BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23824_g1_i4 len=1517 path=[433:0-225 3528:226-226 @659@!:227-585
1018:586-649 1082:650-773 1203:774-871 246:872-878 1307:879-945
@380@!:946-1325 1752:1326-1516]

Length=1517
                                                                      Score     E

ref|XP_009589196.1|  PREDICTED: probable cinnamyl alcohol dehydro...    592   0.0      
ref|XP_009778632.1|  PREDICTED: probable cinnamyl alcohol dehydro...    591   0.0      
ref|XP_004252617.1|  PREDICTED: probable cinnamyl alcohol dehydro...    587   0.0      
ref|XP_006360729.1|  PREDICTED: probable cinnamyl alcohol dehydro...    586   0.0      
emb|CBI34634.3|  unnamed protein product                                579   0.0      
ref|XP_002277375.1|  PREDICTED: probable cinnamyl alcohol dehydro...    579   0.0      Vitis vinifera
gb|EYU33425.1|  hypothetical protein MIMGU_mgv1a008952mg                571   0.0      
ref|XP_011070320.1|  PREDICTED: probable cinnamyl alcohol dehydro...    566   0.0      
emb|CDP08884.1|  unnamed protein product                                563   0.0      
ref|XP_007039280.1|  Cinnamyl-alcohol dehydrogenase isoform 3           560   0.0      
ref|XP_007039278.1|  Cinnamyl-alcohol dehydrogenase isoform 1           560   0.0      
gb|ACZ06241.1|  cinnamyl alcohol dehydrogenase 5                        559   0.0      
ref|XP_010056070.1|  PREDICTED: probable cinnamyl alcohol dehydro...    558   0.0      
gb|KHG29019.1|  putative cinnamyl alcohol dehydrogenase 1 -like p...    558   0.0      
ref|XP_007209297.1|  hypothetical protein PRUPE_ppa007789mg             556   0.0      
gb|KDP25182.1|  hypothetical protein JCGZ_20338                         555   0.0      
ref|XP_007039281.1|  Cinnamyl-alcohol dehydrogenase isoform 4           555   0.0      
ref|XP_006377873.1|  hypothetical protein POPTR_0011s15120g             555   0.0      
ref|XP_008367452.1|  PREDICTED: probable cinnamyl alcohol dehydro...    553   0.0      
ref|XP_008239280.1|  PREDICTED: probable cinnamyl alcohol dehydro...    553   0.0      
gb|KCW72665.1|  hypothetical protein EUGRSUZ_E01119                     552   0.0      
ref|XP_010056079.1|  PREDICTED: probable cinnamyl alcohol dehydro...    553   0.0      
ref|XP_011004372.1|  PREDICTED: probable cinnamyl alcohol dehydro...    552   0.0      
gb|KCW72659.1|  hypothetical protein EUGRSUZ_E01117                     549   0.0      
ref|XP_010056089.1|  PREDICTED: probable cinnamyl alcohol dehydro...    549   0.0      
ref|XP_010056081.1|  PREDICTED: probable cinnamyl alcohol dehydro...    549   0.0      
gb|KCW72661.1|  hypothetical protein EUGRSUZ_E01117                     548   0.0      
ref|XP_009373691.1|  PREDICTED: probable cinnamyl alcohol dehydro...    548   0.0      
ref|XP_006377874.1|  hypothetical protein POPTR_0011s15130g             546   0.0      
ref|XP_010056074.1|  PREDICTED: probable cinnamyl alcohol dehydro...    546   0.0      
ref|NP_177412.1|  cinnamyl-alcohol dehydrogenase                        546   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416031.1|  PREDICTED: probable cinnamyl alcohol dehydro...    544   0.0      
ref|XP_002518961.1|  alcohol dehydrogenase, putative                    543   0.0      Ricinus communis
ref|XP_010471299.1|  PREDICTED: probable cinnamyl alcohol dehydro...    543   0.0      
ref|XP_010056080.1|  PREDICTED: probable cinnamyl alcohol dehydro...    542   0.0      
ref|XP_002888888.1|  hypothetical protein ARALYDRAFT_895120             542   0.0      
gb|KFK41690.1|  hypothetical protein AALP_AA2G160200                    542   0.0      
ref|XP_006390634.1|  hypothetical protein EUTSA_v10018769mg             541   0.0      
ref|XP_010428161.1|  PREDICTED: probable cinnamyl alcohol dehydro...    541   0.0      
ref|XP_010056083.1|  PREDICTED: probable cinnamyl alcohol dehydro...    540   0.0      
ref|XP_004145884.1|  PREDICTED: probable cinnamyl alcohol dehydro...    536   0.0      
ref|XP_009105931.1|  PREDICTED: probable cinnamyl alcohol dehydro...    536   0.0      
ref|XP_010680026.1|  PREDICTED: probable cinnamyl alcohol dehydro...    536   0.0      
ref|XP_004309500.1|  PREDICTED: probable cinnamyl alcohol dehydro...    535   0.0      
ref|XP_004162965.1|  PREDICTED: probable cinnamyl alcohol dehydro...    535   0.0      
ref|XP_008437476.1|  PREDICTED: probable cinnamyl alcohol dehydro...    531   0.0      
ref|XP_010056069.1|  PREDICTED: probable cinnamyl alcohol dehydro...    531   0.0      
ref|XP_007148346.1|  hypothetical protein PHAVU_006G200600g             531   0.0      
ref|XP_010518748.1|  PREDICTED: probable cinnamyl alcohol dehydro...    530   0.0      
ref|XP_008783561.1|  PREDICTED: probable cinnamyl alcohol dehydro...    530   0.0      
gb|ABK21056.1|  unknown                                                 527   0.0      Picea sitchensis
ref|XP_003545737.1|  PREDICTED: probable cinnamyl alcohol dehydro...    526   0.0      
ref|XP_006476239.1|  PREDICTED: probable cinnamyl alcohol dehydro...    526   0.0      
ref|XP_006439168.1|  hypothetical protein CICLE_v10020847mg             526   0.0      
ref|XP_003543132.1|  PREDICTED: probable cinnamyl alcohol dehydro...    523   1e-180   
ref|XP_011040646.1|  PREDICTED: probable cinnamyl alcohol dehydro...    521   5e-180   
ref|XP_009361511.1|  PREDICTED: probable cinnamyl alcohol dehydro...    520   3e-179   
ref|XP_002307925.2|  hypothetical protein POPTR_0006s02530g             519   4e-179   Populus trichocarpa [western balsam poplar]
ref|XP_004485621.1|  PREDICTED: probable cinnamyl alcohol dehydro...    519   5e-179   
ref|XP_009361519.1|  PREDICTED: probable cinnamyl alcohol dehydro...    519   6e-179   
ref|XP_010919062.1|  PREDICTED: putative cinnamyl alcohol dehydro...    518   1e-178   
ref|XP_009393713.1|  PREDICTED: probable cinnamyl alcohol dehydro...    518   1e-178   
ref|XP_003593290.1|  Cinnamyl alcohol dehydrogenase                     520   1e-178   
ref|XP_009361508.1|  PREDICTED: probable cinnamyl alcohol dehydro...    518   2e-178   
ref|XP_008342261.1|  PREDICTED: probable cinnamyl alcohol dehydro...    517   4e-178   
ref|XP_008229770.1|  PREDICTED: probable cinnamyl alcohol dehydro...    516   7e-178   
gb|AID56319.1|  ethylene cinnamyl alcohol dehydrogenase 3               516   8e-178   
ref|XP_002304800.1|  hypothetical protein POPTR_0003s19610g             515   2e-177   Populus trichocarpa [western balsam poplar]
ref|XP_006846499.1|  hypothetical protein AMTR_s00018p00151850          514   3e-177   
ref|XP_008342260.1|  PREDICTED: probable cinnamyl alcohol dehydro...    514   3e-177   
ref|XP_009361512.1|  PREDICTED: probable cinnamyl alcohol dehydro...    514   5e-177   
ref|XP_004309483.1|  PREDICTED: probable cinnamyl alcohol dehydro...    512   3e-176   
ref|XP_003593291.1|  Cinnamyl alcohol dehydrogenase                     515   3e-176   
ref|XP_008342262.1|  PREDICTED: probable cinnamyl alcohol dehydro...    511   6e-176   
ref|XP_007217849.1|  hypothetical protein PRUPE_ppa024217mg             511   1e-175   
gb|AHG52039.1|  cinnamyl alcohol dehydrogenase                          510   2e-175   
emb|CDX72936.1|  BnaC06g33840D                                          506   4e-174   
gb|KCW45115.1|  hypothetical protein EUGRSUZ_L01277                     504   3e-173   
ref|XP_002436634.1|  hypothetical protein SORBIDRAFT_10g006290          501   8e-172   Sorghum bicolor [broomcorn]
dbj|BAJ84795.1|  predicted protein                                      500   2e-171   
ref|XP_002273147.1|  PREDICTED: probable cinnamyl alcohol dehydro...    498   1e-170   Vitis vinifera
ref|XP_008784626.1|  PREDICTED: putative cinnamyl alcohol dehydro...    497   2e-170   
gb|KDP26119.1|  hypothetical protein JCGZ_22220                         496   1e-169   
gb|KCW72652.1|  hypothetical protein EUGRSUZ_E01108                     494   1e-169   
ref|XP_009397914.1|  PREDICTED: probable cinnamyl alcohol dehydro...    495   2e-169   
ref|NP_001064283.2|  Os10g0194200                                       494   2e-169   Oryza sativa Japonica Group [Japonica rice]
sp|Q8H859.1|CADH1_ORYSJ  RecName: Full=Probable cinnamyl alcohol ...    493   5e-169   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008784622.1|  PREDICTED: putative cinnamyl alcohol dehydro...    493   1e-168   
ref|XP_002436633.1|  hypothetical protein SORBIDRAFT_10g006280          497   1e-168   Sorghum bicolor [broomcorn]
ref|NP_001131273.1|  putative cinnamyl-alcohol dehydrogenase fami...    491   3e-168   Zea mays [maize]
gb|KCW72651.1|  hypothetical protein EUGRSUZ_E01107                     490   5e-168   
ref|XP_002322570.2|  hypothetical protein POPTR_0016s02390g             491   7e-168   Populus trichocarpa [western balsam poplar]
ref|XP_006661676.1|  PREDICTED: probable cinnamyl alcohol dehydro...    490   1e-167   
ref|XP_010234664.1|  PREDICTED: probable cinnamyl alcohol dehydro...    490   1e-167   
emb|CDM85988.1|  unnamed protein product                                489   2e-167   
ref|XP_002436635.1|  hypothetical protein SORBIDRAFT_10g006300          489   2e-167   Sorghum bicolor [broomcorn]
dbj|BAJ98188.1|  predicted protein                                      488   7e-167   
gb|EPS65133.1|  hypothetical protein M569_09642                         488   8e-167   
ref|XP_011041298.1|  PREDICTED: probable cinnamyl alcohol dehydro...    488   9e-167   
ref|XP_002322573.2|  hypothetical protein POPTR_0016s02360g             487   1e-166   Populus trichocarpa [western balsam poplar]
gb|EMT27281.1|  Putative cinnamyl alcohol dehydrogenase 1               487   2e-166   
sp|Q2R114.2|CADH4_ORYSJ  RecName: Full=Putative cinnamyl alcohol ...    482   2e-164   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147757.1|  mannitol dehydrogenase                             481   3e-164   Zea mays [maize]
tpg|DAA35929.1|  TPA: putative cinnamyl-alcohol dehydrogenase fam...    484   5e-164   
ref|XP_010052172.1|  PREDICTED: probable cinnamyl alcohol dehydro...    481   7e-164   
gb|EMS58457.1|  putative cinnamyl alcohol dehydrogenase 1               480   3e-163   
ref|XP_009361515.1|  PREDICTED: probable cinnamyl alcohol dehydro...    477   6e-163   
ref|XP_010934171.1|  PREDICTED: probable cinnamyl alcohol dehydro...    474   3e-161   
ref|XP_008784624.1|  PREDICTED: putative cinnamyl alcohol dehydro...    474   3e-161   
ref|XP_006380944.1|  hypothetical protein POPTR_0006s02520g             462   8e-157   
emb|CAN81860.1|  hypothetical protein VITISV_025556                     473   1e-156   Vitis vinifera
emb|CAN73267.1|  hypothetical protein VITISV_034951                     460   5e-156   Vitis vinifera
ref|NP_001068303.2|  Os11g0622800                                       456   2e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010052173.1|  PREDICTED: probable cinnamyl alcohol dehydro...    453   3e-153   
ref|XP_010107966.1|  putative cinnamyl alcohol dehydrogenase 1          452   4e-153   
ref|XP_011020397.1|  PREDICTED: probable cinnamyl alcohol dehydro...    452   7e-153   
ref|XP_010056072.1|  PREDICTED: probable cinnamyl alcohol dehydro...    447   1e-151   
emb|CBI38295.3|  unnamed protein product                                449   1e-151   
ref|XP_010052174.1|  PREDICTED: probable cinnamyl alcohol dehydro...    442   9e-149   
ref|XP_006302587.1|  hypothetical protein CARUB_v10020694mg             437   2e-147   
ref|XP_008784627.1|  PREDICTED: putative cinnamyl alcohol dehydro...    429   1e-144   
ref|XP_004983416.1|  PREDICTED: LOW QUALITY PROTEIN: probable cin...    430   2e-144   
ref|XP_006439167.1|  hypothetical protein CICLE_v10020847mg             427   5e-144   
gb|KDO76799.1|  hypothetical protein CISIN_1g0191991mg                  426   2e-143   
ref|XP_002436632.1|  hypothetical protein SORBIDRAFT_10g006270          427   6e-143   Sorghum bicolor [broomcorn]
ref|XP_010919003.1|  PREDICTED: probable cinnamyl alcohol dehydro...    422   1e-140   
gb|EMS58458.1|  putative cinnamyl alcohol dehydrogenase 1               419   3e-139   
gb|ACF80163.1|  unknown                                                 412   1e-137   Zea mays [maize]
ref|XP_004982526.1|  PREDICTED: LOW QUALITY PROTEIN: putative cin...    404   2e-134   
ref|XP_010054315.1|  PREDICTED: probable cinnamyl alcohol dehydro...    394   1e-130   
gb|ABG65973.1|  mannitol dehydrogenase, putative, expressed             393   1e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007039282.1|  Cinnamyl alcohol dehydrogenase 1 isoform 5         385   3e-128   
ref|XP_002974026.1|  hypothetical protein SELMODRAFT_149351             385   9e-127   
gb|KCW72669.1|  hypothetical protein EUGRSUZ_E01119                     379   1e-125   
ref|XP_006377872.1|  hypothetical protein POPTR_0011s15120g             380   1e-125   
ref|XP_002983465.1|  hypothetical protein SELMODRAFT_268735             382   3e-125   
ref|XP_004309484.1|  PREDICTED: probable cinnamyl alcohol dehydro...    369   9e-122   
ref|XP_002974027.1|  hypothetical protein SELMODRAFT_267688             372   1e-121   
ref|XP_002983464.1|  hypothetical protein SELMODRAFT_118623             369   3e-120   
ref|XP_001766414.1|  predicted protein                                  359   3e-116   
gb|ABK26008.1|  unknown                                                 357   2e-115   Picea sitchensis
gb|ACN40687.1|  unknown                                                 356   4e-115   Picea sitchensis
gb|AFK47110.1|  unknown                                                 355   1e-114   
gb|ABK21490.1|  unknown                                                 354   2e-114   Picea sitchensis
ref|XP_007158342.1|  hypothetical protein PHAVU_002G144500g             349   2e-112   
ref|XP_006364647.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    348   3e-112   
gb|EMS45840.1|  Putative cinnamyl alcohol dehydrogenase 5               347   1e-111   
ref|NP_001064659.2|  Os10g0430200                                       347   2e-111   Oryza sativa Japonica Group [Japonica rice]
gb|AAL99536.1|AF472592_1  cinnamyl alcohol dehydrogenase                346   3e-111   Lolium perenne [perennial ryegrass]
ref|XP_011099958.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    346   4e-111   
ref|XP_009767330.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-l...    345   5e-111   
ref|XP_004235066.1|  PREDICTED: probable cinnamyl alcohol dehydro...    345   9e-111   
ref|XP_011083435.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    345   1e-110   
gb|AFY63472.1|  geraniol dehydrogenase                                  344   2e-110   
ref|XP_008460921.1|  PREDICTED: probable mannitol dehydrogenase         343   2e-110   
ref|XP_006355137.1|  PREDICTED: probable cinnamyl alcohol dehydro...    343   4e-110   
gb|AFY63474.1|  geraniol dehydrogenase                                  343   4e-110   
ref|XP_011083434.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    343   5e-110   
ref|XP_002445214.1|  hypothetical protein SORBIDRAFT_07g006090          343   7e-110   Sorghum bicolor [broomcorn]
ref|XP_004288495.1|  PREDICTED: probable mannitol dehydrogenase-like    342   7e-110   
ref|XP_003612973.1|  Cinnamyl alcohol dehydrogenase                     342   7e-110   
ref|XP_007158344.1|  hypothetical protein PHAVU_002G144700g             342   1e-109   
dbj|BAJ91956.1|  predicted protein                                      342   1e-109   
ref|XP_006340040.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    342   1e-109   
ref|XP_004171787.1|  PREDICTED: probable mannitol dehydrogenase-like    342   1e-109   
ref|XP_007158345.1|  hypothetical protein PHAVU_002G144800g             342   2e-109   
ref|XP_004151454.1|  PREDICTED: probable cinnamyl alcohol dehydro...    342   2e-109   
ref|XP_009801633.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    341   2e-109   
ref|XP_003612989.1|  Cinnamyl alcohol dehydrogenase                     341   3e-109   
gb|EMT31529.1|  Putative cinnamyl alcohol dehydrogenase 5               340   5e-109   
gb|AFY63473.1|  geraniol dehydrogenase                                  340   6e-109   
ref|NP_001240222.1|  uncharacterized protein LOC100809071               340   7e-109   
gb|KHG29850.1|  putative mannitol dehydrogenase                         340   7e-109   
emb|CDP01608.1|  unnamed protein product                                340   1e-108   
ref|XP_009773447.1|  PREDICTED: probable mannitol dehydrogenase         340   1e-108   
ref|XP_003612975.1|  Cinnamyl alcohol dehydrogenase                     339   1e-108   
ref|XP_011097456.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase         339   1e-108   
gb|EYU30917.1|  hypothetical protein MIMGU_mgv1a008848mg                339   1e-108   
ref|XP_004512559.1|  PREDICTED: probable mannitol dehydrogenase-like    339   2e-108   
ref|XP_003517258.1|  PREDICTED: probable mannitol dehydrogenase         339   2e-108   
ref|XP_004512561.1|  PREDICTED: probable mannitol dehydrogenase-like    339   2e-108   
ref|XP_011100934.1|  PREDICTED: probable mannitol dehydrogenase         338   2e-108   
ref|XP_002276703.1|  PREDICTED: probable mannitol dehydrogenase         339   3e-108   Vitis vinifera
gb|KHN04905.1|  Putative mannitol dehydrogenase                         338   3e-108   
emb|CBL95258.1|  cinnamyl alcohol dehydrogenase                         338   4e-108   
emb|CDP01603.1|  unnamed protein product                                338   4e-108   
gb|EMT14649.1|  Putative cinnamyl alcohol dehydrogenase 5               340   4e-108   
sp|Q2KNL6.1|GEDH1_OCIBA  RecName: Full=Geraniol dehydrogenase 1; ...    337   6e-108   Ocimum basilicum [basil]
ref|XP_002300211.1|  mannitol dehydrogenase 1 family protein            338   6e-108   Populus trichocarpa [western balsam poplar]
ref|XP_003573548.1|  PREDICTED: putative cinnamyl alcohol dehydro...    338   7e-108   
gb|AGU43754.1|  cinnamyl alcohol dehydrogenase 6                        337   7e-108   
gb|ABK94550.1|  unknown                                                 337   1e-107   Populus trichocarpa [western balsam poplar]
ref|XP_008785257.1|  PREDICTED: LOW QUALITY PROTEIN: 8-hydroxyger...    337   1e-107   
ref|XP_009759254.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    337   1e-107   
gb|KHG20287.1|  putative mannitol dehydrogenase                         337   1e-107   
ref|XP_006851411.1|  hypothetical protein AMTR_s00040p00069200          355   2e-107   
gb|AHX58273.1|  cinnamyl alcohol dehydrogenase 7                        336   2e-107   
ref|XP_002313294.2|  hypothetical protein POPTR_0009s06770g             336   2e-107   Populus trichocarpa [western balsam poplar]
sp|P41637.1|CADH_PINTA  RecName: Full=Probable cinnamyl alcohol d...    336   2e-107   Pinus taeda
ref|XP_004307159.1|  PREDICTED: probable mannitol dehydrogenase-like    336   2e-107   
gb|AFZ78656.1|  sinapyl alcohol dehydrogenase                           336   3e-107   
ref|XP_011045697.1|  PREDICTED: probable cinnamyl alcohol dehydro...    336   3e-107   
ref|XP_009364795.1|  PREDICTED: probable mannitol dehydrogenase         336   3e-107   
ref|XP_002322761.2|  cinnamyl-alcohol dehydrogenase family protein      336   3e-107   Populus trichocarpa [western balsam poplar]
ref|XP_004972583.1|  PREDICTED: putative cinnamyl alcohol dehydro...    336   3e-107   
ref|XP_003612986.1|  Cinnamyl alcohol dehydrogenase                     336   4e-107   
ref|XP_011025421.1|  PREDICTED: probable mannitol dehydrogenase         335   4e-107   
gb|ABK96585.1|  unknown                                                 335   6e-107   Populus trichocarpa x Populus deltoides
ref|XP_007156455.1|  hypothetical protein PHAVU_003G287400g             335   6e-107   
ref|XP_006851414.1|  hypothetical protein AMTR_s00040p00072630          335   8e-107   
gb|KDP35308.1|  hypothetical protein JCGZ_09467                         335   8e-107   
ref|XP_002968657.1|  hypothetical protein SELMODRAFT_90947              334   8e-107   
ref|XP_011100037.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    335   9e-107   
ref|XP_011042531.1|  PREDICTED: probable mannitol dehydrogenase         335   1e-106   
dbj|BAJ94260.1|  predicted protein                                      335   1e-106   
ref|XP_003635250.1|  PREDICTED: probable mannitol dehydrogenase         334   1e-106   
ref|XP_011083438.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    335   1e-106   
dbj|BAJ87302.1|  predicted protein                                      336   1e-106   
ref|XP_003612978.1|  Mannitol dehydrogenase                             334   1e-106   
ref|XP_006379103.1|  hypothetical protein POPTR_0009s06780g             334   1e-106   
gb|AEA36767.1|  cinnamyl alcohol dehydrogenase                          334   2e-106   
ref|XP_009764994.1|  PREDICTED: probable mannitol dehydrogenase         334   2e-106   
ref|XP_003635435.1|  PREDICTED: probable mannitol dehydrogenase         334   2e-106   
ref|XP_009400342.1|  PREDICTED: probable cinnamyl alcohol dehydro...    334   2e-106   
ref|XP_008236502.1|  PREDICTED: probable mannitol dehydrogenase         334   2e-106   
ref|XP_010244709.1|  PREDICTED: probable mannitol dehydrogenase         333   2e-106   
sp|Q9ZRF1.1|MTDH_FRAAN  RecName: Full=Probable mannitol dehydroge...    333   2e-106   Fragaria x ananassa
gb|AFK34702.1|  unknown                                                 333   2e-106   
ref|XP_002313297.2|  hypothetical protein POPTR_0009s06740g             333   2e-106   Populus trichocarpa [western balsam poplar]
ref|XP_002279832.1|  PREDICTED: probable mannitol dehydrogenase         333   2e-106   Vitis vinifera
gb|KCW76091.1|  hypothetical protein EUGRSUZ_D00471                     329   3e-106   
ref|XP_002989906.1|  hypothetical protein SELMODRAFT_428454             333   3e-106   
ref|XP_008236460.1|  PREDICTED: probable mannitol dehydrogenase         333   3e-106   
ref|XP_004512560.1|  PREDICTED: probable mannitol dehydrogenase-like    333   3e-106   
gb|AAK28509.1|  cinnamyl alcohol dehydrogenase                          333   3e-106   Fragaria x ananassa
gb|AGU43751.1|  cinnamyl alcohol dehydrogenase 9                        333   3e-106   
ref|XP_008440516.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    333   4e-106   
gb|EYU23717.1|  hypothetical protein MIMGU_mgv1a008843mg                333   4e-106   
gb|AAM95578.1|  putative sinapyl alcohol dehydrogenase                  333   4e-106   Populus tremula x Populus tremuloides
sp|Q40976.1|CADH_PINRA  RecName: Full=Probable cinnamyl alcohol d...    333   4e-106   Pinus radiata
ref|XP_003612977.1|  Cinnamyl alcohol dehydrogenase                     333   4e-106   
ref|XP_010095885.1|  putative mannitol dehydrogenase                    333   4e-106   
ref|XP_002534367.1|  alcohol dehydrogenase, putative                    333   4e-106   Ricinus communis
ref|XP_007156456.1|  hypothetical protein PHAVU_003G287500g             333   4e-106   
ref|XP_003635434.1|  PREDICTED: probable mannitol dehydrogenase         333   5e-106   
ref|XP_007205415.1|  hypothetical protein PRUPE_ppa007626mg             333   5e-106   
ref|XP_009759255.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    332   6e-106   
ref|XP_003635278.1|  PREDICTED: probable mannitol dehydrogenase         332   6e-106   
ref|XP_007211488.1|  hypothetical protein PRUPE_ppa007678mg             332   6e-106   
gb|AGY96956.1|  mannitol dehydrogenase 1                                332   7e-106   
ref|XP_003609401.1|  Cinnamyl alcohol dehydrogenase                     332   7e-106   
ref|XP_008809345.1|  PREDICTED: probable mannitol dehydrogenase         332   8e-106   
ref|XP_009609570.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    332   9e-106   
gb|ADD81206.1|  sinapyl alcohol dehydrogenase-like 3                    332   9e-106   Nicotiana tabacum [American tobacco]
gb|AES95941.2|  cinnamyl alcohol dehydrogenase-like protein             332   1e-105   
ref|XP_007206542.1|  hypothetical protein PRUPE_ppa018829mg             332   1e-105   
ref|XP_010095884.1|  putative mannitol dehydrogenase                    332   1e-105   
ref|XP_004972582.1|  PREDICTED: putative cinnamyl alcohol dehydro...    332   1e-105   
ref|NP_001267599.1|  probable mannitol dehydrogenase-like               332   1e-105   
ref|XP_008236471.1|  PREDICTED: probable mannitol dehydrogenase         332   1e-105   
ref|XP_007205416.1|  hypothetical protein PRUPE_ppa007626mg             331   2e-105   
emb|CDP19913.1|  unnamed protein product                                331   2e-105   
ref|XP_004976783.1|  PREDICTED: LOW QUALITY PROTEIN: cinnamyl alc...    332   2e-105   
ref|XP_007205414.1|  hypothetical protein PRUPE_ppa007622mg             331   2e-105   
gb|AAC31166.1|  cinnamyl alcohol dehydrogenase                          331   2e-105   Pinus radiata
ref|XP_002272479.1|  PREDICTED: probable mannitol dehydrogenase         331   2e-105   Vitis vinifera
gb|AFK43439.1|  unknown                                                 331   2e-105   
ref|XP_010647499.1|  PREDICTED: probable mannitol dehydrogenase         331   2e-105   
ref|XP_004288496.1|  PREDICTED: probable mannitol dehydrogenase-like    331   2e-105   
ref|XP_003635280.1|  PREDICTED: probable mannitol dehydrogenase         331   2e-105   
dbj|BAN91670.1|  cinnamyl alcohol dehydrogenase 1                       331   2e-105   
gb|ACJ84730.1|  unknown                                                 331   3e-105   Medicago truncatula
gb|AAW45741.1|  sinapyl alcohol dehydrogenase-like protein              331   3e-105   Populus tremula x Populus tremuloides
ref|XP_009783463.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    331   3e-105   
gb|EPS67580.1|  geraniol dehydrogenase 1                                331   3e-105   
ref|XP_008367678.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    330   3e-105   
emb|CDP01599.1|  unnamed protein product                                340   3e-105   
ref|XP_002322822.1|  mannitol dehydrogenase family protein              330   4e-105   Populus trichocarpa [western balsam poplar]
gb|ACC63874.1|  cinnamyl alcohol dehydrogenase                          330   4e-105   Populus trichocarpa [western balsam poplar]
ref|XP_006659935.1|  PREDICTED: putative cinnamyl alcohol dehydro...    330   4e-105   
gb|AFQ36034.1|  cinnamyl alcohol dehydrogenase                          330   4e-105   
ref|XP_003635436.1|  PREDICTED: probable mannitol dehydrogenase i...    330   4e-105   
gb|AGU43756.1|  cinnamyl alcohol dehydrogenase 2                        330   4e-105   
emb|CAA86073.1|  cinnamyl alcohol dehydrogenase                         330   4e-105   
gb|ADK63098.1|  cinnamyl alcohol dehydrogenase                          330   5e-105   
ref|XP_008236481.1|  PREDICTED: probable mannitol dehydrogenase         330   5e-105   
gb|KDO60515.1|  hypothetical protein CISIN_1g0180941mg                  330   5e-105   
gb|ABK23170.1|  unknown                                                 330   5e-105   
ref|XP_002271579.3|  PREDICTED: probable mannitol dehydrogenase         330   6e-105   
sp|Q08350.1|CADH7_PICAB  RecName: Full=Probable cinnamyl alcohol ...    330   6e-105   
ref|XP_003578087.1|  PREDICTED: probable cinnamyl alcohol dehydro...    332   7e-105   
gb|KDO60514.1|  hypothetical protein CISIN_1g0180941mg                  330   7e-105   
gb|AEE69008.1|  cinnamyl alcohol dehydrogenase 3                        330   7e-105   
ref|XP_011097458.1|  PREDICTED: probable mannitol dehydrogenase         330   8e-105   
ref|XP_003612984.1|  Cinnamyl alcohol dehydrogenase                     330   8e-105   
emb|CDP01607.1|  unnamed protein product                                330   8e-105   
ref|XP_004512563.1|  PREDICTED: probable mannitol dehydrogenase-like    330   9e-105   
ref|XP_007205421.1|  hypothetical protein PRUPE_ppa007668mg             329   1e-104   
pdb|1YQD|A  Chain A, Sinapyl Alcohol Dehydrogenase Complexed With...    330   1e-104   
sp|O82035.1|CADH2_PICAB  RecName: Full=Probable cinnamyl alcohol ...    329   1e-104   
emb|CDP01598.1|  unnamed protein product                                329   1e-104   
gb|AAK58693.1|AF273256_1  sinapyl alcohol dehydrogenase                 329   1e-104   
ref|XP_002534365.1|  alcohol dehydrogenase, putative                    329   1e-104   
gb|AES95930.2|  cinnamyl alcohol dehydrogenase-like protein             329   2e-104   
gb|ACG44715.1|  mannitol dehydrogenase                                  329   2e-104   
ref|XP_009419520.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    329   2e-104   
ref|XP_010027970.1|  PREDICTED: probable mannitol dehydrogenase         328   2e-104   
emb|CAI30877.1|  cinnamyl-alcohol dehydrogenase                         328   2e-104   
ref|XP_011097453.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-l...    328   2e-104   
gb|EAZ06307.1|  hypothetical protein OsI_28541                          328   2e-104   
ref|XP_011097455.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    328   2e-104   
ref|NP_001130781.1|  cinnamyl alcohol dehydrogenase1                    329   2e-104   
ref|XP_010911601.1|  PREDICTED: probable mannitol dehydrogenase         328   2e-104   
ref|XP_010241687.1|  PREDICTED: probable cinnamyl alcohol dehydro...    328   2e-104   
gb|KEH27726.1|  cinnamyl alcohol dehydrogenase-like protein             328   2e-104   
ref|XP_010241689.1|  PREDICTED: probable cinnamyl alcohol dehydro...    328   3e-104   
ref|XP_009764993.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    328   3e-104   
ref|XP_010241688.1|  PREDICTED: probable cinnamyl alcohol dehydro...    328   3e-104   
ref|XP_008236492.1|  PREDICTED: probable mannitol dehydrogenase         328   3e-104   
ref|XP_010680374.1|  PREDICTED: probable mannitol dehydrogenase         328   3e-104   
emb|CBI33197.3|  unnamed protein product                                328   3e-104   
gb|AHL67653.1|  cinnamyl alcohol dehydrogenase                          328   4e-104   
ref|XP_006466345.1|  PREDICTED: probable mannitol dehydrogenase-like    328   4e-104   
ref|XP_010680373.1|  PREDICTED: probable mannitol dehydrogenase         328   5e-104   
ref|XP_008236513.1|  PREDICTED: probable mannitol dehydrogenase         328   5e-104   
gb|AAQ20892.1|  10-hydroxygeraniol oxidoreductase                       328   5e-104   
gb|AFW57003.1|  putative cinnamyl-alcohol dehydrogenase family pr...    327   5e-104   
ref|XP_011097452.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    327   6e-104   
ref|XP_009101881.1|  PREDICTED: probable cinnamyl alcohol dehydro...    327   7e-104   
ref|XP_002447082.1|  hypothetical protein SORBIDRAFT_06g028240          327   8e-104   
gb|ABK27071.1|  unknown                                                 327   9e-104   
dbj|BAK03430.1|  predicted protein                                      327   9e-104   
ref|XP_006353144.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    327   1e-103   
ref|XP_011004094.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    327   1e-103   
gb|KDO53382.1|  hypothetical protein CISIN_1g018246mg                   326   1e-103   
ref|XP_008231559.1|  PREDICTED: probable mannitol dehydrogenase         327   2e-103   
emb|CDX72704.1|  BnaC07g47260D                                          326   2e-103   
ref|XP_006427864.1|  hypothetical protein CICLE_v10025939mg             326   2e-103   
ref|XP_004972588.1|  PREDICTED: LOW QUALITY PROTEIN: probable cin...    326   2e-103   
ref|XP_004250169.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    326   2e-103   
ref|XP_003593292.1|  Cinnamyl alcohol dehydrogenase                     322   2e-103   
ref|XP_006660609.1|  PREDICTED: probable cinnamyl alcohol dehydro...    326   2e-103   
ref|XP_011083436.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    325   2e-103   
ref|XP_010920094.1|  PREDICTED: probable cinnamyl alcohol dehydro...    325   3e-103   
ref|XP_006426239.1|  hypothetical protein CICLE_v10025933mg             326   3e-103   
gb|EPS72626.1|  10-hydroxygeraniol oxidoreductase                       325   3e-103   
ref|XP_011025422.1|  PREDICTED: probable mannitol dehydrogenase         326   3e-103   
ref|XP_002313293.2|  hypothetical protein POPTR_0009s06790g             326   3e-103   
ref|XP_002271374.2|  PREDICTED: probable mannitol dehydrogenase         325   3e-103   
gb|EPS69932.1|  hypothetical protein M569_04831                         325   4e-103   
ref|XP_004288323.1|  PREDICTED: probable cinnamyl alcohol dehydro...    325   4e-103   
dbj|BAN91672.1|  cinnamyl alcohol dehydrogenase 3                       325   4e-103   
gb|AFQ59973.1|  nerol dehydrogenase                                     325   5e-103   
ref|XP_002868956.1|  hypothetical protein ARALYDRAFT_490819             325   7e-103   
ref|NP_001147726.1|  LOC100281336                                       327   8e-103   
gb|AGU43758.1|  cinnamyl alcohol dehydrogenase 5                        324   8e-103   
ref|XP_002530071.1|  alcohol dehydrogenase, putative                    324   8e-103   
ref|XP_007047728.1|  Cinnamyl alcohol dehydrogenase 6                   324   9e-103   
gb|KFK30507.1|  hypothetical protein AALP_AA7G271000                    324   1e-102   
ref|XP_009623568.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    324   1e-102   
ref|XP_002309270.2|  mannitol dehydrogenase 1 family protein            324   1e-102   
ref|XP_006659936.1|  PREDICTED: putative cinnamyl alcohol dehydro...    324   1e-102   
dbj|BAJ94928.1|  predicted protein                                      323   2e-102   
gb|AFL03407.1|  geraniol dehydrogenase 1                                323   2e-102   
emb|CAN77732.1|  hypothetical protein VITISV_036461                     323   2e-102   
ref|XP_011047124.1|  PREDICTED: probable mannitol dehydrogenase         323   2e-102   
ref|XP_011025073.1|  PREDICTED: probable mannitol dehydrogenase         323   3e-102   
gb|ADD81208.1|  sinapyl alcohol dehydrogenase-like 5                    323   3e-102   
ref|XP_006652134.1|  PREDICTED: probable cinnamyl alcohol dehydro...    323   3e-102   
ref|XP_009364231.1|  PREDICTED: probable mannitol dehydrogenase         323   3e-102   
gb|KDP29760.1|  hypothetical protein JCGZ_18695                         323   3e-102   
ref|XP_002299950.1|  hypothetical protein POPTR_0001s27550g             322   5e-102   
ref|NP_001289257.1|  8-hydroxygeraniol dehydrogenase-like               322   5e-102   
ref|XP_004250191.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    322   5e-102   
emb|CDP01602.1|  unnamed protein product                                333   5e-102   
gb|EYU45817.1|  hypothetical protein MIMGU_mgv1a008879mg                322   6e-102   
emb|CAN78954.1|  hypothetical protein VITISV_033855                     322   6e-102   
sp|Q0J6T3.2|CADH5_ORYSJ  RecName: Full=Putative cinnamyl alcohol ...    322   6e-102   
gb|AGU43750.1|  cinnamyl alcohol dehydrogenase 8                        322   6e-102   
sp|P93257.1|MTDH_MESCR  RecName: Full=Probable mannitol dehydroge...    322   6e-102   
ref|XP_002886098.1|  hypothetical protein ARALYDRAFT_900046             319   7e-102   
ref|XP_007206856.1|  hypothetical protein PRUPE_ppa027148mg             322   7e-102   
ref|XP_009387440.1|  PREDICTED: probable mannitol dehydrogenase         322   7e-102   
emb|CDX69347.1|  BnaC01g01060D                                          322   7e-102   
ref|XP_004250190.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase         322   8e-102   
gb|EMT30636.1|  Putative cinnamyl alcohol dehydrogenase 5               323   8e-102   
ref|XP_004975118.1|  PREDICTED: probable cinnamyl alcohol dehydro...    322   9e-102   
sp|O82515.1|MTDH_MEDSA  RecName: Full=Probable mannitol dehydroge...    322   9e-102   
gb|AFK34544.1|  unknown                                                 317   9e-102   
ref|XP_008384197.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    322   9e-102   
ref|XP_009592886.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    322   1e-101   
ref|XP_002968671.1|  hypothetical protein SELMODRAFT_90436              321   1e-101   
gb|ACN25289.1|  unknown                                                 322   1e-101   
ref|XP_003628882.1|  Cinnamyl alcohol dehydrogenase                     322   1e-101   
gb|ADD81205.1|  sinapyl alcohol dehydrogenase 2                         321   1e-101   
ref|XP_007207965.1|  hypothetical protein PRUPE_ppa016455mg             321   1e-101   
ref|XP_010555305.1|  PREDICTED: probable cinnamyl alcohol dehydro...    321   1e-101   
ref|XP_008384087.1|  PREDICTED: probable mannitol dehydrogenase         321   1e-101   
sp|Q6V4H0.1|10HGO_CATRO  RecName: Full=8-hydroxygeraniol dehydrog...    321   2e-101   
ref|XP_002994000.1|  hypothetical protein SELMODRAFT_187673             321   2e-101   
ref|XP_002269356.2|  PREDICTED: probable cinnamyl alcohol dehydro...    322   2e-101   
ref|XP_009364796.1|  PREDICTED: probable mannitol dehydrogenase         321   2e-101   
ref|XP_008353959.1|  PREDICTED: probable mannitol dehydrogenase         321   2e-101   
emb|CBI19922.3|  unnamed protein product                                321   2e-101   
ref|XP_006652804.1|  PREDICTED: cinnamyl alcohol dehydrogenase 7-...    321   2e-101   
gb|ADG46005.1|  cinnamyl alcohol dehydrogenase                          321   2e-101   
ref|XP_002989920.1|  hypothetical protein SELMODRAFT_235915             321   2e-101   
gb|AFK80371.1|  cinnamyl alcohol dehydrogenase 3                        321   2e-101   
ref|XP_002534286.1|  alcohol dehydrogenase, putative                    321   2e-101   
ref|XP_010437051.1|  PREDICTED: probable cinnamyl alcohol dehydro...    321   2e-101   
ref|XP_009419122.1|  PREDICTED: probable mannitol dehydrogenase         321   2e-101   
gb|KFM28250.1|  putative cinnamyl alcohol dehydrogenase                 322   2e-101   
ref|XP_010027971.1|  PREDICTED: probable mannitol dehydrogenase         320   3e-101   
ref|XP_002957700.1|  hypothetical protein VOLCADRAFT_107767             323   3e-101   
ref|XP_006466347.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    320   3e-101   
ref|XP_006466346.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    322   3e-101   
ref|XP_003612983.1|  Cinnamyl alcohol dehydrogenase                     333   3e-101   
ref|XP_004956757.1|  PREDICTED: probable cinnamyl alcohol dehydro...    320   4e-101   
ref|XP_010027973.1|  PREDICTED: probable mannitol dehydrogenase         320   4e-101   
ref|NP_195510.1|  cinnamyl-alcohol dehydrogenase 6                      320   4e-101   
ref|XP_006411735.1|  hypothetical protein EUTSA_v10025545mg             320   5e-101   
ref|XP_003576507.1|  PREDICTED: probable cinnamyl alcohol dehydro...    321   5e-101   
ref|XP_009361550.1|  PREDICTED: probable cinnamyl alcohol dehydro...    315   6e-101   
ref|XP_010431900.1|  PREDICTED: probable cinnamyl alcohol dehydro...    320   6e-101   
ref|XP_007048215.1|  Cinnamyl alcohol dehydrogenase 9 isoform 1         319   7e-101   
ref|XP_010023424.1|  PREDICTED: probable mannitol dehydrogenase         319   9e-101   
ref|XP_004503979.1|  PREDICTED: probable mannitol dehydrogenase-like    319   9e-101   
ref|XP_010266028.1|  PREDICTED: probable cinnamyl alcohol dehydro...    319   1e-100   
ref|XP_004512564.1|  PREDICTED: probable mannitol dehydrogenase-like    319   1e-100   
ref|XP_009407800.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-l...    319   1e-100   
ref|WP_006870607.1|  zinc-binding dehydrogenase                         318   1e-100   
ref|XP_008236420.1|  PREDICTED: probable mannitol dehydrogenase         319   1e-100   
ref|XP_006367178.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    319   1e-100   
ref|XP_002866841.1|  hypothetical protein ARALYDRAFT_912392             318   1e-100   
ref|NP_001052290.1|  Os04g0229100                                       318   1e-100   
gb|EYU24070.1|  hypothetical protein MIMGU_mgv1a009042mg                318   1e-100   
gb|KHG24369.1|  putative cinnamyl alcohol dehydrogenase 9 -like p...    318   2e-100   
gb|ABZ01816.1|  cinnamyl alcohol dehydrogenase                          318   2e-100   
ref|XP_006283984.1|  hypothetical protein CARUB_v10005116mg             318   2e-100   
ref|XP_009364233.1|  PREDICTED: probable mannitol dehydrogenase         318   2e-100   
ref|XP_006660608.1|  PREDICTED: probable cinnamyl alcohol dehydro...    318   2e-100   
ref|XP_006356896.1|  PREDICTED: probable cinnamyl alcohol dehydro...    318   2e-100   
ref|XP_010023416.1|  PREDICTED: probable mannitol dehydrogenase         318   2e-100   
ref|NP_195643.1|  putative cinnamyl alcohol dehydrogenase 9             318   2e-100   
gb|KDP29800.1|  hypothetical protein JCGZ_18735                         318   2e-100   
ref|XP_010247417.1|  PREDICTED: probable cinnamyl alcohol dehydro...    315   2e-100   
gb|EMS45843.1|  Putative cinnamyl alcohol dehydrogenase 5               318   2e-100   
ref|XP_006426236.1|  hypothetical protein CICLE_v10025755mg             320   2e-100   
ref|XP_009407801.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-l...    318   3e-100   
emb|CDP01601.1|  unnamed protein product                                318   3e-100   
gb|EPS74150.1|  geraniol dehydrogenase 1                                317   3e-100   
gb|AHF20166.1|  cinnamyl alcohol dehydrogenase                          318   3e-100   
ref|XP_003630177.1|  Cinnamyl-alcohol dehydrogenase                     320   3e-100   
gb|AFK46246.1|  unknown                                                 318   4e-100   
ref|XP_010941696.1|  PREDICTED: putative cinnamyl alcohol dehydro...    318   4e-100   
emb|CAD29291.1|  alcohol NADP+ oxidoreductase                           317   4e-100   
gb|AFX98063.1|  cinnamyl alcohol dehydrogenase                          317   4e-100   
gb|AAA99511.1|  cinnamyl-alcohol dehydrogenase                          317   4e-100   
ref|XP_002279718.1|  PREDICTED: probable cinnamyl alcohol dehydro...    317   4e-100   
ref|XP_007047729.1|  Geraniol dehydrogenase 1                           317   4e-100   
gb|AHF20169.1|  cinnamyl alcohol dehydrogenase                          316   5e-100   
ref|XP_001773475.1|  predicted protein                                  317   6e-100   
gb|ACJ61779.1|  ELI3                                                    316   6e-100   
ref|XP_008807131.1|  PREDICTED: probable cinnamyl alcohol dehydro...    317   7e-100   
ref|XP_008236534.1|  PREDICTED: probable mannitol dehydrogenase i...    317   7e-100   
ref|XP_008807127.1|  PREDICTED: probable cinnamyl alcohol dehydro...    317   7e-100   
ref|XP_007153368.1|  hypothetical protein PHAVU_003G029500g             317   7e-100   
ref|XP_003612993.1|  Cinnamyl alcohol dehydrogenase-like protein        317   8e-100   
ref|XP_011083448.1|  PREDICTED: probable cinnamyl alcohol dehydro...    317   8e-100   
ref|XP_007153369.1|  hypothetical protein PHAVU_003G029500g             317   9e-100   
sp|Q38707.1|MTDH_APIGR  RecName: Full=Mannitol dehydrogenase; Alt...    317   9e-100   
ref|WP_007660619.1|  alcohol dehydrogenase                              316   9e-100   
ref|XP_008237214.1|  PREDICTED: probable mannitol dehydrogenase         317   9e-100   
sp|Q43137.1|MTDH1_STYHU  RecName: Full=Probable mannitol dehydrog...    316   1e-99    
ref|NP_001241491.1|  uncharacterized protein LOC100819684               317   1e-99    
gb|AAA74746.1|  cinnamyl-alcohol dehydrogenase                          316   1e-99    
gb|EMT16612.1|  Putative cinnamyl alcohol dehydrogenase 5               316   1e-99    
ref|XP_010052660.1|  PREDICTED: probable mannitol dehydrogenase         316   1e-99    
gb|AAM64913.1|  cinnamyl-alcohol dehydrogenase CAD1                     316   1e-99    
ref|XP_010066666.1|  PREDICTED: probable mannitol dehydrogenase         316   1e-99    
gb|ADP68548.1|  putative sinapyl alcohol dehydrogenase                  314   1e-99    
gb|ACV74414.1|  putative cinnamyl alcohol dehydrogenase                 316   2e-99    
gb|EMT14647.1|  Putative cinnamyl alcohol dehydrogenase 5               318   2e-99    
ref|XP_010531428.1|  PREDICTED: probable cinnamyl alcohol dehydro...    316   2e-99    
ref|XP_002263847.1|  PREDICTED: probable mannitol dehydrogenase         315   2e-99    
ref|XP_006353146.1|  PREDICTED: probable mannitol dehydrogenase-like    315   3e-99    
ref|XP_010027972.1|  PREDICTED: probable mannitol dehydrogenase         315   3e-99    
ref|XP_010025539.1|  PREDICTED: probable cinnamyl alcohol dehydro...    315   4e-99    
emb|CDP07361.1|  unnamed protein product                                315   4e-99    
ref|NP_179780.1|  cinnamyl alcohol dehydrogenase-like protein 3         315   4e-99    
ref|XP_008351726.1|  PREDICTED: probable mannitol dehydrogenase         315   4e-99    
ref|XP_007205411.1|  hypothetical protein PRUPE_ppa007615mg             315   5e-99    
ref|XP_002446076.1|  hypothetical protein SORBIDRAFT_06g001430          315   5e-99    
ref|XP_008236439.1|  PREDICTED: probable mannitol dehydrogenase         315   5e-99    
gb|EMT33752.1|  Putative cinnamyl alcohol dehydrogenase 8C              318   5e-99    
ref|XP_010446472.1|  PREDICTED: probable cinnamyl alcohol dehydro...    315   5e-99    
gb|EEC76612.1|  hypothetical protein OsI_14481                          318   6e-99    
ref|XP_005652266.1|  GroES-like protein                                 317   6e-99    
ref|XP_008466466.1|  PREDICTED: probable cinnamyl alcohol dehydro...    314   6e-99    
ref|NP_001141363.1|  uncharacterized protein LOC100273454               314   6e-99    



>ref|XP_009589196.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009589197.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana 
tomentosiformis]
Length=355

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/355 (83%), Positives = 326/355 (92%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S+ + +NCLGWAARDPSG LSPY FSRR VGSDDV LDIA+CG+C+AD++WTRN  G 
Sbjct  1     MTSASAAENCLGWAARDPSGFLSPYKFSRRAVGSDDVLLDIAFCGICFADIVWTRNKLGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVG V++VG+ V+ FKVGD VGVGTYVNSCRECEYCN+GLEV CSKG+V+
Sbjct  61    SKYPLVPGHEIVGTVRDVGTNVKHFKVGDHVGVGTYVNSCRECEYCNDGLEVHCSKGAVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGIDVDGTVTKGGYSSYIVVHERYC++IPENYPLASAAPLLCAG+TVYTPMMRHNMNQ
Sbjct  121   TFDGIDVDGTVTKGGYSSYIVVHERYCFRIPENYPLASAAPLLCAGVTVYTPMMRHNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTSISK+EEAL LLGADNFV+SSDE+QMM
Sbjct  181   PGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSISKREEALKLLGADNFVVSSDEQQMM  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KSFDF+INTA+GDIPFD YLSLLKTAG L LVGFP+EVKF+PG+L LGMK I GS+T
Sbjct  241   ALGKSFDFMINTAAGDIPFDPYLSLLKTAGILVLVGFPTEVKFTPGNLVLGMKSIVGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE+L+FCAS KIYPEI+I+PIQY NEALERLIKKDVKYRFVID+G SLK
Sbjct  301   GGTKQIQEMLDFCASNKIYPEIEIVPIQYANEALERLIKKDVKYRFVIDVGKSLK  355



>ref|XP_009778632.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana 
sylvestris]
 ref|XP_009778633.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Nicotiana 
sylvestris]
Length=355

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/355 (83%), Positives = 324/355 (91%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S+   +NCLGWAARDPSG LSPY FSRR VGSDDV LDI +CG+C+AD++WTRN HG 
Sbjct  1     MTSASVKENCLGWAARDPSGFLSPYKFSRRTVGSDDVLLDILFCGICFADIVWTRNKHGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVG V++VG+ V+ FKVGD VGVGTYVNSCRECEYCN+GLEV CSKG+V+
Sbjct  61    SKYPLVPGHEIVGTVRDVGTNVKHFKVGDHVGVGTYVNSCRECEYCNDGLEVHCSKGAVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGIDVDGTVTKGGYSSYIVVHERYC++IPENYPLASAAPLLCAGITVYTPMMRHNMNQ
Sbjct  121   TFDGIDVDGTVTKGGYSSYIVVHERYCFRIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTSISK+EEAL LLGADNF++SSDE+QM 
Sbjct  181   PGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSISKREEALKLLGADNFMVSSDEQQMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KSFDF+INTASGDIPFD YLSLLKTAG L LVGFP+EVKFSPG+L LGMK I GS+T
Sbjct  241   ALGKSFDFMINTASGDIPFDPYLSLLKTAGILVLVGFPTEVKFSPGNLVLGMKSIVGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L+FCAS KIYPEI+I+PIQY NEALERLIKKDV YRFVID+G SLK
Sbjct  301   GGTKQTQEMLDFCASHKIYPEIEIVPIQYANEALERLIKKDVNYRFVIDVGNSLK  355



