
             E+D+I   LPGQP  V F Q++GYV V++++GRSLFY+  ES  + HTKPL+LWLNGGPG
Sbjct  27    EEDMIKA-LPGQP-QVGFSQFSGYVTVNESHGRSLFYWLTESPSSSHTKPLLLWLNGGPG  84

Query  524   CSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMS  703
             CSS+G GA  E+GPF +N  G  LY  +F WN  AN LFLESPAGVGFSY+NTSSD   S
Sbjct  85    CSSIGYGASEEIGPFRINKTGSNLYLNKFTWNTEANILFLESPAGVGFSYTNTSSDLKDS  144

Query  704   GDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKI  883
             GD RTA++   FL+ W  RFP Y+ RDFYI+GESYAG Y+P+LA  I   N     T  I
Sbjct  145   GDERTAQENLIFLIKWMSRFPQYQYRDFYIVGESYAGHYVPQLAKKIHLYNKAFNNTPII  204

Query  884   PLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF---SIKCEHFERA  1054
              LKG M+GNG M+   D  G   Y WSHA+ISD+T+  +++HC       S KC      
Sbjct  205   NLKGFMVGNGDMDKHYDRLGAAMYAWSHAMISDKTYKSILKHCSFTADKTSDKCNWALYF  264

Query  1055  AGIEIGSIDFYNIYGPLCLDSESSRK------VKRRLGFDPCAEDYVYSYLNLPKVQKAL  1216
             A  E G ++ Y+IY P C+   +  K      +     +DPC E Y   Y N P VQ+A+
Sbjct  265   AYREFGKVNGYSIYSPSCVHQTNQTKFLHGRLLVEEYEYDPCTESYAEIYYNRPDVQRAM  324

Query  1217  HANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTR  1393
             HAN T +PY W +C+ V+   WKD   +M PIY+ L A+G +I +FSGD D+VVPVT TR
Sbjct  325   HANLTSIPYKWTLCNMVVNNNWKDSEFSMLPIYKELTAAGLRIWVFSGDTDAVVPVTGTR  384

Query  1394  YSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNM  1573
              ++  + L V  PW+PW  + KQVGG+  VYEGLTFAT+RGAGHEVP   P RALTLL  
Sbjct  385   LALSKLNLPVKTPWYPWYSE-KQVGGWTEVYEGLTFATIRGAGHEVPVLQPERALTLLRS  443

Query  1574  FLS  1582
             FL+
Sbjct  444   FLA  446



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   431 bits (1109),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/417 (52%), Positives = 283/417 (68%), Gaps = 15/417 (4%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP+NV+F QY+GYV V++  GR+LFY+  ES  ++ P  +PLILWLNGGPGCSS+  
Sbjct  35    LPGQPANVQFNQYSGYVTVNEQAGRALFYWLIESPVSRNPEKRPLILWLNGGPGCSSVAY  94

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF ++ DGKTLY   ++WN +AN LFLESPAGVGFSY+NTSSD   +GD+RTA
Sbjct  95    GAAEEIGPFHIDSDGKTLYLNPYSWNNLANLLFLESPAGVGFSYTNTSSDLYNAGDQRTA  154

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D Y+FLV WF+RFP YK R+FYI GESYAG Y+P+L+ ++ +RN   +  + I  KG M
Sbjct  155   EDTYQFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQLVYRRNKGIKNPI-INFKGFM  213

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S  C      A  E 
Sbjct  214   VGNAVTDDYHDYIGTFEYWWTHGLISDSTYKLLQITCDKGSSEHPSTDCTKALLLAEQEQ  273

Query  1070  GSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
             G+ID Y+IY   C  + S R+  R         +DPC E Y   Y NLP+VQKA HAN T
Sbjct  274   GNIDPYSIYTRPCASTSSLRRNLRGHYPWMSRAYDPCTERYSEIYFNLPEVQKAFHANVT  333

Query  1232  KLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
             K+ Y W+ CS+++  YW D   +M PIY+ LIA+G +I +FSGD DSVVPVT+TRYS+DA
Sbjct  334   KVAYPWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVFSGDTDSVVPVTATRYSIDA  393

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +KL  I  W+PW D+ K+VGG+  VY+GLT  TV GAGHEVP   PR+A  LL  FL
Sbjct  394   LKLPTITNWYPWYDN-KKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFILLRSFL  449



>gb|EMT20722.1| Serine carboxypeptidase II-3 [Aegilops tauschii]
Length=518

 Score =   433 bits (1114),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/410 (51%), Positives = 276/410 (67%), Gaps = 7/410 (2%)
 Frame = +2

Query  365   GLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVG  544
              +PGQ    +F QYAGYV VD   GR+LFYYFAE+ Q P  KPL+LW+NGGPGCSS G G
Sbjct  104   AMPGQMEEAEFTQYAGYVTVDANAGRALFYYFAEAPQDPSNKPLVLWMNGGPGCSSFGAG  163

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             A +ELGPF V+ D KTLY ++ AWN VAN LF+E PAGVG+SYSNT+SDY  +GD+R+  
Sbjct  164   AMLELGPFSVHSDNKTLYKKKHAWNTVANMLFVEIPAGVGYSYSNTTSDYHNTGDKRSTD  223

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMI  904
             DAY FLVNW +RFP Y+ RDF+I GESYAG Y+PELA++I+  N     T  + LKG+ I
Sbjct  224   DAYTFLVNWLERFPKYRDRDFFITGESYAGHYVPELANLIISNNRARGAT-NVKLKGVAI  282

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSI  1078
             GN  +  +  +R  +DY W HA+IS +T+  +  +C  N  ++  C++    A  E G++
Sbjct  283   GNADLQYNLTLRATFDYFWMHAMISGKTYRTVQANCGFNGTYTKDCDNAMNLAIKEKGNV  342

Query  1079  DFYNIYGPLCLDSESSRKVKRRLGF-DPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
             D YNIY P+C D+ S  +    + F DPC   YV SYLN P+VQ+ALHAN T L Y W  
Sbjct  343   DDYNIYAPICRDASSPLRSSDPVVFGDPCTNHYVSSYLNRPEVQRALHANTTGLNYPWTD  402

Query  1256  CSEVITY--WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIK  1429
             CS  + +  WKD   T+ P  R+LI+SG ++ L+SGD+D+V  VTST+Y++D + L    
Sbjct  403   CSSQLVFDNWKDSPETVLPSIRKLISSGTRVWLYSGDMDAVCSVTSTQYALDILDLPTET  462

Query  1430  PWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              W PW  +  +V GY V Y+GL FATV+GAGH VP + PRRAL L + FL
Sbjct  463   SWRPWRVN-NEVAGYVVGYKGLVFATVKGAGHMVPYYQPRRALALFSSFL  511



>ref|XP_003576614.1| PREDICTED: serine carboxypeptidase II-3-like [Brachypodium distachyon]
Length=493

 Score =   432 bits (1112),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/409 (52%), Positives = 274/409 (67%), Gaps = 10/409 (2%)
 Frame = +2

Query  362   GGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGV  541
               LPGQP  V F QY+GYV VD+ NGR+LFYY  E+A     KPL+LWLNGGPGCSS G 
Sbjct  81    AALPGQPDGVSFSQYSGYVTVDEANGRALFYYLVEAAGDAAAKPLVLWLNGGPGCSSFGY  140