>ref|XP_004252617.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Solanum 
lycopersicum]
 ref|XP_010314515.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Solanum 
lycopersicum]
Length=355

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/355 (82%), Positives = 327/355 (92%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M  + + +NCLGWAARDPSGVLSPY F+RRVV SDDV LDIA+CG+C+ADVIWT+NI GT
Sbjct  1     MTFASANENCLGWAARDPSGVLSPYEFNRRVVSSDDVRLDIAFCGMCFADVIWTKNILGT  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI GIV+EVG+ V+ FK+GD VGVGTY+NSCRECEYC + LEV CSKG+++
Sbjct  61    SKYPLVPGHEITGIVREVGADVKHFKIGDHVGVGTYINSCRECEYCCDALEVHCSKGAIY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGIDVDGTVTKGGYSSYIVV+ERYC++IPENYPLASAAPLLCAGITVYTPM++HNMNQ
Sbjct  121   TFDGIDVDGTVTKGGYSSYIVVNERYCFRIPENYPLASAAPLLCAGITVYTPMIKHNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGV+GLGGLGHLAVKFGKAFG+KVTVFSTSISK+EEA+N LGAD FVISSDE+QMM
Sbjct  181   PGKSLGVVGLGGLGHLAVKFGKAFGMKVTVFSTSISKREEAVNRLGADKFVISSDEQQMM  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             ALSKSFDF+INTASGDIPFD YLSLLKTAG L LVGFPSEVKF PG+L LGMK I GS+T
Sbjct  241   ALSKSFDFIINTASGDIPFDTYLSLLKTAGVLVLVGFPSEVKFIPGNLILGMKSIVGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L+FCAS KIYPEI+++PIQYVNEALERLIKKDVKYRFVID+  SLK
Sbjct  301   GGTKQTQEMLDFCASHKIYPEIEVVPIQYVNEALERLIKKDVKYRFVIDVANSLK  355



>ref|XP_006360729.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360730.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like isoform 
X2 [Solanum tuberosum]
Length=355

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/355 (83%), Positives = 327/355 (92%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S+ + +NCLGWAARDPSGVLSPY F+RR V SDDV LDIA+CG+C+ADV+WTRNI GT
Sbjct  1     MTSASANENCLGWAARDPSGVLSPYEFNRRAVSSDDVLLDIAFCGMCFADVLWTRNILGT  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI GIV+EVG+ V+ FKVGD VGVGTYVNSCRECEYC + LEV CS+G++ 
Sbjct  61    SKYPLVPGHEITGIVREVGTDVKHFKVGDLVGVGTYVNSCRECEYCCDELEVHCSEGAIN  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGIDVDGTVTKGGYSSYIVV+ERYC++IPENYPLASAAPLLCAGITVYTPM+RHNMNQ
Sbjct  121   TFDGIDVDGTVTKGGYSSYIVVNERYCFRIPENYPLASAAPLLCAGITVYTPMIRHNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGV+GLGGLGHLAVKFGKAFGLKVTVFSTSISK+EEA+N+LGAD FVISSDE+QMM
Sbjct  181   PGKSLGVVGLGGLGHLAVKFGKAFGLKVTVFSTSISKREEAINVLGADKFVISSDEQQMM  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             ALSKSFDF+INTASGDIPFD YLSLLKTAG L LVGFPSEVKF PG+L LGMK I GS+T
Sbjct  241   ALSKSFDFIINTASGDIPFDTYLSLLKTAGVLVLVGFPSEVKFIPGNLILGMKSIVGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L+FCAS KIYPEI+I+PIQYVNEALERL+KKDVKYRFVID+  S+K
Sbjct  301   GGTKQTQEMLDFCASHKIYPEIEIVPIQYVNEALERLMKKDVKYRFVIDVANSIK  355



>emb|CBI34634.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/355 (81%), Positives = 323/355 (91%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  + DNCL WAARDPSG+LSPY FSRR +GSDDVSL+I +CGVCYADV+WTRN  G 
Sbjct  1     MTSESADDNCLAWAARDPSGLLSPYKFSRRALGSDDVSLNITHCGVCYADVVWTRNKFGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYP+VPGHEI GIVKEVGS V+RFKVGD VGVGTYVNSCR+CEYCN+GLEV C++GSVF
Sbjct  61    SKYPVVPGHEIAGIVKEVGSNVRRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCARGSVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+DVDGTVTKGGYSS+IVVHERYC+KIP+NYPLASAAPLLCAGITVYTPMMRH MNQ
Sbjct  121   TFNGVDVDGTVTKGGYSSHIVVHERYCFKIPDNYPLASAAPLLCAGITVYTPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGHLAVKFGKAFGL+VTV STSISKKEEALNLLGAD FV+SSDE+QMM
Sbjct  181   PGKSLGVIGLGGLGHLAVKFGKAFGLRVTVLSTSISKKEEALNLLGADKFVVSSDEQQMM  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             ALS+S DF+I+TASGD PFD YLSLLKTAG L LVGFPSEVKFSPGS+ +GM+ ++GS T
Sbjct  241   ALSRSLDFIIDTASGDHPFDPYLSLLKTAGVLVLVGFPSEVKFSPGSIVMGMRTVSGSAT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L+FCA+  I+PEI++IPIQY NEALERLIKKDVKYRFVIDI  SLK
Sbjct  301   GGTKDTQEMLDFCAAHGIHPEIEVIPIQYANEALERLIKKDVKYRFVIDIENSLK  355



>ref|XP_002277375.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Vitis vinifera]
Length=371

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/355 (81%), Positives = 323/355 (91%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  + DNCL WAARDPSG+LSPY FSRR +GSDDVSL+I +CGVCYADV+WTRN  G 
Sbjct  17    MTSESADDNCLAWAARDPSGLLSPYKFSRRALGSDDVSLNITHCGVCYADVVWTRNKFGD  76

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYP+VPGHEI GIVKEVGS V+RFKVGD VGVGTYVNSCR+CEYCN+GLEV C++GSVF
Sbjct  77    SKYPVVPGHEIAGIVKEVGSNVRRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCARGSVF  136

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+DVDGTVTKGGYSS+IVVHERYC+KIP+NYPLASAAPLLCAGITVYTPMMRH MNQ
Sbjct  137   TFNGVDVDGTVTKGGYSSHIVVHERYCFKIPDNYPLASAAPLLCAGITVYTPMMRHKMNQ  196

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGHLAVKFGKAFGL+VTV STSISKKEEALNLLGAD FV+SSDE+QMM
Sbjct  197   PGKSLGVIGLGGLGHLAVKFGKAFGLRVTVLSTSISKKEEALNLLGADKFVVSSDEQQMM  256

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             ALS+S DF+I+TASGD PFD YLSLLKTAG L LVGFPSEVKFSPGS+ +GM+ ++GS T
Sbjct  257   ALSRSLDFIIDTASGDHPFDPYLSLLKTAGVLVLVGFPSEVKFSPGSIVMGMRTVSGSAT  316

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L+FCA+  I+PEI++IPIQY NEALERLIKKDVKYRFVIDI  SLK
Sbjct  317   GGTKDTQEMLDFCAAHGIHPEIEVIPIQYANEALERLIKKDVKYRFVIDIENSLK  371



>gb|EYU33425.1| hypothetical protein MIMGU_mgv1a008952mg [Erythranthe guttata]
Length=357

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/348 (84%), Positives = 313/348 (90%), Gaps = 0/348 (0%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             D CLGWAARDPSG LSPY F+RR VGSDDVS+ I YCGVC+ADVIWTRN  G S YPLVP
Sbjct  7     DCCLGWAARDPSGFLSPYKFTRRPVGSDDVSISIQYCGVCFADVIWTRNKLGHSNYPLVP  66

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEIVGIV EVGS V RFK+GD VGVGTYVNSCREC+YC+  LEV CSKG+VFTFDG+D 
Sbjct  67    GHEIVGIVTEVGSNVGRFKIGDHVGVGTYVNSCRECDYCDSKLEVHCSKGAVFTFDGVDA  126

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGT+TKGGYS+YIVVHERYCY IPENYP   AAPLLCAGITVYTPM+RHNMNQPGKSLGV
Sbjct  127   DGTITKGGYSNYIVVHERYCYTIPENYPPQLAAPLLCAGITVYTPMIRHNMNQPGKSLGV  186

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             +GLGGLGHLAVKFGKAFGLKVTVFSTSISK+EEALNLLGADNFVISSDEKQM  L KSFD
Sbjct  187   VGLGGLGHLAVKFGKAFGLKVTVFSTSISKREEALNLLGADNFVISSDEKQMRGLEKSFD  246

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             F+INTASGDI FDLYLSLLKTAG LALVGFPSEVKFSPGSL+LG K I GSITGGTK TQ
Sbjct  247   FIINTASGDISFDLYLSLLKTAGVLALVGFPSEVKFSPGSLSLGAKTITGSITGGTKQTQ  306

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+L+FCA+ KIYPEI++IPIQY N+ALERLIKKDVKYRFVIDI  SLK
Sbjct  307   EMLDFCAAHKIYPEIELIPIQYSNKALERLIKKDVKYRFVIDIANSLK  354



>ref|XP_011070320.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Sesamum 
indicum]
 ref|XP_011070321.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Sesamum 
indicum]
Length=353

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/346 (83%), Positives = 310/346 (90%), Gaps = 0/346 (0%)
 Frame = -2

Query  1288  CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGH  1109
             CLGWAARDPSG+LSPY F+RR VGSDDVS+ I YCGVC+ADV+WTRN  G S YPLVPGH
Sbjct  8     CLGWAARDPSGLLSPYKFTRRSVGSDDVSISILYCGVCFADVVWTRNRLGHSNYPLVPGH  67

Query  1108  EIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDG  929
             EIVGIV EVGS VQRFKVGD VGVGTYVNSCRECEYC+  LEV CSKG++FTFD +DVDG
Sbjct  68    EIVGIVTEVGSNVQRFKVGDHVGVGTYVNSCRECEYCDSELEVYCSKGAIFTFDAVDVDG  127

Query  928   TVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvig  749
             T+TKGGYSSYIVVH+RYC++IPE YPL  AAPLLCAGITVY PMM+HNMNQPGKSLGVIG
Sbjct  128   TITKGGYSSYIVVHQRYCFRIPEKYPLQLAAPLLCAGITVYAPMMQHNMNQPGKSLGVIG  187

Query  748   lgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFL  569
             LGGLGHLAVKFGKAFGLKVTV STSISK+EEALN+LGADNF ISSDEKQM AL KSFDF+
Sbjct  188   LGGLGHLAVKFGKAFGLKVTVLSTSISKREEALNVLGADNFCISSDEKQMRALQKSFDFI  247

Query  568   INTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             INTASGDI FDLYLSLLKTAG   LVGFPSEVKF+PGSL LG K I GSITGGTK TQE+
Sbjct  248   INTASGDISFDLYLSLLKTAGVFVLVGFPSEVKFNPGSLALGGKAITGSITGGTKQTQEM  307

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             L+FCAS KIYPEI++IPIQY NEALERLIKKDVKYRFVIDI  SLK
Sbjct  308   LDFCASHKIYPEIELIPIQYSNEALERLIKKDVKYRFVIDIANSLK  353



>emb|CDP08884.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/355 (79%), Positives = 318/355 (90%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S++  ++CLGWAARDPSG LSPY FSRR +GS+DVSLDI +CG+CYADV WTRN  G 
Sbjct  1     MSSANDNEDCLGWAARDPSGYLSPYKFSRRAIGSEDVSLDITHCGICYADVAWTRNKGGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI G+V++VG  V+ FKVGD VGVGTYVNSCRECEYCN+GLEV CSKG V 
Sbjct  61    SKYPLVPGHEITGVVRQVGFRVKHFKVGDHVGVGTYVNSCRECEYCNDGLEVHCSKGPVL  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGIDVDGTVTKGGYSSYIVVHERYC+++P+NYPL  AAPLLCAGITVYTPM+RHNMNQ
Sbjct  121   TFDGIDVDGTVTKGGYSSYIVVHERYCFRVPDNYPLELAAPLLCAGITVYTPMIRHNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGK+LGVIGLGGLGHLAVKFGKAFGLKVTVFSTS+SKKEEA++ LGADNFV+SSDE+QM 
Sbjct  181   PGKTLGVIGLGGLGHLAVKFGKAFGLKVTVFSTSLSKKEEAVSRLGADNFVVSSDEQQMS  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL+ S DF+I+TA+GDIPFD YLSLLKTAG L LVGFPSEVKFSP +L LGMK ++GS+T
Sbjct  241   ALANSLDFIIDTAAGDIPFDPYLSLLKTAGVLVLVGFPSEVKFSPVTLILGMKTVSGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L FCA  KIYPEI+++PIQY NEALER+IKKDVKYRFVIDI  SLK
Sbjct  301   GGTKQTQEMLNFCALHKIYPEIEVVPIQYSNEALERMIKKDVKYRFVIDIANSLK  355



>ref|XP_007039280.1| Cinnamyl-alcohol dehydrogenase isoform 3 [Theobroma cacao]
 gb|EOY23781.1| Cinnamyl-alcohol dehydrogenase isoform 3 [Theobroma cacao]
Length=361

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/356 (78%), Positives = 316/356 (89%), Gaps = 0/356 (0%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             +M S   T++CLGWAARDPSG LSPY FSRR +GSDDVSL I +CGVCYADVIW+RN +G
Sbjct  6     TMDSQTKTEDCLGWAARDPSGALSPYKFSRRPLGSDDVSLKITHCGVCYADVIWSRNKNG  65

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              S YPLVPGHEI G+VKEVGS V RFKVGDPVGVGTYVNSCR+CEYCN+G+EV C KGSV
Sbjct  66    DSMYPLVPGHEIAGVVKEVGSNVCRFKVGDPVGVGTYVNSCRDCEYCNDGVEVHCVKGSV  125

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FTF+GID DGTVTKGGYSSYIVVHERYC++IP NYPLASAAPLLCAGITVY PMMRHNMN
Sbjct  126   FTFNGIDEDGTVTKGGYSSYIVVHERYCFRIPSNYPLASAAPLLCAGITVYAPMMRHNMN  185

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
               GKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGAD FV+SSD++QM
Sbjct  186   HSGKSLGVIGLGGLGHMAVKFGKAFGLHVTVFSTSISKKEEALNLLGADKFVVSSDQEQM  245

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
               LSKS DF+++TASG+ PFD Y+SLLK +G   LVGFPSEVKFSP SLN+GM+ ++GSI
Sbjct  246   KGLSKSLDFIVDTASGNHPFDPYMSLLKISGVYVLVGFPSEVKFSPASLNMGMRTVSGSI  305

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK+TQE+++FCA+  IYP+I++IPIQY NEALERLIK+DVKYRFVIDI  +LK
Sbjct  306   TGGTKVTQEMIDFCAAHNIYPQIEVIPIQYANEALERLIKRDVKYRFVIDIENTLK  361



>ref|XP_007039278.1| Cinnamyl-alcohol dehydrogenase isoform 1 [Theobroma cacao]
 ref|XP_007039279.1| Cinnamyl-alcohol dehydrogenase isoform 1 [Theobroma cacao]
 ref|XP_007039283.1| Cinnamyl-alcohol dehydrogenase isoform 1 [Theobroma cacao]
 ref|XP_007039284.1| Cinnamyl-alcohol dehydrogenase isoform 1 [Theobroma cacao]
 gb|EOY23779.1| Cinnamyl-alcohol dehydrogenase isoform 1 [Theobroma cacao]
 gb|EOY23780.1| Cinnamyl-alcohol dehydrogenase isoform 1 [Theobroma cacao]
 gb|EOY23784.1| Cinnamyl-alcohol dehydrogenase isoform 1 [Theobroma cacao]
 gb|EOY23785.1| Cinnamyl-alcohol dehydrogenase isoform 1 [Theobroma cacao]
Length=355

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/355 (78%), Positives = 315/355 (89%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S   T++CLGWAARDPSG LSPY FSRR +GSDDVSL I +CGVCYADVIW+RN +G 
Sbjct  1     MDSQTKTEDCLGWAARDPSGALSPYKFSRRPLGSDDVSLKITHCGVCYADVIWSRNKNGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+VKEVGS V RFKVGDPVGVGTYVNSCR+CEYCN+G+EV C KGSVF
Sbjct  61    SMYPLVPGHEIAGVVKEVGSNVCRFKVGDPVGVGTYVNSCRDCEYCNDGVEVHCVKGSVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DGTVTKGGYSSYIVVHERYC++IP NYPLASAAPLLCAGITVY PMMRHNMN 
Sbjct  121   TFNGIDEDGTVTKGGYSSYIVVHERYCFRIPSNYPLASAAPLLCAGITVYAPMMRHNMNH  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
              GKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGAD FV+SSD++QM 
Sbjct  181   SGKSLGVIGLGGLGHMAVKFGKAFGLHVTVFSTSISKKEEALNLLGADKFVVSSDQEQMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
              LSKS DF+++TASG+ PFD Y+SLLK +G   LVGFPSEVKFSP SLN+GM+ ++GSIT
Sbjct  241   GLSKSLDFIVDTASGNHPFDPYMSLLKISGVYVLVGFPSEVKFSPASLNMGMRTVSGSIT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK+TQE+++FCA+  IYP+I++IPIQY NEALERLIK+DVKYRFVIDI  +LK
Sbjct  301   GGTKVTQEMIDFCAAHNIYPQIEVIPIQYANEALERLIKRDVKYRFVIDIENTLK  355



>gb|ACZ06241.1| cinnamyl alcohol dehydrogenase 5 [Gossypium hirsutum]
Length=355

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/355 (79%), Positives = 315/355 (89%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S   T+NCLGWAA DP+GVLSPY FSRR +GSDDVS+ I +CGVCYADVIW+RN+ G 
Sbjct  1     MDSQTKTENCLGWAATDPTGVLSPYKFSRRPLGSDDVSIKITHCGVCYADVIWSRNMFGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI GIVKEVGS VQR KVGD VGVGTYVNSCR CEYCN+G+EVQC KG V 
Sbjct  61    SIYPLVPGHEIAGIVKEVGSNVQRIKVGDLVGVGTYVNSCRNCEYCNDGVEVQCVKGPVL  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ ID+DGTVTKGGYSS+IVVHERYC+KIP NYPLASAAPLLCAGITVYTPMMR+NMNQ
Sbjct  121   TFNHIDIDGTVTKGGYSSHIVVHERYCFKIPNNYPLASAAPLLCAGITVYTPMMRYNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTV STSISKKEEAL+LLGADNFV++SD++QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLSVTVLSTSISKKEEALSLLGADNFVVTSDQEQMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
              LSKS DF+I+TASGD PFD YLSLLK+AG  ALVGFPSE+KFSP SLN GMK  AGS+T
Sbjct  241   GLSKSLDFIIDTASGDHPFDPYLSLLKSAGVYALVGFPSEIKFSPASLNPGMKTFAGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK+ QE++ FCA+RKIYP+I++IPIQY NEALERL+KKDVKYRFVIDI  +LK
Sbjct  301   GGTKMIQEMIGFCAARKIYPQIEVIPIQYANEALERLVKKDVKYRFVIDIENTLK  355



>ref|XP_010056070.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010056071.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW72648.1| hypothetical protein EUGRSUZ_E01104 [Eucalyptus grandis]
Length=354

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/355 (80%), Positives = 315/355 (89%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + ++CLGWAARDPSG+LSPY FSRR VGSDDVS+ I +CGVCYADV WTRN  G 
Sbjct  1     MSSEGAKEDCLGWAARDPSGLLSPYKFSRRTVGSDDVSIRITHCGVCYADVAWTRNEQGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVKEVGS VQRFKVGD VGVGTYVNSCRECEYCN+ LE  C KG VF
Sbjct  61    SKYPLVPGHEIVGIVKEVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDRLENNCEKG-VF  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSSYIVVHERYC+ IPEN PLASAAPLLCAGITVYTPMMRH MNQ
Sbjct  120   TFDGIDADGTVTKGGYSSYIVVHERYCFTIPENLPLASAAPLLCAGITVYTPMMRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVK GKAFGLKVTVFSTSISKKEEAL+LLGAD+FVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKLGKAFGLKVTVFSTSISKKEEALSLLGADHFVISSDPEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS  F+I+TA+GD PFD Y+SLLKT G LALVGFPSEVKFSP SLN+GMK ++GS+T
Sbjct  240   AMAKSLHFIIDTAAGDHPFDPYMSLLKTGGVLALVGFPSEVKFSPASLNIGMKTVSGSLT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE+++FCA++K+YP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  300   GGTKDIQEMIDFCAAQKVYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  354



>gb|KHG29019.1| putative cinnamyl alcohol dehydrogenase 1 -like protein [Gossypium 
arboreum]
Length=355

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/355 (79%), Positives = 315/355 (89%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S   T+NCLGWAA DP+GVLSPY FSRR +GSDDVS+ I +CGVCYADVIW+RN+ G 
Sbjct  1     MDSQTKTENCLGWAATDPTGVLSPYKFSRRPLGSDDVSIKITHCGVCYADVIWSRNMLGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI GIVKEVGS VQ  KVGD VGVGTYVNSCR CEYCN+G+EVQC KG VF
Sbjct  61    SIYPLVPGHEIAGIVKEVGSNVQGIKVGDHVGVGTYVNSCRNCEYCNDGVEVQCVKGPVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ IDVDGTVTKGGYSS+IVVHERYC+KIP NYPLASAAPLLCAGITVYTPMMR+NMNQ
Sbjct  121   TFNHIDVDGTVTKGGYSSHIVVHERYCFKIPNNYPLASAAPLLCAGITVYTPMMRYNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTV STS SKKEEAL+LLGADNF+++SD++Q+ 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLSVTVLSTSTSKKEEALSLLGADNFIVTSDQEQVK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
              LSKS DF+I+TASGD PFD YLSLLK+AG  ALVGFPSE+KFSP SLN+GMK  AGS+T
Sbjct  241   GLSKSLDFIIDTASGDHPFDPYLSLLKSAGVYALVGFPSEIKFSPASLNMGMKTFAGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK+ QE++ FCA+RKIYP+I++IPIQY NEALERL+KKDVKYRFVIDI  +LK
Sbjct  301   GGTKMIQEMISFCAARKIYPQIEVIPIQYANEALERLVKKDVKYRFVIDIENTLK  355



>ref|XP_007209297.1| hypothetical protein PRUPE_ppa007789mg [Prunus persica]
 gb|EMJ10496.1| hypothetical protein PRUPE_ppa007789mg [Prunus persica]
Length=355

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/355 (78%), Positives = 314/355 (88%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + +NCLG+AARDPSGVLS Y FSRR +G DD+S+ I +CGVCYADVIW RN HG 
Sbjct  1     MSSESANENCLGYAARDPSGVLSEYKFSRRALGIDDISIKITHCGVCYADVIWARNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI GIVKEVGS V RFKVGD +GVGTYVNSCR+CEYCNEG EV C+KGSV+
Sbjct  61    SKYPLVPGHEIAGIVKEVGSNVLRFKVGDHIGVGTYVNSCRDCEYCNEGFEVYCAKGSVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGT+TKGGYSS+IVVHERYC+KIP+NYPLASAAPLLCAGITVY PM RH MNQ
Sbjct  121   TFNGVDADGTITKGGYSSHIVVHERYCFKIPDNYPLASAAPLLCAGITVYAPMKRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTS+SKKEEAL+ LGAD FV+SSD++QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLHVTVFSTSVSKKEEALSQLGADKFVVSSDQEQMT  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DFLI+TASGD PFD Y++LLKT GTL LVGFPSEVKFSP SLNLGMK I+GS+T
Sbjct  241   ALVKSLDFLIDTASGDHPFDPYMALLKTGGTLVLVGFPSEVKFSPASLNLGMKTISGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++FCA+ +I+P I+IIPIQY  EALERL+KKDVKYRFVIDI  SLK
Sbjct  301   GGTKDTQEMIDFCAAHEIHPMIEIIPIQYATEALERLVKKDVKYRFVIDIENSLK  355



>gb|KDP25182.1| hypothetical protein JCGZ_20338 [Jatropha curcas]
Length=355

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/348 (79%), Positives = 313/348 (90%), Gaps = 0/348 (0%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             ++CL WAARDPSGVLSPY FSRR VG DDVSL+I +CGVCYADVIWTRN HG SKYPLVP
Sbjct  8     EDCLAWAARDPSGVLSPYKFSRRDVGGDDVSLNITHCGVCYADVIWTRNKHGDSKYPLVP  67

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEIVGIVKEVGS V RFK GD VGVGTYV SCR+CEYCN+G EV C KG+V+TF+ IDV
Sbjct  68    GHEIVGIVKEVGSNVSRFKAGDRVGVGTYVGSCRDCEYCNDGQEVNCVKGTVYTFNAIDV  127

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGT+TKGGYSSYIVVHERYC++IP++YP+A AAPLLCAGITVY PMMRH MNQPGKSLGV
Sbjct  128   DGTITKGGYSSYIVVHERYCFRIPDDYPMALAAPLLCAGITVYNPMMRHGMNQPGKSLGV  187

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             IGLGGLGH+AVKFGKAFGLKVTVFSTSISK+EEAL++LGAD+FV+SSD +QM A SKS D
Sbjct  188   IGLGGLGHMAVKFGKAFGLKVTVFSTSISKREEALSVLGADDFVVSSDPEQMKAFSKSMD  247

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             F+++TASGD PFD Y+S LKTAG   LVGFPSEVKFSP SLNLGM+ I+GSITGGTK+TQ
Sbjct  248   FIVDTASGDHPFDPYMSTLKTAGVFVLVGFPSEVKFSPASLNLGMRTISGSITGGTKVTQ  307

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+L+FCA+ KIYP+I++IPIQY NEALERL+KKDVKYRFVIDI  SL+
Sbjct  308   EMLDFCAAHKIYPKIEVIPIQYANEALERLVKKDVKYRFVIDIENSLE  355



>ref|XP_007039281.1| Cinnamyl-alcohol dehydrogenase isoform 4 [Theobroma cacao]
 gb|EOY23782.1| Cinnamyl-alcohol dehydrogenase isoform 4 [Theobroma cacao]
Length=356

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/356 (78%), Positives = 315/356 (88%), Gaps = 1/356 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S   T++CLGWAARDPSG LSPY FSRR +GSDDVSL I +CGVCYADVIW+RN +G 
Sbjct  1     MDSQTKTEDCLGWAARDPSGALSPYKFSRRPLGSDDVSLKITHCGVCYADVIWSRNKNGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+VKEVGS V RFKVGDPVGVGTYVNSCR+CEYCN+G+EV C KGSVF
Sbjct  61    SMYPLVPGHEIAGVVKEVGSNVCRFKVGDPVGVGTYVNSCRDCEYCNDGVEVHCVKGSVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DGTVTKGGYSSYIVVHERYC++IP NYPLASAAPLLCAGITVY PMMRHNMN 
Sbjct  121   TFNGIDEDGTVTKGGYSSYIVVHERYCFRIPSNYPLASAAPLLCAGITVYAPMMRHNMNH  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
              GKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGAD FV+SSD++QM 
Sbjct  181   SGKSLGVIGLGGLGHMAVKFGKAFGLHVTVFSTSISKKEEALNLLGADKFVVSSDQEQMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLG-MKCIAGSI  419
              LSKS DF+++TASG+ PFD Y+SLLK +G   LVGFPSEVKFSP SLN+G M+ ++GSI
Sbjct  241   GLSKSLDFIVDTASGNHPFDPYMSLLKISGVYVLVGFPSEVKFSPASLNMGSMRTVSGSI  300

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK+TQE+++FCA+  IYP+I++IPIQY NEALERLIK+DVKYRFVIDI  +LK
Sbjct  301   TGGTKVTQEMIDFCAAHNIYPQIEVIPIQYANEALERLIKRDVKYRFVIDIENTLK  356



>ref|XP_006377873.1| hypothetical protein POPTR_0011s15120g [Populus trichocarpa]
 gb|ERP55670.1| hypothetical protein POPTR_0011s15120g [Populus trichocarpa]
Length=355

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/355 (78%), Positives = 312/355 (88%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    D+CL WAARDPSGVLSPY FSRR +G DDVSL I +CGVCYADVIW++N HG 
Sbjct  1     MSSEGVKDDCLAWAARDPSGVLSPYKFSRRALGKDDVSLKITHCGVCYADVIWSKNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S+YPLVPGHEI GIVKEVGS V  FKVGD VGVGTYVNSCRECE+CN+  EV C KGSV+
Sbjct  61    SRYPLVPGHEIAGIVKEVGSSVSNFKVGDHVGVGTYVNSCRECEHCNDKEEVSCEKGSVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DG++TKGGYSSYIVVHERYC++IP+ YPLASAAPLLCAGITVY PMMRH MNQ
Sbjct  121   TFNGIDADGSITKGGYSSYIVVHERYCFRIPDGYPLASAAPLLCAGITVYNPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STS+SKKEEAL++LGADNFVI+SD+ QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSVSKKEEALSVLGADNFVITSDQAQMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DF+I+TASGD PFD YLSLLKTAG   LVGFPSEVKFSP SLN+GMK +AGSIT
Sbjct  241   ALYKSLDFIIDTASGDHPFDPYLSLLKTAGVFVLVGFPSEVKFSPASLNIGMKTVAGSIT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGT++ QE+L+FCA+ KIYP I++IPIQY+NEALER++K DVKYRFVIDI  SLK
Sbjct  301   GGTRVIQEMLDFCAANKIYPGIEVIPIQYINEALERMVKNDVKYRFVIDIENSLK  355



>ref|XP_008367452.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Malus domestica]
Length=357

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/354 (78%), Positives = 315/354 (89%), Gaps = 0/354 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + +NC+G+AARDPSGVLS Y F+RR +G+DDVS+ I +CGVCYADVIW+RN HG 
Sbjct  1     MSSDGANENCVGYAARDPSGVLSHYKFNRRALGADDVSIRITHCGVCYADVIWSRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI G+VKEVGS   RFKVGD VGVGTYVNSCR+CEYCNEGLEV C KGSV+
Sbjct  61    SKYPLVPGHEIAGVVKEVGSNCHRFKVGDHVGVGTYVNSCRDCEYCNEGLEVDCVKGSVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ +D DGT+TKGGYSS+IVVHERYC+KIP+NYPLASAAPLLCAGITVY PM RH MNQ
Sbjct  121   TFNAVDADGTITKGGYSSHIVVHERYCFKIPDNYPLASAAPLLCAGITVYAPMKRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEAL+ LGAD FV+SSD+KQM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLNVTVFSTSISKKEEALSQLGADKFVVSSDQKQMA  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L KSFDFLI+TASGD PFD Y++LLKT GTLALVGFPSEVKFSP SLNLGMK I+GS+T
Sbjct  241   SLVKSFDFLIDTASGDHPFDPYMALLKTGGTLALVGFPSEVKFSPASLNLGMKSISGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GGTK TQE+++FCA++ I+P I+IIPIQY  EALERL+KK+VKYRFVIDI  SL
Sbjct  301   GGTKDTQEMIDFCAAQGIHPMIEIIPIQYATEALERLVKKEVKYRFVIDIESSL  354



>ref|XP_008239280.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Prunus 
mume]
Length=362

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/355 (77%), Positives = 312/355 (88%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + +NCLG+AARDPSGVLS Y FSRR +G DD+S+ I +CGVCYADV W RN HG 
Sbjct  1     MSSESANENCLGYAARDPSGVLSEYKFSRRALGIDDISIKITHCGVCYADVSWARNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI GIVKEVGS V  FKVGD +GVGTYVNSCR+CEYCNEG EV C+KGSV+
Sbjct  61    SKYPLVPGHEIAGIVKEVGSNVHSFKVGDHIGVGTYVNSCRDCEYCNEGFEVHCAKGSVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGT+TKGGYSS+IVVHERYC+KIP+NYPLASAAPLLCAGITVY PM RH MNQ
Sbjct  121   TFNGVDTDGTITKGGYSSHIVVHERYCFKIPDNYPLASAAPLLCAGITVYAPMKRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTS+SKKEEAL+ LGAD FV+SSD++QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLHVTVFSTSVSKKEEALSQLGADKFVVSSDQEQMT  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DFLI+TASGD PFD Y++LLKT GTL LVGFPSEVKFSP SLNLGMK I+GS+T
Sbjct  241   ALVKSLDFLIDTASGDHPFDPYMALLKTGGTLVLVGFPSEVKFSPASLNLGMKTISGSLT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++FCA+ +I+P I+IIPIQY  EALERL+KKDVKYRFVIDI  SLK
Sbjct  301   GGTKDTQEMIDFCAAHEIHPMIEIIPIQYATEALERLVKKDVKYRFVIDIENSLK  355



>gb|KCW72665.1| hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis]
 gb|KCW72666.1| hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis]
 gb|KCW72667.1| hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis]
 gb|KCW72668.1| hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis]
Length=354

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/355 (78%), Positives = 314/355 (88%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARDPSG LSPY F+RR VGS+DVS+ I +CGVCYADV WTRN+ G 
Sbjct  1     MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYADVAWTRNVQGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+ LEVQC K +V 
Sbjct  61    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDRLEVQCEK-AVL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFDGIDADGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STSISKKEEAL+LLGAD+FVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSISKKEEALSLLGADHFVISSDVEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TA+GD PFD Y+SLLKT G LALVGFPSEVKFSP SLNL M+ + GS+T
Sbjct  240   AIAKSLDFIIDTAAGDHPFDPYMSLLKTGGILALVGFPSEVKFSPASLNLNMRTVTGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++ CA++KIYP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  300   GGTKDTQEMIDLCAAQKIYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  354



>ref|XP_010056079.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 gb|KCW72664.1| hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis]
Length=369

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/355 (78%), Positives = 314/355 (88%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARDPSG LSPY F+RR VGS+DVS+ I +CGVCYADV WTRN+ G 
Sbjct  16    MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYADVAWTRNVQGH  75

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+ LEVQC K +V 
Sbjct  76    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDRLEVQCEK-AVL  134

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  135   TFDGIDADGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  194

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STSISKKEEAL+LLGAD+FVISSD +QM 
Sbjct  195   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSISKKEEALSLLGADHFVISSDVEQMK  254

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TA+GD PFD Y+SLLKT G LALVGFPSEVKFSP SLNL M+ + GS+T
Sbjct  255   AIAKSLDFIIDTAAGDHPFDPYMSLLKTGGILALVGFPSEVKFSPASLNLNMRTVTGSVT  314

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++ CA++KIYP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  315   GGTKDTQEMIDLCAAQKIYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  369



>ref|XP_011004372.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
 ref|XP_011004373.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
 ref|XP_011004374.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
Length=355

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/355 (77%), Positives = 309/355 (87%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    D+CL WAARDPSGVLSPY FSRR +G DDVSL I +CGVCYADVIW++N HG 
Sbjct  1     MSSESVKDDCLAWAARDPSGVLSPYKFSRRALGKDDVSLKITHCGVCYADVIWSKNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S+YPLVPGHEI GIVKEVGS V  FK GD VGVGTYVNSCRECEYCN+  EV C KGSVF
Sbjct  61    SRYPLVPGHEIAGIVKEVGSSVSNFKAGDHVGVGTYVNSCRECEYCNDKEEVSCEKGSVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DG++TKGGYSSYIVVHERYC++IP+ YPLASAAPL CAGITVY PMMRH MNQ
Sbjct  121   TFNGIDADGSITKGGYSSYIVVHERYCFRIPDGYPLASAAPLFCAGITVYNPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STS+SKKEEAL++L ADNFVI+SD+ QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSVSKKEEALSVLDADNFVITSDQVQMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DF+I+TASGD PFD YLSLLKTAG   LVGFPSEVKFSP SLN+GMK +AGSIT
Sbjct  241   ALYKSLDFIIDTASGDHPFDPYLSLLKTAGVFVLVGFPSEVKFSPASLNIGMKTVAGSIT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGT++ QE+L+FCA+ KIYP I++IPIQY+NEALER++K DVKYRFVIDI  SLK
Sbjct  301   GGTRVIQEMLDFCAANKIYPGIEVIPIQYINEALERMVKNDVKYRFVIDIEKSLK  355



>gb|KCW72659.1| hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis]
Length=354

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/355 (78%), Positives = 313/355 (88%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + ++CLGWAARDPSG+LSPY FSRR VGSDDVS+ I +CGVCYADV WTRN+ G 
Sbjct  1     MSSEGAKEDCLGWAARDPSGLLSPYKFSRRTVGSDDVSIRITHCGVCYADVGWTRNMSGR  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+GLEV C K  V 
Sbjct  61    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDGLEVHCEK-MVL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFDGIDTDGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STSISKKEEAL+LLGAD+F+ISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSISKKEEALSLLGADHFIISSDLEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TA+GD PFD Y+SLLKT G LALVG PSEVKFSP SLNL M+ + GS+T
Sbjct  240   AIAKSLDFIIDTAAGDHPFDPYMSLLKTGGILALVGVPSEVKFSPASLNLNMRTVTGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++ CA +KIYP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  300   GGTKNTQEMIDLCAVQKIYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  354



>ref|XP_010056089.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 ref|XP_010056090.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 ref|XP_010056092.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 ref|XP_010056093.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 gb|KCW72653.1| hypothetical protein EUGRSUZ_E01110 [Eucalyptus grandis]
 gb|KCW72654.1| hypothetical protein EUGRSUZ_E01110 [Eucalyptus grandis]
Length=354

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/355 (77%), Positives = 314/355 (88%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARDPSG LSPY F+RR VGS+DVS+ I +CGVCYADV WTRN+ G 
Sbjct  1     MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYADVAWTRNVQGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+ LE QC K +V 
Sbjct  61    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDRLETQCEK-AVL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IV+HERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFDGIDADGTVTKGGYSSHIVIHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTSISKKEEAL+LLGAD+FVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSISKKEEALSLLGADHFVISSDLEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TA+GD PFD Y+SLLKT G LALVGF SEVKFSP SLNL M+ ++GS+T
Sbjct  240   AIAKSLDFIIDTAAGDHPFDPYMSLLKTGGILALVGFLSEVKFSPASLNLNMRTVSGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++ CA++KIYP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  300   GGTKDTQEMIDLCAAQKIYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  354



>ref|XP_010056081.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 ref|XP_010056082.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 gb|KCW72660.1| hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis]
Length=369

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/355 (78%), Positives = 312/355 (88%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARDPSG LSPY F+RR VGS+DVS+ I +CGVCYADV WTRN+ G 
Sbjct  16    MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYADVAWTRNVQGH  75

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+ LEVQC K SV 
Sbjct  76    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDRLEVQCEK-SVM  134

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  135   TFDGIDADGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  194

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STSISKKEEAL+LLGAD+F+ISSD +QM 
Sbjct  195   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSISKKEEALSLLGADHFIISSDLEQMK  254

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TA+GD PFD Y+SLLKT G LALVG PSEVKFSP SLNL M+ + GS+T
Sbjct  255   AIAKSLDFIIDTAAGDHPFDPYMSLLKTGGILALVGVPSEVKFSPASLNLNMRTVTGSVT  314

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++ CA +KIYP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  315   GGTKNTQEMIDLCAVQKIYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  369



>gb|KCW72661.1| hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis]
 gb|KCW72662.1| hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis]
 gb|KCW72663.1| hypothetical protein EUGRSUZ_E01117 [Eucalyptus grandis]
Length=354

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/355 (78%), Positives = 312/355 (88%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARDPSG LSPY F+RR VGS+DVS+ I +CGVCYADV WTRN+ G 
Sbjct  1     MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYADVAWTRNVQGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+ LEVQC K SV 
Sbjct  61    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDRLEVQCEK-SVM  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFDGIDADGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STSISKKEEAL+LLGAD+F+ISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSISKKEEALSLLGADHFIISSDLEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TA+GD PFD Y+SLLKT G LALVG PSEVKFSP SLNL M+ + GS+T
Sbjct  240   AIAKSLDFIIDTAAGDHPFDPYMSLLKTGGILALVGVPSEVKFSPASLNLNMRTVTGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++ CA +KIYP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  300   GGTKNTQEMIDLCAVQKIYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  354



>ref|XP_009373691.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Pyrus x 
bretschneideri]
 ref|XP_009373692.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Pyrus x 
bretschneideri]
 ref|XP_009373693.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Pyrus x 
bretschneideri]
Length=355

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/355 (77%), Positives = 314/355 (88%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + +NC+G+AARDPSGVLS Y F+RR +G+DDVS+ I +CGVCYADVIW+RN HG 
Sbjct  1     MSSDGANENCVGYAARDPSGVLSHYKFNRRALGADDVSIRITHCGVCYADVIWSRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI G+VKEVGS   RFKVGD VGVGTYVNSCR+CEYCNEGLEV C KGSV+
Sbjct  61    SKYPLVPGHEIAGVVKEVGSNCHRFKVGDHVGVGTYVNSCRDCEYCNEGLEVDCVKGSVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ +D DGT+TKGGYSS+IVV+ERYC+KIP+NYPLASAAPLLCAGITVY PM RH MNQ
Sbjct  121   TFNAVDADGTITKGGYSSHIVVYERYCFKIPDNYPLASAAPLLCAGITVYAPMKRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTV STSISKKEEAL+ LGAD FV+SSD++QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLNVTVLSTSISKKEEALSQLGADKFVVSSDQEQMA  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L KSFDFLI+TASGD PFD Y++LLKT GTLALVGFPSEVKFSP SLNLG K I+GS+T
Sbjct  241   SLVKSFDFLIDTASGDHPFDPYMALLKTGGTLALVGFPSEVKFSPASLNLGRKAISGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++FCA++ I+P I+IIPIQY  EALERL+KKDVKYRFVIDI  SLK
Sbjct  301   GGTKDTQEMIDFCAAQGIHPMIEIIPIQYATEALERLVKKDVKYRFVIDIESSLK  355



>ref|XP_006377874.1| hypothetical protein POPTR_0011s15130g [Populus trichocarpa]
 ref|XP_006377875.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
 ref|XP_006377876.1| hypothetical protein POPTR_0011s15130g [Populus trichocarpa]
 gb|ERP55671.1| hypothetical protein POPTR_0011s15130g [Populus trichocarpa]
 gb|ERP55672.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|ERP55673.1| hypothetical protein POPTR_0011s15130g [Populus trichocarpa]
Length=354

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/355 (77%), Positives = 310/355 (87%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    D+CL WAA DPSGVLSPY FSRR +G DDVSL I +CGVCYADVIW++N HG 
Sbjct  1     MSSEGVKDDCLAWAAGDPSGVLSPYKFSRRALGKDDVSLKITHCGVCYADVIWSKNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S+YPLVPGHEI GIVKEVGS V  FKVGD VGVGTYVNSCRECE+CN+  EV C KGSVF
Sbjct  61    SRYPLVPGHEIAGIVKEVGSSVSNFKVGDHVGVGTYVNSCRECEHCNDKEEVSCEKGSVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DG++TKGGYSSYIVVHERYC++IP+ YPLASAAPLLCAGITVY PMMRH MNQ
Sbjct  121   TFNGIDADGSITKGGYSSYIVVHERYCFRIPDGYPLASAAPLLCAGITVYNPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STS+SKKEEAL++LGADNFVI+SD+ QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSVSKKEEALSVLGADNFVITSDQAQMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DF+I+TASGD PFD YL LLKTAG   LVGFPSEVKFSP SLN+GMK +AGSIT
Sbjct  241   ALYKSLDFIIDTASGDHPFDPYL-LLKTAGVFVLVGFPSEVKFSPASLNIGMKTVAGSIT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGT++ QE+L+FCA+ KIYP I++IPIQY+NEALER++K DVKYRFVIDI  SLK
Sbjct  300   GGTRVIQEMLDFCAANKIYPGIEVIPIQYINEALERMVKNDVKYRFVIDIENSLK  354



>ref|XP_010056074.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 gb|KCW72649.1| hypothetical protein EUGRSUZ_E01105 [Eucalyptus grandis]
Length=354

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/355 (78%), Positives = 315/355 (89%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + ++CLGWAARDPSG+LSPY FSRR VGSDDVS+ I +CGVC+ADV  TRN+ G 
Sbjct  1     MSSDGAKEDCLGWAARDPSGLLSPYKFSRRTVGSDDVSIRITHCGVCHADVGRTRNMAGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+GLEV C K  V 
Sbjct  61    SKYPLVPGHEIVGIVKQVGSNVQRFKVGDHVGVGTYVNSCRECEYCNDGLEVHCEK-MVL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFD ID+DGTVTKGGYSS+IVVHERYC+ IPEN PLASAAPLLCAGITVYTPMMRH MNQ
Sbjct  120   TFDRIDMDGTVTKGGYSSHIVVHERYCFTIPENLPLASAAPLLCAGITVYTPMMRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTSISK+EEAL+LLGAD+FV+SSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSISKREEALSLLGADHFVVSSDPEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS  F+I+TA+GD PFD Y+SLLKT G LALVGF  EVKFSP SLN+GMK ++GS+T
Sbjct  240   AMAKSLHFIIDTAAGDHPFDPYMSLLKTGGVLALVGFSREVKFSPASLNIGMKTVSGSLT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE+++FCA++KIYP I++IPI YVNEALERLIKKDVKYRFVIDI  SLK
Sbjct  300   GGTKDIQEMIDFCAAQKIYPNIEVIPIDYVNEALERLIKKDVKYRFVIDIENSLK  354



>ref|NP_177412.1| cinnamyl-alcohol dehydrogenase [Arabidopsis thaliana]
 sp|Q9CAI3.1|CADH1_ARATH RecName: Full=Probable cinnamyl alcohol dehydrogenase 1; Short=AtCAD1 
[Arabidopsis thaliana]
 gb|AAG51850.1|AC010926_13 putative cinnamyl-alcohol dehydrogenase; 49641-51171 [Arabidopsis 
thaliana]
 gb|AAO00800.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP40269.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAP68279.1| At1g72680 [Arabidopsis thaliana]
 gb|AEE35360.1| cinnamyl-alcohol dehydrogenase [Arabidopsis thaliana]
Length=355

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/356 (78%), Positives = 312/356 (88%), Gaps = 2/356 (1%)
 Frame = -2

Query  1315  MASSHSTDN-CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             M+SS S +N C+ WAARDPSG+LSP+  +RR V +DDVSL I +CGVCYADVIW+RN HG
Sbjct  1     MSSSESVENECMCWAARDPSGLLSPHTITRRSVTTDDVSLTITHCGVCYADVIWSRNQHG  60

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              SKYPLVPGHEI GIV +VG  VQRFKVGD VGVGTYVNSCRECEYCNEG EV C+KG V
Sbjct  61    DSKYPLVPGHEIAGIVTKVGPNVQRFKVGDHVGVGTYVNSCRECEYCNEGQEVNCAKG-V  119

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FTF+GID DG+VTKGGYSS+IVVHERYCYKIP +YPL SAAPLLCAGITVY PMMRHNMN
Sbjct  120   FTFNGIDHDGSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGITVYAPMMRHNMN  179

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             QPGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGA+NFVISSD  QM
Sbjct  180   QPGKSLGVIGLGGLGHMAVKFGKAFGLSVTVFSTSISKKEEALNLLGAENFVISSDHDQM  239

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              AL KS DFL++TASGD  FD Y+SLLK AGT  LVGFPSE+K SP +LNLGM+ +AGS+
Sbjct  240   KALEKSLDFLVDTASGDHAFDPYMSLLKIAGTYVLVGFPSEIKISPANLNLGMRMLAGSV  299

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK+TQ++L+FCA+ KIYP I++IPIQ +NEALER++KKD+KYRFVIDI  SLK
Sbjct  300   TGGTKITQQMLDFCAAHKIYPNIEVIPIQKINEALERVVKKDIKYRFVIDIKNSLK  355



>ref|XP_010416031.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Camelina 
sativa]
Length=356

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/356 (78%), Positives = 309/356 (87%), Gaps = 1/356 (0%)
 Frame = -2

Query  1315  MASSHSTDN-CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             M+SS S +N C+ WAARDPSG+LSP+  +RR V +DDVSL I +CGVCYADVIWTRN HG
Sbjct  1     MSSSESGENECMCWAARDPSGLLSPHTITRRSVANDDVSLKITHCGVCYADVIWTRNKHG  60

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              SKYPLVPGHEI GIV +VGS V  FKVGD VGVGTYVNSCRECEYCNEG EV C+KG V
Sbjct  61    DSKYPLVPGHEIAGIVTKVGSNVHGFKVGDHVGVGTYVNSCRECEYCNEGQEVSCAKGQV  120

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FTF+GID DG+VTKGGYSS+IVVHERYCYKIP +YPL SAAPLLCAGITVY PMMRH+MN
Sbjct  121   FTFNGIDHDGSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGITVYAPMMRHHMN  180

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             QPGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGA NFVISSD  QM
Sbjct  181   QPGKSLGVIGLGGLGHMAVKFGKAFGLNVTVFSTSISKKEEALNLLGATNFVISSDHDQM  240

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
               L KS DF+I+TASGD  FD Y+SLLK AGT  LVGFPSE+K SP +LNLGM+ +AGS+
Sbjct  241   KGLEKSLDFIIDTASGDHAFDPYMSLLKIAGTYVLVGFPSEIKISPANLNLGMRMLAGSL  300

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK+TQE+L+FCA+ KIYP I++IPIQ +NEALER++KKDVKYRFVIDI  SLK
Sbjct  301   TGGTKITQEMLDFCAAHKIYPNIEVIPIQKINEALERVVKKDVKYRFVIDIQNSLK  356



>ref|XP_002518961.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF43494.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=358

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/354 (75%), Positives = 309/354 (87%), Gaps = 0/354 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CL WAARDPSGVLSPY FSRR VG DD+SL I +CG+CYAD IWTRN HG 
Sbjct  1     MSSQSVKEDCLAWAARDPSGVLSPYKFSRRAVGEDDISLKITHCGICYADFIWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVG+VKEVGS V RFK GD VGVGTYVNSC++C+YCN+  EV C KGSV 
Sbjct  61    SKYPLVPGHEIVGVVKEVGSSVTRFKAGDRVGVGTYVNSCKDCDYCNDRQEVYCVKGSVL  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ ID+DGTVTKGGYSS++VVHERYC++IP +YP A AAPLLCAGITVY PMMRH MNQ
Sbjct  121   TFNAIDMDGTVTKGGYSSHLVVHERYCFRIPNDYPSALAAPLLCAGITVYNPMMRHGMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGK+LGVIGLGGLGH+AVKFGKAFGLKVTVFSTSISKKEEAL++L ADNFV+SSD++QM 
Sbjct  181   PGKALGVIGLGGLGHMAVKFGKAFGLKVTVFSTSISKKEEALSVLDADNFVVSSDQEQMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A S S DF+++TASGD PFD Y+SLLKTAG L LVGFPSEVKFSP SLNLGMK ++GSIT
Sbjct  241   AFSNSLDFIVDTASGDHPFDPYMSLLKTAGVLVLVGFPSEVKFSPASLNLGMKTVSGSIT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GGT++TQE+L+FCA+ KIYP+I+++PI Y N ALERL+K+DVKYRFVIDI  SL
Sbjct  301   GGTQVTQEMLDFCAAHKIYPKIELVPIDYANAALERLVKRDVKYRFVIDIENSL  354



>ref|XP_010471299.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Camelina 
sativa]
Length=356

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/356 (77%), Positives = 310/356 (87%), Gaps = 1/356 (0%)
 Frame = -2

Query  1315  MASSHSTDN-CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             M+SS S +N C+ WAARDPSG+LSP+  +RR V +DDVSL I +CGVCYADVIWTRN HG
Sbjct  1     MSSSESGENECMCWAARDPSGLLSPHTITRRSVANDDVSLKITHCGVCYADVIWTRNKHG  60

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              SKYPLVPGHEI GIV +VGS V  FKVGD VGVGTYVNSCRECEYCN+G EV C+KG V
Sbjct  61    DSKYPLVPGHEIAGIVTKVGSNVHGFKVGDHVGVGTYVNSCRECEYCNDGQEVSCAKGQV  120