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA IELGPF VN D KTL   + +WN VAN +FLESPAGVGFSYSNT+SDYD SGD+RTA
Sbjct  141   GAMIELGPFRVNSDNKTLSRNKHSWNNVANVIFLESPAGVGFSYSNTTSDYDKSGDQRTA  200

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
              DA+ FLVNW +RFP YK R FYI GESYAG Y+P+LA  I+  N    T   + L GI+
Sbjct  201   DDAFIFLVNWLERFPEYKGRAFYISGESYAGHYVPQLAATILSHNMNDTTRTSLNLLGIL  260

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIKCEHFERAAGIEIGSID  1081
             +GN  ++D  + +G  DYLWSHA+ISDE    + ++C  N S      +  A  ++ + D
Sbjct  261   VGNPYLDDSMNTKGVIDYLWSHAVISDEVQINITKNCKFNPSDGTACLDAMAAYDLANTD  320

Query  1082  FYNIYGPLCLDSESSRKVKRRL--GFDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEV  1255
              Y+IYGP+C+D+   +    R   G+DPC+  Y+ +YLN  +VQKALHA  T+    W  
Sbjct  321   VYDIYGPVCIDAPDGKYYPSRYIPGYDPCSGYYIEAYLNDLEVQKALHARTTE----WSG  376

Query  1256  CSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             C+++  +WKD  ++M P  + L+  G  + LFSGD DSV P T+TRYS+  + L V +PW
Sbjct  377   CTDL--HWKDSPASMVPTLKWLLEHGLPVWLFSGDFDSVCPFTATRYSIHDLGLAVAEPW  434

Query  1436  HPWEDDTKQVGGYKVVYE-GLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PW   +K+VGGY  +Y  GL FA+VRGAGH+VP F P RAL L++ FL
Sbjct  435   RPWT-ASKEVGGYIQLYTGGLVFASVRGAGHQVPYFEPERALILVSSFL  482



>emb|CDP16361.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   432 bits (1112),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 228/428 (53%), Positives = 286/428 (67%), Gaps = 19/428 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTK---PLILW  505
             G  E D+I   LPGQP  V FKQY GY+ ++ T GR+ +YYF E AQ P      PL+LW
Sbjct  64    GLKEKDIIQE-LPGQPP-VNFKQYGGYITINATAGRAFYYYFTE-AQDPKKAQDLPLLLW  120

Query  506   LNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTS  685
             LNGGPGCSSLG GA  ELGPF V  DGKTLY  ++AWN VAN LFLESPAGVGFSYSNT+
Sbjct  121   LNGGPGCSSLGFGAMQELGPFRVGSDGKTLYKNQYAWNHVANVLFLESPAGVGFSYSNTT  180

Query  686   SDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMP  865
             SD+   GDR+TA D Y FL+NW +RFP YK RDFYI GESYAG Y+P+LA  IV  N   
Sbjct  181   SDFVKGGDRKTAADNYIFLLNWLERFPEYKNRDFYIAGESYAGHYVPQLAHNIVYHNKKA  240

Query  866   ETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI-----  1030
               T+ I LKGI+IGN ++N +TD  G  DY  SHALIS E+   + ++C  NFS+     
Sbjct  241   NKTI-INLKGILIGNAVINQETDSIGMIDYWASHALISLESSIKIHKYC--NFSLDAQRS  297

Query  1031  -KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR--RLGFDPCAEDYVYSYLNLPK  1201
              +C      AG  +G ID YNIY PLC D   +   KR   +  DPC+  YVYSY NLP+
Sbjct  298   DECNSALDEAGNMVGDIDIYNIYYPLCFDGNVTSIPKRFSIMEIDPCSGYYVYSYFNLPE  357

Query  1202  VQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPV  1381
             VQ+A+HAN TKL Y W+ CS+V+  W+DR ST+ P  + L+    ++ +FSGD D  VPV
Sbjct  358   VQEAIHANVTKLHYDWQPCSDVLEDWEDRQSTVLPFLKELMEKEIRVWIFSGDTDGRVPV  417

Query  1382  TSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVY-EGLTFATVRGAGHEVPQFTPRRAL  1558
             TST+YS++ M +  +  W  W  D ++VGGY   Y + LTF TVRGAGHEVP + P RAL
Sbjct  418   TSTQYSLEVMNITTLNSWRAWYRD-REVGGYVQEYKDNLTFVTVRGAGHEVPSYRPDRAL  476

Query  1559  TLLNMFLS  1582
             +L++ F++
Sbjct  477   SLVSYFVA  484



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase-like 29-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=470

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/420 (52%), Positives = 282/420 (67%), Gaps = 16/420 (4%)
 Frame = +2

Query  365   GLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVG  544
             GLPGQ  NV F  YAGYVNV++  GR+LFY+F E+A+ P +KPL+LWLNGGPGCSS+  G
Sbjct  40    GLPGQTFNVSFAHYAGYVNVNEDAGRALFYWFVEAAEDPTSKPLVLWLNGGPGCSSIAYG  99

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
                E+GPF +  DGKTLY   ++WN+VAN LFL+SP GVGFSYSNTSSD   +GD+RTA 
Sbjct  100   MAEEVGPFHIQADGKTLYLNPYSWNQVANILFLDSPVGVGFSYSNTSSDLMSNGDKRTAS  159

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMI  904
             D+  FL+ W +R+P YK RDFYI GESYAG Y+P+L+  IVK N +      I LKG M+
Sbjct  160   DSLAFLLKWLERYPQYKGRDFYITGESYAGHYVPQLSQAIVKYN-LAAKEKGINLKGYMV  218

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEIG  1072
             GN + +D  D  G + ++WS  LISD+T+  L   C     ++ S  C+     A  E+G
Sbjct  219   GNALTDDYHDHLGVFQFMWSAGLISDQTYKALNLFCDFQSFIHTSNSCDSILDIASAELG  278

Query  1073  SIDFYNIYGPLCLD--SESSRKVKR-----RLG--FDPCAEDYVYSYLNLPKVQKALHAN  1225
             +ID Y+IY P C    S+S+R +KR     R+   +DPC E +   Y NLP+VQKALH +
Sbjct  279   NIDPYSIYTPSCPANVSQSNRLLKRMHVAGRINEKYDPCTEKHTVVYFNLPEVQKALHVD  338

Query  1226  NTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
                 P  WE CS+V+ T WKD   T+  +YR LI SG +I +FSGD D+V+PVTSTRYS+
Sbjct  339   RHHAPSKWETCSDVVYTTWKDSPRTVLDVYRELIHSGLRIWMFSGDTDAVIPVTSTRYSI  398

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             D++KL  +KPW  W D+  QVGG+   Y GLTF +VRGAGHEVP   P+ AL L+  FLS
Sbjct  399   DSLKLPTVKPWRAWYDE-GQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKLALALIKNFLS  457



>ref|XP_004984182.1| PREDICTED: serine carboxypeptidase-like 26-like isoform X2 [Setaria 
italica]
Length=495

 Score =   432 bits (1112),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/408 (52%), Positives = 274/408 (67%), Gaps = 6/408 (1%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             +PGQ   V+F QYAGYV VD   GR+LFYYF E+ Q P  KPL+LWLNGGPGCSS G GA
Sbjct  83    MPGQTGVVEFGQYAGYVTVDAKAGRALFYYFVEAPQDPLDKPLVLWLNGGPGCSSFGSGA  142

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF V  D KTLY +R AWN+VAN LF+E PAGVG+SYSNT+SDY  +GD+RT  D
Sbjct  143   MLELGPFSVRNDNKTLYRKRHAWNRVANMLFVEIPAGVGYSYSNTTSDYYNTGDQRTTDD  202