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FTF+GID DG+VTKGGYS++IVVHERYCYKIP +YPL SAAPLLCAGITVY PMMRH+MN
Sbjct  121   FTFNGIDHDGSVTKGGYSNHIVVHERYCYKIPVDYPLESAAPLLCAGITVYAPMMRHHMN  180

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             QPGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGA NFVISSD  QM
Sbjct  181   QPGKSLGVIGLGGLGHMAVKFGKAFGLNVTVFSTSISKKEEALNLLGATNFVISSDHDQM  240

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              AL KS DF+I+TASGD  FD Y+SLLK AGT  LVGFPSE+K SP +LNLGM+ +AGS+
Sbjct  241   KALEKSLDFIIDTASGDHAFDPYMSLLKIAGTYVLVGFPSEIKISPANLNLGMRMLAGSL  300

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK+TQE+L+FCA+ KIYP I++IPIQ +NEALER++KKDVKYRFVIDI  SLK
Sbjct  301   TGGTKITQEMLDFCAAHKIYPNIEVIPIQKINEALERVVKKDVKYRFVIDIQNSLK  356



>ref|XP_010056080.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
Length=353

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/355 (78%), Positives = 315/355 (89%), Gaps = 2/355 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + ++CLGWAARDPSG+LSPY FSRR VGSDDVS+ I +CGVCYADV WTRN+ G 
Sbjct  1     MSSEGAKEDCLGWAARDPSGLLSPYKFSRRTVGSDDVSIRITHCGVCYADVGWTRNMSGR  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+GLEV C K  V 
Sbjct  61    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDGLEVHCEK-MVL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAG+TVYTPM+RH MNQ
Sbjct  120   TFDGIDTDGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGLTVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTSISKKEEAL+LLGAD+FVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSISKKEEALSLLGADHFVISSDVEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TASG+ PFD Y+S+LKT G LALVG  SEVKFSP SLNL M+ ++GS+T
Sbjct  240   AIAKSLDFIIDTASGNHPFDPYMSVLKTGGILALVG-SSEVKFSPASLNLNMRTVSGSLT  298

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++ CA++KIYP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  299   GGTKDTQEMIDLCAAQKIYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  353



>ref|XP_002888888.1| hypothetical protein ARALYDRAFT_895120 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65147.1| hypothetical protein ARALYDRAFT_895120 [Arabidopsis lyrata subsp. 
lyrata]
Length=355

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/355 (77%), Positives = 313/355 (88%), Gaps = 2/355 (1%)
 Frame = -2

Query  1315  MASSHSTDN-CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             M+SS + +N C+ WAA+DPSG+LSP+ F+RR V SDDVSL I +CGVCYADVIWTRN HG
Sbjct  1     MSSSETGENECMCWAAKDPSGLLSPHKFTRRSVTSDDVSLKITHCGVCYADVIWTRNQHG  60

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              SKYPLVPGHEI GIV +VG  VQRFKVGD VGVGTYVNSCRECEYCN+G EV C+KG V
Sbjct  61    DSKYPLVPGHEIAGIVTKVGPNVQRFKVGDHVGVGTYVNSCRECEYCNDGQEVNCAKG-V  119

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FTF+GID DG+VTKGGYSS+IVVHERYCYKIP +YPL SAAPLLCAGITV+ PMMRHNMN
Sbjct  120   FTFNGIDHDGSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGITVFAPMMRHNMN  179

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             QPGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGA+NFVISSD  QM
Sbjct  180   QPGKSLGVIGLGGLGHMAVKFGKAFGLSVTVFSTSISKKEEALNLLGAENFVISSDHDQM  239

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              AL+KS DF+I+TASGD  FD Y+SLLK AGT  LVGFPSE+K SP +LNLGM+ +AGS+
Sbjct  240   KALAKSLDFIIDTASGDHAFDPYMSLLKIAGTYVLVGFPSEIKISPANLNLGMRMLAGSV  299

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             TGGTK+TQE+++FCA+ KIYP I++IPIQ +NEALER++KKD+KYRFVIDI  SL
Sbjct  300   TGGTKITQEMIDFCAAHKIYPNIEVIPIQNINEALERVVKKDIKYRFVIDIKNSL  354



>gb|KFK41690.1| hypothetical protein AALP_AA2G160200 [Arabis alpina]
Length=352

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/348 (77%), Positives = 305/348 (88%), Gaps = 0/348 (0%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             D CL WAARDPSG+LSP+ F+RR V +DDVS+ I +CGVCYADVIWTRN HG SKYPL+P
Sbjct  5     DECLSWAARDPSGLLSPHTFTRRSVTNDDVSIKITHCGVCYADVIWTRNKHGDSKYPLIP  64

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEI G+V +VGS V RFKVGD VGVGTYVNSCRECEYC+EG EV C KG VFTF+ ID 
Sbjct  65    GHEIAGVVNKVGSNVDRFKVGDHVGVGTYVNSCRECEYCDEGQEVSCVKGQVFTFNAIDY  124

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DG+VTKGGYSS+IVVHERYCYKIP +YPL SAAPLLCAGITVY PM+RHNMNQPGKSLGV
Sbjct  125   DGSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGITVYAPMIRHNMNQPGKSLGV  184

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             IGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGA NFVISSD  QM AL+KS D
Sbjct  185   IGLGGLGHMAVKFGKAFGLDVTVFSTSISKKEEALNLLGAKNFVISSDHDQMKALAKSLD  244

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             F+I+TASGD  FD Y+SLLK AG  ALVGFPSE+K SP +LNLGM+ +AGS++GGTK+TQ
Sbjct  245   FIIDTASGDHAFDPYMSLLKIAGVYALVGFPSEIKISPATLNLGMRMLAGSVSGGTKMTQ  304

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++FCA+ KIYP I++IPIQ +NEALER++KKD+KYRFVIDI  SLK
Sbjct  305   EMIDFCAAHKIYPNIEVIPIQKINEALERVVKKDIKYRFVIDIKNSLK  352



>ref|XP_006390634.1| hypothetical protein EUTSA_v10018769mg [Eutrema salsugineum]
 gb|ESQ27920.1| hypothetical protein EUTSA_v10018769mg [Eutrema salsugineum]
Length=356

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/356 (77%), Positives = 309/356 (87%), Gaps = 1/356 (0%)
 Frame = -2

Query  1315  MASSHST-DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             M+SS S  D CL WAARDPSG+LSP++ +RR V SDDVSL+I +CGVCYADVIWTRN HG
Sbjct  1     MSSSESGGDECLCWAARDPSGLLSPHSLTRRSVTSDDVSLNITHCGVCYADVIWTRNKHG  60

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              SKYPL+PGHEI GIV +VGS V RFKVGD VGVGTYVNSCRECEYC++G E+ C KG V
Sbjct  61    DSKYPLIPGHEIAGIVNKVGSNVHRFKVGDHVGVGTYVNSCRECEYCDQGQEISCVKGQV  120

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FTF+GID DG+VTKGGYSS+IVVHERYCYKIP +YPL SAAPLLCAGITVY PMMRH+MN
Sbjct  121   FTFNGIDYDGSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGITVYAPMMRHSMN  180

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             QPGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGADNFVISSD  QM
Sbjct  181   QPGKSLGVIGLGGLGHMAVKFGKAFGLNVTVFSTSISKKEEALNLLGADNFVISSDHDQM  240

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
               L KS DF+I+TASGD PFD Y+SLLK AGT  LVGFP E+K SP +LNLGM+ +AGS+
Sbjct  241   KGLEKSLDFIIDTASGDHPFDPYMSLLKIAGTYVLVGFPREIKISPVNLNLGMRMLAGSV  300

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK TQE+++FCA+ KIYP I++IPIQ +NEALER++ KD+KYRFVIDI  SLK
Sbjct  301   TGGTKTTQEMIDFCAAHKIYPTIEVIPIQKINEALERVVNKDIKYRFVIDIKNSLK  356



>ref|XP_010428161.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Camelina 
sativa]
Length=356

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/356 (77%), Positives = 309/356 (87%), Gaps = 1/356 (0%)
 Frame = -2

Query  1315  MASSHSTDN-CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             M+SS S +N C+ WAARDPSG+LSP+  +RR V ++DVSL I +CGVCYADVIWTRN HG
Sbjct  1     MSSSESGENECMCWAARDPSGLLSPHTITRRSVTNEDVSLKITHCGVCYADVIWTRNKHG  60

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              SKYPLVPGHEI GIV +VGS V  FKVGD VGVGTYVNSCRECEYCNEG EV C+KG V
Sbjct  61    DSKYPLVPGHEIAGIVTKVGSNVHGFKVGDHVGVGTYVNSCRECEYCNEGQEVSCAKGQV  120

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FTF+GID DG+VTKGGYSS+IVVHERYCYKIP +YPL SAAPLLCAGITVY PMMRH+MN
Sbjct  121   FTFNGIDHDGSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGITVYAPMMRHHMN  180

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             QPGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGA NFVISSD  QM
Sbjct  181   QPGKSLGVIGLGGLGHMAVKFGKAFGLNVTVFSTSISKKEEALNLLGATNFVISSDHDQM  240

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
               L KS DF+++TASGD  FD Y+SLLK AGT  LVGFPSE+K SP +LNLGM+ +AGS+
Sbjct  241   KGLEKSLDFIVDTASGDHAFDPYMSLLKIAGTYVLVGFPSEIKISPANLNLGMRMLAGSL  300

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK+TQE+L+FCA+ KIYP I++IPIQ +NEALER++KKDVKYRFVIDI  SLK
Sbjct  301   TGGTKITQEMLDFCAAHKIYPNIEVIPIQKINEALERVVKKDVKYRFVIDIQNSLK  356



>ref|XP_010056083.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 gb|KCW72658.1| hypothetical protein EUGRSUZ_E01115 [Eucalyptus grandis]
Length=353

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/355 (77%), Positives = 313/355 (88%), Gaps = 2/355 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + ++CLGWAARDPSG LSPY FSRR VGSDDVS+ I +CGVCYADV WTRN+ GT
Sbjct  1     MSSEGAKEDCLGWAARDPSGRLSPYKFSRRTVGSDDVSIRITHCGVCYADVAWTRNMSGT  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+GLEV C K  V 
Sbjct  61    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDGLEVHCEK-MVL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFD ID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFDRIDTDGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTSISKKEEAL+LLGAD+FVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSISKKEEALSLLGADHFVISSDVEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TA+G+ PFD Y+S+LKT G LALVG  SEVKFSP SLN  M+ ++GS+T
Sbjct  240   AIAKSLDFIIDTAAGNHPFDPYMSVLKTGGILALVG-SSEVKFSPASLNHHMRTVSGSLT  298

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++ CA++KIYP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  299   GGTKDTQEMIDLCAAQKIYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  353



>ref|XP_004145884.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like [Cucumis 
sativus]
 gb|KGN49954.1| hypothetical protein Csa_5G146280 [Cucumis sativus]
Length=355

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/355 (76%), Positives = 308/355 (87%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S +S ++CLGWAARD SG LSPY F+RRV G DDVS+ I +CGVCYADV+WTRN  G 
Sbjct  1     MGSHNSGEDCLGWAARDSSGFLSPYKFNRRVPGDDDVSITITHCGVCYADVVWTRNKLGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI GIVK VG+ VQRFKVGD VGVGTYVNSCR+CEYC +  EV C+ G   
Sbjct  61    SKYPLVPGHEIAGIVKNVGANVQRFKVGDHVGVGTYVNSCRQCEYCEDCQEVSCTSGCTH  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ IDVDGTVTKGGYS+YIVVHERYCYKIP+NYPLASAAPLLCAGITVY+PM+RHNMNQ
Sbjct  121   TFNSIDVDGTVTKGGYSNYIVVHERYCYKIPDNYPLASAAPLLCAGITVYSPMIRHNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTSISKKEEAL +LGAD FV+SSD KQM 
Sbjct  181   PGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSISKKEEALGVLGADKFVVSSDNKQME  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +LSKS DF+I+ ASGD PFD Y+S LKT G + LVGFPS+VKF+P SL LGM+ I+GS+T
Sbjct  241   SLSKSLDFIIDAASGDHPFDPYMSTLKTGGVMVLVGFPSQVKFNPASLILGMRTISGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTKLTQE+++FCA+  IYP I++IPIQY NEA+ER++KKDVKYRFVIDI GSLK
Sbjct  301   GGTKLTQEMIDFCAAHGIYPNIEVIPIQYSNEAIERVMKKDVKYRFVIDIEGSLK  355



>ref|XP_009105931.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Brassica 
rapa]
Length=361

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/353 (75%), Positives = 307/353 (87%), Gaps = 0/353 (0%)
 Frame = -2

Query  1309  SSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSK  1130
             SS   D CL WAARDPSG+LSP+ F+RR V SDDVSL I +CGVCYADVIWT+N HG SK
Sbjct  9     SSSGGDECLSWAARDPSGLLSPHTFTRRSVTSDDVSLKITHCGVCYADVIWTKNKHGDSK  68

Query  1129  YPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTF  950
             YPLVPGHEI G+V +VGS V RFKVGD VGVGT+VNSCREC+YC+EG EV C KG VFTF
Sbjct  69    YPLVPGHEIAGVVNKVGSNVTRFKVGDHVGVGTFVNSCRECDYCDEGQEVSCVKGQVFTF  128

Query  949   DGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPg  770
             +G+D DG+VTKGGYSS+IVVHERYCYKIP +YPL SAAPLLCAG+TVY PM+RH+MNQPG
Sbjct  129   NGVDYDGSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGVTVYAPMVRHSMNQPG  188

Query  769   kslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMAL  590
             KSLGV+GLGGLGH+AVKFGKAFGL VTVFSTS+SKKEEALNLLGA+NFVISSD  QM AL
Sbjct  189   KSLGVVGLGGLGHMAVKFGKAFGLHVTVFSTSVSKKEEALNLLGANNFVISSDHDQMKAL  248

Query  589   SKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGG  410
             +KS DF+I+TASGD  FD Y+SLLK AGT  LVGFPSE+K  P +LNLGM+ +AGS++GG
Sbjct  249   AKSLDFIIDTASGDHAFDPYMSLLKIAGTYVLVGFPSEIKIQPATLNLGMRVLAGSVSGG  308

Query  409   TKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TK+TQE+++FCA+ KIYP I++IPIQ  NEA+ER++KKD+KYRFVIDI  SLK
Sbjct  309   TKVTQEMIDFCAAHKIYPNIEVIPIQKANEAIERVVKKDIKYRFVIDIENSLK  361



>ref|XP_010680026.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/354 (75%), Positives = 309/354 (87%), Gaps = 1/354 (0%)
 Frame = -2

Query  1312  ASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTS  1133
             A+  +  NCLGWAARDPSGVLSPY F+RR V +DDVS+ I +CGVCYADV+WT+N+H  S
Sbjct  5     ATETANANCLGWAARDPSGVLSPYEFNRRAVAADDVSIKITHCGVCYADVVWTKNLHRDS  64

Query  1132  KYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFT  953
             KYP+VPGHEIVGIVKEVG  V RFKVGD VGVGT+VNSCR+CE+CNEG+EV C+KG VFT
Sbjct  65    KYPVVPGHEIVGIVKEVGPNVNRFKVGDHVGVGTFVNSCRDCEHCNEGVEVICAKG-VFT  123

Query  952   FDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQP  773
             F+G+D DGT+TKGGYSS+IV HERYCYKIP+NYP   AAPLLCAG+TVY+PM+RHNMNQP
Sbjct  124   FNGVDADGTITKGGYSSFIVTHERYCYKIPDNYPSHLAAPLLCAGVTVYSPMIRHNMNQP  183

Query  772   gkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMA  593
             GKSLGVIGLGGLGH+AV FGKAFGLKVTVFSTSISKKEEALNLLGA NFVISSDE+QM A
Sbjct  184   GKSLGVIGLGGLGHMAVLFGKAFGLKVTVFSTSISKKEEALNLLGAHNFVISSDEQQMKA  243

Query  592   LSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITG  413
              S S DF+I+TASGD  FD YL LLKT GT  LVGFP EVKFSP +L  GMK  +GS+TG
Sbjct  244   FSGSLDFIIDTASGDHQFDPYLQLLKTYGTYVLVGFPREVKFSPANLLPGMKTFSGSVTG  303

Query  412   GTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GTK+TQE+LEFCA++K+YP++++IPI Y NEA+ERL+K+DVKYRFVIDI  SLK
Sbjct  304   GTKVTQEMLEFCAAKKVYPKVEVIPITYANEAIERLLKRDVKYRFVIDIENSLK  357



>ref|XP_004309500.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like [Fragaria 
vesca subsp. vesca]
Length=352

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/347 (77%), Positives = 307/347 (88%), Gaps = 0/347 (0%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
             NC+G+AARDPSGVLS Y FSRR +G+DDVS+ I +CGVCYADV WTRN  G SKYPLVPG
Sbjct  6     NCIGYAARDPSGVLSHYEFSRRDLGTDDVSIRITHCGVCYADVSWTRNKLGDSKYPLVPG  65

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEI GIVKEVGS VQRFKVGD VGVGTYVNSCR+C YCN+GLEVQC KGSVFTF+G+D D
Sbjct  66    HEIAGIVKEVGSNVQRFKVGDHVGVGTYVNSCRDCVYCNDGLEVQCVKGSVFTFNGVDAD  125

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+TKGGYSS+IVVH+RYCY IP+NYPLASAAPLLCAGITVY PMMRH MNQPGKSLGVI
Sbjct  126   GTITKGGYSSHIVVHDRYCYNIPDNYPLASAAPLLCAGITVYAPMMRHKMNQPGKSLGVI  185

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKFGKAFGL VTVFSTSISKKEEAL+ LGAD FV+SSD++QM  L KS DF
Sbjct  186   GLGGLGHMAVKFGKAFGLSVTVFSTSISKKEEALSQLGADKFVLSSDQEQMKGLVKSLDF  245

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQE  392
             +++TASGD PFD Y++LLKT+G L LVGFPSEVKFSP SL LGM+ ++GS+TGGTK TQE
Sbjct  246   IVDTASGDHPFDPYMALLKTSGILVLVGFPSEVKFSPASLILGMRTVSGSVTGGTKDTQE  305

Query  391   LLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +++FCA+  I+P I++IPIQY NEA++RL K+DVKYRFVIDI  SLK
Sbjct  306   MIDFCAAHGIHPMIEVIPIQYANEAIDRLTKRDVKYRFVIDIENSLK  352



>ref|XP_004162965.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like [Cucumis 
sativus]
Length=355

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/355 (76%), Positives = 308/355 (87%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S +S ++CLGWAARD SG LSPY F+RRV G DDVS+ I +CG+CYADV+WTRN  G 
Sbjct  1     MGSHNSGEDCLGWAARDSSGFLSPYKFNRRVPGDDDVSITITHCGICYADVVWTRNKLGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI GIVK VG+ VQRFKVGD VGVGTYVNSCR+CEYC +  EV C+ G   
Sbjct  61    SKYPLVPGHEIAGIVKNVGANVQRFKVGDHVGVGTYVNSCRQCEYCEDCQEVSCTSGCTH  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ IDVDGTVTKGGYS+YIVVHERYCYKIP+NYPLASAAPLLCAGITVY+PM+RHNMNQ
Sbjct  121   TFNSIDVDGTVTKGGYSNYIVVHERYCYKIPDNYPLASAAPLLCAGITVYSPMIRHNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTSISKKEEAL +LGAD FV+SSD KQM 
Sbjct  181   PGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSISKKEEALGVLGADKFVVSSDNKQME  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +LSKS DF+I+ ASGD PFD Y+S LKT G + LVGFPS+VKF+P SL LGM+ I+GS+T
Sbjct  241   SLSKSLDFIIDAASGDHPFDPYMSTLKTGGVMVLVGFPSQVKFNPASLILGMRTISGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTKLTQE+++FCA+  IYP I++IPIQY NEA+ER++KKDVKYRFVIDI GSL+
Sbjct  301   GGTKLTQEMIDFCAAHGIYPNIEVIPIQYSNEAIERVMKKDVKYRFVIDIEGSLE  355



>ref|XP_008437476.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Cucumis 
melo]
Length=355

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/355 (75%), Positives = 304/355 (86%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  S ++CLGWAARD SG LSPY F+RRV+G DDVS+ I +CG+CYADV+WTRN  G 
Sbjct  1     MGSQDSGEDCLGWAARDSSGFLSPYKFNRRVLGDDDVSITITHCGICYADVVWTRNKLGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI GIVK VG+ VQRFKVGD VGVGTYVNSCR+CEYC +  EV C+ G   
Sbjct  61    SKYPLVPGHEIAGIVKNVGANVQRFKVGDHVGVGTYVNSCRQCEYCEDCQEVSCTSGCTH  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ ID DGT+TKGGYS+YIVVHERYCYKIP+NYPLASAAPLLCAGITVY+PM+RHNMNQ
Sbjct  121   TFNSIDFDGTITKGGYSNYIVVHERYCYKIPDNYPLASAAPLLCAGITVYSPMIRHNMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTSISKKEEAL++LGAD FV+SSD KQM 
Sbjct  181   PGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSISKKEEALSVLGADKFVLSSDNKQME  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             ALSKS DF+I+ ASGD PFD Y+S LK  G + LVGFPSEVKF P SL LGM+ I+GS+T
Sbjct  241   ALSKSLDFIIDAASGDHPFDPYMSTLKVGGVMVLVGFPSEVKFIPASLILGMRTISGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTKLTQE+++FCA+  IYP I++IPIQY NEA+ER+ K DVKYRFVIDI GSLK
Sbjct  301   GGTKLTQEMIDFCAAHGIYPNIEVIPIQYSNEAIERVTKNDVKYRFVIDIEGSLK  355



>ref|XP_010056069.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 gb|KCW72647.1| hypothetical protein EUGRSUZ_E01103 [Eucalyptus grandis]
Length=355

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/355 (79%), Positives = 314/355 (88%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARDPSG+LSPY FSRR VG DDVS+ I +CGVCYADV+WTRN HG 
Sbjct  1     MSSEGVKEDCLGWAARDPSGLLSPYKFSRRTVGRDDVSIRITHCGVCYADVVWTRNEHGN  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVKEVG  VQRFKVGD VGVGTYVNSCRECEYCN+ LE  C KG V 
Sbjct  61    SKYPLVPGHEIVGIVKEVGCSVQRFKVGDRVGVGTYVNSCRECEYCNDRLENYCEKGPVS  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFD ID DGTVTKGGYSSYIVVHERYC+KIPE YPLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  121   TFDAIDADGTVTKGGYSSYIVVHERYCFKIPETYPLALAAPLLCAGITVYTPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTSISKKEEAL+LLGAD+FVISSD +Q+ 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSISKKEEALSLLGADHFVISSDPEQIK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TASGD PFD Y+SLLKT G LALVG+PSEVKFSP SLNLGM+ ++GS T
Sbjct  241   AMAKSLDFIIDTASGDHPFDNYMSLLKTGGILALVGYPSEVKFSPASLNLGMRTVSGSKT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE+++FCA++KIYP+I++IPI Y N+ALERLIK+DVKYRFVIDI  SLK
Sbjct  301   GGTKDIQEMIDFCAAQKIYPKIELIPIDYANKALERLIKRDVKYRFVIDIENSLK  355



>ref|XP_007148346.1| hypothetical protein PHAVU_006G200600g [Phaseolus vulgaris]
 ref|XP_007148347.1| hypothetical protein PHAVU_006G200600g [Phaseolus vulgaris]
 ref|XP_007148348.1| hypothetical protein PHAVU_006G200600g [Phaseolus vulgaris]
 gb|ESW20340.1| hypothetical protein PHAVU_006G200600g [Phaseolus vulgaris]
 gb|ESW20341.1| hypothetical protein PHAVU_006G200600g [Phaseolus vulgaris]
 gb|ESW20342.1| hypothetical protein PHAVU_006G200600g [Phaseolus vulgaris]
Length=357

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/355 (74%), Positives = 307/355 (86%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    + CLGWAARD SGVLSPY FSRR +G++DV + I +CGVCYADV+WTRN HG 
Sbjct  1     MSSKGGDEQCLGWAARDASGVLSPYKFSRRNLGTEDVHIKITHCGVCYADVVWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYP+VPGHEI GIV +VG+ V  FKVGD VGVGTYVNSCR+CEYCNE  EV CSKGSVF
Sbjct  61    SKYPVVPGHEIAGIVTKVGTNVHSFKVGDHVGVGTYVNSCRDCEYCNEKQEVLCSKGSVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGT+TKGGYSSYIVVHERYC+ IP+ YPLASAAPLLCAG+TVY+PM+RH MNQ
Sbjct  121   TFNGVDFDGTITKGGYSSYIVVHERYCFTIPKGYPLASAAPLLCAGVTVYSPMVRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VT+FSTSISKKEEAL+LLGAD FV+SS++++M 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLSVTIFSTSISKKEEALSLLGADKFVLSSNQEEMR  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL+KS DF+I+TASGD PFD Y+SLLK  G   LVGFPSEVKFSP SLN+G K +AGSIT
Sbjct  241   ALAKSLDFIIDTASGDHPFDPYMSLLKPYGVFVLVGFPSEVKFSPASLNIGSKTVAGSIT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++FCA+  I+P I++IPI+Y NEALERLI +DVKYRFVIDI  SLK
Sbjct  301   GGTKDTQEMIDFCAANDIHPSIEVIPIEYANEALERLINRDVKYRFVIDIENSLK  355



>ref|XP_010518748.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Tarenaya 
hassleriana]
 ref|XP_010518762.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Tarenaya 
hassleriana]
Length=351

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/348 (75%), Positives = 304/348 (87%), Gaps = 0/348 (0%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             ++C+GWAARD SG+LSPY+F+RR V +DDVS+ I +CGVCYADVIWTRN HG SKYPLVP
Sbjct  4     EDCVGWAARDSSGLLSPYSFTRRSVNNDDVSVAITHCGVCYADVIWTRNKHGDSKYPLVP  63

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEI GIVK+VGS V RFKVGD VGVGTYVNSCR+CEYCNEG EV C +G VFTF+ ID 
Sbjct  64    GHEIAGIVKQVGSNVHRFKVGDHVGVGTYVNSCRQCEYCNEGEEVSCVEGRVFTFNAIDA  123

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DG+VTKGGYSS+I+VHERYCYKIP +YPLASAAPLLCAGITVY PM+RH+MNQPGK LGV
Sbjct  124   DGSVTKGGYSSHIIVHERYCYKIPMDYPLASAAPLLCAGITVYAPMIRHHMNQPGKLLGV  183

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             IGLGGLGH+AVKFGKAFGL VTVFSTS SKKEEALNLLGAD F++SSD+ QM    KS D
Sbjct  184   IGLGGLGHMAVKFGKAFGLNVTVFSTSPSKKEEALNLLGADKFIVSSDQDQMKTQEKSLD  243

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             F+I+TASGD PFD Y+SLLK AG   LVGFPSE++ SP SLNL  + +AGS TGGTK+TQ
Sbjct  244   FIIDTASGDHPFDPYMSLLKIAGIYVLVGFPSEIRISPASLNLDRRMLAGSSTGGTKVTQ  303

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++FCA++KIYP+I++IPIQ +N+ALERL+K+DVKYRFVIDI  SLK
Sbjct  304   EMIDFCAAQKIYPKIELIPIQEINKALERLVKRDVKYRFVIDIESSLK  351



>ref|XP_008783561.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Phoenix 
dactylifera]
Length=355

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/355 (74%), Positives = 302/355 (85%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M +   + +CL WAARD SG+LSPY F+RRVV SDDV ++I +CGVCYADV WTRN HG 
Sbjct  1     MDTDTGSRDCLAWAARDASGILSPYRFNRRVVRSDDVRIEITHCGVCYADVHWTRNAHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI G+V EVGS V+RFKVGD  GVGTYVNSC ECEYCN+ LEV CSKG +F
Sbjct  61    SKYPLVPGHEIAGVVMEVGSNVKRFKVGDHAGVGTYVNSCGECEYCNDFLEVHCSKGQIF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGT+TKGGYSSYI+V ERYCY IP+ YPLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  121   TFNGLDSDGTITKGGYSSYIIVKERYCYMIPDGYPLAKAAPLLCAGITVYTPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PG+SLGVIGLGGLGH+AVKF KAFGLKVTVFSTS SKKEEAL LLGAD FVISSD++QM 
Sbjct  181   PGRSLGVIGLGGLGHMAVKFAKAFGLKVTVFSTSESKKEEALKLLGADKFVISSDKQQME  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +++KS DF+I+TASGD PFD Y+SLLK  G L LV FPSEV+  PGSLNLG + I+GS+T
Sbjct  241   SMTKSLDFIIDTASGDHPFDPYMSLLKVGGVLVLVSFPSEVRMHPGSLNLGSRSISGSLT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQ +LEFCA+ KIYPEI++I IQY+NEALERL+ +DVKYRFVIDI  SLK
Sbjct  301   GGTKETQAMLEFCAANKIYPEIELINIQYINEALERLVNRDVKYRFVIDIKNSLK  355



>gb|ABK21056.1| unknown [Picea sitchensis]
Length=356

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/347 (75%), Positives = 303/347 (87%), Gaps = 0/347 (0%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             +NC GWAARDPSGVLSPY F+RRV G DD+SL I +CGVCYADV+WTRN HG SKYPLVP
Sbjct  9     ENCKGWAARDPSGVLSPYQFNRRVPGLDDISLKITHCGVCYADVVWTRNKHGDSKYPLVP  68

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEIVGIVKEVG  V  FK GD VGVGTYV+SC++CEYCNE +EV C KGSVFTF+GIDV
Sbjct  69    GHEIVGIVKEVGINVVSFKAGDHVGVGTYVSSCQQCEYCNERMEVNCEKGSVFTFNGIDV  128

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGTVTKGGYSS+IVVH+RYC+KIP+N PLASAAPLLCAGITVY+PM+RH+MN  GKSLGV
Sbjct  129   DGTVTKGGYSSHIVVHQRYCFKIPDNLPLASAAPLLCAGITVYSPMIRHHMNHAGKSLGV  188

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             IGLGGLGH+AVKFGKAFGL VT+FSTS SKK+EALN+LGAD F++SSD+ Q+ A SK+ D
Sbjct  189   IGLGGLGHMAVKFGKAFGLNVTIFSTSASKKDEALNILGADKFIVSSDKDQIEASSKTLD  248

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             F+I+TASGD P DLY+ LLKTAG   +VGFPSE+K  P +L +GMK IAGS+TGGTK TQ
Sbjct  249   FIIDTASGDHPIDLYMPLLKTAGVFVIVGFPSEIKIHPANLIIGMKSIAGSVTGGTKDTQ  308

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+L+FCA  ++YP+I++IPIQYVNEALER+I KDVKYRFVIDI  SL
Sbjct  309   EMLDFCAKERVYPDIEVIPIQYVNEALERMINKDVKYRFVIDIENSL  355



>ref|XP_003545737.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like isoform 
X1 [Glycine max]
 ref|XP_006597369.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like isoform 
X2 [Glycine max]
 gb|KHN33575.1| Putative cinnamyl alcohol dehydrogenase 1 [Glycine soja]
Length=357

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/355 (74%), Positives = 309/355 (87%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARD SGVLSPY FSRR  G++DV + I +CGVC+ADV+WTRN HG 
Sbjct  1     MSSKGVGEDCLGWAARDASGVLSPYKFSRRTPGNEDVLIKITHCGVCFADVVWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYP+VPGHEI GIV +VGS V RFKVGD VGVGTYVNSCR+CE+CN+  EV C+KGSVF
Sbjct  61    SKYPVVPGHEIAGIVTKVGSNVHRFKVGDHVGVGTYVNSCRDCEHCNDREEVHCTKGSVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGT+TKGGYSSYIVVHERYC+ IP++Y LASAAPLLCAGITVY+PM+RH MNQ
Sbjct  121   TFNGVDFDGTITKGGYSSYIVVHERYCFTIPKSYALASAAPLLCAGITVYSPMVRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEAL+LLGAD FV+SS++++M 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLSVTVFSTSISKKEEALSLLGADKFVVSSNQEEMT  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL+KS DF+I+TASGD PFD Y+SLLKT G   LVGFPS+VKFSP SLN+G K +AGS+T
Sbjct  241   ALAKSLDFIIDTASGDHPFDPYMSLLKTYGVFVLVGFPSQVKFSPASLNIGSKTVAGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE+++FCA+ +I+P I++IPI+Y NEALERLI +DVKYRFVIDI  SLK
Sbjct  301   GGTKDIQEMIDFCAANEIHPNIEVIPIEYANEALERLINRDVKYRFVIDIENSLK  355



>ref|XP_006476239.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like [Citrus 
sinensis]
Length=354

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/355 (78%), Positives = 311/355 (88%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  ++ +CLGWAARDPSGVLSPY+F+RR VGSDDVS+ I +CGVCYADVIWTRN HG 
Sbjct  1     MTSETASKDCLGWAARDPSGVLSPYSFNRRAVGSDDVSITITHCGVCYADVIWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVKEVG  V RFKVGD VGVGTYVNSCR+C+YCN+GLEV C++ SV+
Sbjct  61    SKYPLVPGHEIVGIVKEVGHNVSRFKVGDHVGVGTYVNSCRDCKYCNDGLEVHCAR-SVY  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ ID DGT+TKGGYSSYIVVHERYCYKI  +YPLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  120   TFNAIDADGTITKGGYSSYIVVHERYCYKIANDYPLALAAPLLCAGITVYTPMMRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKS+GVIGLGGLGH+AVKFGKAFGL VTV STS SKKEEAL+LLGAD FV+SSD +QM 
Sbjct  180   PGKSVGVIGLGGLGHMAVKFGKAFGLNVTVLSTSTSKKEEALSLLGADKFVVSSDLEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DF+I+TASGD PFD Y+SLLK AG   LVGFPSEVKFSP SLN+G K ++GS+T
Sbjct  240   ALGKSLDFIIDTASGDHPFDAYMSLLKVAGVYVLVGFPSEVKFSPASLNIGAKTVSGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+LE+CA+ KIYP+I+ IPI+ VNEALERLIK+DVKYRFVIDI  SLK
Sbjct  300   GGTKDTQEMLEYCAAHKIYPQIETIPIENVNEALERLIKRDVKYRFVIDIQNSLK  354



>ref|XP_006439168.1| hypothetical protein CICLE_v10020847mg [Citrus clementina]
 gb|ESR52408.1| hypothetical protein CICLE_v10020847mg [Citrus clementina]
Length=354

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/355 (78%), Positives = 311/355 (88%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  ++ +CLGWAARDPSGVLSPY+F+RR VGSDDVS+ I +CGVCYADVIWTRN HG 
Sbjct  1     MTSETASKDCLGWAARDPSGVLSPYSFNRRAVGSDDVSITITHCGVCYADVIWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVKEVG  V RFKVGD VGVGTYVNSCR+CEYCN+GLEV C++ SV+
Sbjct  61    SKYPLVPGHEIVGIVKEVGHNVSRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCAR-SVY  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ ID DGT+TKGGYSSYIVVHERYCYKI  +YPLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  120   TFNAIDADGTITKGGYSSYIVVHERYCYKIANDYPLALAAPLLCAGITVYTPMMRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTV STS SKKEEAL+LLGAD FV+SSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLNVTVLSTSTSKKEEALSLLGADKFVVSSDLEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DF+I+TASGD PFD Y+SLLK AG   LVGFPS+VKFSP SLN+G K ++GS+T
Sbjct  240   ALGKSLDFIIDTASGDHPFDAYMSLLKVAGVYVLVGFPSKVKFSPASLNIGAKTVSGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+LE+CA+ KIYP+I+ IPI+ VNEALERLIK+DVKYRFVIDI  SLK
Sbjct  300   GGTKDTQEMLEYCAAHKIYPQIETIPIENVNEALERLIKRDVKYRFVIDIQNSLK  354



>ref|XP_003543132.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Glycine 
max]
 gb|KHN19028.1| Putative cinnamyl alcohol dehydrogenase 1 [Glycine soja]
Length=357

 Score =   523 bits (1348),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 257/355 (72%), Positives = 308/355 (87%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARD SGVLSPY FSRR +G++DV + I +CGVC+ADV+WTRN HG 
Sbjct  1     MSSKGVGEDCLGWAARDASGVLSPYKFSRRTLGNEDVHIKITHCGVCFADVVWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYP+VPGHEI GIV +VG+ V  FKVGD VGVGTY+NSCR+CEYCN+G EV C+KGSV+
Sbjct  61    SKYPVVPGHEIAGIVTKVGANVHHFKVGDHVGVGTYINSCRDCEYCNDGQEVHCTKGSVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGT+TKGGYSSYIVVHERYC+ IP++YPLASAAPLLCAGITVY+PM+RH MNQ
Sbjct  121   TFNGVDFDGTITKGGYSSYIVVHERYCFMIPKSYPLASAAPLLCAGITVYSPMVRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEAL+LLGAD FV+SS++++M 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLSVTVFSTSISKKEEALSLLGADKFVVSSNQEEMT  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL+KS DF+I+TASGD  FD Y+SLLKT G   LVGFPS+VKF P SLN+G K +AGS+T
Sbjct  241   ALAKSLDFIIDTASGDHSFDPYMSLLKTYGVFVLVGFPSQVKFIPASLNIGSKTVAGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE++ FCA+ +I+P I++IPI+Y NEALERLI +DVKYRFVID+  SLK
Sbjct  301   GGTKDIQEMIGFCAANEIHPNIEVIPIEYANEALERLINRDVKYRFVIDVENSLK  355



>ref|XP_011040646.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
 ref|XP_011040647.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
 ref|XP_011040648.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
 ref|XP_011040649.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
Length=354

 Score =   521 bits (1343),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 264/353 (75%), Positives = 302/353 (86%), Gaps = 0/353 (0%)
 Frame = -2

Query  1309  SSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSK  1130
             +S ++ NCL WAARD SG LSPY F+RR VG DDVSL I +CG+CYADV +T    G + 
Sbjct  2     TSDNSGNCLAWAARDKSGFLSPYTFNRRAVGKDDVSLKITHCGICYADVAYTSGTFGEAI  61

Query  1129  YPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTF  950
             YP+VPGHEIVGIV+EVGS VQ F+VGD VGVG YVNSCR+CEYCN+ LE+ CS G VFTF
Sbjct  62    YPVVPGHEIVGIVQEVGSEVQSFRVGDHVGVGAYVNSCRDCEYCNDELEIHCSNGVVFTF  121

Query  949   DGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPg  770
             +G+DVDGTVTKGGYSS+IVVH+RYCYKIPE+YPL+ AAPLLCAGITVYTPM+RH MNQPG
Sbjct  122   NGLDVDGTVTKGGYSSFIVVHKRYCYKIPEDYPLSLAAPLLCAGITVYTPMIRHKMNQPG  181

Query  769   kslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMAL  590
             KSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS+SKKEEALNLLGADNFV+SSD +QM AL
Sbjct  182   KSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSMSKKEEALNLLGADNFVVSSDNEQMKAL  241

Query  589   SKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGG  410
              KS DF+I+TASGD PFD Y+S+LKTAG L L G PSE+K +P +L LGMK + GS TGG
Sbjct  242   DKSLDFIIDTASGDHPFDPYISILKTAGILVLAGNPSEIKLAPLNLILGMKTLTGSATGG  301

Query  409   TKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TK TQE+L+FC + KIYPE+++IPIQY NEALERLIKKDVKYRFVIDI  SL 
Sbjct  302   TKQTQEMLDFCGAHKIYPEVEVIPIQYANEALERLIKKDVKYRFVIDIENSLN  354



>ref|XP_009361511.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Pyrus x 
bretschneideri]
 ref|XP_009361518.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Pyrus x 
bretschneideri]
Length=358

 Score =   520 bits (1339),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 258/356 (72%), Positives = 310/356 (87%), Gaps = 0/356 (0%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S  +++  ++CLGWAARD SGVLSPY F+RR VGSDDVS+ I +CGVCYA+V+WTRN HG
Sbjct  2     SSENANKGEDCLGWAARDESGVLSPYKFARRAVGSDDVSIKITHCGVCYAEVVWTRNKHG  61

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              + YPLVPGHEI GIV+EVGS V+ FKVGD VGVGTY+NSCR C+YCN+GLEV C KG V
Sbjct  62    DATYPLVPGHEIAGIVQEVGSNVRGFKVGDHVGVGTYINSCRNCDYCNDGLEVYCEKGVV  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             +T++ +DVDGT+TKGG+S+YIVV +RYC++I E+YPLASAAPLLCAGITVY+PM+RH MN
Sbjct  122   YTYNRLDVDGTMTKGGFSTYIVVPKRYCFRIAESYPLASAAPLLCAGITVYSPMIRHKMN  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             QPGKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS SKKEE+L LLGADNFV+SSD+++M
Sbjct  182   QPGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSTSKKEESLTLLGADNFVVSSDQEKM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              A++KS DF+I+T S D  FD+Y+SLLKTAG L +VG P+EVK SP SL LGMK I+GS+
Sbjct  242   KAMAKSLDFIIDTVSADHSFDMYMSLLKTAGVLVMVGAPNEVKLSPMSLILGMKSISGSV  301

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              GGTK  QE+L+FCA++KIYP I+I+PIQYVNEA+ERLIKKDVKYRFV+DI  SLK
Sbjct  302   AGGTKEMQEMLDFCAAQKIYPNIEIVPIQYVNEAIERLIKKDVKYRFVVDIENSLK  357



>ref|XP_002307925.2| hypothetical protein POPTR_0006s02530g [Populus trichocarpa]
 ref|XP_006380945.1| hypothetical protein POPTR_0006s02530g [Populus trichocarpa]
 gb|EEE91448.2| hypothetical protein POPTR_0006s02530g [Populus trichocarpa]
 gb|ERP58742.1| hypothetical protein POPTR_0006s02530g [Populus trichocarpa]
Length=354

 Score =   519 bits (1337),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 262/352 (74%), Positives = 303/352 (86%), Gaps = 0/352 (0%)
 Frame = -2

Query  1309  SSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSK  1130
             +S ++ NCL WAARD SG LSP+ F+RR VG DDVSL I +CG+CYADV +T    G + 
Sbjct  2     TSDNSGNCLAWAARDKSGFLSPHTFNRRAVGKDDVSLKITHCGICYADVAYTSGTFGKAI  61

Query  1129  YPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTF  950
             YP+VPGHEIVGIV+EVGS VQ FKVGD VGVG YVNSCR+CEYCN+ LE+ CS G VFTF
Sbjct  62    YPVVPGHEIVGIVQEVGSEVQSFKVGDHVGVGAYVNSCRDCEYCNDELEIHCSNGVVFTF  121

Query  949   DGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPg  770
             +G+DVDGTVTKGGY S+IVVH+RYCYKIP++YPL+ AAPLLCAGITVYTPM+RH MNQPG
Sbjct  122   NGLDVDGTVTKGGYFSFIVVHKRYCYKIPQDYPLSLAAPLLCAGITVYTPMIRHKMNQPG  181

Query  769   kslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMAL  590
             KSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS+SKKEEALNLLGADNFV+SSD +QM AL
Sbjct  182   KSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSMSKKEEALNLLGADNFVVSSDNEQMKAL  241

Query  589   SKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGG  410
              KS DF+I+TASGD PFD Y+S+LKTAG L LVG PSE+K +P +L LGM+ + GS+TGG
Sbjct  242   DKSLDFIIDTASGDHPFDPYMSILKTAGILVLVGAPSEIKLAPLNLILGMRTLTGSVTGG  301

Query  409   TKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             TK TQE+L+FC + KIYPE+++IPIQY NEALERLIKKDVKYRFVIDI  SL
Sbjct  302   TKQTQEMLDFCGAHKIYPEVEVIPIQYANEALERLIKKDVKYRFVIDIENSL  353



>ref|XP_004485621.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004485622.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like isoform 
X2 [Cicer arietinum]
Length=355

 Score =   519 bits (1337),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 255/355 (72%), Positives = 309/355 (87%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARD SGVLSPY F+RR +GS+DV + I +CGVCYADV+WTRN HG 
Sbjct  1     MSSESVGEDCLGWAARDASGVLSPYKFNRRALGSEDVYIKITHCGVCYADVVWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYP+VPGHEI G+V +VGS V  FKVGD VGVGTY+NSCR+CEYCN+ LE+ C KGSV+
Sbjct  61    SKYPVVPGHEIAGVVAKVGSNVHSFKVGDHVGVGTYINSCRDCEYCNDRLEIHCVKGSVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGT+TKGGYS+ IVVHERYC+ IP++YPLASA PLLCAGITVY+PMMRH MNQ
Sbjct  121   TFNGVDFDGTITKGGYSTSIVVHERYCFMIPKSYPLASAGPLLCAGITVYSPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGV+GLGGLGH+AVKFGKAFGL+VTVFS+S SKKEEAL+LLGADNFV+SS++++M 
Sbjct  181   PGKSLGVVGLGGLGHMAVKFGKAFGLRVTVFSSSESKKEEALSLLGADNFVVSSNQEEMA  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL+KS DF+I+TASGD PFD Y+SLLK +G L LVGFPSEVKFSP +L LG + +AGS+T
Sbjct  241   ALAKSLDFIIDTASGDHPFDPYMSLLKISGVLVLVGFPSEVKFSPANLILGSRTVAGSVT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE+++FCA++ IYP+I++IPI Y NEAL+R+I KDVKYRFVIDI  SLK
Sbjct  301   GGTKEIQEMVDFCAAKGIYPDIELIPIGYSNEALDRVINKDVKYRFVIDIENSLK  355



>ref|XP_009361519.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Pyrus x 
bretschneideri]
Length=358

 Score =   519 bits (1337),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 258/356 (72%), Positives = 308/356 (87%), Gaps = 0/356 (0%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S  +++  ++CLGWAARD SGVLSPY F+RR VGSDDVS+ I +CGVCYA+V+WTRN HG
Sbjct  2     SSENANKGEDCLGWAARDESGVLSPYKFARRAVGSDDVSIKITHCGVCYAEVVWTRNKHG  61

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              + YPLVPGHEI GIV+EVGS V+ FK GD VGVGTY+NSCR C+YCN+GLEV C K  V
Sbjct  62    DATYPLVPGHEIAGIVQEVGSNVRGFKAGDHVGVGTYINSCRNCDYCNDGLEVYCEKEVV  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             +T++ +DVDGT+TKGG+S+YIVV ERYC++I E+YPLASAAPLLCAGITVY+PM+RH MN
Sbjct  122   YTYNRLDVDGTMTKGGFSTYIVVCERYCFRIAESYPLASAAPLLCAGITVYSPMIRHKMN  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             QPGKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS SKKEE+L LLGADNFV+SSD++QM
Sbjct  182   QPGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSTSKKEESLTLLGADNFVVSSDQEQM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              A++KS DF+I+T S D  FD+Y+SLLKTAG L +VG P+EVK SP SL LGMK I+GS+
Sbjct  242   KAMAKSLDFIIDTVSADHSFDMYMSLLKTAGVLVMVGAPNEVKLSPMSLILGMKSISGSV  301

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              GGTK  QE+L+FCA++KIYP I+I+PIQYVNEA+ERLIKKDVKYRFV+DI  SLK
Sbjct  302   AGGTKEMQEMLDFCAAQKIYPNIEIVPIQYVNEAIERLIKKDVKYRFVVDIENSLK  357



>ref|XP_010919062.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 4 [Elaeis 
guineensis]
 ref|XP_010919063.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 4 [Elaeis 
guineensis]
Length=355

 Score =   518 bits (1335),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 262/355 (74%), Positives = 298/355 (84%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M +   + +CL WAARD  G LSPY F RRVVG DDV + I +CGVCYADVIWTRN+ G 
Sbjct  1     MDTEIGSGDCLAWAARDAFGTLSPYRFKRRVVGRDDVHIKITHCGVCYADVIWTRNMAGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVG+V EVGS V+ FKVGD  GVGTYV+SC ECEYCN+ +EV CSKGS+ 
Sbjct  61    SKYPLVPGHEIVGLVTEVGSSVKGFKVGDHAGVGTYVDSCGECEYCNDFVEVHCSKGSIL  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGTVTKGGYSSYI+V ERYCY+IP+ YPLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  121   TFNGLDSDGTVTKGGYSSYIIVKERYCYRIPDGYPLAMAAPLLCAGITVYTPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             P KSLGVIGLGGLGH+AVKFGKAFGL VTVFSTS SKKE AL LLGAD FVISSD+KQM 
Sbjct  181   PDKSLGVIGLGGLGHMAVKFGKAFGLNVTVFSTSESKKEAALKLLGADKFVISSDKKQME  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +++ S DF+I+TASGD PFD YLSLLK  G L LVGFPSEV+  PGSL+ G + IAGS+T
Sbjct  241   SMTNSLDFIIDTASGDHPFDPYLSLLKVGGVLVLVGFPSEVRLHPGSLSYGSRTIAGSLT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQ +LEFCA+ K+YPEI++I IQY+NEALERL+K+DVKYRFVIDI  SLK
Sbjct  301   GGTKETQAMLEFCAANKVYPEIELINIQYINEALERLVKRDVKYRFVIDIQNSLK  355



>ref|XP_009393713.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   518 bits (1335),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 261/354 (74%), Positives = 299/354 (84%), Gaps = 0/354 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+     NCL WAAR+ +G LSPY F RR VG+DD+SL I YCGVC+ADV+WTRN HG 
Sbjct  1     MAAELGHGNCLSWAARNVTGTLSPYRFDRRSVGADDISLKIKYCGVCFADVVWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEIVG+V   GS V+ FKVGD +GVGTYVNSCR CEYC++ LEV CSKG   
Sbjct  61    SMYPLVPGHEIVGVVTATGSNVKGFKVGDHIGVGTYVNSCRNCEYCDDFLEVFCSKGPTL  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGTVTKGGYSS+IVVHERYCYKIP+ YPL  AAPLLCAGITVY+PMMRH MNQ
Sbjct  121   TFNGLDSDGTVTKGGYSSFIVVHERYCYKIPDGYPLDKAAPLLCAGITVYSPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AV FGKAFGLKVTVFSTS SKKEEALNLL ADNFVISSD++QMM
Sbjct  181   PGKSLGVIGLGGLGHMAVMFGKAFGLKVTVFSTSESKKEEALNLLRADNFVISSDKQQMM  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L KS D++I+TASGD PFD Y+SLLK  G L LVGFPSEV+  P SLN+G K ++GS+T
Sbjct  241   SLMKSLDYIIDTASGDHPFDPYMSLLKVGGVLVLVGFPSEVRLLPISLNMGAKSVSGSMT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GGTK TQE+L FCA+ +IYPE+++I IQY+NEALERLIK+DVKYRFVIDI  SL
Sbjct  301   GGTKETQEMLNFCATNQIYPEVEVINIQYINEALERLIKRDVKYRFVIDIANSL  354



>ref|XP_003593290.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES63541.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=406

 Score =   520 bits (1339),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 262/377 (69%), Positives = 317/377 (84%), Gaps = 1/377 (0%)
 Frame = -2

Query  1378  SQHSN*KRKRGGSCCSFEFT-SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVS  1202
             SQ S+ K +R     S  F+ +M+S    ++CL WAARD SGVLSPY F+RR +GS+DV 
Sbjct  30    SQTSHSKDQRAVFVLSVFFSEAMSSEGVGEDCLAWAARDASGVLSPYKFNRRELGSEDVY  89

Query  1201  LDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVN  1022
             + I +CGVCYADVIW +N HG SKYP+VPGHEI G+V +VG  VQRFKVGD VGVGTY+N
Sbjct  90    VKITHCGVCYADVIWAKNKHGDSKYPVVPGHEIAGVVAKVGPNVQRFKVGDHVGVGTYIN  149

Query  1021  SCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLAS  842
             SCRECEYCN+  EV C KGSV+TF+G+D DGT+TKGGYS+ IVVHERYC+ IP++YPLAS
Sbjct  150   SCRECEYCNDRFEVHCVKGSVYTFNGVDYDGTITKGGYSTSIVVHERYCFLIPKSYPLAS  209

Query  841   AAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKK  662
             A PLLCAGITVY+PM+RHNMNQPGKSLGV+GLGGLGH+AVKFGKAFGL+VTVFSTS+SKK
Sbjct  210   AGPLLCAGITVYSPMIRHNMNQPGKSLGVVGLGGLGHMAVKFGKAFGLRVTVFSTSMSKK  269

Query  661   EEALNLLGADNFVISSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFP  482
             EEAL+LLGAD FV+SS+++ M AL+KS DF+I+TASGD  FD Y+SLLK +G L LVGFP
Sbjct  270   EEALSLLGADQFVVSSNQEDMRALAKSLDFIIDTASGDHLFDPYMSLLKISGVLVLVGFP  329

Query  481   SEVKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLI  302
             SEVKFSP SLNLG + +AGS+TGGTK  QE+++FCA+  I+P+I++IPI Y NEALER++
Sbjct  330   SEVKFSPASLNLGSRTVAGSVTGGTKEIQEMVDFCAANGIHPDIELIPIGYSNEALERVV  389

Query  301   KKDVKYRFVIDIGGSLK  251
              KDVKYRFVIDI  SLK
Sbjct  390   NKDVKYRFVIDIENSLK  406



>ref|XP_009361508.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Pyrus x 
bretschneideri]
 ref|XP_009361513.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform 
X1 [Pyrus x bretschneideri]
Length=357

 Score =   518 bits (1333),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 260/356 (73%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S  +S    NCLGWAA D SGVLSPY F+RR + +DDVS+ I +CG+CYADV++ RN HG
Sbjct  2     SSQTSRVNGNCLGWAATDESGVLSPYKFTRRNLQNDDVSIRITHCGICYADVVFPRNKHG  61

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              + YP+VPGHEI GIV+EVG  V  FKVGD VGVGT+VNSCR+C+YC +GLE+ C KG V
Sbjct  62    YANYPMVPGHEIAGIVQEVGPNVHGFKVGDHVGVGTFVNSCRDCDYCRDGLEISCEKGIV  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FT++ +D DGT+TKGG+SSYIV HERYC+KIPE YPLASAAPLLCAGITVY+PM+RH MN
Sbjct  122   FTYNHVDADGTITKGGFSSYIVAHERYCFKIPEGYPLASAAPLLCAGITVYSPMIRHKMN  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             Q GKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS+SKKEEAL+LLGADNFV+SS++++M
Sbjct  182   QDGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSLSKKEEALSLLGADNFVVSSNQEEM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              AL+KS DF+I+TASGD PFDLY+SLLKTAG L LVG P+EVK SPGSL  GMK I+GS 
Sbjct  242   TALAKSLDFIIDTASGDHPFDLYMSLLKTAGVLVLVGAPTEVKLSPGSLIGGMKSISGSA  301

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              GGTK TQE+L+FCA+ KIYP I+I+PIQYVNEALER+IK+DVKYRFVIDI  SLK
Sbjct  302   AGGTKQTQEMLDFCAAHKIYPNIEIVPIQYVNEALERMIKRDVKYRFVIDIENSLK  357



>ref|XP_008342261.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Malus domestica]
Length=358

 Score =   517 bits (1331),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 256/356 (72%), Positives = 308/356 (87%), Gaps = 0/356 (0%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S  +++  ++CLGWAARD SGVLSPY F+RR VGSDDVS+ I +CGVCYA+V+WT+N HG
Sbjct  2     SSENANKGEDCLGWAARDESGVLSPYKFARRAVGSDDVSIKITHCGVCYAEVVWTKNKHG  61

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              + YPLVPGHEI GIV+EVGS V+ FKVGD VGVGTY+NSCR C+YCN+GLEV C KG V
Sbjct  62    DATYPLVPGHEIAGIVQEVGSNVRGFKVGDHVGVGTYINSCRNCDYCNDGLEVYCEKGVV  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             +T++ +D+DGT+TKGG+S+YIVV ERYC++I E+YPLASAAPLLCAGITVY+PM+RH MN
Sbjct  122   YTYNRLDIDGTMTKGGFSTYIVVCERYCFRIAESYPLASAAPLLCAGITVYSPMIRHKMN  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             QPGKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS SKKEE+L LLGADNFV+SSD++QM
Sbjct  182   QPGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSTSKKEESLTLLGADNFVVSSDQEQM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              A++KS DF+I+T S D  FD+Y+ LLKTAG   +VG P+EVK SP SL LGMK I+GS+
Sbjct  242   KAMAKSLDFIIDTVSADHSFDMYMLLLKTAGVFVMVGAPNEVKLSPMSLILGMKSISGSV  301

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              GGTK  QE+L+FCA++KIYP I+I+PIQYVNEA+ERLIKKDVKYRFV+DI  SLK
Sbjct  302   AGGTKEMQEMLDFCAAQKIYPNIEIVPIQYVNEAIERLIKKDVKYRFVVDIENSLK  357



>ref|XP_008229770.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Prunus 
mume]
Length=359

 Score =   516 bits (1329),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 261/347 (75%), Positives = 300/347 (86%), Gaps = 0/347 (0%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
             NCLGWAA D SG+LSPY FSRR + +DDVS+ I +CG+CYADV++ RN HG +KYP+VPG
Sbjct  13    NCLGWAATDESGILSPYKFSRRSLQNDDVSVKITHCGICYADVLFPRNKHGNAKYPMVPG  72

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEI GIV+EVGS V  FKVGD VG+GTYVNSCR C+YC +GLEV C KG+VFT++ +D D
Sbjct  73    HEIAGIVQEVGSNVHGFKVGDHVGIGTYVNSCRNCDYCGDGLEVFCEKGAVFTYNNVDED  132

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+T+GG+SSYIV H+ YC++IP+ YPLASAAPLLCAGITVYTPMMRH MNQPGKSLGVI
Sbjct  133   GTITQGGFSSYIVAHQGYCFRIPDGYPLASAAPLLCAGITVYTPMMRHKMNQPGKSLGVI  192

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGHLAVKFGKAFGL VTVFSTS SKKEEAL LLGADNFV+SSD +QM AL+KS DF
Sbjct  193   GLGGLGHLAVKFGKAFGLNVTVFSTSTSKKEEALTLLGADNFVVSSDLEQMTALAKSLDF  252

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQE  392
             +I+TASGD PFD Y+SLLKTAG L LVG PSEVK SP SL  GMK I+GS TGGTK TQE
Sbjct  253   IIDTASGDHPFDPYMSLLKTAGVLVLVGAPSEVKLSPLSLIGGMKSISGSATGGTKQTQE  312

Query  391   LLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +L+FCA+ KIYP I+I+PIQYVNEALERLIK+DVKYRFVID+  SLK
Sbjct  313   MLDFCAAHKIYPNIEIVPIQYVNEALERLIKRDVKYRFVIDVESSLK  359



>gb|AID56319.1| ethylene cinnamyl alcohol dehydrogenase 3 [Eriobotrya japonica]
Length=357

 Score =   516 bits (1329),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 258/356 (72%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S  +S    NCLGWAA D SGVLSPY F+RR + +DDVS+ I +CG+CYADV++ RN HG
Sbjct  2     SSQTSSVNGNCLGWAATDESGVLSPYKFTRRNLQNDDVSIRITHCGICYADVVFPRNKHG  61

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              +KYP+VPGHEI GIV+EVG  V  FKVGD VGVGT+VNSCR+C+YC +G E+ C KG V
Sbjct  62    NAKYPMVPGHEIAGIVQEVGPNVHGFKVGDHVGVGTFVNSCRDCDYCRDGQEISCEKGPV  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FT++ +D DGT+TKGG+SSYIV HERYC+KIPE YPLASAAPLLCAGITVY+PM+RH MN
Sbjct  122   FTYNHVDADGTITKGGFSSYIVAHERYCFKIPEGYPLASAAPLLCAGITVYSPMIRHKMN  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             + GKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS+SKKEEAL+LLGADNFV+SS++ +M
Sbjct  182   KAGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSLSKKEEALSLLGADNFVVSSNQGEM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              AL+KS DF+I+TASGD PFDLY+SLLKTAG L LVG PSEVK SP SL +GMK I+GS 
Sbjct  242   TALAKSLDFIIDTASGDHPFDLYMSLLKTAGVLVLVGAPSEVKLSPLSLIMGMKSISGSA  301

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK TQE+++FCA+ KIYP I+++PIQYVNEALERLIK+DVKYRFVID+  SLK
Sbjct  302   TGGTKQTQEMIDFCAAHKIYPNIELVPIQYVNEALERLIKRDVKYRFVIDVENSLK  357



>ref|XP_002304800.1| hypothetical protein POPTR_0003s19610g [Populus trichocarpa]
 gb|EEE79779.1| hypothetical protein POPTR_0003s19610g [Populus trichocarpa]
Length=355

 Score =   515 bits (1327),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 255/355 (72%), Positives = 299/355 (84%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S     +CLGWAARD SGVLSPY+F RR +G+DD+S+ I YCG+CY D+++TRN H  
Sbjct  1     MSSFQEGKDCLGWAARDASGVLSPYHFKRRAIGADDISVKITYCGICYGDIVYTRNKHED  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYP+VPGHEI GIVKEVGS VQRFK GDPVGVGTY+NSCR C+ CNEGLEVQC  G V 
Sbjct  61    SKYPVVPGHEIAGIVKEVGSNVQRFKTGDPVGVGTYINSCRNCDECNEGLEVQCPNGMVP  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T + +DVDGT+TKGGYSS+IVVHERYCYKIPENYPLA AAPLLC+GITVYTPM+ + MNQ
Sbjct  121   TINAVDVDGTITKGGYSSFIVVHERYCYKIPENYPLALAAPLLCSGITVYTPMIHYKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALN+LGAD F++S+DE++M 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLNVTVFSTSISKKEEALNVLGADKFIVSTDEEEMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
              LS++ DF+I++ASGD PFD Y+SLLKT G   +V +P EVK  P SL  GM+ I GS T
Sbjct  241   TLSRTLDFIIDSASGDHPFDPYMSLLKTNGLFVMVCYPKEVKLDPLSLFTGMRSITGSFT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTKLTQE+LEFCA+ KIYPEI++IPI+Y  EA ER++K DVKYRFVIDI  SLK
Sbjct  301   GGTKLTQEMLEFCAAHKIYPEIEVIPIEYAYEAFERMLKGDVKYRFVIDIENSLK  355



>ref|XP_006846499.1| hypothetical protein AMTR_s00018p00151850 [Amborella trichopoda]
 gb|ERN08174.1| hypothetical protein AMTR_s00018p00151850 [Amborella trichopoda]
Length=350

 Score =   514 bits (1325),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 255/347 (73%), Positives = 300/347 (86%), Gaps = 0/347 (0%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             +NC+GWAARD SG LSPYNFSRR    DDVSL I +CGVCYADV+WTRN  G SKYPLVP
Sbjct  3     ENCVGWAARDASGFLSPYNFSRRDPAPDDVSLRITHCGVCYADVLWTRNKLGDSKYPLVP  62

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEIVG+VKE+GS V  FK GD VGVGTYVN+CR+CEYC+  LE  C KG  FTF+ IDV
Sbjct  63    GHEIVGVVKEIGSNVSGFKAGDHVGVGTYVNTCRDCEYCDAKLECYCFKGLTFTFNAIDV  122

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGT+TKGGYSS+IVVHERYCYKIP+NYPLASAAPLLCAGITVY+PM+RH MNQPGKSLGV
Sbjct  123   DGTITKGGYSSHIVVHERYCYKIPDNYPLASAAPLLCAGITVYSPMIRHKMNQPGKSLGV  182

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             +GLGGLGH+AVKFGKAFGL VTVFSTS SKK++AL +LGAD F++SSD+++M ++++S D
Sbjct  183   VGLGGLGHMAVKFGKAFGLNVTVFSTSKSKKDQALKVLGADKFILSSDKEEMESVARSLD  242

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             F+I+TASGD PFD YLSLLKTAGT+ALVGFPS +K  P SLN+GMK I+GS TGGTK TQ
Sbjct  243   FIIDTASGDHPFDEYLSLLKTAGTMALVGFPSAIKIHPVSLNMGMKTISGSTTGGTKETQ  302

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+L+FCA+ +I+P  ++IPIQY+NEALER+ K DV+YRFVIDI  SL
Sbjct  303   EMLDFCAAHQIFPMTEVIPIQYINEALERMTKNDVQYRFVIDIENSL  349



>ref|XP_008342260.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Malus domestica]
Length=357

 Score =   514 bits (1325),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 259/356 (73%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S  +S    NCLGWAA D SGVLSPY F+RR + +DDVS+ I +CG+CYADV++ RN HG
Sbjct  2     SSQTSSVNGNCLGWAAIDESGVLSPYKFTRRDLRNDDVSIRITHCGICYADVVFPRNKHG  61

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              + YP+VPGHEI GIV+EVG  V  FKVGD VGVGT+VNSCR+C+YC +G E+ C KG+V
Sbjct  62    NANYPMVPGHEIAGIVQEVGPNVHGFKVGDHVGVGTFVNSCRDCDYCRDGQEISCEKGAV  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
              T++ +D DGT+TKGG+SSYIV HERYC+KIPE YPLASAAPLLCAGITVY+PM+RH MN
Sbjct  122   MTYNHVDADGTITKGGFSSYIVAHERYCFKIPEGYPLASAAPLLCAGITVYSPMIRHKMN  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             Q GKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS+SKKEEAL+LLGADNFV+SS++++M
Sbjct  182   QGGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSLSKKEEALSLLGADNFVVSSNQEEM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              AL+KS DF+I+TASGD PFDLY+SLLKTAG L LVG PSEVK SP SL +GMK I+GS 
Sbjct  242   TALAKSLDFIIDTASGDHPFDLYMSLLKTAGVLVLVGAPSEVKLSPLSLIMGMKSISGSG  301

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK TQE+L+FCA+ KIYP I+I+PIQYVNEALERLIK+DVKYRFVID+  SLK
Sbjct  302   TGGTKQTQEMLDFCAAHKIYPNIEIVPIQYVNEALERLIKRDVKYRFVIDVENSLK  357



>ref|XP_009361512.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Pyrus x 
bretschneideri]
Length=357

 Score =   514 bits (1324),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 258/356 (72%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S  +S    NCLGWAA D SGVLSPY F+RR + +DDVS+ I +CG+CYADV + RN HG
Sbjct  2     SSQTSSVIGNCLGWAATDESGVLSPYKFARRNLQNDDVSIRITHCGICYADVFFPRNKHG  61

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              + YP+VPGHEI GIV+EVG  V  FKVGD VGVGT+VNSCR+C+YC +G+E+ C KG++
Sbjct  62    NAMYPMVPGHEIAGIVQEVGPNVHGFKVGDHVGVGTFVNSCRDCDYCRDGIEICCEKGAI  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
              T++ +D DGT+TKGG+SSYIV HERYC+KIPE YPLASAAPLLCAGITVY+PM+RH MN
Sbjct  122   LTYNHVDADGTITKGGFSSYIVAHERYCFKIPEGYPLASAAPLLCAGITVYSPMIRHKMN  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             Q GKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS+SKKEEAL+LLGADNFV+SS++++M
Sbjct  182   QDGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSLSKKEEALSLLGADNFVVSSNQEEM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI  419
              AL+KS DF+I+TASGD PFDLY+SLLKTAG L LVG PSEVK SP SL +GMK I+GS 
Sbjct  242   TALAKSLDFIIDTASGDHPFDLYMSLLKTAGVLVLVGVPSEVKLSPMSLIIGMKSISGSG  301

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TGGTK TQE+L+FCA+ KIYP I+I+PIQYVNEALERLIK+DVKYRFVID+  SLK
Sbjct  302   TGGTKQTQEMLDFCAAHKIYPNIEIVPIQYVNEALERLIKRDVKYRFVIDVENSLK  357



>ref|XP_004309483.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   512 bits (1319),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 253/357 (71%), Positives = 305/357 (85%), Gaps = 2/357 (1%)
 Frame = -2

Query  1321  TSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIH  1142
             +SMA+++   NCLGWAARD SG+LSPY F+RR V +DDVS+ I +CGVCYA+V+W +N H
Sbjct  5     SSMANANG--NCLGWAARDASGILSPYKFNRRDVQADDVSIKITHCGVCYAEVVWPKNKH  62

Query  1141  GTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGS  962
             G + YP+VPGHEIVGIV+EVG  V RFKVGD VGVG Y NSCR+CEYCN+GLEV C KG 
Sbjct  63    GDATYPMVPGHEIVGIVQEVGPNVHRFKVGDHVGVGAYTNSCRDCEYCNDGLEVYCDKGV  122

Query  961   VFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNM  782
             V T++  D DGT+T GG+S++ VVHERYC+KIPE+YPLASAAPLLCAGITVY+PMM H M
Sbjct  123   VLTYNRFDYDGTLTHGGFSTFTVVHERYCFKIPEDYPLASAAPLLCAGITVYSPMMDHKM  182

Query  781   NQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQ  602
             N+PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS+SKK+EAL +LGAD+FV+SSD+ Q
Sbjct  183   NKPGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSMSKKDEALTVLGADSFVVSSDQDQ  242

Query  601   MMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGS  422
             M AL+KS DF+++TASG  PFDLY+S+LKTAG L LVG PSE+K +P SL +G + I GS
Sbjct  243   MKALAKSLDFIVDTASGHHPFDLYMSVLKTAGVLVLVGAPSEIKLNPMSLLIGKRSITGS  302

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              +GGTK  QE+L FCA+ KIYP I+++PIQYVNEA+ERLIKKDVKYRFV+DIG SLK
Sbjct  303   ASGGTKQIQEMLNFCAAHKIYPNIEVVPIQYVNEAIERLIKKDVKYRFVVDIGNSLK  359



>ref|XP_003593291.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
Length=446

 Score =   515 bits (1327),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 256/363 (71%), Positives = 308/363 (85%), Gaps = 0/363 (0%)
 Frame = -2

Query  1339  CCSFEFTSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVI  1160
             C      +M+S    ++CL WAARD SGVLSPY F+RR +GS+DV + I +CGVCYADVI
Sbjct  84    CLLLRRIAMSSEGVGEDCLAWAARDASGVLSPYKFNRRELGSEDVYVKITHCGVCYADVI  143

Query  1159  WTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEV  980
             W +N HG SKYP+VPGHEI G+V +VG  VQRFKVGD VGVGTY+NSCRECEYCN+  EV
Sbjct  144   WAKNKHGDSKYPVVPGHEIAGVVAKVGPNVQRFKVGDHVGVGTYINSCRECEYCNDRFEV  203

Query  979   QCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTP  800
              C KGSV+TF+G+D DGT+TKGGYS+ IVVHERYC+ IP++YPLASA PLLCAGITVY+P
Sbjct  204   HCVKGSVYTFNGVDYDGTITKGGYSTSIVVHERYCFLIPKSYPLASAGPLLCAGITVYSP  263

Query  799   MMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVI  620
             M+RHNMNQPGKSLGV+GLGGLGH+AVKFGKAFGL+VTVFSTS+SKKEEAL+LLGAD FV+
Sbjct  264   MIRHNMNQPGKSLGVVGLGGLGHMAVKFGKAFGLRVTVFSTSMSKKEEALSLLGADQFVV  323

Query  619   SSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGM  440
             SS+++ M AL+KS DF+I+TASGD  FD Y+SLLK +G L LVGFPSEVKFSP SLNLG 
Sbjct  324   SSNQEDMRALAKSLDFIIDTASGDHLFDPYMSLLKISGVLVLVGFPSEVKFSPASLNLGS  383

Query  439   KCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGG  260
             + +AGS+TGGTK  QE+++FCA+  I+P+I++IPI Y NEALER++ KDVKYRFVIDI  
Sbjct  384   RTVAGSVTGGTKEIQEMVDFCAANGIHPDIELIPIGYSNEALERVVNKDVKYRFVIDIEN  443

Query  259   SLK  251
             SLK
Sbjct  444   SLK  446



>ref|XP_008342262.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Malus domestica]
Length=359

 Score =   511 bits (1317),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 307/359 (86%), Gaps = 4/359 (1%)
 Frame = -2

Query  1315  MASSHSTD----NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRN  1148
             M+S  S+D    NCLGWAA D SGVLSP  F+RR + +DDVS+ I +CG+CYADV + RN
Sbjct  1     MSSQTSSDTVNGNCLGWAATDESGVLSPCKFTRRNLQNDDVSIRITHCGICYADVGFPRN  60

Query  1147  IHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSK  968
               G +KYP+VPGHEI GIV+EVG  V  FKVGD VGVGT+VNSCR+C+YC +G EV C K
Sbjct  61    KDGNAKYPMVPGHEIAGIVQEVGPNVHGFKVGDHVGVGTFVNSCRDCDYCRDGQEVSCEK  120

Query  967   GSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRH  788
             G++FT++ +D DGT+TKGG+SSYIV HERYC+KIPE YPLASAAPLLCAGITVY+PM+RH
Sbjct  121   GAIFTYNHVDADGTITKGGFSSYIVAHERYCFKIPEGYPLASAAPLLCAGITVYSPMIRH  180

Query  787   NMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDE  608
              MNQ GKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS+SKKEEAL+LLGADNFV+SS++
Sbjct  181   KMNQAGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFSTSLSKKEEALSLLGADNFVVSSNQ  240

Query  607   KQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIA  428
             ++M AL+KS DF+I+TASGD PFDLY+SLLKTAG L LVG PSEVK SP SL  GMK I+
Sbjct  241   EEMTALAKSLDFIIDTASGDHPFDLYMSLLKTAGVLVLVGAPSEVKLSPMSLIYGMKSIS  300

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS+TGGTK T+E+L+FCA+ KIYP I+I+PIQYVNEALERLIK+DVKYRFVID+  SLK
Sbjct  301   GSVTGGTKQTREMLDFCAAHKIYPNIEIVPIQYVNEALERLIKRDVKYRFVIDVENSLK  359



>ref|XP_007217849.1| hypothetical protein PRUPE_ppa024217mg [Prunus persica]
 gb|EMJ19048.1| hypothetical protein PRUPE_ppa024217mg [Prunus persica]
Length=359

 Score =   511 bits (1315),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 257/347 (74%), Positives = 301/347 (87%), Gaps = 0/347 (0%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
             +CLGWAA D SG+LSPY FSRR + +DDVS+ I +CG+CYADV++ RN HG +KYP+VPG
Sbjct  13    DCLGWAATDESGILSPYKFSRRSLQNDDVSVKITHCGICYADVLFPRNKHGNAKYPMVPG  72

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEI GIV+EVGS V+ FKVGD VG+GTYVNSCR C+YC +GLE+ C KG+VFT++ +D D
Sbjct  73    HEIAGIVQEVGSNVRGFKVGDHVGIGTYVNSCRNCDYCGDGLEIFCEKGAVFTYNNVDED  132

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+T+GG+SSYIV H+ YC++IP+ YPLASAAPLLCAGITVYTPM+RH MNQPGKSLGVI
Sbjct  133   GTITQGGFSSYIVAHQGYCFRIPDGYPLASAAPLLCAGITVYTPMIRHKMNQPGKSLGVI  192

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGHLAVKFGKAFGL VTVFSTS SKKEEAL LLGADNFV+SS+ +QM AL+KS DF
Sbjct  193   GLGGLGHLAVKFGKAFGLNVTVFSTSTSKKEEALTLLGADNFVVSSNLEQMTALAKSLDF  252

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQE  392
             +I+TASGD PFD Y+SLLKTAG L LVG PSEVK SP SL  GMK I+GS TGGTK TQE
Sbjct  253   IIDTASGDHPFDPYMSLLKTAGVLVLVGAPSEVKLSPLSLIGGMKSISGSATGGTKQTQE  312

Query  391   LLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +L+FCA+ KIYP I+I+PIQYVNEALERLIK+DVKYRFVID+  SLK
Sbjct  313   MLDFCAAHKIYPNIEIVPIQYVNEALERLIKRDVKYRFVIDVESSLK  359



>gb|AHG52039.1| cinnamyl alcohol dehydrogenase [Boehmeria nivea]
Length=358

 Score =   510 bits (1313),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 300/358 (84%), Gaps = 0/358 (0%)
 Frame = -2

Query  1324  FTSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
              +S +   + + CLGWAARDPSG LSPY F+RR VG DDVS+ I +CGVCYADV+WTRN 
Sbjct  1     MSSESEPANNEECLGWAARDPSGYLSPYTFTRREVGIDDVSIAITHCGVCYADVVWTRNK  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G S YPLVPGHEIVGIVK+VG  V  F+VGD VGVGTYVNSCR+C++C E LE  C  G
Sbjct  61    FGDSNYPLVPGHEIVGIVKQVGGSVDGFRVGDRVGVGTYVNSCRDCDFCKERLENHCQNG  120

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
             SV+TF+ +D DGT+TKGGYS++IVVH+RYC++IP+ YPLASAAPLLCAGITVY PMMRH 
Sbjct  121   SVYTFNHVDADGTITKGGYSTFIVVHQRYCFRIPDAYPLASAAPLLCAGITVYAPMMRHR  180

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             MNQPGKSLGV+GLGGLGH+AVKFGKAFGL VTVFSTS SKK+EAL+ LGAD FV+SSD++
Sbjct  181   MNQPGKSLGVVGLGGLGHMAVKFGKAFGLNVTVFSTSTSKKQEALSRLGADKFVVSSDQQ  240

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAG  425
             QM AL+ SFDF+++ ASGD PFD Y+SLLKTAG L LVGFPSE+K SP +L LGMK I+G
Sbjct  241   QMKALANSFDFILDAASGDHPFDPYVSLLKTAGVLVLVGFPSEIKISPANLLLGMKTISG  300

Query  424   SITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             S  GGTK TQE+L+FC++  I+P+I+++PIQY NEAL+RLI KDVKYRF ID+  SLK
Sbjct  301   STVGGTKDTQEMLDFCSANGIFPDIEVVPIQYANEALDRLINKDVKYRFAIDVQSSLK  358



>emb|CDX72936.1| BnaC06g33840D [Brassica napus]
Length=351

 Score =   506 bits (1304),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 255/353 (72%), Positives = 296/353 (84%), Gaps = 10/353 (3%)
 Frame = -2

Query  1309  SSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSK  1130
             SS   D CL WAARDPSG+LSP+ F+RR V SDDVSL I +CGVCYADVIWT+N HG SK
Sbjct  9     SSPGGDECLSWAARDPSGLLSPHTFTRRSVTSDDVSLKITHCGVCYADVIWTKNKHGDSK  68

Query  1129  YPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTF  950
             YPLVPGHEI G+V +VGS V RFKVGD VG          C+YC+EG EV C KG VFTF
Sbjct  69    YPLVPGHEIAGVVNKVGSNVTRFKVGDHVG----------CDYCDEGQEVSCVKGQVFTF  118

Query  949   DGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPg  770
             +G+D DG+VTKGGYSS+IVVHERYCYKIP +YPL SAAPLLCAG+TVY PMMRHNMNQPG
Sbjct  119   NGVDYDGSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGVTVYAPMMRHNMNQPG  178

Query  769   kslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMAL  590
             KSLGV+GLGGLGH+AVKFGKAFGL VTVFSTS+SKKEEAL+LLGA+NFVISS   QM AL
Sbjct  179   KSLGVVGLGGLGHMAVKFGKAFGLHVTVFSTSVSKKEEALSLLGANNFVISSAHDQMKAL  238

Query  589   SKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGG  410
             +KS DF+I+TASGD  FD Y+SLLK AGT  LVGFPSE+K  P +LNLGM+ +AGS++GG
Sbjct  239   AKSLDFIIDTASGDHAFDPYMSLLKIAGTYVLVGFPSEIKIQPATLNLGMRVLAGSVSGG  298

Query  409   TKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TK+TQE+++FCA+ KIYP I++IPIQ  NEA+ER++KKD+KYRFVIDI  SLK
Sbjct  299   TKVTQEMIDFCAAHKIYPNIEVIPIQKANEAIERVVKKDIKYRFVIDIENSLK  351



>gb|KCW45115.1| hypothetical protein EUGRSUZ_L01277 [Eucalyptus grandis]
 gb|KCW45116.1| hypothetical protein EUGRSUZ_L01277 [Eucalyptus grandis]
 gb|KCW45117.1| hypothetical protein EUGRSUZ_L01277 [Eucalyptus grandis]
 gb|KCW45118.1| hypothetical protein EUGRSUZ_L01277 [Eucalyptus grandis]
Length=345

 Score =   504 bits (1298),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 252/329 (77%), Positives = 291/329 (88%), Gaps = 1/329 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARDPSG LSPY F+RR VGS+DVS+ I +CGVCYADV WTRN +G 
Sbjct  1     MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYADVAWTRNEYGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+ LE QC K +V 
Sbjct  61    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDRLETQCEK-AVL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFDGIDADGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STSISK+EEAL+LLGAD+FVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSISKEEEALSLLGADHFVISSDLEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TA+GD PFD Y+SLLKT G LALVGFPSEVKFSP SLN  M+ ++GS+T
Sbjct  240   AIAKSLDFIIDTAAGDHPFDSYMSLLKTGGILALVGFPSEVKFSPASLNFNMRTVSGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQY  329
             GGTK TQE+++ CA++KIYP+I++IPI Y
Sbjct  300   GGTKDTQEMIDLCAAQKIYPKIEVIPIDY  328



>ref|XP_002436634.1| hypothetical protein SORBIDRAFT_10g006290 [Sorghum bicolor]
 gb|EER88001.1| hypothetical protein SORBIDRAFT_10g006290 [Sorghum bicolor]
Length=354

 Score =   501 bits (1289),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 252/355 (71%), Positives = 294/355 (83%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+     NC  WAARDPSGVLSPY+F+RR V S DV+L I YCGVCYADV+WTRN+H  
Sbjct  1     MAAESEHGNCNAWAARDPSGVLSPYSFNRRPVQSSDVALKILYCGVCYADVVWTRNMHHD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYP+VPGHEI G+V +VG+ V+ FKVGD VGVGTYVNSCR+CE CN  LE  C KG V+
Sbjct  61    SKYPVVPGHEIAGVVTQVGADVKGFKVGDHVGVGTYVNSCRDCENCNSSLENHCPKG-VY  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DGTVTKGGYS++IVVHERYC++IP+ YPLA AAPLLCAGITVYTPMMRHNMNQ
Sbjct  120   TFNGIDTDGTVTKGGYSTHIVVHERYCFQIPDGYPLAKAAPLLCAGITVYTPMMRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STS SK+ EA++LLGADNFVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSESKRHEAISLLGADNFVISSDTQQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S  F+++TASGD PFD YLSLL   G +A+VGFPSE+K  P SLNLG + ++GS+T
Sbjct  240   SLRNSLHFIVDTASGDHPFDPYLSLLMVGGVMAIVGFPSEIKMHPASLNLGARTLSGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE++ FCA+ KI PEI+II I Y+NEAL RL+ +DVKYRFVIDI  S K
Sbjct  300   GGTKDIQEMVNFCAANKISPEIEIIKIDYINEALTRLVNRDVKYRFVIDIENSFK  354



>dbj|BAJ84795.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=356

 Score =   500 bits (1287),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 251/357 (70%), Positives = 296/357 (83%), Gaps = 3/357 (1%)
 Frame = -2

Query  1315  MASSHSTD--NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIH  1142
             MA+   T+  NC  WAA+DPSG+LSP+ F+RR V  DDVSL I +CGVCYADVIWT+N H
Sbjct  1     MAAESGTESGNCSAWAAKDPSGLLSPHTFNRRTVRHDDVSLRITHCGVCYADVIWTKNRH  60

Query  1141  GTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGS  962
               S YPLVPGHEI G+V EVGS V+ FK+GD V VGTYVNSCR+CE CN  LE  CSK  
Sbjct  61    NDSVYPLVPGHEIAGVVTEVGSDVKGFKLGDHVAVGTYVNSCRDCENCNSSLENHCSK-F  119

Query  961   VFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNM  782
             VFTF+G+D DGTVTKGGYSS+IVVHERYCYKIP+ YPL  AAPL+CAGITVYTPM RHNM
Sbjct  120   VFTFNGVDTDGTVTKGGYSSHIVVHERYCYKIPDGYPLEKAAPLVCAGITVYTPMTRHNM  179

Query  781   NQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQ  602
             NQPGKSLGV+GLGGLGH+AVKFGKAFGLKVTV STS SK++EA+NLLGADNFV+SSD+KQ
Sbjct  180   NQPGKSLGVVGLGGLGHMAVKFGKAFGLKVTVLSTSESKRDEAINLLGADNFVVSSDKKQ  239

Query  601   MMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGS  422
             M +L  S DF+++TASGD PFD YL+LLK  G +ALVGFP E++  P +LNLG + ++GS
Sbjct  240   MESLKSSLDFIVDTASGDHPFDPYLALLKVGGLMALVGFPGEIRVHPATLNLGARTLSGS  299

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +TGGTK TQE++ FCA  KIYP+I++I I Y+NEALERL+ +DVKYRFVIDI  SLK
Sbjct  300   VTGGTKDTQEMINFCAVNKIYPDIELIKIDYINEALERLVNRDVKYRFVIDIESSLK  356



>ref|XP_002273147.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Vitis vinifera]
 emb|CBI38294.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   498 bits (1282),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 252/350 (72%), Positives = 294/350 (84%), Gaps = 1/350 (0%)
 Frame = -2

Query  1297  TDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLV  1118
              +NCLGWAARD SGVLSPY F+RR VG +DVSL I +CG+CYAD+++T+N  G S+YPLV
Sbjct  8     NNNCLGWAARDESGVLSPYTFTRREVGDEDVSLKITHCGICYADMLFTKNRLGDSRYPLV  67

Query  1117  PGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGID  938
             PGHEIVGIVKEVGS V  FKVG  VGVG YVNSCRECE CN+ LEV CSKGSV+T +G+D
Sbjct  68    PGHEIVGIVKEVGSNVHHFKVGHRVGVGAYVNSCRECESCNQSLEVYCSKGSVYTSNGVD  127

Query  937   VDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslg  758
              DGT+T GGYSS+IVVHERYC++IP+ YPLA AAPLLC GIT Y+PM+RH MNQPGKSL 
Sbjct  128   ADGTITNGGYSSFIVVHERYCFRIPDEYPLALAAPLLCPGITAYSPMVRHKMNQPGKSLE  187

Query  757   viglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSF  578
             VIGLGG+GHLAVKFGKAFGL V +FSTSISKKEEAL+LLG DNFV+SSDE+QM A++ S 
Sbjct  188   VIGLGGVGHLAVKFGKAFGLNVKLFSTSISKKEEALSLLGDDNFVVSSDEQQMKAMANSL  247

Query  577   DFLINTASGDIPFDLYLSLLKTAGTLALVGFP-SEVKFSPGSLNLGMKCIAGSITGGTKL  401
             DF+I+TASGD   D Y+S LKTAG LALVGFP  ++K SP SL  GMK I+GS+ GG K 
Sbjct  248   DFIIDTASGDHSLDHYMSCLKTAGVLALVGFPGDQIKLSPASLLRGMKTISGSLVGGVKE  307

Query  400   TQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TQE+L+FCA+ KIYP+I+I+PIQYVNEA ERL K DVKYRFVID+  SLK
Sbjct  308   TQEMLDFCAAHKIYPDIEIVPIQYVNEAWERLTKGDVKYRFVIDVENSLK  357



>ref|XP_008784626.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 4 isoform 
X3 [Phoenix dactylifera]
Length=355

 Score =   497 bits (1280),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 260/355 (73%), Positives = 298/355 (84%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M +   + +CL WAARD SG LSPY F+RRVV  DDV + I +CGVCYADVIWTRN+ G 
Sbjct  1     MGTEIGSGDCLAWAARDASGTLSPYRFNRRVVRRDDVRIKITHCGVCYADVIWTRNMAGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIV EVGS V+ FKVGD  GVGTYV+SC ECEYCN+ LEV CSKGS F
Sbjct  61    SKYPLVPGHEIVGIVTEVGSSVKGFKVGDHAGVGTYVDSCGECEYCNDFLEVHCSKGSTF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ +D DGT+TKGGYSSYI+V ERYCY+IP+ +PLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  121   TFNAVDSDGTITKGGYSSYIIVKERYCYRIPDGFPLAMAAPLLCAGITVYTPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SKKE AL LLGAD FVISSD++QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKKEAALKLLGADKFVISSDKEQME  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +++KS DF+I+TASGD  FD Y+SLLK  G L LVGFPSEV+  PGSL+   + IAGS+T
Sbjct  241   SMTKSLDFIIDTASGDHLFDPYMSLLKVGGVLVLVGFPSEVRLHPGSLSYASRTIAGSLT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQ +LEFCA  K+YPEI++I IQY+NEALERL+K+DVKYRFVID+  SLK
Sbjct  301   GGTKQTQAMLEFCAENKVYPEIELINIQYINEALERLVKRDVKYRFVIDVQNSLK  355



>gb|KDP26119.1| hypothetical protein JCGZ_22220 [Jatropha curcas]
Length=361

 Score =   496 bits (1276),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 261/355 (74%), Positives = 304/355 (86%), Gaps = 0/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + + CL WAA+DPSGVL PY FSRR VGS+DVSL I +CG+CYADV  T N  G 
Sbjct  1     MSSESTKEECLAWAAKDPSGVLLPYKFSRRAVGSEDVSLKITHCGICYADVGSTTNKLGY  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVG VKEVGS V  FKVGD VGVGTYVNSCR+CEYCNEG EV C KG VF
Sbjct  61    SKYPLVPGHEIVGTVKEVGSNVSHFKVGDHVGVGTYVNSCRDCEYCNEGEEVNCVKGIVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DGT+TKGGYSSYIVVH+RYC++IP++YPLA AAPLLCAGITVY PM+RH MN+
Sbjct  121   TFNGIDTDGTITKGGYSSYIVVHQRYCFRIPDDYPLALAAPLLCAGITVYNPMIRHGMNR  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
              GKSLGVIGLGGLGH+AVKFGKAFGLKVTV ST++SKKEEAL++LGADNFV+SSD+ QM 
Sbjct  181   AGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTTLSKKEEALSVLGADNFVLSSDQDQMK  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             ALSKS DF+I+T+SGD PFD +++LLKT G   LV FPSEVKFSP +LN GMK I GS+ 
Sbjct  241   ALSKSLDFIIDTSSGDHPFDPFMALLKTNGVFVLVAFPSEVKFSPANLNPGMKSITGSVA  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGT++TQE+LEFCA+ KIYP+I+IIPIQYVNEAL+R+I KDV+YRFVI+I   L+
Sbjct  301   GGTRVTQEMLEFCAAHKIYPKIEIIPIQYVNEALQRVINKDVRYRFVIEIENPLE  355



>gb|KCW72652.1| hypothetical protein EUGRSUZ_E01108 [Eucalyptus grandis]
Length=334

 Score =   494 bits (1272),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 249/360 (69%), Positives = 287/360 (80%), Gaps = 31/360 (9%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + ++CLGWAARDPSG LSPY FSRR VGSDDVS+ I +CGVCYADV WTRN+ G 
Sbjct  1     MSSEGAKEDCLGWAARDPSGRLSPYKFSRRTVGSDDVSIRITHCGVCYADVGWTRNMSGR  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPL     IVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+GLEV C K  V 
Sbjct  61    SKYPL-----IVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDGLEVHCEK-MVL  114

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  115   TFDGIDTDGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  174

Query  775   PgkslgviglgglghLAVKFGKAFGL-----KVTVFSTSISKKEEALNLLGADNFVISSD  611
             P                   GK+ G+      VTVFSTSISKKEEAL+LLGAD+FVISSD
Sbjct  175   P-------------------GKSLGVIGLGGLVTVFSTSISKKEEALSLLGADHFVISSD  215

Query  610   EKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCI  431
              +QM A++KS DF+I+TASG+ PFD Y+S+LKT G LALVG  SEVKFSP SLN  M+ +
Sbjct  216   VEQMKAIAKSLDFIIDTASGNHPFDPYMSVLKTGGILALVG-SSEVKFSPASLNHNMRTV  274

Query  430   AGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +GS+TGGTK TQE+++ CA++KIYP I++IPI Y NEALERLIK+DVKYRFVIDI  SLK
Sbjct  275   SGSLTGGTKDTQEMIDLCAAQKIYPNIEVIPIDYANEALERLIKRDVKYRFVIDIENSLK  334



>ref|XP_009397914.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   495 bits (1274),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 256/354 (72%), Positives = 292/354 (82%), Gaps = 0/354 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA    T +CL WAARD SG LSPY F+RR +  DDVSL I +CGVCYADV+WTRN  G 
Sbjct  1     MAGEAGTGDCLAWAARDASGTLSPYRFTRRALRGDDVSLRITHCGVCYADVLWTRNKIGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVG+V   GSGV+  + GD VGVGTYVNSCREC YCNE  EV CSKG+ F
Sbjct  61    SKYPLVPGHEIVGVVTATGSGVKDLRAGDHVGVGTYVNSCRECVYCNEFCEVFCSKGATF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGTVTKGGYSSYIVVHERYCYKIP+ YP   AAPLLCAGITVY+PMMRH MNQ
Sbjct  121   TFNGMDSDGTVTKGGYSSYIVVHERYCYKIPDGYPPDRAAPLLCAGITVYSPMMRHRMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGHLAVKFGKAFGL+VTVFSTS SK+ EAL+LLGAD FVISS++++M 
Sbjct  181   PGKSLGVIGLGGLGHLAVKFGKAFGLQVTVFSTSESKRGEALDLLGADKFVISSNKQEME  240

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L+KS DF+I+TASG  PFD Y+SLLK  G L LVGFP EV+ SP SL  G K I+GS T
Sbjct  241   SLAKSLDFIIDTASGAHPFDPYMSLLKVHGVLVLVGFPGEVRLSPLSLLHGAKTISGSAT  300

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GGTK TQE+L+FCA+ K+YPEI++I IQ +NEAL+RL+ KDVKYRFVIDI  SL
Sbjct  301   GGTKETQEMLDFCAANKVYPEIEVIKIQDINEALDRLVNKDVKYRFVIDIANSL  354



>ref|NP_001064283.2| Os10g0194200 [Oryza sativa Japonica Group]
 dbj|BAF26197.2| Os10g0194200, partial [Oryza sativa Japonica Group]
Length=356

 Score =   494 bits (1273),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 247/357 (69%), Positives = 295/357 (83%), Gaps = 1/357 (0%)
 Frame = -2

Query  1321  TSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIH  1142
             + MA+   + NC  WAARDPSG+LSPY F+RR V SDDVSL I +CGVCYADV WTRNI 
Sbjct  1     SGMAAECGSGNCDAWAARDPSGILSPYKFNRRAVQSDDVSLRITHCGVCYADVAWTRNIL  60

Query  1141  GTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGS  962
               S YPLVPGHEI G+V EVG+ V+ FKVGD VGVGTYVNSCR+CE CN  LE  CS+  
Sbjct  61    NNSMYPLVPGHEIAGVVTEVGADVKSFKVGDHVGVGTYVNSCRDCENCNSSLENYCSQ-H  119

Query  961   VFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNM  782
             VFTF+G+D DGTVTKGGYS++IVVHERYC+KIP+ YPL  AAPLLCAGITVY+PMMRHNM
Sbjct  120   VFTFNGVDTDGTVTKGGYSTHIVVHERYCFKIPDGYPLEKAAPLLCAGITVYSPMMRHNM  179

Query  781   NQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQ  602
             NQPGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STS SK++EA++LLGADNFV+SSDE Q
Sbjct  180   NQPGKSLGVIGLGGLGHMAVKFGKAFGLKVTVISTSESKRKEAIDLLGADNFVVSSDENQ  239

Query  601   MMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGS  422
             M  L  S +F+I+TASGD PFD YL+LLK  G +AL+ FPSE+K  P +LNLG + ++GS
Sbjct  240   METLKSSLNFIIDTASGDHPFDPYLTLLKVGGVMALLSFPSEIKVHPANLNLGGRSLSGS  299

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +TGGTK  QE++ FCA+ KIYP+I++I I Y+NEAL+RL+ +DV++RFVIDI  S K
Sbjct  300   VTGGTKDIQEMINFCAANKIYPDIEMIKIDYINEALQRLVDRDVRFRFVIDIENSFK  356



>sp|Q8H859.1|CADH1_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase 1; Short=OsCAD1 
[Oryza sativa Japonica Group]
 gb|AAN09864.1| putative cinnamyl-alcohol dehydrogenase [Oryza sativa Japonica 
Group]
 gb|AAP52597.1| mannitol dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABB46995.2| mannitol dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY77925.1| hypothetical protein OsI_32967 [Oryza sativa Indica Group]
 gb|EAZ15554.1| hypothetical protein OsJ_30963 [Oryza sativa Japonica Group]
Length=354

 Score =   493 bits (1270),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 247/355 (70%), Positives = 294/355 (83%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+   + NC  WAARDPSG+LSPY F+RR V SDDVSL I +CGVCYADV WTRNI   
Sbjct  1     MAAECGSGNCDAWAARDPSGILSPYKFNRRAVQSDDVSLRITHCGVCYADVAWTRNILNN  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVG+ V+ FKVGD VGVGTYVNSCR+CE CN  LE  CS+  VF
Sbjct  61    SMYPLVPGHEIAGVVTEVGADVKSFKVGDHVGVGTYVNSCRDCENCNSSLENYCSQ-HVF  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGTVTKGGYS++IVVHERYC+KIP+ YPL  AAPLLCAGITVY+PMMRHNMNQ
Sbjct  120   TFNGVDTDGTVTKGGYSTHIVVHERYCFKIPDGYPLEKAAPLLCAGITVYSPMMRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STS SK++EA++LLGADNFV+SSDE QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVISTSESKRKEAIDLLGADNFVVSSDENQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
              L  S +F+I+TASGD PFD YL+LLK  G +AL+ FPSE+K  P +LNLG + ++GS+T
Sbjct  240   TLKSSLNFIIDTASGDHPFDPYLTLLKVGGVMALLSFPSEIKVHPANLNLGGRSLSGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE++ FCA+ KIYP+I++I I Y+NEAL+RL+ +DV++RFVIDI  S K
Sbjct  300   GGTKDIQEMINFCAANKIYPDIEMIKIDYINEALQRLVDRDVRFRFVIDIENSFK  354



>ref|XP_008784622.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 4 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008784623.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 4 isoform 
X1 [Phoenix dactylifera]
Length=359

 Score =   493 bits (1269),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 261/359 (73%), Positives = 298/359 (83%), Gaps = 4/359 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M +   + +CL WAARD SG LSPY F+RRVV  DDV + I +CGVCYADVIWTRN+ G 
Sbjct  1     MGTEIGSGDCLAWAARDASGTLSPYRFNRRVVRRDDVRIKITHCGVCYADVIWTRNMAGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIV EVGS V+ FKVGD  GVGTYV+SC ECEYCN+ LEV CSKGS F
Sbjct  61    SKYPLVPGHEIVGIVTEVGSSVKGFKVGDHAGVGTYVDSCGECEYCNDFLEVHCSKGSTF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ +D DGT+TKGGYSSYI+V ERYCY+IP+ +PLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  121   TFNAVDSDGTITKGGYSSYIIVKERYCYRIPDGFPLAMAAPLLCAGITVYTPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SKKE AL LLGAD FVISSD++QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKKEAALKLLGADKFVISSDKEQME  240

Query  595   AL----SKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIA  428
             +L    +KS DF+I+TASGD  FD Y+SLLK  G L LVGFPSEV+  PGSL+   + IA
Sbjct  241   SLLQSMTKSLDFIIDTASGDHLFDPYMSLLKVGGVLVLVGFPSEVRLHPGSLSYASRTIA  300

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS+TGGTK TQ +LEFCA  K+YPEI++I IQY+NEALERL+K+DVKYRFVID+  SLK
Sbjct  301   GSLTGGTKQTQAMLEFCAENKVYPEIELINIQYINEALERLVKRDVKYRFVIDVQNSLK  359



>ref|XP_002436633.1| hypothetical protein SORBIDRAFT_10g006280 [Sorghum bicolor]
 gb|EER88000.1| hypothetical protein SORBIDRAFT_10g006280 [Sorghum bicolor]
Length=470

 Score =   497 bits (1280),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 255/363 (70%), Positives = 293/363 (81%), Gaps = 4/363 (1%)
 Frame = -2

Query  1330  FEFTS---MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVI  1160
             F F S   MA+     NC  WAARDPSGVLSPY F+RR V S DV+L I YCGVCYADV 
Sbjct  109   FSFCSSVRMAAESENGNCNAWAARDPSGVLSPYTFNRRAVQSSDVALKIIYCGVCYADVK  168

Query  1159  WTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEV  980
             WTRN+   SKYPLVPGHEI G+V +VG+ V+ FKVGD VGVGTYVNSCR+CE CN  LE 
Sbjct  169   WTRNMQHDSKYPLVPGHEIAGVVTQVGADVKGFKVGDHVGVGTYVNSCRDCENCNLSLEN  228

Query  979   QCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTP  800
              C KG V+TF+GID DGTVTKGGYS++IVVHERYC++IP+ YPLA AAPLLCAGITVYTP
Sbjct  229   HCPKG-VYTFNGIDADGTVTKGGYSTHIVVHERYCFQIPDGYPLAKAAPLLCAGITVYTP  287

Query  799   MMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVI  620
             MMRHNM QPGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STS SK++EA+ LLGADNFVI
Sbjct  288   MMRHNMYQPGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSESKRDEAITLLGADNFVI  347

Query  619   SSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGM  440
             SSD +QM +L  S  F+++TASGD PFD YLSLLK  G +A+VGFPSE+K  P SLNLG 
Sbjct  348   SSDTQQMESLKNSLHFIVDTASGDHPFDPYLSLLKVGGVMAIVGFPSEIKMHPASLNLGA  407

Query  439   KCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGG  260
             + ++GS+ GGTK  QE++ FCA  KIYPEI+II I Y+NEAL RL+ +DVKYRFVIDI  
Sbjct  408   RTLSGSLVGGTKDIQEMVNFCAENKIYPEIEIIKIDYINEALARLVNRDVKYRFVIDIEN  467

Query  259   SLK  251
             S K
Sbjct  468   SFK  470



>ref|NP_001131273.1| putative cinnamyl-alcohol dehydrogenase family protein isoform 
1 [Zea mays]
 ref|XP_008658047.1| PREDICTED: putative cinnamyl-alcohol dehydrogenase family protein 
isoform 1 isoform X1 [Zea mays]
 ref|XP_008658048.1| PREDICTED: putative cinnamyl-alcohol dehydrogenase family protein 
isoform 1 isoform X1 [Zea mays]
 ref|XP_008658049.1| PREDICTED: putative cinnamyl-alcohol dehydrogenase family protein 
isoform 1 isoform X1 [Zea mays]
 ref|XP_008658050.1| PREDICTED: putative cinnamyl-alcohol dehydrogenase family protein 
isoform 1 isoform X1 [Zea mays]
 ref|XP_008658052.1| PREDICTED: putative cinnamyl-alcohol dehydrogenase family protein 
isoform 1 isoform X1 [Zea mays]
 gb|ACF79608.1| unknown [Zea mays]
 gb|ACG33153.1| mannitol dehydrogenase [Zea mays]
 gb|ACN35444.1| unknown [Zea mays]
 gb|AFW85480.1| putative cinnamyl-alcohol dehydrogenase family protein isoform 
1 [Zea mays]
 gb|AFW85481.1| putative cinnamyl-alcohol dehydrogenase family protein isoform 
2 [Zea mays]
 gb|AFW85482.1| putative cinnamyl-alcohol dehydrogenase family protein isoform 
3 [Zea mays]
 gb|AFW85483.1| putative cinnamyl-alcohol dehydrogenase family protein isoform 
4 [Zea mays]
Length=354

 Score =   491 bits (1265),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 251/355 (71%), Positives = 289/355 (81%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+     NC  WAARDPSGVLSP++F+RR V S DVSL I YCGVCYADV WTRN    
Sbjct  1     MAAESENGNCKAWAARDPSGVLSPHSFNRRAVQSGDVSLKIIYCGVCYADVAWTRNKLND  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI G+V +VG+ V+ FKVGD VGVGTYVNSCR+CE CN  L+  C K +V+
Sbjct  61    SKYPLVPGHEIAGVVTQVGADVKGFKVGDHVGVGTYVNSCRDCENCNISLDNHCPK-AVY  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DGTVTKGGYS++IVVHERYC+KIP+ YPLA AAPLLCAGITVYTPMMRHNMNQ
Sbjct  120   TFNGIDTDGTVTKGGYSTHIVVHERYCFKIPDGYPLAKAAPLLCAGITVYTPMMRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SK++EA+NLLGADNFVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKRDEAINLLGADNFVISSDTQQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S  F+I+TASGD PFD Y SLLK  G + LVGFPSE+K  P SL LG + ++GS+ 
Sbjct  240   SLKNSLHFIIDTASGDHPFDPYFSLLKVGGVMTLVGFPSEIKMHPASLILGARTLSGSVV  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GG K  QE++ FCA+  IYPEI+II I Y+NEAL RL+ +DVKYRFVIDI  S K
Sbjct  300   GGIKDIQEMVNFCAANNIYPEIEIIKIDYINEALARLVNRDVKYRFVIDIENSFK  354