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY F+VNW ++FP Y+ RDF+I GESYAG YIPELA++IV +N     T  + LKG+ IG
Sbjct  203   AYTFIVNWLEKFPEYRDRDFFITGESYAGHYIPELANLIVSKNRASNAT-NVKLKGVAIG  261

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSID  1081
             N  ++D+  +R  +DY W HA+IS + +  + + C  N  ++  C++    A  E G++D
Sbjct  262   NADLDDNLTLRASFDYYWMHAMISRKAYRAIKDKCDFNGTYTKDCQNAMNLATQEKGNVD  321

Query  1082  FYNIYGPLCLDSESSRKVKRRLGF-DPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVC  1258
              Y+IY P C D+ +  K    +   DPC   YV SYLN P+VQKALHAN T L Y W  C
Sbjct  322   DYDIYAPTCHDASNPSKSSDSVYMGDPCTNHYVSSYLNRPEVQKALHANTTGLHYPWMDC  381

Query  1259  SE-VITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPW  1435
             S+ V   WKD   TM P  ++LI+SG +I L+SGD+D+V    ST+Y +D + L +   W
Sbjct  382   SQHVFDNWKDSPETMLPSIKKLISSGIRIWLYSGDMDAVCSFISTQYVLDILGLPIETSW  441

Query  1436  HPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PW  D  +V GY + Y+GL FATVRGAGH VP + PRRAL L + FL
Sbjct  442   RPWSIDN-EVAGYVIGYKGLVFATVRGAGHMVPYYQPRRALALFSSFL  488



>ref|XP_009777076.1| PREDICTED: putative serine carboxypeptidase-like 23 [Nicotiana 
sylvestris]
Length=489

 Score =   432 bits (1111),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 223/420 (53%), Positives = 281/420 (67%), Gaps = 15/420 (4%)
 Frame = +2

Query  344   EDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPG  523
             E+D I   LPGQP  V F QY+GYV VD T GR+LFYYF ES Q   +KPL+LWLNGGPG
Sbjct  70    ENDKIEQ-LPGQPQGVDFNQYSGYVTVDPTAGRNLFYYFVESPQDSGSKPLVLWLNGGPG  128

Query  524   CSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMS  703
             CSSLG GAF ELGPF V+ DG +L   +F+W   AN +FLESPAGVGFSY+NTS+DY+ S
Sbjct  129   CSSLGGGAFGELGPFRVSKDG-SLQRNQFSWISEANIIFLESPAGVGFSYTNTSTDYNSS  187

Query  704   GDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKI  883
             GDR TA D+Y FLVNW +RFP YKTRDFY+ GESYAG Y+P+LA +I+  N     T+ I
Sbjct  188   GDRTTAIDSYTFLVNWLERFPEYKTRDFYLTGESYAGHYVPQLAQLILLHNNYTNHTI-I  246

Query  884   PLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI------KCEHF  1045
              LKGI IGN  ++ + +++G  +Y WSHALISDE +  +   C  NFS       KC+  
Sbjct  247   NLKGITIGNAYVDFEANMKGTTEYYWSHALISDELYYKITSSC--NFSTPSSASKKCKDH  304

Query  1046  ERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHAN  1225
                   EIG+I  YNIY PLC ++  S      +  DPC   Y+ SY N P+VQKA+HAN
Sbjct  305   LDQIDKEIGNIFLYNIYAPLCNNTSPSNTTTSEV--DPCMPVYIQSYFNKPEVQKAIHAN  362

Query  1226  NTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
              T LPY W+ C+  +   WKDR  T+ P+ R+L+ SG +I L+SGD+D VVPVT TRY++
Sbjct  363   VTSLPYPWQSCNNTLNLSWKDRPLTVLPLIRQLMKSGLRIWLYSGDMDVVVPVTDTRYAI  422

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
               +KL +   W+PW    ++VGGY   YE LT  T+RGAGH VP + P RAL   + FLS
Sbjct  423   KKLKLPIKTAWYPWYFQ-EEVGGYVEEYENLTLVTIRGAGHFVPTYQPSRALAFFSYFLS  481



>ref|XP_009607740.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=448

 Score =   431 bits (1107),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 223/418 (53%), Positives = 280/418 (67%), Gaps = 11/418 (3%)
 Frame = +2

Query  344   EDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPG  523
             E+D I   LPGQP  V F QY+GYV VD T GR+LFYYF ES Q   +KPL+LWLNGGPG
Sbjct  30    ENDRIEQ-LPGQPQGVDFNQYSGYVTVDPTAGRNLFYYFVESPQDSASKPLVLWLNGGPG  88

Query  524   CSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMS  703
             CSSLG GAF ELGPF VN DG +L   +F+W   AN +FLESPAGVGFSY+NTS+DY+ S
Sbjct  89    CSSLGGGAFGELGPFRVNKDG-SLNMNQFSWISEANIIFLESPAGVGFSYTNTSADYNFS  147

Query  704   GDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKI  883
             GDR TA D+Y FLVNW +RFP YKTRDFY+ GESYAG Y+P+LA +I+  N     T+ I
Sbjct  148   GDRTTAIDSYTFLVNWLERFPEYKTRDFYLTGESYAGHYVPQLAQLILLHNNYSNQTI-I  206

Query  884   PLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF----SIKCEHFER  1051
              LKGI IGN  ++ + +++G  +Y WSHALISDE ++ +I  C  +     S KC  +  
Sbjct  207   NLKGITIGNAYVDFEANMKGTTEYYWSHALISDELYNKIISSCNFSSPSSASKKCNDYLD  266

Query  1052  AAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKALHANNT  1231
                 EIG+I  YNIY PLC +   S      +  DPC   Y+ SY N P+VQKA+HAN  
Sbjct  267   QIDKEIGNIFLYNIYAPLCPNGSPSSTSTSEV--DPCMPFYIQSYFNKPEVQKAIHANVK  324

Query  1232  KLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDA  1408
              LPY WE C+  +   WKDR  T+ P+ R+L+ S  KI L+SGD+D VVPVT TRY++  
Sbjct  325   NLPYPWESCNNTLNLSWKDRPLTVLPLLRQLMKSDLKIWLYSGDMDVVVPVTDTRYAIKK  384

Query  1409  MKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFLS  1582
             +KL +   W+PW    ++VGGY   YE LT  T+RGAGH VP + P RAL+  + FLS
Sbjct  385   LKLPIKTAWYPWYFQ-EEVGGYVEEYENLTLVTIRGAGHFVPTYQPSRALSFFSYFLS  441



>ref|XP_006292523.1| hypothetical protein CARUB_v10018754mg, partial [Capsella rubella]
 gb|EOA25421.1| hypothetical protein CARUB_v10018754mg, partial [Capsella rubella]
Length=450

 Score =   431 bits (1107),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 218/421 (52%), Positives = 281/421 (67%), Gaps = 18/421 (4%)
 Frame = +2

Query  350   DLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCS  529
             DLI   LPGQP  V F QY GYV V+++ GRS FYYF E++++  + PL+LWLNGGPGCS
Sbjct  30    DLIRR-LPGQPP-VDFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLLWLNGGPGCS  87

Query  530   SLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGD  709
             SL  GA  ELGPF V+ DGKTL+  R+AWN  AN LFLESPAGVGFSY+NT+SD +  GD
Sbjct  88    SLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSDMEKHGD  147