>gb|KCW72651.1| hypothetical protein EUGRSUZ_E01107 [Eucalyptus grandis]
Length=323

 Score =   490 bits (1261),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 239/355 (67%), Positives = 281/355 (79%), Gaps = 32/355 (9%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARDPSG LSPY F+RR VGS+DVS+ I +CGVCYADV WTRN+ G 
Sbjct  1     MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYADVAWTRNVQGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPG EIVGIVK+VGS VQRFKVG+ VGVGTYVNSCRECEYCN+ LE QC K +V 
Sbjct  61    SKYPLVPGLEIVGIVKQVGSSVQRFKVGNHVGVGTYVNSCRECEYCNDRLETQCEK-AVL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH   +
Sbjct  120   TFDGIDADGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRH--KE  177

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             P                               TSISKKE AL+LLGAD+FVISSD +QM 
Sbjct  178   PT-----------------------------CTSISKKEGALSLLGADHFVISSDVEQMK  208

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             A++KS DF+I+TA+GD PFD Y+S+LKT G LALVGFPSEVKFSP SLNL M+ ++GS+T
Sbjct  209   AIAKSLDFIIDTAAGDHPFDPYMSVLKTGGILALVGFPSEVKFSPASLNLNMRTVSGSVT  268

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+++ CA++KIYP+I++IPI Y NEALERLIK+D+KYRFVIDI  SLK
Sbjct  269   GGTKDTQEMIDLCAAQKIYPKIEVIPIDYANEALERLIKRDIKYRFVIDIENSLK  323



>ref|XP_002322570.2| hypothetical protein POPTR_0016s02390g [Populus trichocarpa]
 gb|EEF04331.2| hypothetical protein POPTR_0016s02390g [Populus trichocarpa]
Length=354

 Score =   491 bits (1263),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 259/355 (73%), Positives = 303/355 (85%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MAS  S +NCL WAA+D SGVLSPY F RR VG DD+S+ I +CG+CYADV++TRN    
Sbjct  1     MASDKS-ENCLAWAAKDESGVLSPYKFKRRDVGKDDISVKITHCGICYADVLYTRNKFKK  59

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YP+VPGHEIVG V+EVGS VQRFK+GD VGVGT++NSCR+CEYCN+GLEV C+ G + 
Sbjct  60    SLYPVVPGHEIVGTVQEVGSDVQRFKIGDHVGVGTFINSCRDCEYCNDGLEVHCANGVIT  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ +DVDGT+TKGGYSS+IVVHERYC++IP+ YPLA AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFNSVDVDGTITKGGYSSFIVVHERYCHRIPDGYPLALAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGK FG+ VTVFSTSISKKEEALNLLGADNFV+SSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKVFGMNVTVFSTSISKKEEALNLLGADNFVVSSDTEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DF+I+TASG+ PFD Y++ LKTAG L LVG PSE+K +P  L LGM  I+GS T
Sbjct  240   ALDKSLDFIIDTASGEHPFDPYITTLKTAGVLVLVGAPSEMKLTPLKLLLGMISISGSAT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L+FC + KIYP++++IPIQ VNEALERLIK DVKYRFVIDIG SLK
Sbjct  300   GGTKHTQEMLDFCGTHKIYPKVEVIPIQSVNEALERLIKNDVKYRFVIDIGNSLK  354



>ref|XP_006661676.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like [Oryza 
brachyantha]
Length=354

 Score =   490 bits (1262),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 247/355 (70%), Positives = 294/355 (83%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+   + NC  WAARDPSG+LS Y F+RR V SDDVS+ I +CGVCYADV WTRNI   
Sbjct  1     MAAECGSGNCEAWAARDPSGILSLYKFNRRAVQSDDVSVRITHCGVCYADVAWTRNILNN  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVG+ V+ FKVGD VGVGTYVNSCR+CE CN  LE  CSKG VF
Sbjct  61    SMYPLVPGHEIAGVVTEVGADVKNFKVGDHVGVGTYVNSCRDCENCNSSLENYCSKG-VF  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGTVTKGGYSS+IVVH+RYC+KIP+ YPL  AAPLLCAGITVYTPMMRHNMNQ
Sbjct  120   TFNGVDTDGTVTKGGYSSHIVVHDRYCFKIPDGYPLEKAAPLLCAGITVYTPMMRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STS SK++EA++LLGADNFV+SSD+ +M 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVISTSESKRKEAIDLLGADNFVLSSDKNEME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S  F+I+TASGD PFD YLSLLK  G +AL+ FPSE+K  P +LNLG + ++GS+T
Sbjct  240   SLKSSLHFIIDTASGDHPFDPYLSLLKVGGVMALLSFPSEIKVHPANLNLGGRSLSGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE++ FCA+ KI+P+I++I I Y NEAL+RL+ +DV++RFVIDI  S K
Sbjct  300   GGTKDTQEMINFCAANKIFPDIEMIKIDYANEALQRLVDRDVRFRFVIDIENSFK  354



>ref|XP_010234664.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Brachypodium 
distachyon]
 ref|XP_010234665.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Brachypodium 
distachyon]
Length=354

 Score =   490 bits (1262),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 248/355 (70%), Positives = 291/355 (82%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+   + NC  WAA+DPSG LSPY F+RR V S D+SL I +CGVCYADVIWTRN H  
Sbjct  1     MAAECESGNCHAWAAKDPSGTLSPYKFNRRTVQSGDISLRITHCGVCYADVIWTRNQHND  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVGS V  FKVGD V VGTYVNSCR+CE CN  LE  CSK  VF
Sbjct  61    SVYPLVPGHEIAGVVTEVGSDVNGFKVGDHVCVGTYVNSCRDCENCNSFLENHCSK-FVF  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGTVTKGGYS +IVVHERYCYKIP+ YPL  AAPL+CAGITVYTPM+RHNMNQ
Sbjct  120   TFNGVDTDGTVTKGGYSGHIVVHERYCYKIPDGYPLEKAAPLVCAGITVYTPMIRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGK+FGLKVTVFSTS SK+EEA++LLGADNFVISSD+KQM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKSFGLKVTVFSTSESKREEAISLLGADNFVISSDKKQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S  F+++TASG+ PFD YLSLLK  G +AL+ FP E++  P +LNLG + +AGS+T
Sbjct  240   SLKSSLHFIVDTASGNHPFDPYLSLLKVGGVMALLSFPEEIRIHPATLNLGARTLAGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE++ FCA+ KIYP+I++I I Y+NEAL RL+ +DV+YRFVIDI  S K
Sbjct  300   GGTKDTQEMINFCAANKIYPDIELIKIDYINEALGRLVNRDVRYRFVIDIENSFK  354



>emb|CDM85988.1| unnamed protein product [Triticum aestivum]
Length=354

 Score =   489 bits (1260),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 244/355 (69%), Positives = 290/355 (82%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+   + NC  WAA DPSGVLSP++F+RR    DDVSL I +CGVCYADV WTRN+H  
Sbjct  1     MAAESESCNCSAWAANDPSGVLSPHSFNRRAARHDDVSLRITHCGVCYADVQWTRNLHHD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVGS V+ FK+GD V VGTY+NSCR+C+ CN  LE  CS   VF
Sbjct  61    SVYPLVPGHEIAGVVTEVGSDVKGFKLGDHVAVGTYINSCRDCDNCNSLLENHCSN-FVF  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGTVTKGGYS++IVVHERYCYKIP+ YPL  AAPL CAGITVYTPM+RHNMNQ
Sbjct  120   TFNGVDTDGTVTKGGYSTHIVVHERYCYKIPDGYPLEKAAPLACAGITVYTPMIRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTV STS SK++EA+NLLGADNFV+SSD+ QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLNVTVLSTSESKRDEAINLLGADNFVVSSDKNQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S DF+++TASGD PFD YL+LLK  G +ALVGFP E++  P +LNLG + ++GS+ 
Sbjct  240   SLKNSLDFIVDTASGDHPFDPYLALLKVRGVMALVGFPGEIRVHPATLNLGARTLSGSVV  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE++ FCA+ KIYP+I+II I Y+NEALERL+ +DVKYRFVIDI  S K
Sbjct  300   GGTKDTQEMINFCAANKIYPDIEIIKIDYINEALERLVNRDVKYRFVIDIESSFK  354



>ref|XP_002436635.1| hypothetical protein SORBIDRAFT_10g006300 [Sorghum bicolor]
 gb|EER88002.1| hypothetical protein SORBIDRAFT_10g006300 [Sorghum bicolor]
Length=354

 Score =   489 bits (1260),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/355 (69%), Positives = 291/355 (82%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+     NC  WAARDPSGVLSPY+F+RR V S+DV+L I YCGVCYADV WTRN+   
Sbjct  1     MAAESENSNCNAWAARDPSGVLSPYSFNRRAVQSNDVALKIIYCGVCYADVAWTRNVLND  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI G+V +VG+ V+ FKVGD VGVGTYVNSCR+CE CN  LE  C K +V+
Sbjct  61    SKYPLVPGHEIAGVVTQVGADVKGFKVGDHVGVGTYVNSCRDCENCNSSLENHCPK-AVY  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DGTVT GGYS++IVVH RYC++IP+ YPLA AAPLLCAGITVYTPMMRHNMNQ
Sbjct  120   TFNGIDTDGTVTMGGYSTHIVVHARYCFQIPDGYPLAKAAPLLCAGITVYTPMMRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SK++EA+NLLGADNFVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKRDEAINLLGADNFVISSDTQQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S  F+++TASGD PFD +LSLLK  G + +VG PSE+K  P SL LG + ++GS+ 
Sbjct  240   SLKNSLHFIVDTASGDHPFDPFLSLLKAGGVMTVVGSPSEIKMQPASLILGARTLSGSLV  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE++ FCA+ KIYP+I++I I Y+NEAL RL+ +DVKYRFVIDI  S K
Sbjct  300   GGTKDIQEMVNFCAANKIYPKIEVIRIDYINEALARLVNRDVKYRFVIDIENSFK  354



>dbj|BAJ98188.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   488 bits (1256),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 241/355 (68%), Positives = 291/355 (82%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+   + NC  WAA+DPSGVLSP++F+RR V  DDVSL I +CGVC+ADV WTRN+H  
Sbjct  1     MAAESESCNCSAWAAKDPSGVLSPHSFNRRAVRHDDVSLRITHCGVCFADVQWTRNLHHD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVGS V+ FK+GD V VGTY+NSCR+C+ CN  LE  CS   VF
Sbjct  61    SVYPLVPGHEIAGVVTEVGSDVKGFKLGDHVAVGTYINSCRDCDNCNSLLENHCSN-FVF  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGTVTKGGYS++IVVHERYCYKIP+ YPL  AAPL CAGITVYTPM RHNMNQ
Sbjct  120   TFNGVDTDGTVTKGGYSTHIVVHERYCYKIPDGYPLEKAAPLACAGITVYTPMTRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFG+ VTV STS SK++EA+NLLGADNFV+SSD+ QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGMNVTVLSTSESKRDEAINLLGADNFVVSSDKNQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S DF+++TASGD PFD YL+LLK  G +ALVGFP E++  P +LNLG + ++GS+ 
Sbjct  240   SLKNSLDFIVDTASGDHPFDPYLALLKVRGLMALVGFPGEIRVHPATLNLGARTLSGSVV  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE++ FCA+ KIYP++++I I Y+NEALERL+ +DVKYRFVIDI  S K
Sbjct  300   GGTKDTQEMINFCAANKIYPDVEVIKIDYINEALERLVNRDVKYRFVIDIESSFK  354



>gb|EPS65133.1| hypothetical protein M569_09642, partial [Genlisea aurea]
Length=351

 Score =   488 bits (1256),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 253/349 (72%), Positives = 286/349 (82%), Gaps = 0/349 (0%)
 Frame = -2

Query  1300  STDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPL  1121
             ++ +CLGWAARD SG LSPY+F+RR VGSDDVS+ I +CGVCYADV WTRN  G +KYP+
Sbjct  3     ASRDCLGWAARDSSGHLSPYHFTRRAVGSDDVSIKILHCGVCYADVAWTRNKIGGTKYPV  62

Query  1120  VPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGI  941
             VPGHEIVGIV EVGS V++ KVGD VGVGTYVNSCR+C+ C   LEV CSKG V TFDG+
Sbjct  63    VPGHEIVGIVTEVGSDVRKHKVGDHVGVGTYVNSCRKCDNCENDLEVHCSKGHVLTFDGV  122

Query  940   DVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgksl  761
             D DGT+TKGGYS++IVVH+RY ++IPENYPL  AAPLLCAGITV+TPMMR NMNQPGKSL
Sbjct  123   DEDGTITKGGYSTHIVVHQRYIFRIPENYPLEFAAPLLCAGITVFTPMMRFNMNQPGKSL  182

Query  760   gviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKS  581
             GVIGLGGLGHLAVKFGKAFGLKV VFSTS SKKE+AL LLGAD+FVISSDE QM    KS
Sbjct  183   GVIGLGGLGHLAVKFGKAFGLKVVVFSTSSSKKEDALTLLGADDFVISSDENQMKGYEKS  242

Query  580   FDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKL  401
              DF+INTAS DI  D YL LLK  G L  VG PS VKFSP ++ L  + +AGS+ GG K 
Sbjct  243   LDFIINTASADIAADSYLKLLKPLGVLVFVGVPSVVKFSPFNILLDSRTVAGSLVGGLKQ  302

Query  400   TQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             TQE+L FCA  KIYPEI+ IPIQY N+ALER+I KDVKYRFVIDI  SL
Sbjct  303   TQEMLYFCADHKIYPEIEQIPIQYSNQALERMINKDVKYRFVIDIANSL  351



>ref|XP_011041298.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
 ref|XP_011010097.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
Length=354

 Score =   488 bits (1256),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 258/355 (73%), Positives = 303/355 (85%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MAS  S +NCL WAA+D SGVLSPY F RR VG DD+S+ I +CG+CYADV++TRN    
Sbjct  1     MASDKS-ENCLAWAAKDESGVLSPYEFKRRDVGKDDISVKITHCGICYADVLYTRNKFKK  59

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YP+VPGHEIVG V+EVGS VQRFK+GD VGVGT++NSCR+CEYCN+GLEV C+ G + 
Sbjct  60    SLYPVVPGHEIVGTVQEVGSDVQRFKMGDHVGVGTFINSCRDCEYCNDGLEVHCANGVIT  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ +DVDGT+TKGGYSS+IVVHERYC++IP+ YPLA AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFNSVDVDGTITKGGYSSFIVVHERYCHRIPDGYPLALAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFG+ VTVFSTSISKKEEALNLLGADNFV+SSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGMNVTVFSTSISKKEEALNLLGADNFVVSSDTEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DF+I+TASG+ PFD Y++ LKTAG L LVG PSE+K +P  L +GM  I+GS T
Sbjct  240   ALDKSLDFIIDTASGEHPFDPYITTLKTAGVLVLVGAPSEMKLTPLKLLVGMISISGSAT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L+FC + KIYP++++IPIQ VNEALERLIK DVKYRFVIDI  SLK
Sbjct  300   GGTKHTQEMLDFCGTHKIYPKVEVIPIQSVNEALERLIKNDVKYRFVIDIENSLK  354



>ref|XP_002322573.2| hypothetical protein POPTR_0016s02360g [Populus trichocarpa]
 gb|EEF04334.2| hypothetical protein POPTR_0016s02360g [Populus trichocarpa]
Length=354

 Score =   487 bits (1254),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 259/355 (73%), Positives = 302/355 (85%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MAS  S +NC  WAA+D SGVLSPY F RR VG DD+S+ I +CG+CYADV+ TRN  G 
Sbjct  1     MASDKS-ENCPAWAAKDESGVLSPYKFKRRDVGKDDISVKITHCGICYADVLLTRNKFGK  59

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YP+VPGHEIVG V+EVGS VQRFK+GD VGVGT++NSCR+CEYCN+GLEV C+ G + 
Sbjct  60    SLYPVVPGHEIVGTVQEVGSDVQRFKIGDHVGVGTFINSCRDCEYCNDGLEVHCANGIIT  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T + +DVDGT+TKGGYSS+IVVHERYC++IP+ YPLA AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TINSVDVDGTITKGGYSSFIVVHERYCHRIPDGYPLALAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFG+ VTVFSTSISKKEEALNLLGADNFV+SSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGMNVTVFSTSISKKEEALNLLGADNFVVSSDTEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL KS DF+I+TASG+ PFD Y++ LKTAG LALVG PSE+K +P  L LGM  I+GS T
Sbjct  240   ALDKSLDFIIDTASGEHPFDPYITTLKTAGVLALVGAPSEMKLTPLKLLLGMISISGSAT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L+FC + KIYP++++IPIQ VNEALERLIK DVKYRFVIDI  SLK
Sbjct  300   GGTKHTQEMLDFCGTHKIYPKVEVIPIQSVNEALERLIKNDVKYRFVIDIENSLK  354



>gb|EMT27281.1| Putative cinnamyl alcohol dehydrogenase 1 [Aegilops tauschii]
Length=354

 Score =   487 bits (1254),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 243/355 (68%), Positives = 289/355 (81%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+   + NC  WAA DPSGVLSP++F+RR V  DDVSL I +CGVCYADV WTRN+H  
Sbjct  1     MAAESESCNCSAWAANDPSGVLSPHSFNRRAVRHDDVSLRITHCGVCYADVQWTRNLHHD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVGS V+ FK GD V VGTY+NSCR+C+ CN  LE  CS   VF
Sbjct  61    SVYPLVPGHEIAGVVTEVGSDVKGFKPGDHVAVGTYINSCRDCDNCNNLLENHCSN-FVF  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGTVTKGGYS++IVVHERYCYKIP+ YPL  AAPL CAGITVYTPM+RHNMNQ
Sbjct  120   TFNGVDTDGTVTKGGYSTHIVVHERYCYKIPDGYPLDKAAPLACAGITVYTPMIRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTV STS SK++EA+NLLGADNFV+SSD+ QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLNVTVLSTSESKRDEAINLLGADNFVVSSDKNQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
              L  S DF+++TASGD PFD YL+LLK  GT+ALVGFP E++  P +LNLG + ++GS+ 
Sbjct  240   FLKNSLDFIVDTASGDHPFDPYLALLKVRGTMALVGFPGEIRVHPATLNLGARTLSGSVV  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE++ FCA+ +IYP +++I I Y+NEALERL+ +DVKYRFVIDI  S K
Sbjct  300   GGTKDTQEMINFCAANRIYPNVEVIKIDYINEALERLVNRDVKYRFVIDIESSFK  354



>sp|Q2R114.2|CADH4_ORYSJ RecName: Full=Putative cinnamyl alcohol dehydrogenase 4; Short=OsCAD4 
[Oryza sativa Japonica Group]
 gb|EEC68559.1| hypothetical protein OsI_36879 [Oryza sativa Indica Group]
Length=354

 Score =   482 bits (1240),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/355 (69%), Positives = 290/355 (82%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+   + NC  WAARDPSG+LSPY F+RR V S+DVSL I +CGVCYADVIWTRN+   
Sbjct  1     MAAECGSGNCDAWAARDPSGILSPYKFNRREVQSEDVSLRITHCGVCYADVIWTRNMFND  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVG+ V+ FKVGD VGVG YVNSC++CE CN  LE  CSK  V 
Sbjct  61    SIYPLVPGHEIAGVVTEVGADVKGFKVGDHVGVGVYVNSCQDCENCNSSLENHCSK-CVV  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T++ +D DGTVTKGGYSS+I+VH+RYC+KIP +YPL+ AAPLLCAGITVYTPM+RHNMNQ
Sbjct  120   TYNSVDSDGTVTKGGYSSHILVHQRYCFKIPADYPLSKAAPLLCAGITVYTPMIRHNMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SK+EEA+NLLGADNFVISSDE QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKREEAINLLGADNFVISSDENQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S  F+I+TASGD  FD YLSLLK  G + L+ FPSE+K  P +LNL  + +AGS+T
Sbjct  240   SLKSSLHFIIDTASGDHQFDPYLSLLKVGGVMVLLSFPSEIKVHPENLNLAARSLAGSVT  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE++ FCA+  +YP+I++I I YVNEAL+RLI +DV++RFVIDI  S K
Sbjct  300   GGTKDIQEMINFCAANNVYPDIEMIKIDYVNEALQRLINRDVRFRFVIDIENSFK  354



>ref|NP_001147757.1| mannitol dehydrogenase [Zea mays]
 gb|ACG28596.1| mannitol dehydrogenase [Zea mays]
Length=354

 Score =   481 bits (1239),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 245/355 (69%), Positives = 283/355 (80%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA++    NC  WAARDPSGVLSPY F+RR V S DVSL I YCGVCY DV+W +N H  
Sbjct  1     MAAAAEHGNCDAWAARDPSGVLSPYKFNRRAVQSSDVSLKIIYCGVCYGDVMWIQNKHND  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVG+ V+ FKVGD  GVGTYVNSCR CE CN  LE  C + +VF
Sbjct  61    SVYPLVPGHEIAGVVTEVGADVKAFKVGDHAGVGTYVNSCRHCENCNSSLENYCPE-TVF  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T++  D DGT+TKGGYS++IVVHERYC+KIP+ YPLA AAPLLCAGITVYTPM RHNM Q
Sbjct  120   TYNTTDADGTITKGGYSTHIVVHERYCFKIPDGYPLAKAAPLLCAGITVYTPMARHNMKQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SK+EEA+NLLGADNFVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKREEAINLLGADNFVISSDTQQME  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             AL  S  F+++TASGD PFD YLSLLK  G + +V FPSE+K  P SLN G + ++GSI 
Sbjct  240   ALKNSLHFIVDTASGDHPFDPYLSLLKVGGVMTIVCFPSEIKMHPASLNRGGRTLSGSIV  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE++ FCA  KIYPEI+II + Y+NEAL RL+ +DVKYRFVIDI  S +
Sbjct  300   GGTKDIQEMVNFCAENKIYPEIEIIKMDYINEALARLVNRDVKYRFVIDIKNSFE  354



>tpg|DAA35929.1| TPA: putative cinnamyl-alcohol dehydrogenase family protein [Zea 
mays]
Length=432

 Score =   484 bits (1245),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 248/363 (68%), Positives = 287/363 (79%), Gaps = 4/363 (1%)
 Frame = -2

Query  1339  CCSFEFTSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVI  1160
             C SF+   MA++    NC  WAARDPSGVLSPY F+RR V S DVSL I YCGVCY DV+
Sbjct  74    CSSFQ---MAAAAEHGNCDAWAARDPSGVLSPYKFNRRAVQSSDVSLKIIYCGVCYGDVM  130

Query  1159  WTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEV  980
             W +N H  S YPLVPGHEI G+V EVG+ V+ FKVGD  GVGTYVNSCR CE CN  LE 
Sbjct  131   WIQNKHNDSVYPLVPGHEIAGVVTEVGADVKAFKVGDHAGVGTYVNSCRHCENCNSSLEN  190

Query  979   QCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTP  800
              C + +VFT++  D DGT+TKGGYS++IVVHERYC+KIP+ YPLA AAPLLCAGITVYTP
Sbjct  191   YCPE-TVFTYNTTDADGTITKGGYSTHIVVHERYCFKIPDGYPLAQAAPLLCAGITVYTP  249

Query  799   MMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVI  620
             M RHNM QPGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SK+EEA+NLLGADNFVI
Sbjct  250   MARHNMKQPGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKREEAINLLGADNFVI  309

Query  619   SSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGM  440
             SSD +QM AL  S  F+++TASGD PFD YLSLLK  G + +V FPSE+K  P SLN G 
Sbjct  310   SSDTQQMEALKNSLHFIVDTASGDHPFDPYLSLLKVGGVMTIVCFPSEIKMHPASLNRGG  369

Query  439   KCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGG  260
             + ++GSI GGTK  QE++ FCA  KIYPEI+II + Y+NEAL RL+ +DVKYRFVIDI  
Sbjct  370   RTLSGSIVGGTKDIQEMVNFCAENKIYPEIEIIKMDYINEALARLVNRDVKYRFVIDIKN  429

Query  259   SLK  251
             S +
Sbjct  430   SFE  432



>ref|XP_010052172.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 gb|KCW76090.1| hypothetical protein EUGRSUZ_D00468 [Eucalyptus grandis]
Length=357

 Score =   481 bits (1237),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 250/348 (72%), Positives = 286/348 (82%), Gaps = 1/348 (0%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
             NC GWAARD SG LSPY F RR VG +DVS+ I +CGVCYADV+ TRN    SKYP+VPG
Sbjct  10    NCHGWAARDDSGFLSPYEFGRRAVGKEDVSVKITHCGVCYADVLCTRNKLKHSKYPMVPG  69

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVGI+ EVG  + +FK+GD VGVGTYV+SCR+CE C+ GLE+ C KG+V T  G   D
Sbjct  70    HEIVGIITEVGRDIGKFKIGDHVGVGTYVDSCRDCENCDGGLEIHCLKGAVSTIGGTYAD  129

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             G+  KGGYS +IVVHERYCYKIP+NYPLA AAPLLCAGITVYTPM+RHNMNQPGKSLGVI
Sbjct  130   GSTCKGGYSQFIVVHERYCYKIPDNYPLAQAAPLLCAGITVYTPMIRHNMNQPGKSLGVI  189

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGHLAVKFGKAFGL VTV STS SKK++ALNLL ADNFV+SSD++QM  LSKS DF
Sbjct  190   GLGGLGHLAVKFGKAFGLNVTVCSTSTSKKDDALNLLKADNFVLSSDKEQMSVLSKSLDF  249

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFP-SEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+TASGD P DLY+SLLKT G LALVGFP  E+K SP SL +  + I+GS  GGTK TQ
Sbjct  250   IIDTASGDHPLDLYMSLLKTGGVLALVGFPGEELKLSPLSLLMDTRSISGSAVGGTKRTQ  309

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+LEFCA  +I+PEI++IPIQY NEALERL K DVKYRFVIDI  SL+
Sbjct  310   EMLEFCAKHEIHPEIEVIPIQYSNEALERLQKNDVKYRFVIDIENSLE  357



>gb|EMS58457.1| putative cinnamyl alcohol dehydrogenase 1 [Triticum urartu]
Length=389

 Score =   480 bits (1235),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 247/386 (64%), Positives = 294/386 (76%), Gaps = 34/386 (9%)
 Frame = -2

Query  1309  SSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSK  1130
             S   T NC  WAA+DPSG+LSP++F+RR V  DDVSL I +CGVCYADVIWT+N H  S 
Sbjct  5     SQTETGNCSAWAAKDPSGILSPHSFNRRTVRHDDVSLRITHCGVCYADVIWTKNRHNDSV  64

Query  1129  YPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTF  950
             YPLVPGHEI G+V EVGS V+ FK+GD V VGTYVNSCR+C+ CN  LE  CSK  VFTF
Sbjct  65    YPLVPGHEIAGVVTEVGSDVKGFKLGDHVAVGTYVNSCRDCDNCNSFLENHCSK-FVFTF  123

Query  949   DGIDVDGTVTKGGYSSYIVVHER---------------------------------YCYK  869
             +G+D DG VTKGGYS++IVVHER                                 YCYK
Sbjct  124   NGVDTDGAVTKGGYSTHIVVHERLSLDNRRGNSFLPPVKTHVSRIRILHLLLIHVRYCYK  183

Query  868   IPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVT  689
             IP+ YPL  AAPL+CAGITVYTPM RHNMNQPGKSLGVIGLGGLGH+AVKFGKAFGLKVT
Sbjct  184   IPDGYPLEKAAPLVCAGITVYTPMTRHNMNQPGKSLGVIGLGGLGHMAVKFGKAFGLKVT  243

Query  688   VFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTA  509
             V STS SK++EA+++LGADNFV+SSD+KQM +L  S DF+++TASGD PFD YL+LLK  
Sbjct  244   VLSTSESKRDEAISVLGADNFVVSSDKKQMESLKNSLDFIVDTASGDHPFDPYLALLKVG  303

Query  508   GTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQY  329
             G +ALVGFP E++  P +LNLG + ++GS+TGGTK TQE++ FCA+ KIYPEI++I I Y
Sbjct  304   GVMALVGFPGEIRVHPATLNLGARTLSGSVTGGTKDTQEMMNFCAANKIYPEIEVIKIDY  363

Query  328   VNEALERLIKKDVKYRFVIDIGGSLK  251
             VNEALERL+ +DV+YRFVIDI GS K
Sbjct  364   VNEALERLVNRDVRYRFVIDIEGSFK  389



>ref|XP_009361515.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform 
X2 [Pyrus x bretschneideri]
Length=326

 Score =   477 bits (1228),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 240/322 (75%), Positives = 282/322 (88%), Gaps = 0/322 (0%)
 Frame = -2

Query  1216  SDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGV  1037
             +DDVS+ I +CG+CYADV++ RN HG + YP+VPGHEI GIV+EVG  V  FKVGD VGV
Sbjct  5     NDDVSIRITHCGICYADVVFPRNKHGYANYPMVPGHEIAGIVQEVGPNVHGFKVGDHVGV  64

Query  1036  GTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPEN  857
             GT+VNSCR+C+YC +GLE+ C KG VFT++ +D DGT+TKGG+SSYIV HERYC+KIPE 
Sbjct  65    GTFVNSCRDCDYCRDGLEISCEKGIVFTYNHVDADGTITKGGFSSYIVAHERYCFKIPEG  124

Query  856   YPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTVFST  677
             YPLASAAPLLCAGITVY+PM+RH MNQ GKSLGVIGLGGLGHLAVKFGKAFGL VTVFST
Sbjct  125   YPLASAAPLLCAGITVYSPMIRHKMNQDGKSLGVIGLGGLGHLAVKFGKAFGLNVTVFST  184

Query  676   SISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLA  497
             S+SKKEEAL+LLGADNFV+SS++++M AL+KS DF+I+TASGD PFDLY+SLLKTAG L 
Sbjct  185   SLSKKEEALSLLGADNFVVSSNQEEMTALAKSLDFIIDTASGDHPFDLYMSLLKTAGVLV  244

Query  496   LVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEA  317
             LVG P+EVK SPGSL  GMK I+GS  GGTK TQE+L+FCA+ KIYP I+I+PIQYVNEA
Sbjct  245   LVGAPTEVKLSPGSLIGGMKSISGSAAGGTKQTQEMLDFCAAHKIYPNIEIVPIQYVNEA  304

Query  316   LERLIKKDVKYRFVIDIGGSLK  251
             LER+IK+DVKYRFVIDI  SLK
Sbjct  305   LERMIKRDVKYRFVIDIENSLK  326



>ref|XP_010934171.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Elaeis 
guineensis]
Length=358

 Score =   474 bits (1219),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 250/362 (69%), Positives = 294/362 (81%), Gaps = 11/362 (3%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M +   + +CL WAARD SG+LSPY F+RRVV S+DV ++I +CGVCY +   +R   G+
Sbjct  1     MDTEIGSGDCLAWAARDASGILSPYRFNRRVVRSNDVRIEITHCGVCYFEAT-SRVEMGS  59

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
                 L   HEIVG+V EVGS V+ FKVGD  GVGTYVNSC ECEYCN+ LEV CSKGS+F
Sbjct  60    IIQEL---HEIVGVVTEVGSNVKGFKVGDHAGVGTYVNSCGECEYCNDFLEVHCSKGSIF  116

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+D DGT+TKGGYSSYI+V ERYCY IP+ YPLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  117   TFNGLDSDGTITKGGYSSYIIVKERYCYMIPDGYPLAMAAPLLCAGITVYTPMMRHKMNQ  176

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SKKEEAL LLGAD FVISSD++QM 
Sbjct  177   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSKSKKEEALKLLGADKFVISSDQQQME  236

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGM-------K  437
             +++KS DF+++TASGD PFD Y+SLLK  G L LVGFPSEV+ +PGSLNLG+        
Sbjct  237   SMTKSLDFIVDTASGDHPFDPYMSLLKIGGVLVLVGFPSEVRLNPGSLNLGILLYXXXXX  296

Query  436   CIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGS  257
               +GS+TGGTK TQ +LEFCA+ K+YPEI++I IQY+NEA+ERLI +DVKYRFVIDI  S
Sbjct  297   XXSGSLTGGTKETQRMLEFCAANKVYPEIELINIQYINEAIERLINRDVKYRFVIDIKNS  356

Query  256   LK  251
             LK
Sbjct  357   LK  358



>ref|XP_008784624.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 4 isoform 
X2 [Phoenix dactylifera]
 ref|XP_008784625.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 4 isoform 
X2 [Phoenix dactylifera]
Length=356

 Score =   474 bits (1219),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 245/333 (74%), Positives = 280/333 (84%), Gaps = 4/333 (1%)
 Frame = -2

Query  1237  FSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFK  1058
             ++ RVV  DDV + I +CGVCYADVIWTRN+ G SKYPLVPGHEIVGIV EVGS V+ FK
Sbjct  24    YASRVVRRDDVRIKITHCGVCYADVIWTRNMAGDSKYPLVPGHEIVGIVTEVGSSVKGFK  83

Query  1057  VGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERY  878
             VGD  GVGTYV+SC ECEYCN+ LEV CSKGS FTF+ +D DGT+TKGGYSSYI+V ERY
Sbjct  84    VGDHAGVGTYVDSCGECEYCNDFLEVHCSKGSTFTFNAVDSDGTITKGGYSSYIIVKERY  143

Query  877   CYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAVKFGKAFGL  698
             CY+IP+ +PLA AAPLLCAGITVYTPMMRH MNQPGKSLGVIGLGGLGH+AVKFGKAFGL
Sbjct  144   CYRIPDGFPLAMAAPLLCAGITVYTPMMRHKMNQPGKSLGVIGLGGLGHMAVKFGKAFGL  203

Query  697   KVTVFSTSISKKEEALNLLGADNFVISSDEKQMMAL----SKSFDFLINTASGDIPFDLY  530
             KVTVFSTS SKKE AL LLGAD FVISSD++QM +L    +KS DF+I+TASGD  FD Y
Sbjct  204   KVTVFSTSESKKEAALKLLGADKFVISSDKEQMESLLQSMTKSLDFIIDTASGDHLFDPY  263

Query  529   LSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRKIYPEI  350
             +SLLK  G L LVGFPSEV+  PGSL+   + IAGS+TGGTK TQ +LEFCA  K+YPEI
Sbjct  264   MSLLKVGGVLVLVGFPSEVRLHPGSLSYASRTIAGSLTGGTKQTQAMLEFCAENKVYPEI  323

Query  349   DIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             ++I IQY+NEALERL+K+DVKYRFVID+  SLK
Sbjct  324   ELINIQYINEALERLVKRDVKYRFVIDVQNSLK  356



>ref|XP_006380944.1| hypothetical protein POPTR_0006s02520g [Populus trichocarpa]
 gb|ERP58741.1| hypothetical protein POPTR_0006s02520g [Populus trichocarpa]
Length=354

 Score =   462 bits (1190),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 261/355 (74%), Positives = 303/355 (85%), Gaps = 1/355 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MAS  S +NCLGWAARD SGVLSPY F+RR VG DD+S+ I +CG+CYADV++TR     
Sbjct  1     MASDKS-ENCLGWAARDESGVLSPYEFNRRAVGKDDISVRITHCGMCYADVLYTRGKSRK  59

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YP+VPGHEIVGIV+E GS V RFK+GD VGVGTYVNSCR+CEYC++GLEV C+ G V 
Sbjct  60    SLYPVVPGHEIVGIVQEAGSDVHRFKIGDHVGVGTYVNSCRDCEYCDDGLEVHCADGIVT  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+G+DVDGT+T+GGYSS+IVVHERYCY IP++YPLA AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFNGVDVDGTITRGGYSSFIVVHERYCYNIPDSYPLALAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGHLAVKFGKAFGL VTVFSTS+SKKEEAL +LGA+NFV+SSD++QM 
Sbjct  180   PGKSLGVIGLGGLGHLAVKFGKAFGLYVTVFSTSMSKKEEALTILGAENFVVSSDKEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
              L KS DF+I+TASGD  FD Y+S LKTAG L LVG P+E+K SP +L LGM  I+GS+ 
Sbjct  240   TLDKSLDFIIDTASGDHIFDPYISTLKTAGVLVLVGAPNEIKLSPLNLLLGMITISGSVV  299

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK TQE+L+FC + KI+PEI+IIPIQ VNEALERLIK DVKYRFVIDI  SLK
Sbjct  300   GGTKRTQEMLDFCGTHKIHPEIEIIPIQSVNEALERLIKNDVKYRFVIDIENSLK  354



>emb|CAN81860.1| hypothetical protein VITISV_025556 [Vitis vinifera]
Length=664

 Score =   473 bits (1218),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 245/353 (69%), Positives = 284/353 (80%), Gaps = 12/353 (3%)
 Frame = -2

Query  1297  TDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLV  1118
              +NCLGWAARD SGVLSPY F+RR VG +DVSL I +CG+CYAD+++T+N  G S+YPLV
Sbjct  42    NNNCLGWAARDESGVLSPYTFTRREVGDEDVSLKITHCGICYADMLFTKNRLGDSRYPLV  101

Query  1117  PGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGID  938
             PGHEIVGIVKEVGS V  FKVG  VGVG YVNSCRECE CN+ LEV CSKGSV+T +G+D
Sbjct  102   PGHEIVGIVKEVGSNVHHFKVGHRVGVGAYVNSCRECESCNQSLEVYCSKGSVYTSNGVD  161

Query  937   VDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslg  758
              DGT+T GGYSS+IVVHERYC++IP+ YPLA AAPLLC GIT Y+PM+RH MNQPGKSL 
Sbjct  162   ADGTITNGGYSSFIVVHERYCFRIPDEYPLALAAPLLCPGITAYSPMVRHKMNQPGKSLE  221

Query  757   viglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSF  578
             VIGLGG+GHLAVKFGKAFGL V +FSTSISKKEEAL+LLG DNFV+SSDE+QM A++ S 
Sbjct  222   VIGLGGVGHLAVKFGKAFGLNVKLFSTSISKKEEALSLLGDDNFVVSSDEQQMKAMANSL  281

Query  577   DFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLT  398
             DF+I+TASGD   D Y+S LKTAG LALVGFP            GMK I+GS+ GG K T
Sbjct  282   DFIIDTASGDHSLDHYMSCLKTAGVLALVGFP------------GMKTISGSLVGGVKET  329

Query  397   QELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK*GGC  239
             QE+L+FCA+ KIYP+I+I+PIQYVNEA ERL K DVKYR V     SLK   C
Sbjct  330   QEMLDFCAAHKIYPDIEIVPIQYVNEAWERLTKGDVKYRVVGSDDVSLKITHC  382


 Score =   427 bits (1098),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 228/334 (68%), Positives = 263/334 (79%), Gaps = 29/334 (9%)
 Frame = -2

Query  1252  LSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEIVGIVKEVGSG  1073
             L+  +   RVVGSDDVSL I +CG+CYAD+I TRN  G SKYP+VPGH+IVGIVKEVGS 
Sbjct  360   LTKGDVKYRVVGSDDVSLKITHCGICYADIIHTRNKFGNSKYPVVPGHDIVGIVKEVGSN  419

Query  1072  VQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTVTKGGYSSYIV  893
             V  FKVGD VGVGTYVNSCRECE C EGLE+ CSKG VFTF G+DVDGT+TKGGYSS+IV
Sbjct  420   VGVFKVGDSVGVGTYVNSCRECENCEEGLEIHCSKGPVFTFGGVDVDGTITKGGYSSFIV  479

Query  892   VHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAVKFG  713
             VH+RYCY+I ++YPL  AAPLLCAGITVYTPM+RH MNQPGKSLGVIGLGGLGH+AVKFG
Sbjct  480   VHQRYCYRIADDYPLGLAAPLLCAGITVYTPMIRHKMNQPGKSLGVIGLGGLGHMAVKFG  539

Query  712   KAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLINTASGDIPFDL  533
             KAF L VTVFSTS+SKKEEAL LLGAD FV+SSDE+ M A++KS DF+INTASGD PFD 
Sbjct  540   KAFRLNVTVFSTSMSKKEEALTLLGADKFVLSSDEQDMKAMAKSLDFIINTASGDHPFDP  599

Query  532   YLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRKIYPE  353
             Y+SLLKTAG L                               + TQE+L+FCA+ KIYPE
Sbjct  600   YMSLLKTAGILE-----------------------------AQKTQEMLDFCAAHKIYPE  630

Query  352   IDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             ++++ IQ VNEALER+IK+DVKYRFVI+I  SLK
Sbjct  631   VEMVAIQNVNEALERVIKRDVKYRFVIEIEKSLK  664



>emb|CAN73267.1| hypothetical protein VITISV_034951 [Vitis vinifera]
Length=336

 Score =   460 bits (1183),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 241/336 (72%), Positives = 281/336 (84%), Gaps = 7/336 (2%)
 Frame = -2

Query  1258  GVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEIVGIVKEVG  1079
             GVLSPY F+RR VG DDVSL I +CGVC+ADV++TRN  G S YP+VPGHEIVGIVKEVG
Sbjct  8     GVLSPYTFTRRDVGEDDVSLRITHCGVCHADVVYTRNKLGDSIYPVVPGHEIVGIVKEVG  67

Query  1078  SGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTVTKGGYSSY  899
             S V  FKVGD VGVG Y++SCRECEYCNE LEV CSKG+++T +G+DVDG+VTKGGYSS+
Sbjct  68    SHVHGFKVGDRVGVGAYLDSCRECEYCNERLEVFCSKGALYTINGVDVDGSVTKGGYSSF  127

Query  898   IVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAVK  719
             IVVHE       + +P ASAAPLLCAGITVY+PM+RH MNQPGKSLGV+GLGGLGHLAVK
Sbjct  128   IVVHE-------DEFPSASAAPLLCAGITVYSPMVRHKMNQPGKSLGVVGLGGLGHLAVK  180

Query  718   FGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLINTASGDIPF  539
             FGKAFGL V VFSTSISKKEEALNLLGAD F++SSDE++M  + KS DF+I T S +  F
Sbjct  181   FGKAFGLNVIVFSTSISKKEEALNLLGADKFIVSSDEQEMTGMVKSLDFIIGTVSPNHSF  240

Query  538   DLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRKIY  359
             DLYLSLLKTAGT  LVG P+EVK +P S+ +GMK I+GS TGG K TQE+L+FCA+ KI+
Sbjct  241   DLYLSLLKTAGTFVLVGCPNEVKLNPLSILVGMKTISGSATGGMKETQEMLDFCAAHKIH  300

Query  358   PEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             P I+++PIQY NEALERLIK DVKYRFV+DI  SLK
Sbjct  301   PNIEVVPIQYANEALERLIKSDVKYRFVVDIENSLK  336



>ref|NP_001068303.2| Os11g0622800 [Oryza sativa Japonica Group]
 gb|ABA94833.1| mannitol dehydrogenase, putative [Oryza sativa Japonica Group]
 dbj|BAF28666.2| Os11g0622800 [Oryza sativa Japonica Group]
Length=343

 Score =   456 bits (1173),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 235/355 (66%), Positives = 280/355 (79%), Gaps = 12/355 (3%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+   + NC  WAARDPSG+LSPY F+RR V S+DVSL I +CGVCYADVIWTRN+   
Sbjct  1     MAAECGSGNCDAWAARDPSGILSPYKFNRREVQSEDVSLRITHCGVCYADVIWTRNMFND  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVG+ V+ FKVGD            +CE CN  LE  CSK  V 
Sbjct  61    SIYPLVPGHEIAGVVTEVGADVKGFKVGD-----------HDCENCNSSLENHCSK-CVV  108

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T++ +D DGTVTKGGYSS+I+VH+RYC+KIP +YPL+ AAPLLCAGITVYTPM+RHNMNQ
Sbjct  109   TYNSVDSDGTVTKGGYSSHILVHQRYCFKIPADYPLSKAAPLLCAGITVYTPMIRHNMNQ  168

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SK+EEA+NLLGADNFVISSDE QM 
Sbjct  169   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKREEAINLLGADNFVISSDENQME  228

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S  F+I+TASGD  FD YLSLLK  G + L+ FPSE+K  P +LNL  + +AGS+T
Sbjct  229   SLKSSLHFIIDTASGDHQFDPYLSLLKVGGVMVLLSFPSEIKVHPENLNLAARSLAGSVT  288

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE++ FCA+  +YP+I++I I YVNEAL+RLI +DV++RFVIDI  S K
Sbjct  289   GGTKDIQEMINFCAANNVYPDIEMIKIDYVNEALQRLINRDVRFRFVIDIENSFK  343



>ref|XP_010052173.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
Length=358

 Score =   453 bits (1166),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 233/350 (67%), Positives = 282/350 (81%), Gaps = 2/350 (1%)
 Frame = -2

Query  1297  TDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLV  1118
             ++NC GWAARD +G+LSPY F RR VG +DVS+ I +CG+CYADV  TRN    + YP+V
Sbjct  10    SNNCHGWAARDDTGLLSPYEFQRRSVGGNDVSVKITHCGICYADVACTRNKRKNTVYPVV  69

Query  1117  PGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGID  938
             PGHEIVGIV+EVG  V +FKVGD VGVG +V+SCREC YC+ G E  CSK +  T +G  
Sbjct  70    PGHEIVGIVQEVGDEVSKFKVGDHVGVGPFVDSCRECAYCDVGREEHCSKAT-LTINGTC  128

Query  937   VDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslg  758
              DGT++KGGYSS+IVVH+ YCYKIP+ YPL  AAPLLCAGITVY PM+ H MNQPGKSLG
Sbjct  129   KDGTISKGGYSSFIVVHDGYCYKIPDKYPLPLAAPLLCAGITVYNPMIHHKMNQPGKSLG  188

Query  757   viglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSF  578
             V+GLGGLGH+AVKFGKAFGL VTVFSTSISKK++ALN+L AD FV+SSD++QM AL+ S 
Sbjct  189   VVGLGGLGHMAVKFGKAFGLNVTVFSTSISKKDDALNMLKADKFVLSSDKEQMAALAHSL  248

Query  577   DFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKL  401
             DF+++ ASG+ P DLY+SLLK  G LALVG PSE ++ SP SL +G + I+GS  GGTK 
Sbjct  249   DFIVDAASGNHPVDLYMSLLKPEGVLALVGLPSEKIELSPLSLLMGARSISGSAVGGTKR  308

Query  400   TQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TQE++EFCA  +IYPEI++IPIQY NEAL+RL K DVKYRFVIDI  SL+
Sbjct  309   TQEMIEFCAKHEIYPEIEVIPIQYANEALDRLEKSDVKYRFVIDIENSLE  358



>ref|XP_010107966.1| putative cinnamyl alcohol dehydrogenase 1 [Morus notabilis]
 gb|EXC17366.1| putative cinnamyl alcohol dehydrogenase 1 [Morus notabilis]
Length=319

 Score =   452 bits (1162),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 238/348 (68%), Positives = 269/348 (77%), Gaps = 38/348 (11%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             + CLGWAA DPSG+LSPYNF+RR                                     
Sbjct  10    EECLGWAATDPSGLLSPYNFARR-------------------------------------  32

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
              HEIVGIVK VG GV  FKVGD VGVGTYVNSCR CEYC+EGLE  C  G+V TF+ +D 
Sbjct  33    -HEIVGIVKAVGCGVHAFKVGDHVGVGTYVNSCRHCEYCSEGLENHCENGAVRTFNHLDF  91

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGT+TKGGYSS IVVH+RYC++IP+ YPLASAAPLLCAGITVY PMMRHNMNQPGKSLGV
Sbjct  92    DGTITKGGYSSSIVVHQRYCFRIPDGYPLASAAPLLCAGITVYAPMMRHNMNQPGKSLGV  151

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             IGLGGLGH+AVKFGKAFGL VTVFSTSISK+EEAL LLGAD FVISSDE+QM AL+KS+D
Sbjct  152   IGLGGLGHMAVKFGKAFGLNVTVFSTSISKREEALMLLGADKFVISSDEEQMKALAKSYD  211

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             F+I+TASGD PFD Y+SLLKTAG L LVG PSE+K  P +L LGM+ I+GS  GGT  TQ
Sbjct  212   FIIDTASGDHPFDPYMSLLKTAGVLVLVGVPSEIKLHPANLILGMRTISGSTVGGTNETQ  271

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+LEFCA+R IYP I+++PIQY NEALERL++KDVKYRFVIDI  SLK
Sbjct  272   EMLEFCATRGIYPNIEVVPIQYANEALERLVRKDVKYRFVIDIENSLK  319



>ref|XP_011020397.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Populus 
euphratica]
Length=342

 Score =   452 bits (1163),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 230/346 (66%), Positives = 278/346 (80%), Gaps = 4/346 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S     +CLGW A D SGVLSPY+F RR + +DD+S+ I YCG CY DVI+TRN H  
Sbjct  1     MSSFQEGKDCLGWEASDASGVLSPYHFKRRSISADDISVKITYCGTCYGDVIYTRNKHED  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYP+VP HEI GI++EVGS VQRFK+GDPVGV TY+NSCR C+ CNEGLEVQC  G V 
Sbjct  61    SKYPVVPSHEIAGILQEVGSNVQRFKIGDPVGVETYINSCRNCDECNEGLEVQCPNGMVP  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
               + +DVDGT+TKGG SS+IVV ERYCYKIPENYPLA AAPLLC+GITVYTPM+ + MNQ
Sbjct  121   IINAVDVDGTITKGG-SSFIVVIERYCYKIPENYPLALAAPLLCSGITVYTPMIHYKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKS GVIGLGGLGH+AV FGKAFG+    FSTSISKKEEALN+LGAD FV+S+DE++M 
Sbjct  180   PGKSPGVIGLGGLGHMAVDFGKAFGVD---FSTSISKKEEALNVLGADKFVVSTDEEEMK  236

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             ALS++ +F+I++ASGD PFD Y+SLL+T G   +V +P EVK  P SL  GM+ I GS T
Sbjct  237   ALSRTLNFIIDSASGDHPFDPYMSLLQTNGLFVMVCYPKEVKLDPLSLFTGMRLITGSFT  296

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRF  278
             GGTKLTQE+ +FCA+ KIYPEI+++PI+Y  EA ER++K DVKYR 
Sbjct  297   GGTKLTQEMSDFCAANKIYPEIEVMPIEYAYEAFERMLKGDVKYRL  342



>ref|XP_010056072.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 isoform 
X2 [Eucalyptus grandis]
Length=284

 Score =   447 bits (1149),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 232/282 (82%), Positives = 251/282 (89%), Gaps = 1/282 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S  + ++CLGWAARDPSG+LSPY FSRR VGSDDVS+ I +CGVCYADV WTRN  G 
Sbjct  1     MSSEGAKEDCLGWAARDPSGLLSPYKFSRRTVGSDDVSIRITHCGVCYADVAWTRNEQGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVKEVGS VQRFKVGD VGVGTYVNSCRECEYCN+ LE  C KG VF
Sbjct  61    SKYPLVPGHEIVGIVKEVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDRLENNCEKG-VF  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSSYIVVHERYC+ IPEN PLASAAPLLCAGITVYTPMMRH MNQ
Sbjct  120   TFDGIDADGTVTKGGYSSYIVVHERYCFTIPENLPLASAAPLLCAGITVYTPMMRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVK GKAFGLKVTVFSTSISKKEEAL+LLGAD+FVISSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKLGKAFGLKVTVFSTSISKKEEALSLLGADHFVISSDPEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVK  470
             A++KS  F+I+TA+GD PFD Y+SLLKT G LALVGFPSEVK
Sbjct  240   AMAKSLHFIIDTAAGDHPFDPYMSLLKTGGVLALVGFPSEVK  281



>emb|CBI38295.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   449 bits (1156),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 235/316 (74%), Positives = 267/316 (84%), Gaps = 1/316 (0%)
 Frame = -2