Query  710   RRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPL  889
             R TA D Y FLV W +RFP YK RD YI GESYAG Y+P+LA  I+  +        + L
Sbjct  148   RNTAADNYIFLVKWLERFPEYKDRDLYIAGESYAGHYVPQLAHTILLHHQS-----FLDL  202

Query  890   KGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN------FSIKCEHFER  1051
             KGI+IGN ++ND+TD+ G YD+  SHALIS+++   L  +C +        + +C     
Sbjct  203   KGILIGNAVINDETDLMGMYDFFESHALISEDSLASLKNNCDLKTESASVMTEECAVVSD  262

Query  1052  AAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLG---FDPCAEDYVYSYLNLPKVQKALHA  1222
                ++   +D YNIY PLCL+S  +R+ KR      FDPC++ YV +YLN P+VQ ALHA
Sbjct  263   QIDMDTYYLDIYNIYAPLCLNSTLTRRPKRGTTIREFDPCSDHYVQAYLNRPEVQAALHA  322

Query  1223  NNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSV  1402
             N TKLPY W+ CS VI  W D  +T+ P+ + L+  G ++ +FSGD D  +PVTST+YS+
Sbjct  323   NATKLPYEWQPCSSVIKKWNDSPTTVIPLIKGLMGRGVRVWVFSGDTDGRIPVTSTKYSL  382

Query  1403  DAMKLKVIKPWHPWEDDTKQVGGYKVVYEG-LTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
               M L     WHPW     +VGGY   Y+G LTFATVRGAGH+VP F P+R+L+L   FL
Sbjct  383   KKMNLTAKTAWHPWYIG-GEVGGYTEEYKGKLTFATVRGAGHQVPSFQPKRSLSLFIHFL  441

Query  1580  S  1582
             +
Sbjct  442   N  442



>emb|CDP16360.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   432 bits (1111),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 229/428 (54%), Positives = 287/428 (67%), Gaps = 19/428 (4%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTK---PLILW  505
             G  E D+I   LPGQPS V FKQY GY+ ++ T GR+ +YYF E AQ P      PL+LW
Sbjct  64    GLKEKDIIQK-LPGQPS-VSFKQYGGYITINATAGRAFYYYFTE-AQDPKKAQDLPLLLW  120

Query  506   LNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTS  685
             LNGGPGCSSL  GA  ELGPF V  DGKTLY  ++AWN VAN LF+ESPAGVGFSYSNT+
Sbjct  121   LNGGPGCSSLAYGAMQELGPFRVGSDGKTLYKNQYAWNHVANVLFVESPAGVGFSYSNTT  180

Query  686   SDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMP  865
             SD+   GDR+TA D Y FL+NW +RFP YK RDFYI GESYAG Y+P+LA  IV  N   
Sbjct  181   SDFVKGGDRKTAADNYIFLINWLERFPEYKDRDFYIAGESYAGHYVPQLAHNIVYHNKKA  240

Query  866   ETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSI-----  1030
               T+ I LKGI+IGN  +N +TD  G  DY  SHALIS E+   + ++C  NFS+     
Sbjct  241   NKTI-INLKGILIGNADINHETDNIGMIDYWASHALISLESSRKIHKYC--NFSLDDQRS  297

Query  1031  -KCEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR--RLGFDPCAEDYVYSYLNLPK  1201
              +C          +  ID YNIY PLCLD+  +   KR   +  DPC+++YVYSY NLP+
Sbjct  298   DECSSTLGEVSNMLEDIDIYNIYYPLCLDANVTSIPKRFSIMEIDPCSDNYVYSYFNLPE  357

Query  1202  VQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPV  1381
             VQ+ +HAN TKL Y W+ CS VI  W+DRAST+ P    L+ +G ++ LFSGD+D  VPV
Sbjct  358   VQEQIHANVTKLHYDWQSCSGVIERWEDRASTVLPFIEELMENGIRVWLFSGDMDGRVPV  417

Query  1382  TSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVY-EGLTFATVRGAGHEVPQFTPRRAL  1558
             TST+YS++ M +  + PW  W  D ++VGGY   Y + LTF TVRGAGHEVP + P RAL
Sbjct  418   TSTQYSLEVMNITTLNPWRAWYRD-REVGGYVQEYKDNLTFVTVRGAGHEVPSYRPDRAL  476

Query  1559  TLLNMFLS  1582
             +L+  F++
Sbjct  477   SLVLNFIA  484



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   431 bits (1107),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 219/420 (52%), Positives = 285/420 (68%), Gaps = 21/420 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP+NV F QY+GYV+V++  GR+LFY+  ES  ++ P ++PLILWLNGGPGCSS+  
Sbjct  35    LPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLILWLNGGPGCSSVAY  94

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTLY   ++WNK+AN LFLESPAGVGFSY+NT+SD   +GD RTA
Sbjct  95    GAAEEIGPFRIRPDGKTLYLNPYSWNKLANLLFLESPAGVGFSYTNTTSDLYTAGDGRTA  154

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRN---TMPETTLKIPLK  892
             +DAY FLVNWF+RFP YK  DFYI GESYAG Y+P+L+ ++ +RN     PE    I  K
Sbjct  155   EDAYTFLVNWFERFPQYKHTDFYIAGESYAGHYVPQLSQIVYERNKGIANPE----INFK  210

Query  893   GIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAG  1060
             G M+GN + +D  D  G ++Y W+H LISD T+  L   C      + S+ C    ++A 
Sbjct  211   GFMVGNAVTDDYHDYVGTFEYWWTHGLISDSTYRSLRIACESGSSEHPSLDCMTALKSAE  270

Query  1061  IEIGSIDFYNIYGPLCLDSESSRKVKR------RLGFDPCAEDYVYSYLNLPKVQKALHA  1222
             +E G+ID Y+I+   C  + S R+  R         +DPC E Y   Y N P+VQKALHA
Sbjct  271   MEQGNIDPYSIFTRPCNGTASLRRNLRGHYPWMSRAYDPCTERYSEVYFNHPEVQKALHA  330

Query  1223  NNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N T + Y W  CSE++   W D   +M PIY+ LIA+G KI +FSGD D+VVPVT+TRYS
Sbjct  331   NVTGISYPWRTCSEIVGDNWTDSPLSMLPIYKELIAAGLKIWVFSGDTDAVVPVTATRYS  390

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +DA+KL  +  W+PW D+ ++VGG+  VY+GLTF TV GAGHEVP   PR+A  L   FL
Sbjct  391   IDALKLPTVINWYPWYDN-RKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAFILFRSFL  449



>gb|EEE59170.1| hypothetical protein OsJ_11093 [Oryza sativa Japonica Group]
Length=415

 Score =   429 bits (1103),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 216/410 (53%), Positives = 271/410 (66%), Gaps = 8/410 (2%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVGA  547
             +PGQ    +F QYAGYV VD   GR+LFYYF E+   P  KPL+LWLNGGPGCSS G GA
Sbjct  1     MPGQMEEAEFNQYAGYVTVDAKAGRALFYYFVEAPHDPLKKPLVLWLNGGPGCSSFGAGA  60

Query  548   FIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAKD  727
              +ELGPF V  D KTLY+++ AWN VAN LF++ PAGVG+SYSNT+SDY   GD++T  D
Sbjct  61    MLELGPFSVRSDNKTLYNKQHAWNTVANMLFVDVPAGVGYSYSNTTSDYYNIGDKKTTDD  120