Query  1306  SHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKY  1127
             +H  +NCLGWAARDPSGVLSPY+F+RRVVGSDDVSL I +CG+CYAD+I TRN  G SKY
Sbjct  32    NHMMENCLGWAARDPSGVLSPYSFNRRVVGSDDVSLKITHCGICYADIIHTRNKFGNSKY  91

Query  1126  PLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFD  947
             P+VPGH+IVGIVKEVGS V  FKVGD VGVGTYVNSCRECE C EGLE+ CSKG VFTF 
Sbjct  92    PVVPGHDIVGIVKEVGSNVGVFKVGDSVGVGTYVNSCRECENCEEGLEIHCSKGPVFTFG  151

Query  946   GIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgk  767
             G+DVDGT+TKGGYSS+IVVH+RYCY+I ++YPL  AAPLLCAGITVYTPM+RH MNQPGK
Sbjct  152   GVDVDGTITKGGYSSFIVVHQRYCYRIADDYPLGLAAPLLCAGITVYTPMIRHKMNQPGK  211

Query  766   slgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALS  587
             SLGVIGLGGLGH+AVKFGKAF L VTVFSTS+SKKEEAL LLGAD FV+SSDE+ M A++
Sbjct  212   SLGVIGLGGLGHMAVKFGKAFRLNVTVFSTSMSKKEEALTLLGADKFVLSSDEQDMKAMA  271

Query  586   KSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPS-EVKFSPGSLNLGMKCIAGSITGG  410
             KS DF+INTASGD PFD Y+SLLKTAG L LVGFPS E+K S  SL  GM+ + GS+TGG
Sbjct  272   KSLDFIINTASGDHPFDPYMSLLKTAGILVLVGFPSPEIKLSTISLLTGMRTVCGSVTGG  331

Query  409   TKLTQELLEFCASRKI  362
             TK T+     C  + I
Sbjct  332   TKDTRNAGFLCCPQDI  347



>ref|XP_010052174.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
 gb|KCW76092.1| hypothetical protein EUGRSUZ_D00472 [Eucalyptus grandis]
Length=357

 Score =   442 bits (1137),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 235/348 (68%), Positives = 281/348 (81%), Gaps = 1/348 (0%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
             NC  WAARD SG+LSPY F RR VGS+DVS+ I +CG+CYADV +TRN    S YP+VPG
Sbjct  10    NCHAWAARDDSGLLSPYEFERRGVGSNDVSVKIIHCGICYADVAYTRNKRKNSVYPVVPG  69

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVGIV+EVG  V  FKVGD  GVGTY++SCR CEYC++G EV CSKG   T +G   D
Sbjct  70    HEIVGIVQEVGDNVSSFKVGDQAGVGTYLDSCRHCEYCDDGQEVYCSKGIAVTINGTYED  129

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T+GGYSS+IVV ER+CYKIPE YPLA AAPLLCAGITVY+PM++H MNQPGK +GV+
Sbjct  130   GTRTQGGYSSFIVVDERFCYKIPEKYPLALAAPLLCAGITVYSPMIQHKMNQPGKLVGVV  189

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KAFGL VTVFST++SKK +ALNLL AD FV+SSD++QM A++KS DF
Sbjct  190   GLGGLGHMAVKFAKAFGLNVTVFSTNMSKKNDALNLLKADRFVLSSDKEQMAAMAKSLDF  249

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFP-SEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+ ASGD P D Y+SLLK  G L LVG P  E+K +P SL +GM+ I+GS+ GG K TQ
Sbjct  250   IIDAASGDHPLDQYMSLLKIGGVLTLVGVPCEEIKLNPFSLLMGMRSISGSVVGGVKRTQ  309

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++FCA ++IYPEI++IPIQY NEALERL K DVKYRFVIDI  SLK
Sbjct  310   EMIDFCAEKEIYPEIEVIPIQYANEALERLQKSDVKYRFVIDIENSLK  357



>ref|XP_006302587.1| hypothetical protein CARUB_v10020694mg [Capsella rubella]
 gb|EOA35485.1| hypothetical protein CARUB_v10020694mg [Capsella rubella]
Length=310

 Score =   437 bits (1124),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 246/283 (87%), Gaps = 0/283 (0%)
 Frame = -2

Query  1288  CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGH  1109
             C+ WAARDPSG+LSP+  +RR V +DDVSL I +CGVCYADVIWT+N HG SKYPLVPGH
Sbjct  12    CMCWAARDPSGLLSPHTITRRSVTNDDVSLKITHCGVCYADVIWTKNQHGDSKYPLVPGH  71

Query  1108  EIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDG  929
             EI GIV +VGS V RFKVGD VGVGTYVNSCRECEYCNEG EV C+KG VFTF+GID DG
Sbjct  72    EIAGIVTKVGSNVHRFKVGDHVGVGTYVNSCRECEYCNEGQEVNCAKGQVFTFNGIDHDG  131

Query  928   TVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvig  749
             +VTKGGYSS+IVVHERYCY IP +YPL SAAPLLCAGITVY PMMRH+MNQPGKSLGVIG
Sbjct  132   SVTKGGYSSHIVVHERYCYNIPVDYPLESAAPLLCAGITVYAPMMRHHMNQPGKSLGVIG  191

Query  748   lgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFL  569
             LGGLGH+AVKFGKAFGL VTVFSTSISKKEEAL+LLGA+NFVISSD  QM AL KS DF+
Sbjct  192   LGGLGHMAVKFGKAFGLSVTVFSTSISKKEEALSLLGANNFVISSDHDQMKALEKSLDFI  251

Query  568   INTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGM  440
             I+TASGD  FD Y+SLLK AGT  LVGFP E+K SP +LNLGM
Sbjct  252   IDTASGDHAFDPYMSLLKIAGTYVLVGFPREIKISPANLNLGM  294



>ref|XP_008784627.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 4 isoform 
X4 [Phoenix dactylifera]
 ref|XP_008784628.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 4 isoform 
X4 [Phoenix dactylifera]
Length=303

 Score =   429 bits (1104),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 225/301 (75%), Positives = 255/301 (85%), Gaps = 4/301 (1%)
 Frame = -2

Query  1141  GTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGS  962
             G SKYPLVPGHEIVGIV EVGS V+ FKVGD  GVGTYV+SC ECEYCN+ LEV CSKGS
Sbjct  3     GDSKYPLVPGHEIVGIVTEVGSSVKGFKVGDHAGVGTYVDSCGECEYCNDFLEVHCSKGS  62

Query  961   VFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNM  782
              FTF+ +D DGT+TKGGYSSYI+V ERYCY+IP+ +PLA AAPLLCAGITVYTPMMRH M
Sbjct  63    TFTFNAVDSDGTITKGGYSSYIIVKERYCYRIPDGFPLAMAAPLLCAGITVYTPMMRHKM  122

Query  781   NQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQ  602
             NQPGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SKKE AL LLGAD FVISSD++Q
Sbjct  123   NQPGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKKEAALKLLGADKFVISSDKEQ  182

Query  601   MMAL----SKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKC  434
             M +L    +KS DF+I+TASGD  FD Y+SLLK  G L LVGFPSEV+  PGSL+   + 
Sbjct  183   MESLLQSMTKSLDFIIDTASGDHLFDPYMSLLKVGGVLVLVGFPSEVRLHPGSLSYASRT  242

Query  433   IAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             IAGS+TGGTK TQ +LEFCA  K+YPEI++I IQY+NEALERL+K+DVKYRFVID+  SL
Sbjct  243   IAGSLTGGTKQTQAMLEFCAENKVYPEIELINIQYINEALERLVKRDVKYRFVIDVQNSL  302

Query  253   K  251
             K
Sbjct  303   K  303



>ref|XP_004983416.1| PREDICTED: LOW QUALITY PROTEIN: probable cinnamyl alcohol dehydrogenase 
1-like [Setaria italica]
Length=339

 Score =   430 bits (1106),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 233/355 (66%), Positives = 268/355 (75%), Gaps = 16/355 (5%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MAS     NC  WAAR PSGVLSPY F+RR V S DVSL I +CGVCYA VIWTRN H  
Sbjct  1     MASESGDGNCNAWAARYPSGVLSPYKFNRRSVQSSDVSLKITHCGVCYA-VIWTRNKHNN  59

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPL PGHEI G+V EVGS V    VGD            +CE CN  LE  C + SVF
Sbjct  60    SKYPLFPGHEIAGVVTEVGSDVX---VGD-----------HDCENCNNSLENHCPQ-SVF  104

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+  D DGT+TKGGYS++IVVHERYC+KIP+ YPLA AAPLLCAGITVYTPM++HNMNQ
Sbjct  105   TFNCTDTDGTITKGGYSTHIVVHERYCFKIPDGYPLAKAAPLLCAGITVYTPMVQHNMNQ  164

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAF LKVTVFSTS SK++EA+N+LGADNFVIS + +QM 
Sbjct  165   PGKSLGVIGLGGLGHMAVKFGKAFCLKVTVFSTSESKRDEAINILGADNFVISLNTQQME  224

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S  F+++T S D PFD YLSLLK  G +ALV FPSE+K  P SLNLG   ++GSI 
Sbjct  225   SLKSSLHFIVDTDSIDHPFDPYLSLLKVGGVMALVSFPSEIKIHPASLNLGAWTLSGSIV  284

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GGTK  QE++ FCA+ KIYPEI+II + Y+NEAL RL+  DVKY FVIDI  S K
Sbjct  285   GGTKDIQEMVNFCAANKIYPEIEIIKMDYINEALMRLLNXDVKYHFVIDIXNSFK  339



>ref|XP_006439167.1| hypothetical protein CICLE_v10020847mg [Citrus clementina]
 gb|ESR52407.1| hypothetical protein CICLE_v10020847mg [Citrus clementina]
 gb|KDO76798.1| hypothetical protein CISIN_1g0191991mg [Citrus sinensis]
Length=299

 Score =   427 bits (1099),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 231/291 (79%), Positives = 255/291 (88%), Gaps = 1/291 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  ++ +CLGWAARDPSGVLSPY+F+RR VGSDDVS+ I +CGVCYADVIWTRN HG 
Sbjct  1     MTSETASKDCLGWAARDPSGVLSPYSFNRRAVGSDDVSITITHCGVCYADVIWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVKEVG  V RFKVGD VGVGTYVNSCR+CEYCN+GLEV C++ SV+
Sbjct  61    SKYPLVPGHEIVGIVKEVGHNVSRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCAR-SVY  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ ID DGT+TKGGYSSYIVVHERYCYKI  +YPLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  120   TFNAIDADGTITKGGYSSYIVVHERYCYKIANDYPLALAAPLLCAGITVYTPMMRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTV STS SKKEEAL+LLGAD FV+SSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLNVTVLSTSTSKKEEALSLLGADKFVVSSDLEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLG  443
             AL KS DF+I+TASGD PFD Y+SLLK AG   LVGFPS+VKFSP SLN+G
Sbjct  240   ALGKSLDFIIDTASGDHPFDAYMSLLKVAGVYVLVGFPSKVKFSPASLNIG  290



>gb|KDO76799.1| hypothetical protein CISIN_1g0191991mg, partial [Citrus sinensis]
Length=289

 Score =   426 bits (1094),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 230/290 (79%), Positives = 254/290 (88%), Gaps = 1/290 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  ++ +CLGWAARDPSGVLSPY+F+RR VGSDDVS+ I +CGVCYADVIWTRN HG 
Sbjct  1     MTSETASKDCLGWAARDPSGVLSPYSFNRRAVGSDDVSITITHCGVCYADVIWTRNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVKEVG  V RFKVGD VGVGTYVNSCR+CEYCN+GLEV C++ SV+
Sbjct  61    SKYPLVPGHEIVGIVKEVGHNVSRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCAR-SVY  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+ ID DGT+TKGGYSSYIVVHERYCYKI  +YPLA AAPLLCAGITVYTPMMRH MNQ
Sbjct  120   TFNAIDADGTITKGGYSSYIVVHERYCYKIANDYPLALAAPLLCAGITVYTPMMRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGL VTV STS SKKEEAL+LLGAD FV+SSD +QM 
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLNVTVLSTSTSKKEEALSLLGADKFVVSSDLEQMK  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNL  446
             AL KS DF+I+TASGD PFD Y+SLLK AG   LVGFPS+VKFSP SLN+
Sbjct  240   ALGKSLDFIIDTASGDHPFDAYMSLLKVAGVYVLVGFPSKVKFSPASLNI  289



>ref|XP_002436632.1| hypothetical protein SORBIDRAFT_10g006270 [Sorghum bicolor]
 gb|EER87999.1| hypothetical protein SORBIDRAFT_10g006270 [Sorghum bicolor]
Length=365

 Score =   427 bits (1099),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 224/326 (69%), Positives = 259/326 (79%), Gaps = 13/326 (4%)
 Frame = -2

Query  1228  RVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGD  1049
             R V S DV+L I YCGVCYADV WTRN+   SKYPLVPGHEI G+V +VG+ V+ FKVGD
Sbjct  53    RAVQSSDVALKIIYCGVCYADVGWTRNMLNDSKYPLVPGHEIAGVVTQVGADVKAFKVGD  112

Query  1048  PVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYK  869
              VGVGTYVNSCR+CE CN  LE  C +  VFTF+GID DGTVTKGGYS++IVVHERYC+K
Sbjct  113   HVGVGTYVNSCRDCENCNSSLENHCPE-RVFTFNGIDTDGTVTKGGYSTHIVVHERYCFK  171

Query  868   IPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVT  689
             IP+ YPLA AAPLLCAGITVYTPMM+HNMNQPGKSLGVIGLGGLGH+AVKFGKAFGLKVT
Sbjct  172   IPDGYPLAKAAPLLCAGITVYTPMMQHNMNQPGKSLGVIGLGGLGHMAVKFGKAFGLKVT  231

Query  688   VFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTA  509
             V STS SK+ EA++LLGADNFVISSD +QM +L  S  F+++TASGD PFD YLSLLK  
Sbjct  232   VLSTSESKRHEAISLLGADNFVISSDTQQMESLKNSLHFIVDTASGDHPFDPYLSLLKVG  291

Query  508   GTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQY  329
             G + L+GFPS             + ++GS+ GGTK  QE++ FCA  KIYPEI+II I Y
Sbjct  292   GVMTLLGFPSA------------RALSGSVVGGTKDIQEMVNFCAENKIYPEIEIIKIDY  339

Query  328   VNEALERLIKKDVKYRFVIDIGGSLK  251
             +NEAL RL+ +DVKYRFVIDI  S K
Sbjct  340   INEALARLVNRDVKYRFVIDIENSFK  365



>ref|XP_010919003.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Elaeis 
guineensis]
Length=375

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 224/327 (69%), Positives = 272/327 (83%), Gaps = 0/327 (0%)
 Frame = -2

Query  1225  VVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDP  1046
             V+  DDV + I + GVCY DV+WTRN  G S YPLVPGHEI G+VKE+GS V++FK+GD 
Sbjct  37    VLERDDVFVKITHWGVCYGDVVWTRNGLGDSIYPLVPGHEIAGVVKEIGSNVKKFKIGDH  96

Query  1045  VGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKI  866
             VGVGT++NSCR+C+YCN+ LE+ CSKG VFTF+ +D+DG++TKGGYSSYI+VHERYCY+I
Sbjct  97    VGVGTFINSCRDCDYCNDFLEIHCSKGPVFTFNSLDLDGSITKGGYSSYIIVHERYCYRI  156

Query  865   PENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTV  686
              + Y LA AAPLLCAG TVYTPM+ + MNQPGKSLGVIGLGGLGHL VKFGKAFGL VTV
Sbjct  157   RDGYLLAMAAPLLCAGSTVYTPMICYKMNQPGKSLGVIGLGGLGHLVVKFGKAFGLNVTV  216

Query  685   FSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAG  506
             FSTS SKK EAL++LGAD F+ISSD++QM +L KS D++I+TASGD PFD Y+SLL+  G
Sbjct  217   FSTSESKKGEALDVLGADGFLISSDQEQMKSLMKSLDYIIDTASGDHPFDPYMSLLRIGG  276

Query  505   TLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYV  326
                +VG+PSEV+  PGS+N+G + IAGS+T GTK TQE+L+FCA  KIYPEI+II IQY+
Sbjct  277   VWVMVGYPSEVRMHPGSVNIGARTIAGSMTRGTKQTQEMLDFCAENKIYPEIEIIEIQYL  336

Query  325   NEALERLIKKDVKYRFVIDIGGSLK*G  245
             NEA ERLI KDVK+RFV DI  SLK G
Sbjct  337   NEAPERLINKDVKFRFVFDIENSLKRG  363



>gb|EMS58458.1| putative cinnamyl alcohol dehydrogenase 1 [Triticum urartu]
Length=397

 Score =   419 bits (1078),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/303 (70%), Positives = 249/303 (82%), Gaps = 1/303 (0%)
 Frame = -2

Query  1159  WTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEV  980
             WTRN+H  S YPLVPGHEI G+V EVGS V  FK+GD V VGTY+NSCR+C+ CN  LE 
Sbjct  96    WTRNLHHDSVYPLVPGHEIAGVVTEVGSDVMDFKLGDHVAVGTYINSCRDCDNCNSLLEN  155

Query  979   QCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTP  800
              CS   VFTF+G+D DGTVTKGGYSS+IVVHERYCYKIP+ YPL  AAPL CAGITVYTP
Sbjct  156   HCSN-FVFTFNGVDTDGTVTKGGYSSHIVVHERYCYKIPDGYPLEKAAPLACAGITVYTP  214

Query  799   MMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVI  620
             M+RHNMNQPGKSLGVIGLGGLGH+AVKFGKAFGL VT+ STS SK++EA+NLLGADNFV+
Sbjct  215   MIRHNMNQPGKSLGVIGLGGLGHMAVKFGKAFGLNVTILSTSESKRDEAINLLGADNFVV  274

Query  619   SSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGM  440
             SSD+ QM +L  S DF+++TASGD PFD YL+LLK  G +ALVGFP E++  P SLNLG 
Sbjct  275   SSDKNQMESLKNSLDFIVDTASGDHPFDPYLALLKVRGVMALVGFPGEIRVHPASLNLGA  334

Query  439   KCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGG  260
             + ++GS+ GGTK TQE++ FCA  KIYP +++I I Y+NEALERL+ +DVKYRFVIDI  
Sbjct  335   RTLSGSVVGGTKDTQEMINFCAVNKIYPNVEVIKIDYINEALERLVNRDVKYRFVIDIES  394

Query  259   SLK  251
             S K
Sbjct  395   SFK  397



>gb|ACF80163.1| unknown [Zea mays]
 gb|AFW85484.1| putative cinnamyl-alcohol dehydrogenase family protein isoform 
1 [Zea mays]
 gb|AFW85485.1| putative cinnamyl-alcohol dehydrogenase family protein isoform 
2 [Zea mays]
Length=312

 Score =   412 bits (1059),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 221/355 (62%), Positives = 254/355 (72%), Gaps = 43/355 (12%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA+     NC  WAARDPSGVLSP++F+RR V S DVSL I YCGVCYADV WTRN    
Sbjct  1     MAAESENGNCKAWAARDPSGVLSPHSFNRRAVQSGDVSLKIIYCGVCYADVAWTRNKLND  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI G+V +VG+ V+ FKVGD                               
Sbjct  61    SKYPLVPGHEIAGVVTQVGADVKGFKVGD-------------------------------  89

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
                          GGYS++IVVHERYC+KIP+ YPLA AAPLLCAGITVYTPMMRHNMNQ
Sbjct  90    ------------HGGYSTHIVVHERYCFKIPDGYPLAKAAPLLCAGITVYTPMMRHNMNQ  137

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTVFSTS SK++EA+NLLGADNFVISSD +QM 
Sbjct  138   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKRDEAINLLGADNFVISSDTQQME  197

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSIT  416
             +L  S  F+I+TASGD PFD Y SLLK  G + LVGFPSE+K  P SL LG + ++GS+ 
Sbjct  198   SLKNSLHFIIDTASGDHPFDPYFSLLKVGGVMTLVGFPSEIKMHPASLILGARTLSGSVV  257

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GG K  QE++ FCA+  IYPEI+II I Y+NEAL RL+ +DVKYRFVIDI  S K
Sbjct  258   GGIKDIQEMVNFCAANNIYPEIEIIKIDYINEALARLVNRDVKYRFVIDIENSFK  312



>ref|XP_004982526.1| PREDICTED: LOW QUALITY PROTEIN: putative cinnamyl alcohol dehydrogenase 
4-like [Setaria italica]
Length=318

 Score =   404 bits (1038),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 258/359 (72%), Gaps = 45/359 (13%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MAS     NC  WAARDPSGVLSPY F RR V S DVSL I +CGVCYADV+WT+N+H  
Sbjct  1     MASESGDGNCNAWAARDPSGVLSPYKFDRRAVQSGDVSLKITHCGVCYADVVWTQNMHND  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEI G+V EVGS V+ FKVGD +G+GTY                        
Sbjct  61    SKYPLVPGHEIAGVVTEVGSDVKGFKVGDHIGIGTY------------------------  96

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
                          GGYS++IV+HERYC+KIP     A AAPLLCAGIT+YTPMMRHNMNQ
Sbjct  97    -------------GGYSTHIVIHERYCFKIPX----AKAAPLLCAGITMYTPMMRHNMNQ  139

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGK FGLKVTVFSTS SK++EA+N+LGADNFVISS+ +QM 
Sbjct  140   PGKSLGVIGLGGLGHMAVKFGKDFGLKVTVFSTSESKRDEAINILGADNFVISSNTQQME  199

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLN----LGMKCIA  428
             +L  S  F+++ A GD PFD YLSLLK  G +A+V FPSE+K  P SLN    L  + ++
Sbjct  200   SLKYSLHFIVDAALGDHPFDPYLSLLKVGGVMAVVCFPSEIKVHPASLNLVSFLSARTLS  259

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GSI GGTK  QE++ FCA+ KIYP+I+II I Y+NEAL+RL+ +DVKYRFVIDI  S K
Sbjct  260   GSIVGGTKDIQEMVNFCAANKIYPQIEIIKIDYINEALKRLVNRDVKYRFVIDIENSFK  318



>ref|XP_010054315.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1 [Eucalyptus 
grandis]
Length=299

 Score =   394 bits (1011),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 209/294 (71%), Positives = 242/294 (82%), Gaps = 1/294 (0%)
 Frame = -2

Query  1129  YPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTF  950
             + L P HEIVGI+ EVG  V +FK+GD VGVGTYV++CR+CE C+ GLE+ C KG V T 
Sbjct  6     WNLRPRHEIVGIITEVGRDVGKFKIGDHVGVGTYVDTCRDCENCDGGLEMHCLKGGVPTI  65

Query  949   DGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPg  770
              G   DG+  KGGYS +IVVHERYCYKIP+ YPLA AAPLLCAGITVYTPM+RHNMNQPG
Sbjct  66    GGTYADGSTCKGGYSQFIVVHERYCYKIPDKYPLAQAAPLLCAGITVYTPMIRHNMNQPG  125

Query  769   kslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMAL  590
             KSLGVIGLGGLGHL VKFGKAFGL VTVFSTS SKK++ALNLL ADNFV+SSD++QM AL
Sbjct  126   KSLGVIGLGGLGHLTVKFGKAFGLNVTVFSTSASKKDDALNLLKADNFVLSSDKEQMSAL  185

Query  589   SKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFP-SEVKFSPGSLNLGMKCIAGSITG  413
             SKS DF+++TASGD P DLY+SLL+  G LALVGFP  E+K SP SL + M+ I+GS  G
Sbjct  186   SKSLDFIVDTASGDHPLDLYMSLLRAGGVLALVGFPGEELKLSPLSLLMDMRSISGSTVG  245

Query  412   GTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GTK TQE+LEFCA  +I+PEI++IPIQY NEALERL K DVKYRFVIDI  SL+
Sbjct  246   GTKRTQEMLEFCAEHEIHPEIEVIPIQYSNEALERLQKNDVKYRFVIDIENSLE  299



>gb|ABG65973.1| mannitol dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
Length=297

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 200/287 (70%), Positives = 242/287 (84%), Gaps = 1/287 (0%)
 Frame = -2

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEI G+V EVG+ V+ FKVGD VGVGTYVNSCR+CE CN  LE  CS+  VFTF+G+D D
Sbjct  12    HEIAGVVTEVGADVKSFKVGDHVGVGTYVNSCRDCENCNSSLENYCSQ-HVFTFNGVDTD  70

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GTVTKGGYS++IVVHERYC+KIP+ YPL  AAPLLCAGITVY+PMMRHNMNQPGKSLGVI
Sbjct  71    GTVTKGGYSTHIVVHERYCFKIPDGYPLEKAAPLLCAGITVYSPMMRHNMNQPGKSLGVI  130

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKFGKAFGLKVTV STS SK++EA++LLGADNFV+SSDE QM  L  S +F
Sbjct  131   GLGGLGHMAVKFGKAFGLKVTVISTSESKRKEAIDLLGADNFVVSSDENQMETLKSSLNF  190

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQE  392
             +I+TASGD PFD YL+LLK  G +AL+ FPSE+K  P +LNLG + ++GS+TGGTK  QE
Sbjct  191   IIDTASGDHPFDPYLTLLKVGGVMALLSFPSEIKVHPANLNLGGRSLSGSVTGGTKDIQE  250

Query  391   LLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             ++ FCA+ KIYP+I++I I Y+NEAL+RL+ +DV++RFVIDI  S K
Sbjct  251   MINFCAANKIYPDIEMIKIDYINEALQRLVDRDVRFRFVIDIENSFK  297



>ref|XP_007039282.1| Cinnamyl alcohol dehydrogenase 1 isoform 5 [Theobroma cacao]
 gb|EOY23783.1| Cinnamyl alcohol dehydrogenase 1 isoform 5 [Theobroma cacao]
Length=256

 Score =   385 bits (990),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S   T++CLGWAARDPSG LSPY FSRR +GSDDVSL I +CGVCYADVIW+RN +G 
Sbjct  1     MDSQTKTEDCLGWAARDPSGALSPYKFSRRPLGSDDVSLKITHCGVCYADVIWSRNKNGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+VKEVGS V RFKVGDPVGVGTYVNSCR+CEYCN+G+EV C KGSVF
Sbjct  61    SMYPLVPGHEIAGVVKEVGSNVCRFKVGDPVGVGTYVNSCRDCEYCNDGVEVHCVKGSVF  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DGTVTKGGYSSYIVVHERYC++IP NYPLASAAPLLCAGITVY PMMRHNMN 
Sbjct  121   TFNGIDEDGTVTKGGYSSYIVVHERYCFRIPSNYPLASAAPLLCAGITVYAPMMRHNMNH  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
              GKSLGVIGLGGLGH+AVKFGKAFGL VTVFSTSISKKEEALNLLGAD FV+SSD++QM
Sbjct  181   SGKSLGVIGLGGLGHMAVKFGKAFGLHVTVFSTSISKKEEALNLLGADKFVVSSDQEQM  239



>ref|XP_002974026.1| hypothetical protein SELMODRAFT_149351 [Selaginella moellendorffii]
 gb|EFJ24981.1| hypothetical protein SELMODRAFT_149351 [Selaginella moellendorffii]
Length=351

 Score =   385 bits (990),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 201/348 (58%), Positives = 257/348 (74%), Gaps = 3/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
              C+GWAARD SGVLS + FSRR +G DD+   I +CG+CYA+ +W  N HG +KYP+VPG
Sbjct  6     ECVGWAARDQSGVLSRHEFSRRAIGDDDICFKITHCGICYAEAVWLFNKHGDTKYPIVPG  65

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V EVGS V RFKVGD  GVG Y  SC  C+ C+ G+E  C K S+ T++  D+D
Sbjct  66    HEIVGVVAEVGSNVTRFKVGDRAGVGAYCRSCGSCDDCDNGMENYCHK-SLLTYNYEDID  124

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNM-NQPgkslgv  755
             GT+TKGG+S+ +VVH RY ++IP+    + AAPLLCAGITVY+PM R+ M +Q GK LGV
Sbjct  125   GTITKGGFSNKMVVHSRYAFQIPDKLSSSDAAPLLCAGITVYSPMKRYGMISQTGKHLGV  184

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             IGLGGLGH+AVKFGKAFG KVTV STS  KKE+AL LLGAD F+++ D + + A  KS D
Sbjct  185   IGLGGLGHMAVKFGKAFGHKVTVLSTSPGKKEDALTLLGADEFLVTKDPQALHAAEKSID  244

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             ++I+TA+G    +LYL LLKT G L +VG P   +F+P  L L M+ I+GS TGG K  +
Sbjct  245   WIIDTAAGKHDLNLYLPLLKTGGHLVMVGVPPSHEFAP-HLMLPMRSISGSSTGGCKEIE  303

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+L+FCA +KI P I+I+PI Y N A++R+IK DV +RFVIDI  SLK
Sbjct  304   EMLQFCADKKILPNIEIVPIDYANTAIQRMIKSDVTFRFVIDIASSLK  351



>gb|KCW72669.1| hypothetical protein EUGRSUZ_E01119 [Eucalyptus grandis]
Length=259

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 215/239 (90%), Gaps = 1/239 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    ++CLGWAARDPSG LSPY F+RR VGS+DVS+ I +CGVCYADV WTRN+ G 
Sbjct  1     MSSEGGKEDCLGWAARDPSGFLSPYKFTRRAVGSEDVSIKITHCGVCYADVAWTRNVQGH  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             SKYPLVPGHEIVGIVK+VGS VQRFKVGD VGVGTYVNSCRECEYCN+ LEVQC K +V 
Sbjct  61    SKYPLVPGHEIVGIVKQVGSSVQRFKVGDHVGVGTYVNSCRECEYCNDRLEVQCEK-AVL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TFDGID DGTVTKGGYSS+IVVHERYC++IPENYP+  AAPLLCAGITVYTPM+RH MNQ
Sbjct  120   TFDGIDADGTVTKGGYSSHIVVHERYCFRIPENYPMDLAAPLLCAGITVYTPMIRHKMNQ  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STSISKKEEAL+LLGAD+FVISSD +QM
Sbjct  180   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSISKKEEALSLLGADHFVISSDVEQM  238



>ref|XP_006377872.1| hypothetical protein POPTR_0011s15120g [Populus trichocarpa]
 gb|ERP55669.1| hypothetical protein POPTR_0011s15120g [Populus trichocarpa]
Length=275

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 192/246 (78%), Positives = 215/246 (87%), Gaps = 0/246 (0%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M+S    D+CL WAARDPSGVLSPY FSRR +G DDVSL I +CGVCYADVIW++N HG 
Sbjct  1     MSSEGVKDDCLAWAARDPSGVLSPYKFSRRALGKDDVSLKITHCGVCYADVIWSKNKHGD  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S+YPLVPGHEI GIVKEVGS V  FKVGD VGVGTYVNSCRECE+CN+  EV C KGSV+
Sbjct  61    SRYPLVPGHEIAGIVKEVGSSVSNFKVGDHVGVGTYVNSCRECEHCNDKEEVSCEKGSVY  120

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             TF+GID DG++TKGGYSSYIVVHERYC++IP+ YPLASAAPLLCAGITVY PMMRH MNQ
Sbjct  121   TFNGIDADGSITKGGYSSYIVVHERYCFRIPDGYPLASAAPLLCAGITVYNPMMRHKMNQ  180

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGKSLGVIGLGGLGH+AVKFGKAFGLKVTV STS+SKKEEAL++LGADNFVI+SD+ QM 
Sbjct  181   PGKSLGVIGLGGLGHMAVKFGKAFGLKVTVLSTSVSKKEEALSVLGADNFVITSDQAQMK  240

Query  595   ALSKSF  578
               S+ F
Sbjct  241   VKSQEF  246



>ref|XP_002983465.1| hypothetical protein SELMODRAFT_268735 [Selaginella moellendorffii]
 gb|EFJ15366.1| hypothetical protein SELMODRAFT_268735 [Selaginella moellendorffii]
Length=351

 Score =   382 bits (980),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 200/348 (57%), Positives = 257/348 (74%), Gaps = 3/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
              C+GWAARD SGVLS + FSRR +G DD+   I +CG+CYA+ +W  N  G +KYP+VPG
Sbjct  6     ECVGWAARDQSGVLSRHEFSRRAIGDDDICFKITHCGICYAEAVWLFNKLGDTKYPIVPG  65

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V EVGS V RFKVGD  GVG Y  SC  C+ C+ G+E  C K S+ T++  D+D
Sbjct  66    HEIVGVVAEVGSNVTRFKVGDRAGVGAYCRSCGSCDDCDNGMENYCHK-SLLTYNYEDID  124

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNM-NQPgkslgv  755
             GT+TKGG+S+ +VVH RY ++IP+    + AAPLLCAGITVY+PM R+ M +Q GK LGV
Sbjct  125   GTITKGGFSNKMVVHSRYAFQIPDKLSSSDAAPLLCAGITVYSPMKRYGMISQTGKHLGV  184

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             IGLGGLGH+AVKFGKAFG KVTV STS  KKE+AL LLGAD F+++ D + + A  KS D
Sbjct  185   IGLGGLGHMAVKFGKAFGHKVTVLSTSPGKKEDALTLLGADEFLVTKDPQALHAAEKSID  244

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             ++I+TA+G    +LYL LLKT G L +VG P   +F+P  L L M+ I+GS TGG K  +
Sbjct  245   WIIDTAAGKHDLNLYLPLLKTGGHLVMVGVPPSHEFAP-HLMLPMRSISGSSTGGCKEIE  303

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+L+FCA ++I P I+I+PI Y N A++R+IK DVK+RFVIDI  SLK
Sbjct  304   EMLQFCADKQILPNIEIVPIDYANTAIQRMIKSDVKFRFVIDIASSLK  351



>ref|XP_004309484.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 1-like, partial 
[Fragaria vesca subsp. vesca]
Length=259

 Score =   369 bits (948),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 186/258 (72%), Positives = 224/258 (87%), Gaps = 0/258 (0%)
 Frame = -2

Query  1024  NSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLA  845
             NSCR+CEYCN+GLEV C KG V T++  D DGT+T GG+S++ VVHERYC+KIPE+YPLA
Sbjct  2     NSCRDCEYCNDGLEVYCDKGVVLTYNRFDYDGTITHGGFSTFTVVHERYCFKIPEDYPLA  61

Query  844   SAAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISK  665
             SAAPLLCAGITVY+PMM H MN+PGKSLGVIGLGGLGH+A+KFGKAF LKVTVFSTS+SK
Sbjct  62    SAAPLLCAGITVYSPMMDHKMNKPGKSLGVIGLGGLGHMAMKFGKAFKLKVTVFSTSMSK  121

Query  664   KEEALNLLGADNFVISSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGF  485
             K+EAL +LGADNFV+SSD+ QM AL+KS DF+++TASGD PFDLY+SLLKTAG L LVG 
Sbjct  122   KDEALTVLGADNFVVSSDQDQMKALAKSLDFIVDTASGDHPFDLYMSLLKTAGVLVLVGA  181

Query  484   PSEVKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERL  305
             P+E+K SP SL +G + I GS+ GGTK  QE+L FC++ +IYP I+++PIQ VNEA+ERL
Sbjct  182   PNEIKLSPMSLLIGKRSITGSVAGGTKQIQEMLNFCSAHQIYPNIEVVPIQNVNEAIERL  241

Query  304   IKKDVKYRFVIDIGGSLK  251
             IKKDVKYRFV+DIG SLK
Sbjct  242   IKKDVKYRFVVDIGNSLK  259



>ref|XP_002974027.1| hypothetical protein SELMODRAFT_267688 [Selaginella moellendorffii]
 gb|EFJ24982.1| hypothetical protein SELMODRAFT_267688 [Selaginella moellendorffii]
Length=351

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 255/348 (73%), Gaps = 3/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
              C+GWAARD SGVLS + FSRR +G DD+   I +CG+CYA+ +   N  G +KYP+VPG
Sbjct  6     ECVGWAARDQSGVLSRHEFSRRAIGDDDICFKITHCGICYAEAVCIYNKLGDTKYPIVPG  65

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V EVGS V RFKVGD  GVG Y  SC  C+ C+ G+E  C K S+ T++  D+D
Sbjct  66    HEIVGVVTEVGSNVTRFKVGDRAGVGAYCRSCGSCDDCDNGMENYCHK-SLLTYNYEDID  124

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNM-NQPgkslgv  755
             GT+TKGG+S+ +VVH  Y ++IP+    + AAPLLCAGITVY+PM R+ M +Q GK LGV
Sbjct  125   GTITKGGFSNKMVVHSSYAFQIPDKLSSSDAAPLLCAGITVYSPMKRYGMISQTGKHLGV  184

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             IGLGGLGH+AVKFGKAFG KVTV STS  KKE+AL LLGAD F+++ D + + A  KS D
Sbjct  185   IGLGGLGHMAVKFGKAFGHKVTVLSTSPGKKEDALTLLGADEFLVTKDPQALHAAGKSID  244

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             ++I+TA+G    +LYL LLKT G L +VG P  ++F+   L L  + I+GS+TGG K  +
Sbjct  245   WIIDTAAGKHDLNLYLPLLKTGGHLVMVGVPPSIEFAT-HLMLPRRSISGSVTGGCKEIE  303

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+L+FCA ++I P I+IIPI Y N A++R+IK DVK+RFVIDI  SLK
Sbjct  304   EMLQFCADKQILPNIEIIPIDYANAAIQRMIKSDVKFRFVIDIASSLK  351



>ref|XP_002983464.1| hypothetical protein SELMODRAFT_118623 [Selaginella moellendorffii]
 gb|EFJ15365.1| hypothetical protein SELMODRAFT_118623 [Selaginella moellendorffii]
Length=349

 Score =   369 bits (947),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 254/348 (73%), Gaps = 3/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
              C+GWAARD SGVLS + FSRR +G DD+   I +CG+CYA+ +   N  G +KYP+VPG
Sbjct  4     ECVGWAARDQSGVLSRHEFSRRAIGDDDICFKITHCGICYAEAVCIFNKLGDTKYPIVPG  63

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V EVGS V RFKVGD   VG Y  SC  C+ C+ G+E  C K  + T++  D+D
Sbjct  64    HEIVGVVTEVGSNVTRFKVGDRAAVGAYCRSCGSCDDCDNGMENYCHK-LLLTYNYEDID  122

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNM-NQPgkslgv  755
             GT+TKGG+S+ +VVH RY ++IP+    + AAPLLCAGITVY+PM R+ M +Q GK LGV
Sbjct  123   GTITKGGFSNKMVVHSRYAFQIPDKLSSSDAAPLLCAGITVYSPMKRYGMISQTGKHLGV  182

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             IGLGGLGH+AVKFGKAFG KVTV STS  KKE+AL LLGAD F+++ D + + A  KS D
Sbjct  183   IGLGGLGHMAVKFGKAFGHKVTVLSTSPGKKEDALTLLGADEFLVTKDPQALHAAGKSID  242

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             ++I+TA+G    +LYL LLKT G L +VG P  ++F+   L L  + I+GS+TGG K  +
Sbjct  243   WIIDTAAGKHDLNLYLPLLKTGGHLVMVGVPPSIEFAT-HLMLRKRSISGSVTGGCKEIE  301

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+L+FCA ++I P I+I+PI Y N A++R+I+ DVK+RFVIDI  SLK
Sbjct  302   EMLQFCADKQILPNIEIVPIDYANTAIQRMIRSDVKFRFVIDIASSLK  349



>ref|XP_001766414.1| predicted protein [Physcomitrella patens]
 gb|EDQ68742.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 191/348 (55%), Positives = 243/348 (70%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
             +C+G+AA D SG L P+ F RR  G DDV   + +CG+CYA+VIWTRN     +YP+VPG
Sbjct  8     DCIGYAAHDESGFLKPFKFKRRNSGPDDVVFRVTHCGICYAEVIWTRNFLSDVQYPVVPG  67

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V +VGS V  FKVG+ VGVG    SC  C+ C EG++  C   +   F+ +DVD
Sbjct  68    HEIVGVVTKVGSNVSNFKVGERVGVGYCAMSCLHCDSCKEGMDSMCVNLATRVFNAVDVD  127

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+T+GG+S+ +  H+R+  KIP+  P   AAPLLCAG TVY PM R  MN+PG  LGV+
Sbjct  128   GTITRGGFSNIMQAHQRFVVKIPDALPSDVAAPLLCAGATVYGPMKRLGMNKPGMKLGVV  187

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGG+GH+ V FGKAFGL VTVFSTS SKK+EAL +LGAD FV+S DE+ M A   + DF
Sbjct  188   GLGGVGHMGVLFGKAFGLHVTVFSTSSSKKDEALGVLGADAFVLSKDEEAMKAQHNTLDF  247

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSI-TGGTKLTQ  395
             +IN ASG IP D YL  LK  G L LVG  +E KFSP ++ +  K I GS   GG K  Q
Sbjct  248   IINAASGSIPLDPYLLALKQEGVLVLVGAGAEAKFSPHNVFM-RKFITGSAGGGGAKNVQ  306

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+L+F A ++++P I+ I I YVNEA+ RL++ DV+YRFVIDI  SLK
Sbjct  307   EMLDFAAEKRVFPLIETINIDYVNEAMNRLVQNDVRYRFVIDIENSLK  354



>gb|ABK26008.1| unknown [Picea sitchensis]
Length=364

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 249/344 (72%), Gaps = 2/344 (1%)
 Frame = -2

Query  1282  GWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEI  1103
             GWAA+D SG+LSP+NF+RR  GS DV+  +AYCG+C++D+   RN   TS+YP+VPGHEI
Sbjct  16    GWAAKDESGILSPFNFTRRKTGSHDVTFKVAYCGICHSDLHQIRNDWKTSQYPMVPGHEI  75

Query  1102  VGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTV  923
             VG V EVGS V+ F VGD VGVG  V SC++C+ C++  E  C K  V+T++GI VDG+ 
Sbjct  76    VGTVIEVGSQVKNFAVGDRVGVGCMVWSCQQCDSCSKDHEQYCEK-VVWTYNGIYVDGSP  134

Query  922   TKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglg  743
             T GGYSS +V   R+  KIPE  P  +AAPLLCAGITVY+PM    M +PGKSLGV+GLG
Sbjct  135   TLGGYSSLMVCDHRFVVKIPECLPFDAAAPLLCAGITVYSPMKYFQMTEPGKSLGVVGLG  194

Query  742   glghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLIN  563
             GLGH+AVKFGKAFGLKVTV STS  K++EA   LGADNF+IS D+KQM+  ++S D++I+
Sbjct  195   GLGHMAVKFGKAFGLKVTVISTSPQKEKEAREHLGADNFLISKDQKQMLEAARSLDYIID  254

Query  562   TASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQELL  386
             T S D P    ++LLK  G L +VG P + + F P ++  G + + GS+ GG K TQE+L
Sbjct  255   TVSADHPLHPIINLLKVNGKLVVVGMPEKPISFHPATVIFGRRFVGGSMIGGVKETQEML  314

Query  385   EFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             +FCA   I   I+ IP+ YVN A++RL K DVKYRFVID+ GS 
Sbjct  315   DFCAEHNISCVIESIPMDYVNTAMQRLEKGDVKYRFVIDVTGSF  358



>gb|ACN40687.1| unknown [Picea sitchensis]
Length=366

 Score =   356 bits (914),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 193/343 (56%), Positives = 247/343 (72%), Gaps = 2/343 (1%)
 Frame = -2

Query  1282  GWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEI  1103
             GWAARD SG+LSP NF+RR  GS+DV+  +AYCG+C++D+   RN    S YP+VPGHEI
Sbjct  18    GWAARDDSGILSPINFTRRKTGSNDVTFKVAYCGICHSDLHQIRNEWKNSMYPMVPGHEI  77

Query  1102  VGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTV  923
             VG+V EVGS V++F VGD VGVG  V SC++C+ C+EG E  C K +V T++ I+ DG+ 
Sbjct  78    VGLVTEVGSEVKKFAVGDRVGVGCMVWSCQQCDSCSEGQEQYCDK-TVLTYNAINADGSP  136

Query  922   TKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglg  743
             T GGYSS +V ++R+  KIPE  P  +AAPLLCAGITVY+PM    M +PGKSLGV+GLG
Sbjct  137   TFGGYSSLMVCNQRFVVKIPETLPFDAAAPLLCAGITVYSPMKYLQMTEPGKSLGVVGLG  196

Query  742   glghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLIN  563
             GLGH+AVK GKAFGL+VTV STS  K++EA  +LGAD+F+IS D+KQM   +KS D++I+
Sbjct  197   GLGHMAVKLGKAFGLRVTVISTSPKKEKEAREVLGADHFIISKDQKQMQDAAKSLDYIID  256

Query  562   TASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQELL  386
             T S D P    +SLLK  G L LVG P   + F P ++  G + + GS  GG K TQE+L
Sbjct  257   TVSADHPIQPLISLLKVQGKLVLVGLPENPIYFHPAAVISGRRFVGGSSIGGVKETQEML  316

Query  385   EFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGS  257
             +FCA   I   I+ IPI YVN A+ERL K DVKYRFVI++  S
Sbjct  317   DFCAEHNISCMIENIPIDYVNTAMERLGKGDVKYRFVINVAES  359



>gb|AFK47110.1| unknown [Lotus japonicus]
Length=363

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 251/359 (70%), Gaps = 5/359 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MAS    ++     GWAARD SGVLSP+ FSRR  G  DV+  + YCG+C++D+   +N 
Sbjct  1     MASQPEMEHPKKAFGWAARDSSGVLSPFKFSRRETGEKDVTFKVLYCGICHSDLHMIKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G+S YPLVPGHEI G+V EVGS VQ+FKVGD VGVG  VNSCR C+ C + LE  C K 
Sbjct  61    WGSSVYPLVPGHEIAGVVTEVGSKVQKFKVGDRVGVGCMVNSCRSCQSCADNLENYCPK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T+   +VDGTVT GGYS  +V  E +  +IP+N PL +AAPLLCAGITVY+P+  + 
Sbjct  120   MILTYAAKNVDGTVTYGGYSDLMVSDEDFVIRIPDNLPLEAAAPLLCAGITVYSPLKYYG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG  +GV+GLGGLGH+AVKF KA G KVTV STS +KK EA+  LGAD+FV+S ++ 
Sbjct  180   LDKPGLHVGVVGLGGLGHMAVKFAKALGAKVTVISTSPNKKTEAIEKLGADSFVVSREQD  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIA  428
             QM A+  +FD +I+T S   P    +SLLK  G L +VG P +    P  SL  G K IA
Sbjct  240   QMKAVMGTFDGIIDTVSAVHPLLPLISLLKPHGKLVMVGAPEKPLEVPVFSLLGGRKTIA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS+ GG K TQE+++F A   + PEI++IP+ YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  300   GSMIGGIKETQEMIDFAAKHDVKPEIEVIPMDYVNTAMERLLKADVKYRFVIDIGNTLK  358



>gb|ABK21490.1| unknown [Picea sitchensis]
Length=366

 Score =   354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 192/343 (56%), Positives = 246/343 (72%), Gaps = 2/343 (1%)
 Frame = -2

Query  1282  GWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEI  1103
             GWAARD SG+LSP NF+RR  GS+DV+  +AYCG+C++D+   RN    S YP+VPGHEI
Sbjct  18    GWAARDDSGILSPINFTRRKTGSNDVTFKVAYCGICHSDLHQIRNEWKNSMYPMVPGHEI  77

Query  1102  VGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTV  923
             VG+V EVGS V++F VGD VGVG  V SC++C+ C+EG E  C K +V T++ I+ DG+ 
Sbjct  78    VGLVTEVGSEVKKFAVGDRVGVGCMVWSCQQCDSCSEGQEQYCDK-TVLTYNAINADGSP  136

Query  922   TKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglg  743
             T GGYSS +V ++R+  KIPE  P  + APLLCAGITVY+PM    M +PGKSLGV+GLG
Sbjct  137   TFGGYSSLMVCNQRFVVKIPETLPFDAEAPLLCAGITVYSPMKYLQMTEPGKSLGVVGLG  196

Query  742   glghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLIN  563
             GLGH+AVK GKAFGL+VTV STS  K++EA  +LGAD+F+IS D+KQM   +KS D++I+
Sbjct  197   GLGHMAVKLGKAFGLRVTVISTSPKKEKEAREVLGADHFIISKDQKQMQDAAKSLDYIID  256

Query  562   TASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQELL  386
             T S D P    +SLLK  G L LVG P   + F P ++  G + + GS  GG K TQE+L
Sbjct  257   TVSADHPIQPLISLLKVQGKLVLVGLPENPIYFHPAAVISGRRFVGGSSIGGVKETQEML  316

Query  385   EFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGS  257
             +FCA   I   I+ IPI YVN A+ERL K DVKYRFVI++  S
Sbjct  317   DFCAEHNISCMIENIPIDYVNTAMERLGKGDVKYRFVINVAES  359



>ref|XP_007158342.1| hypothetical protein PHAVU_002G144500g [Phaseolus vulgaris]
 gb|ESW30336.1| hypothetical protein PHAVU_002G144500g [Phaseolus vulgaris]
Length=361

 Score =   349 bits (896),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/359 (52%), Positives = 252/359 (70%), Gaps = 5/359 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MAS   T++     GWAA+D SG LSP+ FSRR  G +DV+  + YCG+C++D+   +N 
Sbjct  1     MASQPETEHPNKAFGWAAQDTSGHLSPFKFSRRATGENDVAFKVLYCGICHSDLHMLKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G S YPLVPGHE+ G+V EVG  VQ+FKVGD VGVG  V SC  CE C+E LE  C K 
Sbjct  61    WGVSVYPLVPGHEVAGLVTEVGKNVQKFKVGDKVGVGCMVGSCHSCESCSEDLENYCPK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T++   VDGT+T GGYS  +VV E++  +IP+N PL +AAPLLCAGITVY+P+  + 
Sbjct  120   MILTYNAKYVDGTITYGGYSDSMVVDEQFAIRIPDNLPLDAAAPLLCAGITVYSPLKYYG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG  +GV+GLGGLGH+AVKF KA G+KVTV STS  KK+EA+  +GAD+FV+S ++ 
Sbjct  180   LDKPGLHIGVVGLGGLGHMAVKFAKALGVKVTVISTSPGKKKEAIENMGADSFVVSREQD  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIA  428
             +MMA+  +FD +I+T S + P    + LLK  G L +VG P +    P  SL +G K IA
Sbjct  240   EMMAVMGTFDGIIDTVSANHPLVPLIGLLKPHGKLVMVGAPEKPLEVPAFSLLMGRKMIA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS  GG K TQE+++F A   + P+I++I + YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  300   GSAMGGIKETQEMVDFAAKHGVKPDIEVIGMDYVNTAMERLLKADVKYRFVIDIGNTLK  358



>ref|XP_006364647.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Solanum tuberosum]
Length=356

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 246/355 (69%), Gaps = 3/355 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M  SH      GWAARD SGVLSP+NFSRRV G  DV   + YCG+C++D+   +N    
Sbjct  1     MEKSHENVKAFGWAARDTSGVLSPFNFSRRVTGEKDVQFKVMYCGICHSDLHQLKNEWSN  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YP+VPGHE+VG+V E+GS V++FK+GD VGVG  V SCR+CE C+  LE  C +  + 
Sbjct  61    SIYPMVPGHEVVGVVTEIGSKVEKFKIGDKVGVGCLVGSCRKCENCDNNLENYC-RDQIM  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T++G+  DG  T GGYS  +V +E Y    PEN P+  AAPLLCAGIT Y+P+    +++
Sbjct  120   TYNGVYTDGIPTYGGYSDIMVTNEHYVVHWPENLPM-EAAPLLCAGITTYSPLRYFGLDK  178

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PG  +GV+GLGGLGH+AVKF KAFG KVTV STS+SKK+EA++ LGAD+F++S D  QM 
Sbjct  179   PGMHIGVVGLGGLGHMAVKFAKAFGTKVTVISTSVSKKDEAIDRLGADSFLVSRDPDQMQ  238

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSI  419
               + S D +I+T S   P    ++LLKT G L +VG P + ++     L LG K +AGS 
Sbjct  239   GAAGSLDGIIDTVSEIHPLLPLINLLKTHGKLVMVGAPEKPLELPVFPLLLGRKLVAGSA  298