Query  728   AYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMIG  907
             AY FL+NW K+FP Y+  DF+I GESYAG YIPELA++IV  N    +T  I LKG+ IG
Sbjct  121   AYIFLINWMKKFPEYQGHDFFITGESYAGHYIPELANLIVSNNRAINST-NIKLKGVAIG  179

Query  908   NGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSID  1081
             N  ++D+  +R  +DY W HA+ISD  +  +   C  N  ++  C++    A  E G++D
Sbjct  180   NADLHDNVTLRASFDYYWRHAMISDRVYRAIQTSCGFNETYTNDCQNAMNLANKEKGNVD  239

Query  1082  FYNIYGPLCLDSE--SSRKVKRRLGF-DPCAEDYVYSYLNLPKVQKALHANNTKLPYTWE  1252
              YNIY P C D+   S       + F DPC   YV SYLN P+VQ+ALHAN T L Y W 
Sbjct  240   DYNIYAPQCHDASNPSPSGSSDSVAFGDPCTNHYVSSYLNNPEVQRALHANTTGLNYPWM  299

Query  1253  VCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIK  1429
              CS +I   WKD   TM P  + LI+SG +I L+SGD+D+V  VTST+Y++D + L V  
Sbjct  300   DCSGLIFDNWKDSPETMLPSIKTLISSGTRIWLYSGDMDAVCSVTSTQYALDILGLPVET  359

Query  1430  PWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              W PW  D  +V GY V Y GL FATVRGAGH VP + PRRAL LL+ FL
Sbjct  360   SWRPWRID-NEVAGYVVGYRGLVFATVRGAGHMVPYYQPRRALALLSSFL  408



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   431 bits (1107),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 288/422 (68%), Gaps = 21/422 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAES--AQTPHTKPLILWLNGGPGCSSLGV  541
             LPGQPSNV F+QY+GYV V +  GR+LFY+  ES  A+ P ++PL+LWLNGGPGCSS+  
Sbjct  37    LPGQPSNVDFRQYSGYVTVHEERGRALFYWLVESPLARDPKSRPLVLWLNGGPGCSSVAY  96

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF V  DGKTL+S+ +AWNK+AN LFLESPAGVGFSYSNT+SD   +GD+RTA
Sbjct  97    GAAEEIGPFRVGSDGKTLHSKLYAWNKLANLLFLESPAGVGFSYSNTTSDLYTTGDQRTA  156

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +D+Y FLVNWF+RFP YK R+FYI+GESYAG ++P+L+ ++ +RN   +    I LKG M
Sbjct  157   EDSYIFLVNWFERFPQYKHREFYIVGESYAGHFVPQLSKLVHERNKGFKNP-AINLKGFM  215

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVV----NFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S++C    R A +E 
Sbjct  216   VGNAVTDDYHDYIGTFEYWWNHGLISDSTYHQLKTACYSVSSQHPSMQCMVALRNAELEQ  275

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRRL---------GFDPCAEDYVYSYLNLPKVQKALHA  1222
             G+ID Y+I+   C    S+  +KR L          +DPC E Y   Y N   VQKALHA
Sbjct  276   GNIDPYSIFTKPC---NSTVALKRFLKGRYPWMSRAYDPCTERYSNVYFNRLDVQKALHA  332

Query  1223  NNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N T+L Y W+ CS+++ +YW D   +M PIY+ LI +G KI +FSGD D+VVP+T+TRYS
Sbjct  333   NVTRLSYPWKACSDIVGSYWDDSPLSMLPIYKELITAGLKIWVFSGDTDAVVPITATRYS  392

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             VDA+KL  I  W+PW D  K VGG+  VY+GLT  TV GAGHEVP   PR+A  L   FL
Sbjct  393   VDALKLATITNWYPWYDHGK-VGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFL  451

Query  1580  ST  1585
              +
Sbjct  452   ES  453



>gb|KEH21654.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=468

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 228/436 (52%), Positives = 282/436 (65%), Gaps = 25/436 (6%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I   LPGQP  V FKQ++GYV V+   GR+LFY+  E+ Q P  KPL++WLNG
Sbjct  29    GEEEKDRI-FKLPGQPK-VLFKQFSGYVTVNHVAGRALFYWLTEAEQNPLNKPLVIWLNG  86

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS+  GA  E+GPF +N     LY  +FAWN VAN LFLE+PAGVGFSYSN SSD 
Sbjct  87    GPGCSSVAYGASEEIGPFRLNKTASGLYINKFAWNTVANLLFLEAPAGVGFSYSNRSSDL  146

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
               +GDRRTAKD+ +F++ W +RFP YK R+ YI GESYAG Y+P+LA  I+  N   +  
Sbjct  147   LDTGDRRTAKDSLEFVIQWLERFPRYKNRELYITGESYAGHYVPQLAKEIMTYNI--KAK  204

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF---SIKCEH-  1042
              +I LKGIM+GN + ++  D  G   Y WSHA+ISD+T+  LI  C  +    S +CE  
Sbjct  205   QRINLKGIMVGNAVTDNYYDNLGTVTYWWSHAMISDQTYKQLISTCDFHHQKESNECESL  264

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSESSRKVKR---RL------------GFDPCAEDYV  1177
             +  A   E G+ID YNIY P C +S+ S    R   RL            G+DPC E Y 
Sbjct  265   YSYAMDQEFGNIDQYNIYAPPCNNSDGSSSGTRHTLRLPHLPHVAFRQMAGYDPCTEKYA  324

Query  1178  YSYLNLPKVQKALHANNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFS  1354
               Y N P VQKALHAN T +PY W  CSEV+   W D   ++ P+YR LIA G ++ +FS
Sbjct  325   EVYYNRPDVQKALHANTTGIPYKWTACSEVLNRNWNDTDVSVLPLYRELIAHGVRVWVFS  384

Query  1355  GDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVP  1534
             GDVDSVVPVT+TRY++  +KL    PW+PW    KQVGG+  VYEGLTFATVRGAGHEVP
Sbjct  385   GDVDSVVPVTATRYALAQLKLATKIPWYPWYVK-KQVGGWTEVYEGLTFATVRGAGHEVP  443

Query  1535  QFTPRRALTLLNMFLS  1582
              F PR AL L   FL+
Sbjct  444   LFKPRAALQLFKSFLA  459



>ref|XP_008813035.1| PREDICTED: putative serine carboxypeptidase-like 23 [Phoenix 
dactylifera]
Length=484

 Score =   431 bits (1109),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 216/411 (53%), Positives = 274/411 (67%), Gaps = 16/411 (4%)
 Frame = +2

Query  365   GLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGVG  544
              LPGQP  V F QYAGYV V+  NGR+LFYYF ES +    KPL+LWLNGGPGCSSLG G
Sbjct  76    ALPGQPKGVSFDQYAGYVTVEPQNGRTLFYYFVESPRDSEKKPLLLWLNGGPGCSSLGYG  135

Query  545   AFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTAK  724
             A  ELGPF VN DGKTL     AWN VAN +FLESPAGVGFSY+NTSSDY   GD+RTA+
Sbjct  136   ALQELGPFRVNRDGKTLLRNNHAWNNVANVIFLESPAGVGFSYTNTSSDYKNRGDKRTAE  195

Query  725   DAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIMI  904
             D Y FLVNW +RFP YKTRD +I GESYAG Y+P+LA +I+  N  P   + I L+GI +
Sbjct  196   DTYTFLVNWLERFPEYKTRDLFITGESYAGHYVPQLASLILLNNKNPNKPI-INLRGIAM  254

Query  905   GNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVN--FSIKCEHFERAAGIEIGSI  1078
             GN  ++ +      Y++LW H + SD TH  +   C ++   S +C+H    A +EIGSI
Sbjct  255   GNAYIDSNITEMAMYEFLWMHDMYSDRTHKLIRRTCNISDMSSPECKHATNLADMEIGSI  314

Query  1079  DFYNIYGPLCLDSESSRKV----KRRLGFDPCAEDYVYSYLNLPKVQKALHANNTKLPYT  1246
             + YN+Y PLC  +E S K        + FDPC ++YV  YLN P VQK+LHA    +P  
Sbjct  315   NPYNVYAPLC--TEKSHKATCITSSNVEFDPCTDEYVDVYLNQPVVQKSLHA----VPSL  368

Query  1247  WEVCSEVITYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYSVDAMKLKVI  1426
             W  CS  +  W+D   TM P+  +L  SG +I L+SGD+DS+V VTST+YS+  + L + 
Sbjct  369   WTHCS--LGGWRDSPDTMLPMIEQLTTSGIRIWLYSGDMDSIVSVTSTKYSLRMLGLPIK  426

Query  1427  KPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
              PW PW+ +  +V GY V Y+GLTF TVRGAGHEVP + P +AL +++ FL
Sbjct  427   SPWRPWQAN-GEVAGYVVAYKGLTFVTVRGAGHEVPSYQPEKALVMISAFL  476



>ref|XP_006346530.1| PREDICTED: serine carboxypeptidase II-3-like [Solanum tuberosum]
Length=486

 Score =   431 bits (1109),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 226/490 (46%), Positives = 314/490 (64%), Gaps = 22/490 (4%)
 Frame = +2

Query  137   MSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEAWSemeeee  316
             +S+   +  +L  ++    +     + D  R  +  RR K + +       A  +    +
Sbjct  3     ISSVLPLFLILCYLSAQQCYA---GEADVLREFLKARRTKTRDVVSQGLAVAEKQKSVSK  59

Query  317   mVFDDVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPL  496
              +   VGS ++D I+  LPGQP  + F QY+GYV VD   GR+LFYY AES   P TKPL
Sbjct  60    FLVPQVGSKKNDKISA-LPGQPKGINFAQYSGYVTVDANAGRALFYYLAESPNDPSTKPL  118

Query  497   ILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYS  676
             +LWLNGGPGCSS G G  +ELGPF VN DGKTL+   FAWNKVAN LFLESPAGVGFSYS
Sbjct  119   LLWLNGGPGCSSFGNGGMVELGPFRVNEDGKTLWLNPFAWNKVANVLFLESPAGVGFSYS  178

Query  677   NTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVK-R  853
             NTSSDY  +GD +T +D++ FLVNW +RFP YK RDFYI+GESYAG Y+P+LA +I+  +
Sbjct  179   NTSSDY-TTGDEKTRQDSFTFLVNWMERFPEYKHRDFYIVGESYAGHYVPQLAQLILSHK  237

Query  854   NTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK  1033
              T P   L I L+GI  GN +++D+T   G YD+ W+HALISDE H+G++++C  NFS +
Sbjct  238   KTKPN--LVINLQGIATGNALLDDETWNSGSYDFYWTHALISDEVHEGIVKNC--NFSTE  293

Query  1034  ------CEHFERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRLGFDPCAEDYVYSYLNL  1195
                   C+ +   A     +I  YN Y  LC  + S+       GFDPC+++YV +YLN 
Sbjct  294   TSTSEACDKYTSEADSCQANIYSYNTYSQLC--NSSAYTSLPIDGFDPCSDNYVDNYLNT  351

Query  1196  PKVQKALHANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSV  1372
              +VQKAL+  +  +P++W  CS  I  YW+D   T+ PI++ L+ SG ++ ++SGD+D +
Sbjct  352   IEVQKALNVRD--IPHSWGSCSNDIGGYWQDSPDTVLPIFQELMQSGIRVWIYSGDIDHI  409

Query  1373  VPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRR  1552
             + VT++RY ++ +K  V   W+PW     +VGGY V Y+ LTF TVRGAGH VP + P R
Sbjct  410   LSVTTSRYDINKIKTPVKTAWYPWSFH-GEVGGYAVEYQNLTFVTVRGAGHFVPSYQPGR  468

Query  1553  ALTLLNMFLS  1582
             ALT+ + F++
Sbjct  469   ALTMFSSFIN  478



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   430 bits (1106),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 223/422 (53%), Positives = 280/422 (66%), Gaps = 22/422 (5%)
 Frame = +2

Query  368   LPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESA--QTPHTKPLILWLNGGPGCSSLGV  541
             LPGQP+ V F QY+GYV V++  GR+LFY+  ES   + P ++PL+LWLNGGPGCSS+  
Sbjct  35    LPGQPT-VGFAQYSGYVTVNRKAGRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAY  93

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  E+GPF + PDGKTLY   +AWN +AN LFLESPAGVGFSY+NTSSD   +GD+RTA
Sbjct  94    GAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTA  153

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DAY FLVNWF+RFP YK RDFYI GESYAG Y+P+L+ +I +RN   +  + I  KG M
Sbjct  154   EDAYAFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQIIYERNKGKKNPI-INFKGFM  212

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC----VVNFSIKCEHFERAAGIEI  1069
             +GN + +D  D  G ++Y W+H LISD T+  L   C      + S+ C      A +E 
Sbjct  213   VGNAVTDDYHDFVGTFEYWWNHGLISDSTYQSLRVTCDSGSSQHPSVDCMRALXLAEMEQ  272

Query  1070  GSIDFYNIYGPLCLDSESSRKVKRRL---------GFDPCAEDYVYSYLNLPKVQKALHA  1222
             G+ID Y+IY   C    S+  +KR L          +DPC E Y   Y N P VQKALHA
Sbjct  273   GNIDPYSIYTRPC---NSTASLKRNLRGHYPWMSRAYDPCTERYSEVYFNRPDVQKALHA  329

Query  1223  NNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTSTRYS  1399
             N TK+ Y W+ CS+ +  YW D   +M PIY+ LIA+G KI +FSGD DSVVPVT+TRYS
Sbjct  330   NVTKVSYPWQTCSDXVGNYWADSPLSMLPIYKELIAAGLKIWVFSGDTDSVVPVTATRYS  389

Query  1400  VDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLNMFL  1579
             +DA+KL  I  W PW D+ K VGG   +Y+GLTF TV GAGHEVP   PR A  L   FL
Sbjct  390   IDALKLPTITNWFPWNDNGK-VGGRSQIYKGLTFVTVTGAGHEVPLHRPRLAFILFRSFL  448

Query  1580  ST  1585
              +
Sbjct  449   ES  450



>dbj|BAK01526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score =   432 bits (1111),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 239/508 (47%), Positives = 310/508 (61%), Gaps = 26/508 (5%)
 Frame = +2

Query  113   MGKKQDSLMSTKFHMLFLLIIMATHLGFGHGVNKIDQARRIMWLRRAKMQQLHGGITDEA  292
             M  + +   + +  +L LL+ +   L  G G     +AR+   LRR +       +   +
Sbjct  1     MPAEAEKQSTVRKAVLMLLLAVVQCLALGCGTAAAARARQGDHLRRLRRSSSLAAVEGPS  60