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
              GG K TQE+++F A   I P+++++P+ YVN+ALERL+K DVKYRFV+DIG +L
Sbjct  299   IGGMKETQEMVDFAAKHSITPDVEVVPMDYVNKALERLLKSDVKYRFVLDIGNTL  353



>gb|EMS45840.1| Putative cinnamyl alcohol dehydrogenase 5 [Triticum urartu]
Length=366

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 244/358 (68%), Gaps = 2/358 (1%)
 Frame = -2

Query  1324  FTSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
              T+  S   T   +G AARD SG LSP   +RR    DDV + I YCG+C++D+   +N 
Sbjct  1     MTAEQSQQHTRRAVGLAARDASGHLSPLAITRRSTRDDDVVIRILYCGICHSDLHGIKND  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
                +KYP+VPGHEI G V EVG  V +FK GD VGVG  VNSC+ CE CN+G E  C  G
Sbjct  61    WKNAKYPMVPGHEIAGEVNEVGKNVTKFKTGDRVGVGCMVNSCQSCESCNKGFENHCP-G  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T++ +D+DGT+T GGYSS +VVHER+  + P+  PL   APLLCAGITVY+PM  H 
Sbjct  120   IIPTYNLVDLDGTITYGGYSSMVVVHERFVVRFPDTIPLDKGAPLLCAGITVYSPMKYHG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +N PG  LGV+GLGGLGH+AVKFGKAFG+KVTV S+S  KK+EAL  LGAD F++S ++K
Sbjct  180   LNVPGMHLGVLGLGGLGHVAVKFGKAFGMKVTVISSSPGKKQEALERLGADAFIVSKNDK  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             +M A   + D +INT S +IP   +L LLK  G + +VG P + ++ SP +L    K +A
Sbjct  240   EMKAAMSTMDGIINTVSANIPMAPFLGLLKPNGKMIMVGLPEKPMEISPFALVATNKTLA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GS+ GG + TQE+L+  A   +  +I++I  +YVN A+ERL K DV+YRFVIDIG +L
Sbjct  300   GSLIGGMRDTQEMLDLAAKHGVTADIEVIGAEYVNTAMERLAKADVRYRFVIDIGNTL  357



>ref|NP_001064659.2| Os10g0430200 [Oryza sativa Japonica Group]
 sp|Q337Y2.1|CADH3_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase 3; Short=OsCAD3 
[Oryza sativa Japonica Group]
 gb|ABB47655.1| mannitol dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ16157.1| hypothetical protein OsJ_31603 [Oryza sativa Japonica Group]
 dbj|BAG91230.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93975.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF26573.2| Os10g0430200 [Oryza sativa Japonica Group]
Length=366

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 235/347 (68%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
               +G AARD SG LSP+  SRR  G DDV++ I +CG+C++D+   +N    S YPLVPG
Sbjct  15    QAVGLAARDSSGHLSPFAISRRSTGDDDVAIKILFCGICHSDLHCIKNEWKHSIYPLVPG  74

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEI G+V EVG  V RFK GD VGVG  VNSCR CE CN G E  C +G VFT++ +D D
Sbjct  75    HEIAGVVTEVGKNVTRFKAGDRVGVGCMVNSCRSCESCNNGFENHCPEG-VFTYNSVDKD  133

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GTVT GGYSS +VVHER+    PE  PL   APLLCAGITVYTPM  H +N PGK +GV+
Sbjct  134   GTVTYGGYSSMVVVHERFVVMFPEAMPLDVGAPLLCAGITVYTPMKYHGLNAPGKHVGVL  193

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF +AFGLKVTV S+S  KK EAL  LGAD FV+SS  ++M A   + D 
Sbjct  194   GLGGLGHVAVKFARAFGLKVTVISSSPGKKREALERLGADAFVVSSSAEEMEAARSTMDG  253

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +INT S + P   YL+LLK  G + LVG P   ++  P SL  G + +AGS  GG   TQ
Sbjct  254   VINTVSANTPMAPYLALLKPNGKMILVGLPENPLEVPPFSLVHGNRTLAGSNIGGMADTQ  313

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E++E  A   +  +I++I    VN A+ERL K DV+YRFVID+G +L
Sbjct  314   EMIELAAKHGVTADIEVIGADDVNTAMERLAKADVRYRFVIDVGNTL  360



>gb|AAL99536.1|AF472592_1 cinnamyl alcohol dehydrogenase [Lolium perenne]
Length=370

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 237/351 (68%), Gaps = 2/351 (1%)
 Frame = -2

Query  1303  HSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYP  1124
               T   +G AARD +G LSP   +RR  G DDV + I YCG+C++D+   +N    S+YP
Sbjct  13    QHTRKAVGLAARDDAGHLSPLAITRRSTGDDDVVIKILYCGICHSDLHALKNDWKNSRYP  72

Query  1123  LVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDG  944
             ++PGHEI G V EVG  V +FK GD VGVG  VNSCR CE C++G E  C  G + T++ 
Sbjct  73    MIPGHEIAGEVTEVGKNVSKFKAGDRVGVGCMVNSCRSCESCDKGFENHCP-GMILTYNS  131

Query  943   IDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgks  764
             +DVDGTVT GGYSS +VVHER+  + P+  PL   APLLCAGITVY+PM  H +N PG  
Sbjct  132   VDVDGTVTYGGYSSMVVVHERFVVRFPDAMPLDKGAPLLCAGITVYSPMKYHGLNVPGLH  191

Query  763   lgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSK  584
             LGV+GLGGLGH+AVKFGKAFG+KVTV S+S  KKEEAL  LGAD F++S D  +M A+  
Sbjct  192   LGVLGLGGLGHVAVKFGKAFGMKVTVISSSPGKKEEALGRLGADAFIVSKDADEMKAVMS  251

Query  583   SFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGT  407
             + D +INT S +IP      LLK  G + +VG P + ++  P +L    K +AGSI GG 
Sbjct  252   TMDGIINTVSANIPLTPLFGLLKPNGKMIMVGLPEKPIEIPPFALVATNKTLAGSIIGGM  311

Query  406   KLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
               TQE+L+  A   +  +I+++  +YVN ALERL K DV+YRFVIDIG +L
Sbjct  312   SDTQEMLDLAAKHGVTADIEVVGAEYVNTALERLAKNDVRYRFVIDIGNTL  362



>ref|XP_011099958.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Sesamum indicum]
Length=359

 Score =   346 bits (887),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 250/358 (70%), Gaps = 4/358 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MA+S  T++     GWAA+D SG+LSP+ FSRR  G  DV L I YCGVC++D+   +N 
Sbjct  1     MATSPETEHPVKAFGWAAKDTSGILSPFKFSRRATGEHDVQLRILYCGVCHSDLHMAKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G +++P+VPGHEIVGIV EVGS V++FKVG+ VGVG  V SCR+C+ C+  LE  C+K 
Sbjct  61    LGFTQFPMVPGHEIVGIVTEVGSKVKKFKVGNKVGVGCLVGSCRQCDLCDRDLENYCAK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T+     DGT+T+GGYS  +V  E +    P+N+PL + APLLCAGIT Y+P+    
Sbjct  120   QILTYSMPYYDGTITQGGYSDIMVADEHFVILWPDNFPLDAGAPLLCAGITTYSPLRHFG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG S+G++GLGGLGHLAVKF KAFG +VTV STSI+KKEEA+  LGAD F++SSD +
Sbjct  180   LDKPGMSVGIVGLGGLGHLAVKFAKAFGCRVTVISTSINKKEEAIGKLGADEFLVSSDPE  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAG  425
             QM A   + D +I+T S      + +SLLK  G L LVG P  ++     L +G + I G
Sbjct  240   QMQAAIGTLDGIIDTVSATHSLFMLVSLLKAEGKLILVGLPQSLEIPIFPLLIGRRAIIG  299

Query  424   SITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             S TGG K TQE+++F A   I P++++IP+ YVN A+ERL+K DVKYRFVIDI  +LK
Sbjct  300   SATGGLKETQEMIDFAAKHNILPDVEMIPMDYVNTAMERLLKSDVKYRFVIDIASTLK  357



>ref|XP_009767330.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like isoform X1 [Nicotiana 
sylvestris]
 emb|CAO99126.1| putative cinnamyl alcohol dehydrogenase [Nicotiana tabacum]
 gb|ADD81207.1| sinapyl alcohol dehydrogenase 4 [Nicotiana tabacum]
Length=359

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 242/346 (70%), Gaps = 3/346 (1%)
 Frame = -2

Query  1288  CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGH  1109
               GWAARD SGVLSP+NFSRR  G  DV   + YCG+C++D+   +N   TS YP+VPGH
Sbjct  13    AFGWAARDTSGVLSPFNFSRRATGEKDVQFKVMYCGICHSDLHQLKNEWSTSIYPMVPGH  72

Query  1108  EIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDG  929
             E+ G+V +VGS V++FKVGD VGVG  V SCR+CE C+  LE  C  G + T++GI +DG
Sbjct  73    EVAGVVTDVGSKVEKFKVGDKVGVGCLVGSCRKCENCDNNLENYCP-GQIMTYNGIYIDG  131

Query  928   TVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvig  749
             T T GGYS+ +V  E Y    PEN P+  AAPLLCAGIT Y+P+    +++PG  +GV+G
Sbjct  132   TTTYGGYSNIMVTDEHYVVHWPENLPM-EAAPLLCAGITTYSPLKYFGLDKPGMHIGVVG  190

Query  748   lgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFL  569
             LGGLGH+AVKF KAFG KVTV STS SKK+EA+  LGAD+F++S D  QM A + S D +
Sbjct  191   LGGLGHMAVKFAKAFGTKVTVISTSASKKQEAIGRLGADSFLVSRDPDQMQAAAGSLDGI  250

Query  568   INTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQE  392
             I+T S   P    ++LLKT G L +VG P + ++     L LG K +AGS  GG K TQE
Sbjct  251   IDTVSAIHPLLPLINLLKTHGKLVMVGAPEKPLELPVFPLLLGRKLVAGSAIGGIKETQE  310

Query  391   LLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             +++F A   I P+++++P+ YVN AL+RL+K DVKYRFV+D+G +L
Sbjct  311   MVDFAAKHNITPDVEVVPMDYVNTALDRLLKSDVKYRFVLDVGNTL  356



>ref|XP_004235066.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Solanum 
lycopersicum]
Length=360

 Score =   345 bits (884),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 188/354 (53%), Positives = 242/354 (68%), Gaps = 2/354 (1%)
 Frame = -2

Query  1312  ASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTS  1133
             A +       GWAARDPSGVLSP++FSRR  G+DD ++ I YCGVC++D+   +N  G +
Sbjct  5     AVNEQPQKAFGWAARDPSGVLSPFHFSRRENGNDDATVKIHYCGVCHSDLHTLKNEWGFT  64

Query  1132  KYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFT  953
             KYP++PGHEIVGIV  VGS V +FKVGD VGVG  V SC+ C+ C + LE  C K ++FT
Sbjct  65    KYPILPGHEIVGIVTAVGSSVHKFKVGDRVGVGVIVGSCQTCDICEQSLENYCPK-AIFT  123

Query  952   FDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQP  773
             ++  D DGT T GGYS  IVVH+R+  + PEN P  + APLLCAGITVY+PM  + M +P
Sbjct  124   YNSTDHDGTNTYGGYSDIIVVHQRFVLRFPENLPSDAGAPLLCAGITVYSPMKYYGMTEP  183

Query  772   gkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMA  593
             GK LG+ GLGGLGH+AVK GKAFGLKVTV STS  K++EA+  LGAD FV+S+D  +  A
Sbjct  184   GKHLGIAGLGGLGHIAVKIGKAFGLKVTVISTSPKKEDEAITKLGADAFVLSTDPAKFKA  243

Query  592   LSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSIT  416
                + D++I+T +   P    LSLLK  G L  +G P + ++     L LG K + GS  
Sbjct  244   AVNTMDYIIDTIAAVHPLAPLLSLLKMDGKLITIGLPEKPLELPIFPLVLGRKLVGGSDI  303

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GG K TQE+L+FCA   I  +I++I +  +N A+ERL K DVKYRFVIDI  SL
Sbjct  304   GGMKETQEMLDFCAKHNITADIELISVDNINMAMERLAKSDVKYRFVIDIANSL  357



>ref|XP_011083435.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Sesamum indicum]
Length=356

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 186/351 (53%), Positives = 245/351 (70%), Gaps = 2/351 (1%)
 Frame = -2

Query  1300  STDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPL  1121
             S+    GWAARDPSGVLSP++FSRR     DV   + YCG+C++D+   +N  G S YP+
Sbjct  4     SSVKAFGWAARDPSGVLSPFDFSRRPTRDHDVQFKVLYCGICHSDLHAIKNEWGFSTYPV  63

Query  1120  VPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGI  941
             VPGHEIVG+V EVGS VQ+F+VGD VGVG  V+SCR+C+ C   LE  C + +V T++ I
Sbjct  64    VPGHEIVGVVTEVGSKVQKFQVGDKVGVGCLVDSCRKCDQCTNNLENYCPQ-TVLTYNTI  122

Query  940   DVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgksl  761
               DGTVT GGYS  +VV E +  + PEN PL   APLLCAGIT Y+P+  + +++PG  +
Sbjct  123   LPDGTVTYGGYSDIMVVDEDFAIRWPENLPLDKGAPLLCAGITTYSPLRYYGLDKPGLHI  182

Query  760   gviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKS  581
             GV+GLGGLGH+AVKF KAFG KVTV STS+ KK+EAL  LGAD F++S D  +M A + S
Sbjct  183   GVVGLGGLGHVAVKFAKAFGTKVTVISTSVGKKKEALEGLGADTFLVSRDPAEMKAAAGS  242

Query  580   FDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTK  404
              D +I+T S   P +  LSLLK  G + +VG P + ++    SL +  K +AGS+ GG K
Sbjct  243   LDGIIDTVSAQHPIEPLLSLLKPHGKMIMVGAPEKPLELPVFSLIMTRKMVAGSMIGGLK  302

Query  403   LTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              TQE+++F A   I P++++I + YVN A+ERL K DVKYRFVIDIG +LK
Sbjct  303   ETQEMIDFAAKHNILPDVEMISMDYVNTAMERLAKADVKYRFVIDIGKTLK  353



>gb|AFY63472.1| geraniol dehydrogenase [Perilla frutescens]
Length=360

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 246/358 (69%), Gaps = 5/358 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MA +  T++     GWAARD SG LSP+NFSRR  G  DV   + YCGVC++D+   +N 
Sbjct  1     MAKTPETEHPVKAFGWAARDNSGTLSPFNFSRRDTGERDVQFKVLYCGVCHSDLHMVKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G + YP+VPGHEIVG+V EVGS V++ K GD VGVG  V SCR+C+ C+  LE  CSK 
Sbjct  61    RGVTHYPVVPGHEIVGVVTEVGSKVEKVKAGDKVGVGVIVGSCRQCDQCSNDLENYCSK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T+    +DGT+T+GGYS+ +V  E +  + PEN PL + APLLCAGIT Y+P+  + 
Sbjct  120   QILTYGAPYIDGTITRGGYSNIMVADEHFIIRWPENLPLDAGAPLLCAGITTYSPLRYYG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG S+GV GLGGLGH+AVKF KAFG KVTV STS+ KK+EA+  LG D F++SSD +
Sbjct  180   LDKPGLSVGVNGLGGLGHVAVKFAKAFGTKVTVISTSLGKKKEAIEHLGVDEFLVSSDPQ  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             QM A   + D +I+T S + P    +SLLK  G L +VG P + ++    SL  G K +A
Sbjct  240   QMQAAVGTLDGIIDTVSAEHPLVPLMSLLKPHGKLIVVGAPEKPLQLHAFSLIQGRKTVA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GS  GG K TQE+++F A + I P++++IPI Y+N A++RL+K DVKYRFVID+  S 
Sbjct  300   GSAIGGMKETQEMIDFAAKKNIIPDVEVIPIDYINTAMDRLLKSDVKYRFVIDVNKSF  357



>ref|XP_008460921.1| PREDICTED: probable mannitol dehydrogenase [Cucumis melo]
Length=358

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 189/350 (54%), Positives = 239/350 (68%), Gaps = 2/350 (1%)
 Frame = -2

Query  1297  TDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLV  1118
             T    GWAARD SG+LSP++FSRR  G DDVS+ + YCGVC++D+   +N  G++ YP+V
Sbjct  10    THKAFGWAARDSSGLLSPFHFSRRENGDDDVSIKVLYCGVCHSDLHMLKNDWGSTDYPIV  69

Query  1117  PGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGID  938
             PGHEIVG+V  VG  V+RFK GD VGVG  V SCR CE C + LE  C K   +T++   
Sbjct  70    PGHEIVGVVTSVGKNVKRFKAGDEVGVGVIVGSCRNCENCKQDLESYCPKME-YTYNSPG  128

Query  937   VDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslg  758
             VDGT   GGYS  IVV + +  + P+N  L + APLLCAGITVY+PM    M +PGK LG
Sbjct  129   VDGTKNYGGYSDKIVVDQHFVVRFPKNLALDAGAPLLCAGITVYSPMKHFGMTEPGKHLG  188

Query  757   viglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSF  578
             V GLGGLGH+AVKFGKAFGLKVTV STS  KKEEA++ LGAD FV+S+D +Q+ A   + 
Sbjct  189   VAGLGGLGHVAVKFGKAFGLKVTVISTSSRKKEEAIDRLGADAFVVSTDPEQLKAAMGTM  248

Query  577   DFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKL  401
             D++++T S   P D  +SLL   G L  VG P++ V+ S G L  G + +AGS  GG K 
Sbjct  249   DYILDTISAVHPLDPLISLLNLNGKLVAVGLPNKPVELSIGILASGRRVVAGSNFGGLKE  308

Query  400   TQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TQE+L+FC    I  EI++I +  +N A+ERL K DVKYRFVIDI  S K
Sbjct  309   TQEMLDFCGKHNITAEIELIKMDDINSAMERLAKADVKYRFVIDIENSFK  358



>ref|XP_006355137.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9-like [Solanum 
tuberosum]
Length=360

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 187/354 (53%), Positives = 241/354 (68%), Gaps = 2/354 (1%)
 Frame = -2

Query  1312  ASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTS  1133
             A +       GWAARDPSG+LSP++FSRR  G DDV++ I YCG+C++D+   +N  G +
Sbjct  5     AENEQPQKAFGWAARDPSGILSPFHFSRRENGDDDVTVKIHYCGICHSDLHSLKNEWGFT  64

Query  1132  KYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFT  953
             KYP++PGHEIVG V  VGS V +FKVGD VGVG  V SC+ C+ C + LE  C    +FT
Sbjct  65    KYPILPGHEIVGFVTAVGSSVHKFKVGDRVGVGVIVGSCQTCDICEQSLENYCPN-VIFT  123

Query  952   FDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQP  773
             ++  D DGT T GGYS  IVVH+R+  + PEN P  + APLLCAGITVY+PM  + M +P
Sbjct  124   YNSTDHDGTNTYGGYSDMIVVHQRFVLQFPENLPSDAGAPLLCAGITVYSPMKYYGMTEP  183

Query  772   gkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMA  593
             GK LGV GLGGLGH+AVK GKAFGLKVTV STS  K++EA+N LGAD FV+SSD  ++ A
Sbjct  184   GKHLGVAGLGGLGHIAVKIGKAFGLKVTVISTSPKKEDEAINKLGADAFVLSSDPAKLKA  243

Query  592   LSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSIT  416
                + D++I+T +   P    LSLLK  G L  +G P + ++     L LG K + GS  
Sbjct  244   AVNTMDYIIDTIAAVHPLAPLLSLLKMDGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDI  303

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GG K TQE+L+FCA   I  +I++I +  +N A+ERL + DVKYRFVIDI  SL
Sbjct  304   GGMKETQEMLDFCAKHNITADIELISVDNINMAMERLAESDVKYRFVIDIANSL  357



>gb|AFY63474.1| geraniol dehydrogenase [Perilla setoyensis]
Length=360

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 247/358 (69%), Gaps = 5/358 (1%)
 Frame = -2

Query  1315  MASSHSTDNCL---GWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MA +  T++ L   GWAARD SG LSP+NFSRR  G  DV   + YCGVC++D+   +N 
Sbjct  1     MAKTPETEHPLKAFGWAARDNSGTLSPFNFSRRDTGERDVQFKVLYCGVCHSDLHMVKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G + YP+VPGHEIVG+V EVGS V++ K GD VGVG  V SCR+C+ C+  LE  CSK 
Sbjct  61    WGVTHYPVVPGHEIVGVVTEVGSKVEKVKAGDKVGVGVIVGSCRQCDQCSNDLENYCSK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T+    +DGT+T+GGYS+ +V  E +  + PEN PL + APLLCAGIT Y+P+  + 
Sbjct  120   QILTYGAPYIDGTITRGGYSNIMVADEHFIIRWPENLPLDAGAPLLCAGITTYSPLRYYG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG S+GV GLGGLGH+AVKF KAFG KVTV STS+ KK+EA+  LG D F++SSD +
Sbjct  180   LDKPGLSVGVNGLGGLGHVAVKFAKAFGTKVTVISTSLGKKKEAIEHLGVDEFLVSSDPQ  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             QM A   + D +I+T S + P    +SLLK  G L +VG P + ++    SL  G K +A
Sbjct  240   QMQAAVGTLDGIIDTVSAEHPLAPLMSLLKPHGKLIVVGAPQKPLQLHAFSLIQGRKTVA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GS  GG K TQE+++F A + I P++++IPI Y+N A++RL+K DVKYRFVID+  S 
Sbjct  300   GSGIGGMKETQEMIDFAAKKNIIPDVEVIPIDYINTAMDRLLKSDVKYRFVIDVNKSF  357



>ref|XP_011083434.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Sesamum indicum]
Length=355

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 244/348 (70%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARD SGVLSP++FSRR     DV   + YCG+C++D+   +N  G + YP+VPG
Sbjct  6     KAFGWAARDSSGVLSPFDFSRRSTADRDVQFKVLYCGICHSDLHGIKNEWGFTNYPMVPG  65

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V EVGS VQ+F+VGD VGVG  VNSCR+C+ C   LE  C K  +FT++ +  +
Sbjct  66    HEIVGVVTEVGSKVQKFRVGDKVGVGCLVNSCRKCDQCANNLENYCPK-PIFTYNTVLPN  124

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GTVT GGYS  +VV E +  + PEN+PL   APLLCAGIT Y+P+  + +++PG  +GV+
Sbjct  125   GTVTYGGYSDIMVVDEDFVIRWPENFPLDKGAPLLCAGITTYSPLKYYGLDKPGLHIGVV  184

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KAFG KVTV STS+ KK+EAL  LGAD FV+S ++ ++ A + S D 
Sbjct  185   GLGGLGHVAVKFAKAFGSKVTVISTSVGKKKEALEALGADVFVVSREQGELKAAAGSLDG  244

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P +  LSLLK  G + +VG P + ++    S+ +  K +AGS+ GG K TQ
Sbjct  245   IIDTVSAQHPIEPLLSLLKPHGKMIMVGAPEKPLQLPVFSIIMARKTVAGSMIGGLKETQ  304

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A   I P+++II + YVN A+ERL K DVKYRFVIDIG +LK
Sbjct  305   EMIDFAAKHNILPDVEIISMDYVNTAIERLAKADVKYRFVIDIGQTLK  352



>ref|XP_002445214.1| hypothetical protein SORBIDRAFT_07g006090 [Sorghum bicolor]
 gb|EES14709.1| hypothetical protein SORBIDRAFT_07g006090 [Sorghum bicolor]
Length=373

 Score =   343 bits (880),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 242/353 (69%), Gaps = 2/353 (1%)
 Frame = -2

Query  1303  HSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYP  1124
               T   +G AA D SG L+P   +RR  G DDV++ I +CG+C++D+   +N  G + YP
Sbjct  17    QHTGKAVGLAAHDASGHLAPLTITRRSTGDDDVAIKILFCGMCHSDLHSIKNEWGNAMYP  76

Query  1123  LVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDG  944
             +VPGHEI G+V EVG  V RF  GD VGVG  VNSC+ C+ C EG E  C  G +FT++ 
Sbjct  77    MVPGHEIAGVVTEVGKNVTRFNPGDRVGVGCMVNSCQSCDGCAEGFENTCGGGIIFTYNS  136

Query  943   IDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgks  764
             +D DGTVT GGYSS + VHER+  + P+  PL   APLLCAGITVY+PM  H +N+PGK 
Sbjct  137   VDRDGTVTYGGYSSSVTVHERFVVRFPDGMPLDRGAPLLCAGITVYSPMKYHGLNKPGKH  196

Query  763   lgviglgglghLAVKFGK-AFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALS  587
             +GV+GLGGLGH+AVK  K AFG+KVTV STS  KK+EA++ LGAD FV+S D ++M A +
Sbjct  197   VGVLGLGGLGHVAVKLAKAAFGMKVTVISTSPGKKQEAMDRLGADAFVVSKDAEEMKAAA  256

Query  586   KSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGG  410
              + D +INT S +IP   ++SLLK  G + +VG P++ ++  P  L +G K +AGS  GG
Sbjct  257   STMDGIINTVSANIPLAPFMSLLKPNGKMIMVGLPTKALEIPPFDLIMGNKTLAGSCIGG  316

Query  409   TKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              + TQE+L+  A   +  +I+++   YVN A+ERL K DV+YRFVIDIG +LK
Sbjct  317   MRDTQEMLDVAAKHGVTADIELVDADYVNTAMERLAKADVRYRFVIDIGNTLK  369



>ref|XP_004288495.1| PREDICTED: probable mannitol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=361

 Score =   342 bits (878),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 184/348 (53%), Positives = 238/348 (68%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
               +GWAARD SGVLSP+NFSRR  G  DV+  + YCG+C++D+   +N  G+S YPLVPG
Sbjct  12    KAIGWAARDTSGVLSPFNFSRRETGEKDVAFKVLYCGICHSDLHMVKNEWGSSTYPLVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V EVGS VQ  KVGD VGVG  V SCR C+ C + LE  C K  + T+  ++ D
Sbjct  72    HEIVGVVTEVGSKVQNVKVGDRVGVGCMVGSCRSCDSCADHLENYCPK-MILTYGSVNFD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+T GGYS  +V  E +  +IPEN PL  AAPLLCAGIT Y+P+    +++PG  +GV+
Sbjct  131   GTMTYGGYSDIMVADEHFIVRIPENLPLDGAAPLLCAGITTYSPLKHFGLDKPGMHVGVV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KA G+KVTV STS  KK EAL  L AD+F++S+D  +M A   + D 
Sbjct  191   GLGGLGHVAVKFAKALGVKVTVISTSPKKKAEALERLRADSFLVSTDANEMQAAMGTMDG  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    + LLK  G L +VG P +    P  SL +G K +AGS  GG K TQ
Sbjct  251   IIDTVSALHPLPPLIGLLKAHGKLVMVGAPEKPLELPAFSLIMGRKIVAGSAIGGMKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A   I  +I++IPI Y+N A+ERL+K DV+YRFVIDIG +LK
Sbjct  311   EMIDFAAKHNITADIEVIPIDYLNTAMERLLKADVRYRFVIDIGNTLK  358



>ref|XP_003612973.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95931.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=361

 Score =   342 bits (878),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 249/359 (69%), Gaps = 5/359 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MAS   T++     GWAARD SGVLSP+ FSRR  G  DV+  + +CG+C++D+   +N 
Sbjct  1     MASKPETEHPKQAFGWAARDTSGVLSPFKFSRRETGEKDVAFKVLFCGICHSDLHMAKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G++ YP+VPGHE+ G V EVGS V+  KVGD VGVG  V SC  C+ C E LE  CSK 
Sbjct  61    WGSTTYPVVPGHEVAGEVTEVGSKVKNIKVGDRVGVGCMVGSCHSCQSCGEDLENYCSK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T+   +VDGT+T GGYS  +VV E +  +IP+   L +AAPLLCAGITVY+PM    
Sbjct  120   MIQTYSSKNVDGTITYGGYSDTMVVDEHFIVRIPDALSLDAAAPLLCAGITVYSPMKHFG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
              ++PG  +GV+GLGGLGH+AVKF KAFG+KVTV STS +KK+EA+  LGAD+FV+S ++ 
Sbjct  180   FDKPGLHIGVVGLGGLGHMAVKFAKAFGVKVTVVSTSPNKKKEAIERLGADSFVVSREQD  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             QM A+  +FD +I+T S   P    L LLK  G L +VG P + ++F   SL +G K I 
Sbjct  240   QMKAVMGTFDGIIDTVSALHPLMPLLGLLKNNGKLVMVGAPEKPLEFPVFSLIVGRKTIG  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS+ GG K TQE+++F A   + P+I+++P+ YVN A+ERL+K DVKYRFVIDIG ++K
Sbjct  300   GSMIGGMKETQEMIDFAAKHGVKPDIEVVPVDYVNTAMERLVKADVKYRFVIDIGNTMK  358



>ref|XP_007158344.1| hypothetical protein PHAVU_002G144700g [Phaseolus vulgaris]
 gb|ESW30338.1| hypothetical protein PHAVU_002G144700g [Phaseolus vulgaris]
Length=358

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 248/356 (70%), Gaps = 2/356 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA +       GWAARDPSG+L+P++FSRR  G  DV+  + YCG+C++D+ + +N  GT
Sbjct  1     MAETEHPRKAFGWAARDPSGLLTPFHFSRRETGEKDVAFKVLYCGICHSDLHFAKNEWGT  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YPLVPGHEI G+V EVGS V +FKVGD VGVG  V+SC  C  C + LE  C + ++ 
Sbjct  61    STYPLVPGHEIAGVVTEVGSKVVKFKVGDKVGVGCMVDSCHTCLNCVDNLENYCPQYTL-  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T+     DGT+T GG+S  +VV E +  +IP+  PL +AAPLLCAGITV++P+    +++
Sbjct  120   TYSAKYRDGTITYGGFSDSMVVDEHFVIRIPDGLPLEAAAPLLCAGITVFSPLRYFALDK  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PG ++GV+GLGGLGH+AVKF KAFG KVTV STS +KK+EA+  LGAD+F+IS D  QM 
Sbjct  180   PGLNVGVVGLGGLGHMAVKFAKAFGAKVTVISTSPNKKKEAMQHLGADSFIISRDPDQMQ  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSI  419
             A + + D +I+T S   P    + LLK+ G L  VG P + ++ S  SL LG K +AGS 
Sbjct  240   AANGTLDGIIDTVSAVHPLLPLIGLLKSHGKLVAVGAPEKPLELSIISLILGRKIVAGSK  299

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              GG K TQE+++F     + P+I+IIPI YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  300   IGGMKETQEIMDFAVLHNVKPDIEIIPIDYVNTAMERLLKADVKYRFVIDIGNTLK  355



>dbj|BAJ91956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/353 (52%), Positives = 236/353 (67%), Gaps = 2/353 (1%)
 Frame = -2

Query  1309  SSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSK  1130
             S   T   +G AA D SG LSP   +RR  G DDV + I YCG+C++D+   +N    +K
Sbjct  11    SQQHTKKAVGLAALDASGRLSPLAITRRSTGDDDVMIKILYCGICHSDLHSIKNDWKNAK  70

Query  1129  YPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTF  950
             YP++PGHEI G V EVG  V +FK GD VGVG  VNSC+ CE C++G E  C  G +FT+
Sbjct  71    YPMIPGHEIAGEVTEVGKNVTKFKAGDRVGVGCMVNSCQSCESCDKGFENHCP-GIIFTY  129

Query  949   DGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPg  770
             + +D DGTVT GGYSS +VVHER+  + P+  PL   APLLCAGITVY+PM  H +N PG
Sbjct  130   NSVDRDGTVTHGGYSSMVVVHERFVVRFPDAMPLDKGAPLLCAGITVYSPMKYHGLNVPG  189

Query  769   kslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMAL  590
               LGV+GLGGLGH+AVKFGKAFG+KVTV S+S  KK+EAL  LGAD FV+S D  +M A 
Sbjct  190   LHLGVLGLGGLGHVAVKFGKAFGMKVTVISSSPGKKQEALERLGADAFVVSKDADEMKAA  249

Query  589   SKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITG  413
               + D +INT S +IP    L LLK  G + +VG P + ++  P +L    K +AGS  G
Sbjct  250   VSTMDGIINTVSANIPMAPLLGLLKPNGKMIMVGLPEQPIEVPPFALVARNKTLAGSCIG  309

Query  412   GTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             G + TQE+L+  A   +  +I++I  +YVN A+ERL K DV+YRFVIDI  +L
Sbjct  310   GMRDTQEMLDLAAKHGVTADIEVISAEYVNTAMERLAKADVRYRFVIDIANTL  362



>ref|XP_006340040.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Solanum tuberosum]
Length=356

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 243/355 (68%), Gaps = 3/355 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M  +H      GWAARD  GVLSP+NFSRRV G  DV   + YCG+C+ D+   +N    
Sbjct  1     MEKTHENVKAFGWAARDTFGVLSPFNFSRRVTGEKDVQFKVVYCGICHTDLHQLKNEWSN  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YP+VPGHE+VG+V E+G+ V++FK+GD VGVG  V SCR+CE C+  LE  C +  + 
Sbjct  61    SIYPMVPGHEVVGVVTEIGTKVEKFKIGDKVGVGGLVESCRKCENCDNDLENYC-RDQIM  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T++G+  DGT T GGYS  +V +E Y    PEN P+  AAPLLCAGIT+Y+P+    +++
Sbjct  120   TYNGVYTDGTTTYGGYSDIMVTNEHYVVHWPENLPM-EAAPLLCAGITIYSPLKYFGLDK  178

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PG  +GV+GLGGLGH+AVKF K FG KVTV STS+SKK+EA+  LGAD+F++S D  QM 
Sbjct  179   PGMHIGVVGLGGLGHMAVKFAKVFGTKVTVISTSLSKKDEAIEHLGADSFLVSRDPDQMQ  238

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSI  419
               + S D +I+T S   P    ++LLKT G LA++G P + ++     L LG K +AGS 
Sbjct  239   GAAGSLDGIIDTVSVIHPLLPLINLLKTRGKLAMLGAPEKPLELPVFPLLLGRKLVAGSF  298

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
              GG K TQE+++F A   I P+++++P+ YVN A ERL+K +VKYRFV+DIG +L
Sbjct  299   IGGMKETQEMVDFAAKHSITPDVEVVPMDYVNTAFERLLKSNVKYRFVLDIGNTL  353



>ref|XP_004171787.1| PREDICTED: probable mannitol dehydrogenase-like [Cucumis sativus]
Length=358

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/350 (54%), Positives = 238/350 (68%), Gaps = 2/350 (1%)
 Frame = -2

Query  1297  TDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLV  1118
             T    GWAARD SG+LSP++FSRR  G DDVS+ + YCGVC++D+   +N  G++ YP+V
Sbjct  10    THKAFGWAARDSSGLLSPFHFSRRENGDDDVSIKVLYCGVCHSDLHMLKNDWGSTDYPVV  69

Query  1117  PGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGID  938
             PGHEIVG+V  VG  V++FK GD VGVG  V SCR CE C + LE  C K   +T++   
Sbjct  70    PGHEIVGVVTSVGKNVKKFKAGDEVGVGVIVGSCRSCENCKQDLESYCPKME-YTYNSPG  128

Query  937   VDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslg  758
             VDGT   GGYS  IVV + +  + P+N  L + APLLCAGITVY+PM    M +PGK LG
Sbjct  129   VDGTKNYGGYSDKIVVDQHFVVRFPKNLALDAGAPLLCAGITVYSPMKHFGMTEPGKHLG  188

Query  757   viglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSF  578
             V GLGGLGH+AVKFGKAFGLKVTV STS  KKEEA++ LGAD FV+SSD +Q+ A   + 
Sbjct  189   VAGLGGLGHVAVKFGKAFGLKVTVISTSSRKKEEAIDRLGADAFVVSSDPEQLKAAMGTM  248

Query  577   DFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKL  401
             D++++T S   P D  + LL   G L  VG P++ V+ S G L  G + +AGS  GG K 
Sbjct  249   DYILDTISAVHPLDPLIRLLNLNGKLVAVGLPNKPVELSIGILASGRRVVAGSNFGGLKE  308

Query  400   TQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TQE+L+FC    I  EI++I +  +N A+ERL K DVKYRFVIDI  S K
Sbjct  309   TQEMLDFCGKHNITAEIELIKMNDINSAMERLAKADVKYRFVIDIENSFK  358



>ref|XP_007158345.1| hypothetical protein PHAVU_002G144800g [Phaseolus vulgaris]
 gb|ESW30339.1| hypothetical protein PHAVU_002G144800g [Phaseolus vulgaris]
Length=362

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/348 (53%), Positives = 243/348 (70%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARDPSG+LSP+NFSRR     DV+  + YCG+C++D+   +N  G S YPLVPG
Sbjct  13    KAFGWAARDPSGLLSPFNFSRRETAEKDVAFKVLYCGICHSDLHMAKNEWGFSTYPLVPG  72

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HE+VG+V +VGS V++FKVGD VGVG  V+SCR C+ C+E LE  C + ++ T+     D
Sbjct  73    HEVVGVVTQVGSKVEKFKVGDKVGVGCLVDSCRTCQSCSEDLENYCPQYTL-TYGAKYKD  131

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+T GGYS  +VV E +  +IP+  PL +AAPLLCAGITVY+P+    +++PG  +GV+
Sbjct  132   GTITYGGYSDSMVVDEHFVVRIPDGLPLDAAAPLLCAGITVYSPLRYFALDKPGLHVGVV  191

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KAFG KVTV STS  KKEEA+  LGAD+F+IS D  +M   + + D 
Sbjct  192   GLGGLGHMAVKFAKAFGAKVTVISTSPHKKEEAIQHLGADSFLISRDHDEMQGANGTLDG  251

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    + LLK+ G L +VG P + ++     L  G K +AGS  GG K TQ
Sbjct  252   IIDTVSAFHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLSGRKIVAGSGIGGMKETQ  311

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A   + P+I+IIPI YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  312   EMMDFAAKHNVKPDIEIIPIDYVNTAMERLLKADVKYRFVIDIGNTLK  359



>ref|XP_004151454.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9-like [Cucumis 
sativus]
 gb|KGN62126.1| hypothetical protein Csa_2G300950 [Cucumis sativus]
Length=358

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/350 (54%), Positives = 238/350 (68%), Gaps = 2/350 (1%)
 Frame = -2

Query  1297  TDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLV  1118
             T    GWAARD SG+LSP++FSRR  G DDVS+ + YCGVC++D+   +N  G++ YP+V
Sbjct  10    THKTFGWAARDSSGLLSPFHFSRRENGDDDVSIKVLYCGVCHSDLHMLKNDWGSTDYPVV  69

Query  1117  PGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGID  938
             PGHEIVG+V  VG  V++FK GD VGVG  V SCR CE C + LE  C K   +T++   
Sbjct  70    PGHEIVGVVTSVGKNVKKFKAGDEVGVGVIVGSCRSCENCKQDLESYCPKME-YTYNSPG  128

Query  937   VDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslg  758
             VDGT   GGYS  IVV + +  + P+N  L + APLLCAGITVY+PM    M +PGK LG
Sbjct  129   VDGTKNYGGYSDKIVVDQHFVVRFPKNLALDAGAPLLCAGITVYSPMKHFGMTEPGKHLG  188

Query  757   viglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSF  578
             V GLGGLGH+AVKFGKAFGLKVTV STS  KKEEA++ LGAD FV+SSD +Q+ A   + 
Sbjct  189   VAGLGGLGHVAVKFGKAFGLKVTVISTSSRKKEEAIDRLGADAFVVSSDPEQLKAAMGTM  248

Query  577   DFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKL  401
             D++++T S   P D  + LL   G L  VG P++ V+ S G L  G + +AGS  GG K 
Sbjct  249   DYILDTISAVHPLDPLIRLLNLNGKLVAVGLPNKPVELSIGILASGRRVVAGSNFGGLKE  308

Query  400   TQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             TQE+L+FC    I  EI++I +  +N A+ERL K DVKYRFVIDI  S K
Sbjct  309   TQEMLDFCGKHNITAEIELIKMNDINSAMERLAKADVKYRFVIDIENSFK  358



>ref|XP_009801633.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Nicotiana sylvestris]
Length=359

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 240/346 (69%), Gaps = 3/346 (1%)
 Frame = -2

Query  1288  CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGH  1109
               GWAARD SG+LSP+NFSRR  G  DV   + YCG+C++D+   +N    S YP+VPGH
Sbjct  13    AFGWAARDTSGILSPFNFSRRATGKKDVQFKVMYCGICHSDLHQLKNEWSNSIYPMVPGH  72

Query  1108  EIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDG  929
             EIVG+V EVGS V++FKVGD VGVG +V SCR+CE C+  LE  C  G + T +G   DG
Sbjct  73    EIVGVVTEVGSKVEKFKVGDKVGVGYFVESCRKCENCSNNLENYCP-GQIMTTNGTYSDG  131

Query  928   TVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvig  749
             T+T GGYS  ++  E Y    P+N P+  AAPLLCAGIT Y+P+    +++PG  +GV+G
Sbjct  132   TITYGGYSDIMISDEHYVVHWPDNLPM-KAAPLLCAGITTYSPLKYFGLDKPGMHIGVVG  190

Query  748   lgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFL  569
             LGGLGH+AVKF KAFG KVTV STS SKK+EA+  LGAD+F++S D  QM A + S D +
Sbjct  191   LGGLGHMAVKFAKAFGTKVTVISTSTSKKQEAIERLGADSFLVSRDPDQMQAATGSLDGI  250

Query  568   INTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQE  392
             I+T S   P    ++LLKT G L +VG P + ++     L LG K +AGS  GG K TQE
Sbjct  251   IDTVSAIHPLLPLINLLKTHGKLVMVGAPEKPLELPVFPLLLGRKLVAGSAIGGIKETQE  310

Query  391   LLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             +++F A   I P+++++P+ YVN AL+RL+K DVKYRFV+D+G +L
Sbjct  311   MVDFAAKHNITPDVEVVPMDYVNRALDRLLKSDVKYRFVLDVGNTL  356



>ref|XP_003612989.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95947.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=361

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 245/355 (69%), Gaps = 12/355 (3%)
 Frame = -2

Query  1297  TDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLV  1118
             +    GWAARD SGVLSP+NFSRR +   DV+L + YCG+C++D+   +N  GT+ YPLV
Sbjct  10    SKKAFGWAARDSSGVLSPFNFSRREICEKDVALRVLYCGICHSDLHKAKNEWGTTNYPLV  69

Query  1117  PGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSK-----GSVFT  953
             PGHEIVGIV EVGS V++FKVGD VGVG  V+SC  C+ C + LE  C +     GS ++
Sbjct  70    PGHEIVGIVTEVGSKVKKFKVGDRVGVGCLVDSCHSCQNCVDNLENYCPQLTLTDGSKYS  129

Query  952   FDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQP  773
                   DGT T GG+S  +V  E + ++IP+  PL +AAPLLCAGITVY+P+    +++P
Sbjct  130   ------DGTSTHGGFSDSMVSDEHFVFRIPDQLPLDAAAPLLCAGITVYSPLRHFGLDKP  183

Query  772   gkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMA  593
               ++GV+GLGGLGH+AVKF KAFG  VTV STS  K++EAL  L AD+F+IS D KQM A
Sbjct  184   DMNIGVVGLGGLGHMAVKFAKAFGANVTVISTSPKKEKEALEHLRADSFLISRDPKQMKA  243

Query  592   LSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSIT  416
              + + D +I+T S D P    + LLK+ G L +VG P + ++     L  G K +AGS+ 
Sbjct  244   ATATLDGIIDTVSADHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLAGRKIVAGSLI  303

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GG K TQE+++F A   + P+I+IIPI YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  304   GGIKETQEMIDFAAEHNVKPDIEIIPIDYVNTAMERLLKADVKYRFVIDIGNTLK  358



>gb|EMT31529.1| Putative cinnamyl alcohol dehydrogenase 5 [Aegilops tauschii]
Length=365

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 183/361 (51%), Positives = 239/361 (66%), Gaps = 2/361 (1%)
 Frame = -2

Query  1312  ASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTS  1133
             A+   T   +  AARD SG LSP   +RR  G DDV + I YCG+C++D+   +N    +
Sbjct  5     AAEQHTRKAVALAARDASGHLSPLAITRRSTGDDDVVIKILYCGICHSDLHSIKNEWKNA  64

Query  1132  KYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFT  953
             +YP++PGHEI G V EVG  V +F+ GD VGVG  VNSC+ CE CNEG E  C  G + T
Sbjct  65    RYPMIPGHEIAGEVTEVGKNVTKFEAGDRVGVGVMVNSCQSCESCNEGFENHCP-GIIPT  123

Query  952   FDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQP  773
             ++ +D+DGT+T GGYS  +VVHER+  + P+  PL   APLLCAGITVY+PM  H +N P
Sbjct  124   YNTVDLDGTITYGGYSGMVVVHERFVVRFPDTIPLDKGAPLLCAGITVYSPMKYHGLNVP  183

Query  772   gkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMA  593
             G  LGV+GLGGLGH+AVKFGKAFG+KVTV S+S  KK+EAL  LGAD FVIS D  +M A
Sbjct  184   GMHLGVLGLGGLGHVAVKFGKAFGMKVTVISSSPGKKQEALERLGADAFVISKDADEMKA  243

Query  592   LSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSIT  416
                + D +INT S +IP    L LLK  G + +VG P + ++  P +L    K +AGS  
Sbjct  244   AMSTMDGIINTVSANIPMAPLLGLLKPNGKMIMVGLPEKSMEIPPFALVAMNKTLAGSCI  303

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK*GGCS  236
             GG + TQE+L+  A   +  +I++I  +YVN A+ERL K DV+YRFVIDIG +L     +
Sbjct  304   GGMRDTQEMLDLAAKHDVTADIEVIGAEYVNTAMERLAKADVRYRFVIDIGNTLDKAAAA  363

Query  235   S  233
             S
Sbjct  364   S  364



>gb|AFY63473.1| geraniol dehydrogenase [Perilla citriodora]
Length=360

 Score =   340 bits (872),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 245/358 (68%), Gaps = 5/358 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MA +  T++     GWAARD SG LSP+NFSRR  G  DV   + YCGVC++ +   +N 
Sbjct  1     MAKTPETEHPVKAFGWAARDNSGTLSPFNFSRRDTGERDVQFKVLYCGVCHSGLHMVKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G + YP+VPGHEIVG+V EVGS V++ K GD VGVG  V SCR+C+ C+  LE  CSK 
Sbjct  61    WGVTHYPVVPGHEIVGVVTEVGSKVEKVKAGDKVGVGVIVGSCRQCDQCSNDLENYCSK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T+    +DGT+T+GGYS+ +V  E +  + PEN PL + APLLCAGIT Y+P+  + 
Sbjct  120   QILTYGAPYIDGTITRGGYSNIMVADEHFIIRWPENLPLDAGAPLLCAGITTYSPLRYYG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG S+GV GLGGLGH+AVKF KAFG KVTV STS+ KK+EA+  LG D F++SSD +
Sbjct  180   LDKPGLSVGVNGLGGLGHVAVKFAKAFGTKVTVISTSLGKKKEAIEHLGVDEFLVSSDPQ  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             QM A   + D +I+T S + P    +SLLK  G L +VG P + ++    SL  G K +A
Sbjct  240   QMQAAVGTLDGIIDTVSAEHPLVPLMSLLKPHGKLIVVGAPEKPLQLHAFSLIQGRKTVA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GS  GG K TQE+++F A + I P++++IPI Y+N A++RL+K DVKYRFVID+  S 
Sbjct  300   GSAIGGMKETQEMIDFAAKKNIIPDVEVIPIDYINTAMDRLLKSDVKYRFVIDVNKSF  357



>ref|NP_001240222.1| uncharacterized protein LOC100809071 [Glycine max]
 gb|ACU21285.1| unknown [Glycine max]
 gb|KHN04904.1| Putative mannitol dehydrogenase [Glycine soja]
Length=362

 Score =   340 bits (872),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 186/360 (52%), Positives = 245/360 (68%), Gaps = 6/360 (2%)
 Frame = -2

Query  1315  MASSH----STDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRN  1148
             MASS           GWAARD SG+LSP+NFSRR  G  D+   + YCG+C++D+   +N
Sbjct  1     MASSQPEMEHPKKVFGWAARDSSGLLSPFNFSRRETGEKDLVFKVQYCGICHSDLHMLKN  60

Query  1147  IHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSK  968
               G + YPLVPGHEI G+V EVGS VQ+FKVGD VGVG  + SCR CE C+E LE  C K
Sbjct  61    EWGNTTYPLVPGHEIAGVVTEVGSKVQKFKVGDRVGVGCMIGSCRSCESCDENLENYCPK  120

Query  967   GSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRH  788
               + T+     DGT+T GGYS  +V  E +  +IP+N PL +AAPLLCAGITVY+P+  +
Sbjct  121   -MILTYGVKYFDGTITHGGYSDLMVADEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRYY  179

Query  787   NMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDE  608
              +++PG +LGV+GLGGLGH+AVKF KA G  VTV STS +KK+EA+  +GAD+FV+S ++
Sbjct  180   GLDKPGLNLGVVGLGGLGHMAVKFAKALGANVTVISTSPNKKKEAIENIGADSFVVSREQ  239

Query  607   KQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCI  431
              QM A+  + D +I+T S   P    + LLK  G L +VG P + ++    SL +G K +
Sbjct  240   DQMQAVMGTMDGIIDTVSAVHPLVPLIGLLKPHGKLVMVGAPEKPLELPVFSLLMGRKMV  299

Query  430   AGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              GS  GG K TQE+++F A   + P+I++IPI YVN A+ERL K DVKYRFVIDIG +LK
Sbjct  300   GGSSIGGMKETQEMIDFAAKHGVKPDIEVIPIDYVNTAIERLAKADVKYRFVIDIGNTLK  359



>gb|KHG29850.1| putative mannitol dehydrogenase [Gossypium arboreum]
Length=361

 Score =   340 bits (872),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 241/359 (67%), Gaps = 2/359 (1%)
 Frame = -2

Query  1324  FTSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
              T +      +   GWAARD  GVLSP+ FSRR  G  DV+  + YCG+C++D+   +N 
Sbjct  1     MTRLPEEEHPNKAFGWAARDSYGVLSPFKFSRRATGEKDVAFKVLYCGICHSDLHMAKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              GTS YPLVPGHEI G V EVGS VQ+FKVGD VGVG  V SCR C+ C + LE  C K 
Sbjct  61    WGTSIYPLVPGHEIAGEVTEVGSEVQKFKVGDRVGVGCLVGSCRSCDSCKDNLENYCPK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              V T+     DGT+T GGYS  +V  E +  +IP+N PL +AAPLLCAGITVY+P+  + 
Sbjct  120   MVLTYGAKYYDGTITYGGYSDTMVADEHFIVRIPDNMPLDAAAPLLCAGITVYSPLRYYE  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++P   +GV+GLGGLGH+AVKF KA G+KVTV STS +KK+EAL  LGAD+F++S D+ 
Sbjct  180   LDRPSLHIGVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKKEALENLGADSFLVSRDQD  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             Q+     + D +I+T S   P    L+LLK+ G L L+G P + ++     L  G K I 
Sbjct  240   QLQGAIGTLDGIIDTVSAQHPVLPLLALLKSHGKLVLLGAPEKPLELPVFPLIQGRKVIG  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS+ GG K TQE+++F A   + P+I++I + YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  300   GSLIGGMKETQEMIDFAAKHDVKPDIEVIAMDYVNTAMERLLKADVKYRFVIDIGNTLK  358



>emb|CDP01608.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 244/356 (69%), Gaps = 2/356 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             MA +      +GWAARDPSGVLSP+ FSRR  G  D+   + YCG+C++D+ + +N  G 
Sbjct  1     MAKTEHPVKAVGWAARDPSGVLSPFKFSRRATGEHDIQFKVLYCGICHSDLHFCKNEWGF  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S+YP+VPGHEIVG+  EVGS V++ KVGD VGVG  V SCR C+ C++ LE  C K  + 
Sbjct  61    SQYPMVPGHEIVGVATEVGSKVEKVKVGDKVGVGCLVGSCRGCDMCSQDLENYCPK-QIL  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T+  ID DGT+T+GGYS+ +V  E +  + PEN P+   APLLCAGIT Y+P+    +++
Sbjct  120   TYSAIDTDGTLTQGGYSNIMVADEHFVVRWPENLPMDIGAPLLCAGITTYSPLRYFGLDK  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PG  +G++GLGGLGH+ VKF KAFG KVTV STS  K++EA+  LGAD F+ S D +Q+ 
Sbjct  180   PGVHVGIVGLGGLGHVGVKFAKAFGAKVTVISTSEGKRQEAIGKLGADGFLNSRDPEQLQ  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSI  419
             A + + D +I+T S   P    ++LLK  G + +VG P + ++F    L  G K ++GS 
Sbjct  240   AAAATMDGIIDTVSAVHPIVPLINLLKPHGKIVMVGVPEKPLEFGTFPLIAGRKTMSGSA  299