Query  293   WSemeeeemVFD--DVGSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAE  466
              +  +    +    + GS E D ++  LPGQP  V F QYAGYV VD   GR+LFYY AE
Sbjct  61    SATADRRPKLVPAAEAGSKEADRVDA-LPGQPRGVDFAQYAGYVTVDAAAGRALFYYLAE  119

Query  467   SA----QTPHTKPLILWLNGGPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANT  634
             +A         KP +LWLNGGPGCSSLG GA  ELGPF V  DGKTLY   ++WN+ AN 
Sbjct  120   AAGGNGNGNKPKPFLLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLYRNPYSWNRAANV  179

Query  635   LFLESPAGVGFSYSNTSSDYDMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAG  814
             LFLESPAGVG+SYSNT++DYD SGD RTA+DAY FLV+W +RFP YK R+FYI GESYAG
Sbjct  180   LFLESPAGVGYSYSNTTADYDRSGDNRTAEDAYIFLVSWLQRFPEYKGREFYIAGESYAG  239

Query  815   FYIPELADVIVKRNTMPETTLKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHD  994
              + P+LA  I+ R+  P     I LKG+MIGN ++ND TD +G +D+ W+HALISDET D
Sbjct  240   HFAPQLAHAIL-RHASP----AINLKGVMIGNAVINDGTDKKGTFDFYWTHALISDETAD  294

Query  995   GLIEHCVVNFSIK------CEHFERAAGIEIGSIDFYNIYGPLCLDSE--SSRKVKRRLG  1150
             G+  +C  NF+        C+         + +ID YNIY P C      +         
Sbjct  295   GVSRNC--NFTNGAESNDLCDEANDDVVENLRNIDNYNIYAPNCQTEGLVTPPITPSVES  352

Query  1151  FDPCAEDYVYSYLNLPKVQKALHANNTKLPYTWEVCSEVITYWKDRASTMFPIYRRLIAS  1330
             FD C  +YV +YLN P VQKALHAN T+L   W  CSEV T W D A+T+ PI R L+ +
Sbjct  353   FDTCTSNYVEAYLNKPDVQKALHANVTRLDRPWLACSEVFTRWVDSAATVLPIIRELMEN  412

Query  1331  GQKILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTK---QVGGYKVVYE-GLT  1498
               ++ ++SGD D  VPVT+TRYS++ ++L V   W  W   TK   +VGGY V Y+ GL+
Sbjct  413   NIRVWVYSGDTDGNVPVTATRYSINQLQLPVAVKWRRWFSSTKGAGEVGGYVVQYKGGLS  472

Query  1499  FATVRGAGHEVPQFTPRRALTLLNMFLS  1582
               TVRGAGHEVP + P+RAL LL  FL+
Sbjct  473   LVTVRGAGHEVPSYQPQRALQLLQGFLA  500



>gb|AAK44013.1|AF370198_1 putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=465

 Score =   431 bits (1107),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 288/436 (66%), Gaps = 28/436 (6%)
 Frame = +2

Query  341   MEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQ-TPHTKPLILWLNGG  517
              E D I   LPGQP  V F QY+GYVNV++++GR+LFY+  ES+  +PHTKPL+LWLNGG
Sbjct  28    QEKDRIKA-LPGQP-KVAFSQYSGYVNVNQSHGRALFYWLTESSSPSPHTKPLLLWLNGG  85

Query  518   PGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYD  697
             PGCSS+  GA  E+GPF +N +G  LY  +FAWNK AN LFLESPAGVG+SY+NTSSD  
Sbjct  86    PGCSSIAYGASEEIGPFRINKNGSNLYLNKFAWNKDANLLFLESPAGVGYSYTNTSSDLK  145

Query  698   MSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTL  877
              SGD RTA+D   FL+ W  RFP YK RDFYI GESYAG Y+P+LA  I   N      +
Sbjct  146   DSGDERTAQDNLIFLIKWLSRFPQYKYRDFYIAGESYAGHYVPQLAKKINDYNKAFSKPI  205

Query  878   KIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK-----CEH  1042
              I LKG ++GN + ++  D  G   Y W+HA+ISD+++  ++++C  NF+++     C++
Sbjct  206   -INLKGFLVGNAVTDNQYDSIGTVTYWWTHAIISDKSYKSILKYC--NFTVERVSDDCDN  262

Query  1043  -FERAAGIEIGSIDFYNIYGPLCLDSESSRK------------VKRRL--GFDPCAEDYV  1177
                 A   E G ID Y+IY P C+ ++  +             ++RRL  G+DPC E Y 
Sbjct  263   AVNYAMNHEFGDIDQYSIYTPTCVAAQQKKNTTGFFVRMKNTLLRRRLVSGYDPCTESYA  322

Query  1178  YSYLNLPKVQKALHANNTKLPYTWEVCSEV-ITYWKDRASTMFPIYRRLIASGQKILLFS  1354
               Y N P VQ+A+HAN T + Y W  CS+V I  WKD   TM PIY+ L ASG +I +FS
Sbjct  323   EKYFNRPDVQRAMHANVTGIRYKWTACSDVLIKTWKDSDKTMLPIYKELAASGLRIWIFS  382

Query  1355  GDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVP  1534
             GD DSVVPVT+TR+S+  + L V   W+PW  D  QVGG+  VY+GLTFATVRGAGHEVP
Sbjct  383   GDTDSVVPVTATRFSLSHLNLPVKTRWYPWYTDN-QVGGWTEVYKGLTFATVRGAGHEVP  441

Query  1535  QFTPRRALTLLNMFLS  1582
              F P+RAL L   FL+
Sbjct  442   LFEPKRALILFRSFLA  457



>ref|XP_011009401.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Populus 
euphratica]
Length=469

 Score =   431 bits (1107),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 228/434 (53%), Positives = 281/434 (65%), Gaps = 30/434 (7%)
 Frame = +2

Query  344   EDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPG  523
             E D I+  LPGQP NV F+Q++GYV V+K  GR+LFY+  E+   P +KPL++WLNGGPG
Sbjct  36    EADRISS-LPGQP-NVSFQQFSGYVTVNKVVGRALFYWLTEAVHDPSSKPLVVWLNGGPG  93

Query  524   CSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMS  703
             CSS+  GA  E+GPF +N     LY  +F+WN VAN LFLE+PAGVGFSYSN SSD   +
Sbjct  94    CSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLLFLETPAGVGFSYSNRSSDLLDT  153

Query  704   GDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIV---KRNTMPETT  874
             GD RTAKD+ +FLV W  RFP YK R+ Y+ GESYAG Y+P+LA  I+   KR+  P   
Sbjct  154   GDIRTAKDSLEFLVGWMNRFPRYKHREVYLTGESYAGHYVPQLAREIMMYNKRSKHP---  210

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNF---SIKCEH-  1042
               I LKG M+GN + ++  D  G   Y WSHA+ISD+T+  L+  C       S +CE  
Sbjct  211   --INLKGFMVGNAVTDNYYDNLGTVTYWWSHAMISDKTYQQLVNTCDFRRQKESDECESL  268

Query  1043  FERAAGIEIGSIDFYNIYGPLCLDSESSRKVKRRL--------------GFDPCAEDYVY  1180
             +  A   E G+ID YNIY P C +S+ S    + +              G+DPC E Y  
Sbjct  269   YSYAMDQEFGNIDQYNIYAPPCNNSDGSTSTHQSIRLPHHPYKLVRPLSGYDPCTEKYAE  328

Query  1181  SYLNLPKVQKALHANNTKLPYTWEVCSEVITY-WKDRASTMFPIYRRLIASGQKILLFSG  1357
              Y N P VQKALHAN TK PY W  CSEV+   W D A ++ PIYR ++ASG +I +FSG
Sbjct  329   IYYNRPDVQKALHANVTKTPYKWTACSEVLNRNWNDTAVSVLPIYREMLASGLRIWVFSG  388

Query  1358  DVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQ  1537
             DVDSVVPVT+TRYS+  +KL    PWHPW    KQVGG+  VYEGLTFATVRGAGHEVP 
Sbjct  389   DVDSVVPVTATRYSLAQLKLATKIPWHPWYVK-KQVGGWTEVYEGLTFATVRGAGHEVPL  447

Query  1538  FTPRRALTLLNMFL  1579
             F PR AL L   FL
Sbjct  448   FKPRAALQLFKSFL  461



>ref|XP_007017345.1| Serine carboxypeptidase 40, putative [Theobroma cacao]
 gb|EOY14570.1| Serine carboxypeptidase 40, putative [Theobroma cacao]
Length=569

 Score =   434 bits (1116),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 225/440 (51%), Positives = 288/440 (65%), Gaps = 28/440 (6%)
 Frame = +2

Query  335   GSMEDDLINGGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNG  514
             G  E D I G LPGQP  V F QY+GYV VD   GR+LFYYF ES     TKPL+LWLNG
Sbjct  71    GLREVDKI-GSLPGQPGEVDFDQYSGYVTVDPEAGRALFYYFVESPHHSSTKPLVLWLNG  129

Query  515   GPGCSSLGVGAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDY  694
             GPGCSS+G GA +ELGPF V  DGK+L   R+AWNK AN +FLESPAGVGFSYSN +SDY
Sbjct  130   GPGCSSIGNGAMMELGPFRVKKDGKSLRRNRYAWNKDANIIFLESPAGVGFSYSNRTSDY  189

Query  695   DMSGDRRTAKDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETT  874
               SGD+RTA+D+Y FLVNW +RFP YKTR+F+I GESYAG Y+P+LA  I++ N     T
Sbjct  190   KSSGDKRTAQDSYTFLVNWRERFPEYKTREFFITGESYAGHYVPQLAHTILQNNKYTNQT  249

Query  875   LKIPLKGIMIGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHC---VVNFSIK-CEH  1042
             + I LKGI IGN  ++ +T ++G  D+ W+HAL+SDE ++GL  +C    +N S K C  
Sbjct  250   I-INLKGIAIGNAYIDFETTMKGAVDFYWTHALMSDEIYNGLASNCDYSTLNLSSKECLG  308

Query  1043  FERAAGIEIGSIDFYNIYGPLC--LDSESSRKVKRRLGFDPCAEDYVYSYLNLPKVQKAL  1216
             F   A    G+I  Y+IY  LC    S +S+   +   FDPC+E+YV+SYLN P+VQ+AL
Sbjct  309   FVDKANDAAGNIYTYDIYASLCNSSSSSNSKFTSQVSAFDPCSENYVHSYLNNPEVQRAL  368

Query  1217  HANNTKLPYTWEVC-------------------SEVITYWKDRASTMFPIYRRLIASGQK  1339
             HAN T LPY WE C                    EV  +WKD+  T+ PI + L+ SG +
Sbjct  369   HANVTALPYLWESCRHGPISLSLFPSWGICVVIGEVNRHWKDKPLTVLPIIKELMESGIR  428

Query  1340  ILLFSGDVDSVVPVTSTRYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGA  1519
             + ++SGD D  +PVT +RY+++ +   +   W+PW     +VGGY V Y+ LTF TVRGA
Sbjct  429   VWIYSGDTDGALPVTCSRYAINKLGTPIKTAWYPWYTQ-GEVGGYAVGYQNLTFVTVRGA  487

Query  1520  GHEVPQFTPRRALTLLNMFL  1579
             GH VP + P RAL L + FL
Sbjct  488   GHFVPSYQPARALVLFSSFL  507



>ref|XP_009358427.1| PREDICTED: serine carboxypeptidase 24 [Pyrus x bretschneideri]
Length=472

 Score =   431 bits (1107),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 219/424 (52%), Positives = 279/424 (66%), Gaps = 22/424 (5%)
 Frame = +2

Query  362   GGLPGQPSNVKFKQYAGYVNVDKTNGRSLFYYFAESAQTPHTKPLILWLNGGPGCSSLGV  541
               LPGQP  V F Q++GYV V++ +GR+LFY+  E+A  P  KPL+LWLNGGPGCSS+  
Sbjct  46    SALPGQPP-VSFSQFSGYVTVNEHHGRALFYWLTEAATCPQEKPLVLWLNGGPGCSSVAY  104

Query  542   GAFIELGPFGVNPDGKTLYSRRFAWNKVANTLFLESPAGVGFSYSNTSSDYDMSGDRRTA  721
             GA  ELGPF +N    +LY  +++WN+ AN LFLESPAGVGFSY+NTSSD   SGD+RTA
Sbjct  105   GASEELGPFRINRTCSSLYLNKYSWNREANILFLESPAGVGFSYTNTSSDLKNSGDKRTA  164

Query  722   KDAYKFLVNWFKRFPHYKTRDFYIIGESYAGFYIPELADVIVKRNTMPETTLKIPLKGIM  901
             +DA  FLVNW  RFP Y  R+FYI GESYAG Y+P+L+  IV  N +  +   I LKG M
Sbjct  165   QDALVFLVNWLSRFPQYAHREFYITGESYAGHYVPQLSKEIVAYNKV-HSESTINLKGFM  223

Query  902   IGNGIMNDDTDVRGGYDYLWSHALISDETHDGLIEHCVVNFSIK-----CEH-FERAAGI  1063
             +GN + +   D  G   Y WSHA+ISD T+  +I HC  NF++K     CE     A   
Sbjct  224   VGNAVTDYYYDNIGTVTYWWSHAMISDRTYLSIISHC--NFTVKTTSKQCEDAINYATDH  281

Query  1064  EIGSIDFYNIYGPLCLDSESSRKVKRRL----------GFDPCAEDYVYSYLNLPKVQKA  1213
             + G ID Y+IY P CL   ++RK   RL          G+DPC E+Y   Y N P VQKA
Sbjct  282   DFGDIDPYSIYTPFCLTMLNNRKRHLRLKNTLLRRRASGYDPCTENYAEKYYNRPDVQKA  341

Query  1214  LHANNTKLPYTWEVCSEVI-TYWKDRASTMFPIYRRLIASGQKILLFSGDVDSVVPVTST  1390
             +HAN T++PY W  CS+V+  YWKD   ++ P Y+ LIA+G +I +FSGD DSVVPVT+T
Sbjct  342   MHANVTRIPYKWTACSDVLFKYWKDSEYSVLPTYKELIAAGLRIWVFSGDTDSVVPVTAT  401

Query  1391  RYSVDAMKLKVIKPWHPWEDDTKQVGGYKVVYEGLTFATVRGAGHEVPQFTPRRALTLLN  1570
             R S++ + L +  PW+PW   + QVGG+  VY+GLTFATVRGAGHEVP     R LTL  
Sbjct  402   RLSLNHLNLTIKTPWYPWYSGS-QVGGWTEVYDGLTFATVRGAGHEVPLIQAERGLTLFK  460

Query  1571  MFLS  1582
              FL+
Sbjct  461   SFLA  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5587182010156