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              GG K TQE+++F A   + P+++I+P+ YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  300   IGGLKETQEMIDFAAKHNVLPDVEIVPVDYVNTAMERLLKADVKYRFVIDIGNTLK  355



>ref|XP_009773447.1| PREDICTED: probable mannitol dehydrogenase [Nicotiana sylvestris]
Length=364

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 237/345 (69%), Gaps = 2/345 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAARD SG+LSP++FSRR  G DDV++ I YCGVC++D+   +N  G +KYP+VPGHE
Sbjct  14    FGWAARDTSGILSPFDFSRRQNGDDDVTVRILYCGVCHSDLHCLKNEWGFTKYPIVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG+V  VG+ V RFKVGD VGVG  V SC  C+ C + LE  C K  +FT++    DGT
Sbjct  74    IVGLVTAVGTSVHRFKVGDRVGVGVIVGSCHTCDICEQSLENYCPK-VMFTYNSTYHDGT  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
              T GGYS  IVVH+R+  + PEN P  + APLLCAGITVY+PM  + M +PGK LGV GL
Sbjct  133   RTYGGYSDMIVVHQRFVLQFPENLPSDAGAPLLCAGITVYSPMKYYGMTEPGKHLGVAGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVK GKAFGLKVTV STS  K++EA+  LGAD FV+SSD  +M A   + D++I
Sbjct  193   GGLGHVAVKIGKAFGLKVTVISTSPKKEDEAIKKLGADAFVLSSDPTKMKAFVNTMDYII  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             +T     P    LSLLK  G L  VG P + ++     L LG K + GS  GG K TQE+
Sbjct  253   DTIGAVHPLAPLLSLLKVDGKLVTVGLPEKPLELPIFPLVLGRKLVGGSDIGGMKETQEM  312

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             L+FCA   I  +I++I ++ +N A+ERL K DVKYRFVIDI  S+
Sbjct  313   LDFCAKHNITADIELIRVEQINTAMERLAKSDVKYRFVIDIANSI  357



>ref|XP_003612975.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95933.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=361

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 186/351 (53%), Positives = 241/351 (69%), Gaps = 6/351 (2%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             +   GWAARD SGVLSP+NFSRR  G  DV+  I YCG+C++DV   +N  G S YPLVP
Sbjct  11    NKAFGWAARDTSGVLSPFNFSRRETGEKDVAFKILYCGICHSDVCMAKNEWGISTYPLVP  70

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEIVGIV +VGS V++F VGD VGVG  ++SCR C+ C + LE  C   +  T  G+  
Sbjct  71    GHEIVGIVTKVGSKVEKFNVGDKVGVGYIIDSCRSCQNCVDNLENYCPAYTT-TVGGMHR  129

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGT+T GGYS  +VV E +   IP+  PL +AAPLLCAGITVY+P+    +++PG  +GV
Sbjct  130   DGTITHGGYSDSLVVAENFVVHIPDGLPLEAAAPLLCAGITVYSPLRYFGLDKPGLHVGV  189

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             +GLGGLGH+AVKF KAFG  VTV STS SK++EA   LGAD+F+IS D+ +M +   + D
Sbjct  190   VGLGGLGHMAVKFAKAFGANVTVISTSASKEKEAKEHLGADSFLISRDQDKMQSALGTLD  249

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPS---EVKFSPGSLNLGMKCIAGSITGGTK  404
              +I+T S + P    L LLK+ G L +VG P    E+   P  L LG K +AGS  G  K
Sbjct  250   GIIDTVSANHPVLPLLGLLKSHGKLVMVGVPDKPLEIPVFP--LILGRKLVAGSGIGSIK  307

Query  403   LTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              TQE+LEF A   + P+I+++P+ YVN A+ERL+K DVKYRFV+DIG +LK
Sbjct  308   ETQEMLEFAAKHNVKPDIEVVPVDYVNTAIERLLKADVKYRFVLDIGNTLK  358



>ref|XP_011097456.1| PREDICTED: 8-hydroxygeraniol dehydrogenase [Sesamum indicum]
Length=360

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 188/359 (52%), Positives = 242/359 (67%), Gaps = 5/359 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MA S  T++     GWAARD SG  SP+ FSRR  G  DV   + YCGVC++D+   +N 
Sbjct  1     MAKSPETEHPVKAFGWAARDTSGSFSPFKFSRRATGEHDVQFKVMYCGVCHSDLHMVKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G ++YP+VPGHEIVGIV EVGS V++FKVGD VGVG  V SCREC+ C   LE  C K 
Sbjct  61    WGFTQYPIVPGHEIVGIVTEVGSKVEKFKVGDKVGVGCLVGSCRECDQCASDLENYCPK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T+     DGT+T GGYS+ +V  E +  + PEN PL   APLLCAGIT Y+P+    
Sbjct  120   QILTYSAPYTDGTITYGGYSNLMVADEHFVVRWPENLPLDIGAPLLCAGITTYSPLRHFG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG ++GV+GLGGLGH+AVKF KAFG  VTV STS+SKK+EA+  LGAD F++S + +
Sbjct  180   LDKPGLNVGVVGLGGLGHVAVKFAKAFGTTVTVISTSLSKKKEAIENLGADKFLVSRNPE  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             +M A + + D +I+T S        LSLLK  G L  VG P + ++    SL +G K IA
Sbjct  240   EMQAAAGTLDGIIDTVSATHAVAPLLSLLKPHGKLICVGAPEKPLELPVFSLIMGRKLIA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS  GG K TQE+++F A   I P+++IIPI YVN A+ERL+K DVKYRFVIDI  SLK
Sbjct  300   GSAIGGLKETQEMIDFAAKHNILPDVEIIPIDYVNTAMERLLKSDVKYRFVIDIENSLK  358



>gb|EYU30917.1| hypothetical protein MIMGU_mgv1a008848mg [Erythranthe guttata]
Length=360

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 245/359 (68%), Gaps = 5/359 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MA +H T++     GWAARD SGVLSP+NFSRR  G  DV   + YCGVC++D+   +N 
Sbjct  1     MAKNHETEHPVGAFGWAARDTSGVLSPFNFSRRATGEYDVQFKVLYCGVCHSDLHMAKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G + YP+VPGHEIVG+V EVGS V + K GD VGVG  V SCREC+ C   LE  C+K 
Sbjct  61    WGVTLYPVVPGHEIVGVVTEVGSKVNKVKPGDNVGVGVLVGSCRECDQCTNDLENYCAK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T+     DG++T GGYS  +V HE +  + PEN+PL   APLLCAGIT Y+P+    
Sbjct  120   QILTYGAQYTDGSITYGGYSDIMVAHEHFIIRWPENFPLDIGAPLLCAGITTYSPLKYFG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG S+GV+GLGGLGH+AVKF KAFG KVTV STSI KK+EA+ LLGAD F++S D +
Sbjct  180   LDKPGMSVGVVGLGGLGHVAVKFAKAFGTKVTVISTSIGKKKEAIELLGADEFLVSRDPE  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIA  428
             QM A   + D +I+T S   P    L+LLK  G L +VG P ++   P  S+  G K IA
Sbjct  240   QMQAAIGTLDGIIDTVSATHPLPPLLALLKPHGKLIVVGAPEKLLELPAFSMIAGRKTIA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS  GG K TQE+++F A   I PE+++IPI YVN A+ERL+K DVKYRFVID+  S+K
Sbjct  300   GSGIGGLKETQEMIDFAAKNNILPEVEVIPIDYVNTAMERLLKSDVKYRFVIDVAKSMK  358



>ref|XP_004512559.1| PREDICTED: probable mannitol dehydrogenase-like [Cicer arietinum]
Length=362

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 250/359 (70%), Gaps = 4/359 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MA+ H  ++     GWAARD SGVLSP+NFSRR     DV++ + YCG+C++D+   +N 
Sbjct  1     MATQHELEHPNKAFGWAARDTSGVLSPFNFSRRETSEKDVAIKVLYCGICHSDLHMAKND  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G S YPLVPGHEIVGIV +VGS V++FK+G+ VGVG  V+SCR C+ C++ LE  C K 
Sbjct  61    WGISTYPLVPGHEIVGIVTKVGSKVEKFKIGEKVGVGFMVDSCRSCQNCSDNLENYCPKP  120

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
                T  G   DG++T GGYS  IVV E +   I +  PL SAAPLLCAGITVY+P+    
Sbjct  121   YTPTSGGKHSDGSITYGGYSDSIVVDEHFIVHISDGLPLESAAPLLCAGITVYSPLKYFG  180

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG  +G++GLGGLGHLAVKF KAFG  VTV STS +K++EAL  LGAD+F++S D+ 
Sbjct  181   LDKPGLHIGIVGLGGLGHLAVKFAKAFGAYVTVISTSPNKEKEALEHLGADSFLVSRDQD  240

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             +M A   + D +++T SGD      L LLK+ G L ++G P++ ++ S   L LG K +A
Sbjct  241   KMQAAMNTLDGILDTVSGDHSLLPLLGLLKSHGKLVMLGVPTKPLEISAFPLILGRKLVA  300

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS  GG K TQE+++F A   + P+++IIP+ YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  301   GSAIGGLKETQEMIDFAAKHNVKPDVEIIPMDYVNTAMERLLKADVKYRFVIDIGNTLK  359



>ref|XP_003517258.1| PREDICTED: probable mannitol dehydrogenase [Glycine max]
Length=359

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 182/359 (51%), Positives = 245/359 (68%), Gaps = 2/359 (1%)
 Frame = -2

Query  1324  FTSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
               + A         GWAARD SG+LSP+NF RR  G  DV+  + YCG+C++D+   +N 
Sbjct  1     MAAQAEIEHPRKAFGWAARDSSGLLSPFNFCRREPGEKDVAFRVLYCGICHSDLHSIKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              GTS YP+VPGHE+ G+V EVGS V++FKVGD VGVG  V+SCR C+ C + LE  C + 
Sbjct  61    WGTSIYPMVPGHEVAGVVTEVGSKVEKFKVGDKVGVGCLVDSCRTCQNCCDNLENYCPQ-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
             S FT+     DGT+T GGYS  +V  E +  +IP+  PL +AAPLLCAGITVY+P+  + 
Sbjct  120   STFTYGAKYRDGTITYGGYSDSMVADEHFVVRIPDRLPLDAAAPLLCAGITVYSPLRYYG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG  +GV+GLGGLGH+AVKF KAFG KVTV STS +KKEEA+  LGAD+F+IS D+ 
Sbjct  180   LDKPGLHVGVVGLGGLGHMAVKFAKAFGAKVTVISTSPNKKEEAIQNLGADSFLISRDQD  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             QM A   + D +I+T S   P    + LLK+ G L +VG P + ++     L  G K +A
Sbjct  240   QMQAAMGTLDGIIDTVSAVHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLAGRKIVA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             G++ GG   TQE+++F A   + P+I++IP+ YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  300   GTLIGGLMETQEMIDFAAKHNVKPDIEVIPMDYVNTAMERLLKADVKYRFVIDIGNTLK  358



>ref|XP_004512561.1| PREDICTED: probable mannitol dehydrogenase-like [Cicer arietinum]
Length=362

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 241/348 (69%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARD SG LSP+NFSRR  G  DV+  + YCG+C++DV   +N  G S YPLVPG
Sbjct  13    KAFGWAARDSSGFLSPFNFSRRETGEKDVAFKVLYCGICHSDVHMAKNEWGNSVYPLVPG  72

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HE+VG+V EVGS V++FKVGD VGVG  ++SC  C+ C+E LE  C K +V T      D
Sbjct  73    HELVGVVTEVGSKVEKFKVGDKVGVGYIIDSCGSCQNCSENLENYCPKHTV-TCGSKYRD  131

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             G++T GGYS  +V  + +  +IP N PL +AAPLLCAGITVY+P+    +++PG  +GV+
Sbjct  132   GSITYGGYSDSMVADQHFVIRIPHNLPLEAAAPLLCAGITVYSPLRHFGLDKPGLHIGVV  191

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KAFG  VTV STS  K++EA+  LGAD+F+IS D  QM A   + D 
Sbjct  192   GLGGLGHMAVKFAKAFGAYVTVISTSPDKEKEAIQHLGADSFLISRDPNQMQAAVDTLDG  251

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    +SLLK+ G L +VG  ++ ++    SL  G K +AGS+ GG K TQ
Sbjct  252   IIDTVSASHPLLPLISLLKSQGKLVMVGAVAKPLELPIFSLLTGRKIVAGSLIGGIKETQ  311

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A   + PEI+++PI YVN A++RL+K DVKYRFVIDIG SLK
Sbjct  312   EMIDFAAEHNVMPEIEVVPIDYVNTAMDRLVKADVKYRFVIDIGNSLK  359



>ref|XP_011100934.1| PREDICTED: probable mannitol dehydrogenase [Sesamum indicum]
Length=355

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 239/349 (68%), Gaps = 2/349 (1%)
 Frame = -2

Query  1297  TDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLV  1118
             +    GWAA D SGVLSP++FSRR  G+DDV++ I YCG+C++D+   +N  G +KYP+V
Sbjct  5     SQKAFGWAATDTSGVLSPFHFSRRENGADDVTIKILYCGICHSDLHTAKNEWGFTKYPVV  64

Query  1117  PGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGID  938
             PGHEIVG+V + GS V+ FKVGD VGVG  V SCR C+ C + LE  C K  +FT++  D
Sbjct  65    PGHEIVGLVTKTGSNVESFKVGDRVGVGVLVGSCRTCDICQQDLENYCRK-MIFTYNSTD  123

Query  937   VDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslg  758
              DGT T GGYS  IVV + +  + P+N P  + APLLCAGITVY+PM  + M +PGK LG
Sbjct  124   KDGTRTYGGYSDIIVVDQHFVLRFPDNLPSDAGAPLLCAGITVYSPMKYYGMTEPGKHLG  183

Query  757   viglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSF  578
             V GLGGLGH+AVKFGKAFGLKVTV STS  K+ EA+N LGAD F++SSD  Q+ A   + 
Sbjct  184   VAGLGGLGHVAVKFGKAFGLKVTVISTSPKKEAEAINKLGADAFLVSSDPVQLKAAMGTM  243

Query  577   DFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKL  401
             DF+I+T +   P    L LLK  G L  VG P + ++     L LG K + GS  GG K 
Sbjct  244   DFIIDTIAAVHPLAPLLDLLKMNGKLVTVGLPDKPLELPIFPLVLGRKLVGGSDIGGMKE  303

Query  400   TQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             TQE+L+FC    I  +I++I + Y+N ALER+ K DV+YRFVID+G SL
Sbjct  304   TQEMLDFCGKHGITADIELIRMDYINTALERVSKSDVRYRFVIDVGNSL  352



>ref|XP_002276703.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI40784.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 182/363 (50%), Positives = 247/363 (68%), Gaps = 5/363 (1%)
 Frame = -2

Query  1330  FEFTSMASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVI  1160
             F  +   +SH  ++     GWAARD SG LSP+NFSRR  G +DV L + YCG+C+ D+ 
Sbjct  10    FSGSKAVTSHEEEHPVKAFGWAARDNSGHLSPFNFSRRSTGEEDVRLKVLYCGICHTDLH  69

Query  1159  WTRNIHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEV  980
              ++N  G++ YPLVPGHE+VG V EVGS V++FKVGD VGVG+ V +C  C+ C+  LE 
Sbjct  70    NSKNEWGSASYPLVPGHEVVGTVTEVGSKVKKFKVGDKVGVGSLVGACHSCDDCSHDLEN  129

Query  979   QCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTP  800
              C K  + T+  +  DGT+T GGYS  +V +ERY  +IP+N PL   APLLCAGITVY+P
Sbjct  130   YCPK-LILTYGSLYHDGTMTYGGYSDTMVANERYVIRIPDNMPLDKGAPLLCAGITVYSP  188

Query  799   MMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVI  620
             +  + +N+PG  +G++GLGGLGH+AVKF KAFG KVTV STS +KK+EA+  LGAD F++
Sbjct  189   LKYYGLNEPGMHIGIVGLGGLGHIAVKFAKAFGCKVTVISTSPAKKKEAIEHLGADMFLV  248

Query  619   SSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLG  443
             S DE+QM     + D +I+T S   P    + LLK+ G L ++G P +    P   L LG
Sbjct  249   SRDEQQMQGAMGTMDGIIDTVSAIHPLLPLIDLLKSQGKLVMLGAPDQPLELPAFPLILG  308

Query  442   MKCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIG  263
              K + GS+TGG K TQE+++F A   I  +I++I + Y+N A+ERL K DV+YRFVIDIG
Sbjct  309   RKSVGGSLTGGLKETQEMIDFAAKHDIKSDIEVISMDYINTAMERLAKGDVRYRFVIDIG  368

Query  262   GSL  254
              +L
Sbjct  369   NTL  371



>gb|KHN04905.1| Putative mannitol dehydrogenase [Glycine soja]
Length=359

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 246/359 (69%), Gaps = 2/359 (1%)
 Frame = -2

Query  1324  FTSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
               + A         GWAARD SG+LSP+NF RR  G  DV+  + YCG+C++D+   +N 
Sbjct  1     MAAQAEIEHPRKAFGWAARDSSGLLSPFNFCRREPGEKDVAFRVLYCGICHSDLHSIKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              GTS YP+VPGHE+ G+V EVGS V++FKVGD VGVG  V+SCR C+ C + LE  C + 
Sbjct  61    WGTSIYPMVPGHEVAGVVTEVGSKVEKFKVGDKVGVGCLVDSCRTCQNCCDNLENYCPQ-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
             S FT+     DGT+T GGYS  +V  E +  +IP+  PL +AAPLLCAGITVY+P+  + 
Sbjct  120   STFTYGAKYRDGTITYGGYSDSMVAEEHFVVRIPDRLPLDAAAPLLCAGITVYSPLRYYG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG  +GV+GLGGLGH+AVKF KAFG KVTV STS +KKEEA+  LGAD+F+IS D+ 
Sbjct  180   LDKPGLHVGVVGLGGLGHMAVKFAKAFGAKVTVISTSPNKKEEAIQNLGADSFLISRDQD  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             Q+ A   +FD +I+T S   P    + LLK+ G + +VG P + ++     L  G K +A
Sbjct  240   QVQAAMGTFDGIIDTVSAVHPLLPLIGLLKSHGKIVMVGAPEKPLELPVFPLLAGRKIVA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             G++ GG   TQE+++F A   + P+I++IP+ YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  300   GTLIGGLMETQEMIDFAAKHNVKPDIEVIPMDYVNTAMERLLKADVKYRFVIDIGNTLK  358



>emb|CBL95258.1| cinnamyl alcohol dehydrogenase [Pinus pinaster]
Length=357

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 247/354 (70%), Gaps = 2/354 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  S     G+AARD SG LSPY ++ R  G +DV + + YCG+C++D++  RN  G 
Sbjct  1     MGSLESEKTVTGYAARDSSGHLSPYTYNLRKKGPEDVIVKVIYCGICHSDLVQMRNEMGM  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YP+VPGHE+VGIV E+GS V++FKVG+ VGVG  V SCR C  CN+ +E  CSK  ++
Sbjct  61    SHYPMVPGHEVVGIVTEIGSEVKKFKVGEHVGVGCIVGSCRSCGNCNQSMEQYCSK-RIW  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T++ ++ DGT T+GG++S +VV + +  +IPEN PL  AAPLLCAG+TV++PM    M +
Sbjct  120   TYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVFSPMKHFGMTE  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGK  G++GLGG+GH+ VK  KAFGL VTV S+S  KKEEA+ +LGAD +++S D ++MM
Sbjct  180   PGKKCGILGLGGVGHMGVKIAKAFGLHVTVISSSDKKKEEAMEVLGADAYLVSKDTEKMM  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVG-FPSEVKFSPGSLNLGMKCIAGSI  419
               ++S D++++T     P + YL+LLKT G L ++G  P  + F    L LG + IAGS 
Sbjct  240   EAAESLDYIMDTIPVAHPLEPYLALLKTNGKLVMLGVVPEPLHFVTPLLILGRRSIAGSF  299

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGS  257
              G  + TQE LEFCA +K+   I+++ + Y+N A+ERL+K DV+YRFV+D+ GS
Sbjct  300   IGSMEETQETLEFCAEKKVSSMIEVVGLDYINTAMERLVKNDVRYRFVVDVAGS  353



>emb|CDP01603.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   338 bits (866),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 241/348 (69%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
               +GWAARDPSGVLSP+ FSRR  G  D+   + YCG+C+AD+ + +N  G S+YP+VPG
Sbjct  4     KAVGWAARDPSGVLSPFKFSRRATGEHDIEFKVLYCGICHADLHFCKNEWGFSQYPMVPG  63

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+  EVGS V++ KVGD VGVG  V SCR C+ C++ LE  C K  + T+  ID D
Sbjct  64    HEIVGVATEVGSKVEKVKVGDKVGVGCLVGSCRGCDMCSQDLENYCPK-HILTYSAIDTD  122

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+T+GGYS+ +V  E +  + PEN P+   APLLCAGIT Y+P+    +++PG  +G++
Sbjct  123   GTLTQGGYSNIMVADEHFVVRWPENLPMDIGAPLLCAGITTYSPLRYFGLDKPGVHVGIV  182

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+ VKF KAFG KVTV STS  K++EA+  LGAD F+ S D +Q+ A + + D 
Sbjct  183   GLGGLGHVGVKFAKAFGAKVTVISTSEGKRQEAIGKLGADGFLNSRDPEQLQAAAGTMDG  242

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    ++LLK  G + +VG P + ++F    L  G K I+GS  GG K TQ
Sbjct  243   IIDTVSAVHPIVPLINLLKPHGKIVMVGAPEKPLEFGTIPLIAGRKTISGSAVGGLKETQ  302

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A   + P+++I+P+ YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  303   EMIDFAAKHNVLPDVEIVPVDYVNTAMERLLKADVKYRFVIDIGNTLK  350



>gb|EMT14649.1| Putative cinnamyl alcohol dehydrogenase 5 [Aegilops tauschii]
Length=419

 Score =   340 bits (872),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 241/354 (68%), Gaps = 2/354 (1%)
 Frame = -2

Query  1312  ASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTS  1133
             A+   T   +G AARD SG LSP   +RR  G DDV + I YCG+C++D+   +N    +
Sbjct  5     AAEQHTRKAVGLAARDASGHLSPLAITRRSTGDDDVVIKILYCGICHSDLHSIKNDWKNA  64

Query  1132  KYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFT  953
             KYP+VPGHEI G V EVG  V +FK GD VGVG  VNSC+ CE CN+G E  C  G + T
Sbjct  65    KYPMVPGHEITGEVNEVGKNVTKFKTGDRVGVGCMVNSCQSCESCNKGFENLCL-GIIPT  123

Query  952   FDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQP  773
             ++ +D+DGT+T GGYSS +VVHER+  + P+  PL   APLLCAGITVY+PM  H +N P
Sbjct  124   YNLVDLDGTITYGGYSSMVVVHERFVVRFPDTIPLEKGAPLLCAGITVYSPMKYHGLNIP  183

Query  772   gkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMA  593
             G  LGV+GLGGLGH+AVKFGKAFG+KVTV S+S  KK+EAL  LGAD F++  ++++M A
Sbjct  184   GMHLGVLGLGGLGHVAVKFGKAFGMKVTVISSSPGKKQEALERLGADAFIVGKNDEEMKA  243

Query  592   LSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSIT  416
                + D +INT S +IP    L LLK  G + +VG P + ++  P +L    K +AGS+ 
Sbjct  244   AMSTMDGIINTVSANIPMAPLLGLLKPNGKMIMVGLPEKPMEIPPFALVATNKTLAGSLI  303

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GG + TQE+L+  A   +  +I++I  +YVN A+ERL K DV+YRFVIDIG +L
Sbjct  304   GGMRDTQEMLDLAAKHNVTADIEVIGAEYVNTAMERLAKADVRYRFVIDIGNTL  357



>sp|Q2KNL6.1|GEDH1_OCIBA RecName: Full=Geraniol dehydrogenase 1; Short=ObaGEDH1 [Ocimum 
basilicum]
 gb|AAX83107.1| geraniol dehydrogenase [Ocimum basilicum]
Length=360

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 241/359 (67%), Gaps = 5/359 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MA S  T++    LGWAA D SG  SP+NFSRR  G  DV   + YCGVC++D+   +N 
Sbjct  1     MAKSPETEHPVKALGWAATDNSGTFSPFNFSRRATGERDVQFRVLYCGVCHSDLHMVKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G + YP+VPGHEIVGIV EVGS V++ K+GD VGVG  V SCR+C+ C+  LE  C K 
Sbjct  61    WGVTHYPIVPGHEIVGIVTEVGSKVEKVKIGDKVGVGVLVGSCRQCDQCSNDLENYCYK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              + T+    +DGT+ +GGYS  +V  E +  + PEN+PL + APLLCAGIT Y+P+    
Sbjct  120   QILTYGAPYLDGTIARGGYSDIMVADEHFIIRWPENFPLDAGAPLLCAGITTYSPLKYFG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG  +GV GLGGLGH+AVKF KAFG KVTV STS+SKKEEA+  LG D FV+S+D +
Sbjct  180   LDKPGLRVGVNGLGGLGHVAVKFAKAFGTKVTVISTSLSKKEEAMQHLGVDEFVVSTDPQ  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             QM A   + D +I+T S   P    LSLLK  G L +VG P + ++     L  G + IA
Sbjct  240   QMQAAVGTLDGIIDTVSAPHPIVPLLSLLKPHGKLIVVGLPDKPLQLPVFPLIQGRRTIA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS  GG K TQE+++F A   I  ++++IPI Y+N A++RL+K DVKYRFVID+  SLK
Sbjct  300   GSGIGGLKETQEMIDFAAKNNIVADVEVIPIDYINTAMDRLLKSDVKYRFVIDVEKSLK  358



>ref|XP_002300211.1| mannitol dehydrogenase 1 family protein [Populus trichocarpa]
 gb|EEE85016.1| mannitol dehydrogenase 1 family protein [Populus trichocarpa]
Length=362

 Score =   338 bits (866),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 245/347 (71%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAA+D SGVLSP++FSRR  G +DV++ I YCGVC++D+   +N  G S+YPLVPG
Sbjct  12    KAFGWAAKDSSGVLSPFHFSRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPLVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVGIV ++GS V++FKV D VGVG  VNSC+ CEYC++ LE  C K  +FT++  + D
Sbjct  72    HEIVGIVTKIGSNVKKFKVDDQVGVGVLVNSCKSCEYCDQDLENYCPK-MIFTYNAQNHD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T GGYS  IVV + +  +IP++ P   AAPLLCAGITVY+PM  + M +PGK LG++
Sbjct  131   GTKTYGGYSDTIVVDQHFVLRIPDSMPADGAAPLLCAGITVYSPMKYYGMTEPGKHLGIV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVK GKAFGLKVTV S+S  K+ EAL+ LGAD+F++SSD ++M A   + D+
Sbjct  191   GLGGLGHVAVKIGKAFGLKVTVISSSSRKESEALDRLGADSFLVSSDPEKMKAAFGTMDY  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S        LSLLKT G L  +G P + ++     L LG K + GS  GG K TQ
Sbjct  251   IIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGVKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+L+FCA   I  ++++I +  +N A++RL K DV+YRFVID+  SL
Sbjct  311   EMLDFCAKHNITSDVEVIRMDQINTAMDRLAKSDVRYRFVIDVANSL  357



>ref|XP_003573548.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 5 [Brachypodium 
distachyon]
Length=371

 Score =   338 bits (866),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 232/351 (66%), Gaps = 2/351 (1%)
 Frame = -2

Query  1303  HSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYP  1124
               T   +G AARD SG LSP   +RR  G DDV++ I YCG+C++D+   RN    + YP
Sbjct  13    QHTKKAVGLAARDASGHLSPLAITRRSTGDDDVAIKILYCGICHSDLHSIRNEWANATYP  72

Query  1123  LVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDG  944
             ++PGHEI G V EVG  V +FK GD VGVG  VNSC+ CE C+ G E QC  G +FT++ 
Sbjct  73    MIPGHEIAGEVTEVGKNVTKFKAGDRVGVGCMVNSCQSCESCDVGFENQCP-GMIFTYNS  131

Query  943   IDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgks  764
              D DGT T GGYSS +VVHER+  + P+  PL   APLLCAGITVY+PM  H +N PG  
Sbjct  132   TDRDGTCTYGGYSSAVVVHERFVVRFPDAMPLDKGAPLLCAGITVYSPMKYHGLNVPGLH  191

Query  763   lgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSK  584
             LGV+GLGGLGH+AVKFGKAFG+KVTV S+S  KKEEAL LLGAD FV+S D ++M A   
Sbjct  192   LGVLGLGGLGHVAVKFGKAFGMKVTVISSSPGKKEEALGLLGADAFVVSKDPEEMKAAMG  251

Query  583   SFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIAGSITGGT  407
             + D +INT S ++P      LLK  G + +VG P +    P  +L    K +AGS  GG 
Sbjct  252   TMDGIINTVSANVPMAPLFGLLKPNGKMIMVGLPDKPIEVPAFALVAKNKTLAGSCIGGM  311

Query  406   KLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
               TQE+L+  A   +  EI+++   YVN ALERL+K DV+YRFVIDI  +L
Sbjct  312   ADTQEMLDIAAKHGVTAEIEVVGADYVNTALERLVKADVRYRFVIDIANTL  362



>gb|AGU43754.1| cinnamyl alcohol dehydrogenase 6 [Populus tomentosa]
Length=360

 Score =   337 bits (865),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 240/357 (67%), Gaps = 3/357 (1%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S    H T    GWAARD SGVLSP+ FSRR  G  DV   + YCG+C++D+   +N  G
Sbjct  5     SYEEEHPT-RAFGWAARDQSGVLSPFKFSRRSTGEKDVRFKVLYCGICHSDLHMAKNEWG  63

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
             TS YPLVPGHEIVG V EVGS V++FKVGD VGVG  V SC  C+ CN  LE  C K  +
Sbjct  64    TSMYPLVPGHEIVGEVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCNSDLENYCPK-MI  122

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
              T+     DGT T GGYS  +V  E +  +IP+N PL +AAPLLCAGITVY+P+   N++
Sbjct  123   LTYSTKYHDGTTTYGGYSDSMVTDEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRFFNLD  182

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             +PG  +GV+GLGGLGH+AVKF KA G+KVTV STS  KK+EAL  LGAD+F++S D+ +M
Sbjct  183   KPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALEHLGADSFLVSRDQDEM  242

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGS  422
              A   + D +I+T S   P    +SLLKT G L LVG P + ++     L +G K + GS
Sbjct  243   QAAMGTMDGVIDTVSAMHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLIMGRKIVGGS  302

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
               GG K TQE+++F A   I  +I++I + YVN A+ERL+K DV+YRFVIDIG ++K
Sbjct  303   CIGGMKETQEMIDFAAKNNITADIEVISMDYVNTAMERLLKTDVRYRFVIDIGNTMK  359



>gb|ABK94550.1| unknown [Populus trichocarpa]
Length=362

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 245/347 (71%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAA+D SGVLSP++FSRR  G +DV++ I YCGVC++D+   +N  G S+YPL+PG
Sbjct  12    KAFGWAAKDSSGVLSPFHFSRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPLIPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVGIV ++GS V++FKV D VGVG  VNSC+ CEYC++ LE  C K  +FT++  + D
Sbjct  72    HEIVGIVTKIGSNVKKFKVDDQVGVGVLVNSCKSCEYCDQDLENYCPK-MIFTYNAQNHD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T GGYS  IVV + +  +IP++ P   AAPLLCAGITVY+PM  + M +PGK LG++
Sbjct  131   GTKTYGGYSDTIVVDQHFVLRIPDSMPADGAAPLLCAGITVYSPMKYYGMTEPGKHLGIV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVK GKAFGLKVTV S+S  K+ EAL+ LGAD+F++SSD ++M A   + D+
Sbjct  191   GLGGLGHVAVKIGKAFGLKVTVISSSSRKESEALDRLGADSFLVSSDPEKMKAAFGTMDY  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S        LSLLKT G L  +G P + ++     L LG K + GS  GG K TQ
Sbjct  251   IIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGVKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+L+FCA   I  ++++I +  +N A++RL K DV+YRFVID+  SL
Sbjct  311   EMLDFCAKHNITSDVEVIRMDQINTAMDRLAKSDVRYRFVIDVANSL  357



>ref|XP_008785257.1| PREDICTED: LOW QUALITY PROTEIN: 8-hydroxygeraniol dehydrogenase-like 
[Phoenix dactylifera]
Length=359

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 237/358 (66%), Gaps = 2/358 (1%)
 Frame = -2

Query  1324  FTSMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
                +      +   GWAARD +GVLSP+ FSRR  G  DV++ I YCGVC++D+ + +N 
Sbjct  1     MAKLPEEEHPEKAFGWAARDSNGVLSPFKFSRRSSGPKDVNIKILYCGVCHSDLHFVKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G S YP+VPGHEIVGIV EVGS VQ+F+VGD VGVG  V  C ECE C  G E  C K 
Sbjct  61    WGMSIYPIVPGHEIVGIVTEVGSMVQKFRVGDAVGVGCMVGGCDECEDCKRGWESYCPK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
             ++ T+  I  DGTVT GGYS  IVV E Y  + P+  P  + APLLCAGITVY+PM  + 
Sbjct  120   TILTYSNIYHDGTVTYGGYSDRIVVEEHYVVRFPDGLPKDAGAPLLCAGITVYSPMRYYG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             + +PG  LGV+GLGGLGHLAVKF KAFG KVTV STS SKK EA+  LGAD F++S + +
Sbjct  180   LAEPGTHLGVVGLGGLGHLAVKFAKAFGAKVTVISTSPSKKXEAIEHLGADAFLVSRNAE  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIA  428
             QM A +++ D +++T S        + LLK+ G L LVG P E    P   L +G K + 
Sbjct  240   QMKAAARTMDGILDTVSAKHSLLPLMELLKSHGKLVLVGAPEEPLELPAFPLLVGRKLVG  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             GS TGG + TQE+L+F A   I  +I+IIP+ Y+N A+ERL K DVKYRFVID+  +L
Sbjct  300   GSATGGMQETQEMLDFAAKHNITADIEIIPMNYINTAMERLAKADVKYRFVIDVANTL  357



>ref|XP_009759254.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Nicotiana sylvestris]
Length=360

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 239/348 (69%), Gaps = 4/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIH-GTSKYPLVP  1115
               LGWAARD SGVLSP+NF+RR  G  DV   + YCG+C++D+   +NI   TS YP+VP
Sbjct  12    KALGWAARDASGVLSPFNFTRRATGEKDVQFKVMYCGICHSDLQQLKNIEWSTSIYPMVP  71

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             G+E+VG+V E+GS V++FKVGD VGVG  V SCR+CE C+  LE+ C    + T++ I  
Sbjct  72    GYEVVGVVTEIGSKVEKFKVGDKVGVGCLVGSCRQCEKCDNNLEIYCPD-HIMTYNSIYT  130

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGT T GGYS  +V  E Y    PEN P+  AAPLL AGIT Y+P+    +++PG  +GV
Sbjct  131   DGTTTYGGYSDIMVTDEHYVVHWPENLPM-EAAPLLNAGITTYSPLKYFELDKPGMHIGV  189

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
              GLGGLGH+AVKF KAFG KVTV STS SKK+EA+  LGAD+F++S D  QM A + S D
Sbjct  190   AGLGGLGHMAVKFAKAFGTKVTVISTSASKKQEAIERLGADSFLLSRDPDQMQAATGSLD  249

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLT  398
              +I+T S   P    ++LLKT G L +VG P + ++     L LG K +AGS  GG K T
Sbjct  250   GIIDTVSAAHPLLPLINLLKTHGKLVIVGAPDKPLELPVFPLLLGRKLVAGSAIGGIKET  309

Query  397   QELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             QE+++F A   I P+++++P+ YVN A+ERL K DVKYRFV+DIG +L
Sbjct  310   QEMVDFAAKHNITPDVEVVPMDYVNTAMERLAKSDVKYRFVLDIGNTL  357



>gb|KHG20287.1| putative mannitol dehydrogenase [Gossypium arboreum]
Length=364

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 241/347 (69%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARDPSG LSP+ FSRRV G +DV   + YCG+C++D+   +N  G S YP+VPG
Sbjct  12    KAFGWAARDPSGHLSPFTFSRRVTGEEDVRFKVLYCGICHSDLHSIKNEWGFSNYPMVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG V EVGS V++ KVGD VGVG  V +C  C+ C   LE  C K  + T++GI  D
Sbjct  72    HEIVGEVTEVGSKVEKVKVGDKVGVGCMVGACHSCDSCTNDLENYCPK-LILTYNGIYYD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+T GGYS  +V +ERY  +IP+  PL SAAPLLCAGITVY+P+    + +PGK +G++
Sbjct  131   GTITYGGYSDSMVANERYVVRIPDGMPLDSAAPLLCAGITVYSPLKYFGLGEPGKHIGIV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KA G KVTV STS SKK EAL  LGAD+F++S D+ ++ A   +FD 
Sbjct  191   GLGGLGHVAVKFAKALGSKVTVISTSPSKKAEALEHLGADSFLVSPDQDELQAAMGTFDG  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    L LLK+ G L +VG PSE ++    SL +G K +AGS  GG K TQ
Sbjct  251   IIDTVSATHPIMPLLGLLKSHGKLIMVGAPSEPLELPVFSLIIGRKTMAGSGIGGMKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+++F A   I  +I++I + YVN+A+ERL + DV+YRFVIDIG +L
Sbjct  311   EMIDFAAKHNIRADIEVISMDYVNKAMERLEQADVRYRFVIDIGNTL  357



>ref|XP_006851411.1| hypothetical protein AMTR_s00040p00069200 [Amborella trichopoda]
 gb|ERN12992.1| hypothetical protein AMTR_s00040p00069200 [Amborella trichopoda]
Length=1047

 Score =   355 bits (912),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 250/360 (69%), Gaps = 3/360 (1%)
 Frame = -2

Query  1324  FTSMASSHS-TDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRN  1148
              +++A  H       GWAARD SG+LSP+ FSRR  G +DV++ I YCG+C++D+ + RN
Sbjct  1     MSTIAPEHEHPQQAFGWAARDTSGILSPFKFSRRANGEEDVTMKIVYCGICHSDLHFIRN  60

Query  1147  IHGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSK  968
               G + YP+VPGHEI GIV EVGS V+ FKVGD VGVG  V +C  CE C + LE QC K
Sbjct  61    DWGNTIYPIVPGHEIAGIVTEVGSNVKEFKVGDKVGVGCMVGACHTCEPCEKSLENQCPK  120

Query  967   GSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRH  788
               + T++ ID D T+T GGYS  +VVH+RY  ++PEN PL +AAPLLCAGITVY+PM   
Sbjct  121   -MILTYNSIDYDSTMTYGGYSDKLVVHKRYVIRLPENLPLDAAAPLLCAGITVYSPMKYF  179

Query  787   NMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDE  608
              + +PGK LG++GLGGLGH+AVKF KAFG+K+TV S+S SK++EA+++LGAD F++S D 
Sbjct  180   GLAEPGKHLGIVGLGGLGHVAVKFAKAFGVKITVISSSPSKEKEAIDMLGADKFLVSHDP  239

Query  607   KQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCI  431
             +QM A   + D++++T S + P    LSLLKT G L +VG P +    P   L LG K I
Sbjct  240   EQMQAAMGTMDYILDTVSAEHPLVPLLSLLKTNGKLIMVGLPEKPLELPAFPLILGRKLI  299

Query  430   AGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              GS  GG K TQE+++F     I  +I++I I YVN A+ERL   DV+YRFVID+  SLK
Sbjct  300   GGSHIGGMKETQEMIDFAGKHNITADIEVIKIDYVNTAMERLANADVRYRFVIDVANSLK  359



>gb|AHX58273.1| cinnamyl alcohol dehydrogenase 7 [Populus tomentosa]
Length=362

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAARD SG+LSP+ FSRR  G  DV+  + YCG+C++D+   +N  G ++YPL+PGHE
Sbjct  15    FGWAARDQSGLLSPFKFSRRATGEKDVAFKVLYCGICHSDLHMVKNEWGATQYPLIPGHE  74

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG+V EVGS V++FKVGD VGVG  V SCR C+ C   LE  CSK  + T+     DGT
Sbjct  75    IVGVVTEVGSEVEKFKVGDKVGVGCMVGSCRTCDSCQNDLENYCSK-KILTYGARYYDGT  133

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
             VT GGYS  +V  E +  +IP+N P  + APLLCAGITVY+P+    +++PG  +G++GL
Sbjct  134   VTYGGYSDSMVADEHFIVRIPDNLPPDAGAPLLCAGITVYSPLRYFGLDKPGMHVGIVGL  193

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVKF +A G+KVTV STS  KK+EAL  LGAD+F++S D+ QM A   + D +I
Sbjct  194   GGLGHVAVKFARAMGVKVTVISTSPDKKQEALENLGADSFLVSRDQDQMQAAMGTLDGII  253

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPS---EVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +T S   P    ++LLK+ G L LVG P    E+  SP  L +G K + GS  GG K TQ
Sbjct  254   DTVSAVHPLLPLVALLKSHGKLVLVGAPEKPLELPVSP--LIIGRKTVGGSCFGGIKETQ  311

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A  KI  +I++IP+ YVN A+ER++K DV+YRFVID+G +LK
Sbjct  312   EMIDFAAEHKITADIEVIPMDYVNTAMERVLKTDVRYRFVIDVGKTLK  359



>ref|XP_002313294.2| hypothetical protein POPTR_0009s06770g [Populus trichocarpa]
 gb|EEE87249.2| hypothetical protein POPTR_0009s06770g [Populus trichocarpa]
Length=360

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 239/349 (68%), Gaps = 2/349 (1%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             +   GWAARD SGVLSP+ FSRR  G  DV   + +CG+C++D+   +N  GTS YPLVP
Sbjct  12    NKAFGWAARDQSGVLSPFKFSRRSTGEKDVRFKVLFCGICHSDLHMAKNEWGTSMYPLVP  71

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEIVG V EVGS V++FKVGD VG+G  V SC  C+ CN  LE  C K  + T+     
Sbjct  72    GHEIVGEVTEVGSKVEKFKVGDKVGLGCMVGSCHSCDSCNNNLENYCPK-MILTYSTKYS  130

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGT T GGYS+ +V  E +  +IP+N PL +AAPLLCAGITVY+P+   N+++PG  +GV
Sbjct  131   DGTTTYGGYSNSMVTDEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRFFNLDKPGMHVGV  190

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             +GLGGLGH+AVKF KA G+KVTV STS  KK+EAL  LGAD+F++S D+ +M A   + D
Sbjct  191   VGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALEHLGADSFLVSRDQDEMQAAKGTMD  250

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLT  398
              +I+T S   P    +SLLKT G L LVG P + ++     L +G K + GS  GG K T
Sbjct  251   GVIDTVSAMHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLLMGRKIVGGSCIGGMKET  310

Query  397   QELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             QE+++F A   I  +I++I + YVN A+ERL+K DV+YRFVIDIG ++K
Sbjct  311   QEMIDFAAKNNITADIEVISMDYVNTAMERLMKTDVRYRFVIDIGNTMK  359



>sp|P41637.1|CADH_PINTA RecName: Full=Probable cinnamyl alcohol dehydrogenase; Short=CAD 
[Pinus taeda]
 emb|CAA86072.1| cinnamyl alcohol dehydrogenase [Pinus taeda]
Length=357

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/354 (49%), Positives = 247/354 (70%), Gaps = 2/354 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  S     G+AARD SG LSPY ++ R  G +DV + + YCG+C++D++  RN  G 
Sbjct  1     MGSLESEKTVTGYAARDSSGHLSPYTYNLRKKGPEDVIVKVIYCGICHSDLVQMRNEMGM  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YP+VPGHE+VGIV E+GS V++FKVG+ VGVG  V SCR C  CN+ +E  CSK  ++
Sbjct  61    SHYPMVPGHEVVGIVTEIGSEVKKFKVGEHVGVGCIVGSCRSCGNCNQSMEQYCSK-RIW  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T++ ++ DGT T+GG++S +VV + +  +IPEN PL  AAPLLCAG+TV++PM    M +
Sbjct  120   TYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVFSPMKHFAMTE  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGK  G++GLGG+GHL VK  KAFGL VTV S+S  KKEEA+ +LGAD +++S D ++MM
Sbjct  180   PGKKCGILGLGGVGHLGVKIAKAFGLHVTVISSSDKKKEEAMEVLGADAYLVSKDTEKMM  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVG-FPSEVKFSPGSLNLGMKCIAGSI  419
               ++S D++++T     P + YL+LLKT G L ++G  P  + F    L LG + IAGS 
Sbjct  240   EAAESLDYIMDTIPVAHPLEPYLALLKTNGKLVMLGVVPEPLHFVTPPLILGRRSIAGSF  299

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGS  257
              GG + TQE L+FCA +K+   I+++ + Y+N A+ERL K DV+YRFV+D+ GS
Sbjct  300   IGGMEETQETLDFCAEKKVSSMIEVVGLDYINTAMERLEKNDVRYRFVVDVAGS  353



>ref|XP_004307159.1| PREDICTED: probable mannitol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=361

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 236/345 (68%), Gaps = 2/345 (1%)
 Frame = -2

Query  1282  GWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEI  1103
             GWAARD SGVLSP++FSRR  G  DV+  + YCG+C++D+   +N  G S YPLVPGHEI
Sbjct  15    GWAARDSSGVLSPFSFSRRETGEKDVTFKVLYCGICHSDLHMIKNEWGFSTYPLVPGHEI  74

Query  1102  VGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTV  923
             VG V EVGS VQ+FKVGD VGVG  V SCR CE C   LE  C K  + T+     DGT 
Sbjct  75    VGEVTEVGSSVQKFKVGDRVGVGCIVGSCRSCENCTGHLENYCPK-QILTYGAKYYDGTT  133

Query  922   TKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglg  743
             T GGYS  +V  E +  +IP+N PL  AAPLLCAGIT Y+P+    +++PG  +GV+GLG
Sbjct  134   TYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGLDKPGMHVGVVGLG  193

Query  742   glghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLIN  563
             GLGH+AVKF KA G+KVTV STS  K+EEAL  LGAD+F++S D+ QM A   + D +I+
Sbjct  194   GLGHVAVKFAKAMGVKVTVISTSPKKEEEALKHLGADSFLVSRDQDQMQAAIGTMDGIID  253

Query  562   TASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQELL  386
             T S   P    + LLK+ G L +VG P + ++     L +G K +AGS  GG K TQE++
Sbjct  254   TVSAQHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLMGRKMVAGSGIGGMKETQEMI  313

Query  385   EFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +F A   I  +I++IPI Y+N A+ERL+K DV+YRFVIDIG +LK
Sbjct  314   DFAAKHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLK  358



>gb|AFZ78656.1| sinapyl alcohol dehydrogenase [Populus tomentosa]
Length=362

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 243/347 (70%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAA+D SGVLSP++F+RR  G +DV++ I YCGVC++D+   +N  G S+YPLVPG
Sbjct  12    KAFGWAAKDSSGVLSPFHFTRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPLVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVGIV ++GS V++FKV D VGVG  VNSC+ CEYC++  E  C K  +FT++  + D
Sbjct  72    HEIVGIVTKIGSNVKKFKVDDQVGVGVMVNSCKSCEYCDQDSENYCPK-MIFTYNAHNYD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T GGYS  IVV + +   IP++ P   AAPLLCAGITVY+PM  + M +PGK LG++
Sbjct  131   GTKTYGGYSDTIVVDQHFVLHIPDSMPADGAAPLLCAGITVYSPMKYYGMTEPGKHLGIV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVK GKAFGLKVTV S+S  K+ EAL+ LGAD+FV+SSD ++M A   + D+
Sbjct  191   GLGGLGHVAVKIGKAFGLKVTVISSSSRKEREALDRLGADSFVVSSDPEKMKAAFGTMDY  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S        LSLLKT G L  +G P + ++     L LG K + GS  GG K TQ
Sbjct  251   IIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGMKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+L+FCA   I  ++++I +  +N A+ERL K DV+YRFVID+  SL
Sbjct  311   EMLDFCAKHNITSDVEVIRMDQINTAMERLAKSDVRYRFVIDVANSL  357



>ref|XP_011045697.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Populus 
euphratica]
Length=362

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 244/347 (70%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAA+D SGV SP++FSRR  G +DV++ I YCGVC++D+   +N  G S+YPLVPG
Sbjct  12    KAFGWAAKDSSGVFSPFHFSRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPLVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVGIV ++GS V++FKV D VGVG  VNSC+ CEYC++ LE  C K  +FT++  + D
Sbjct  72    HEIVGIVTKIGSNVKKFKVDDQVGVGVMVNSCKSCEYCDQDLENYCPK-MIFTYNAQNYD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T GGYS  IVV + +  +IP++ P   AAPLLCAGITVY+PM  + M++PGK LG++
Sbjct  131   GTKTYGGYSDTIVVDQHFVLRIPDSLPADGAAPLLCAGITVYSPMKYYGMSEPGKHLGIV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVK GKAFGLKVTV S+S  K+ EAL+ LGAD F++SSD ++M A   + D+
Sbjct  191   GLGGLGHVAVKIGKAFGLKVTVISSSSRKEREALDRLGADTFLVSSDLEKMKAAFGTMDY  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S        LSLLKT G L  +G P + ++     L LG K + GS  GG K TQ
Sbjct  251   IIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDVGGIKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+L+FCA   I  ++++I +  +N A++RL K DV+YRFVID+  SL
Sbjct  311   EMLDFCAKHNITSDVEVIRMDQINTAMDRLAKSDVRYRFVIDVANSL  357



>ref|XP_009364795.1| PREDICTED: probable mannitol dehydrogenase [Pyrus x bretschneideri]
Length=361

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 238/348 (68%), Gaps = 2/348 (1%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             +   GWAARD SGVLSP  FSRR  G  DV   + YCG+C++D+   +N  G+S YPL+P
Sbjct  11    NKAFGWAARDSSGVLSPLKFSRRKTGEKDVRFKVLYCGICHSDLHMVKNEWGSSVYPLIP  70

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEIVG+V EVGS VQ+F VGD VGVG  V SCR C+ CN  LE  C K  + T+   ++
Sbjct  71    GHEIVGVVTEVGSKVQKFNVGDKVGVGCMVGSCRSCDSCNNHLENYCPK-MILTYGTRNL  129

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGT+T GGYS  +V  E +  +IP+N PL  AAPLLCAGIT Y+P+    +++PG  +GV
Sbjct  130   DGTITYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGLDKPGMHVGV  189

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             +GLGGLGHLAVKF KA G+KVTV STS +KKEEA+  L AD+F++S D+ QM A   + D
Sbjct  190   VGLGGLGHLAVKFAKAMGVKVTVISTSPNKKEEAIEHLHADSFLVSRDQDQMQAAMGTLD  249

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLT  398
              +I+T S   P    + LLK+ G L +VG P + ++     L +G K + GS  GG K T
Sbjct  250   GIIDTVSALHPLVPLIGLLKSHGKLVMVGAPEKPLELPVFPLIMGRKIVGGSCIGGMKET  309

Query  397   QELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             QE+++F A  KI  +I++IPI Y+N A+ERL+K DV+YRFVIDIG +L
Sbjct  310   QEMIDFSAKHKITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTL  357



>ref|XP_002322761.2| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|EEF04522.2| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
Length=362

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 240/346 (69%), Gaps = 2/346 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAARD SGVLSP+ FSRR  G  DV+  + YCG+C++D+   +N  G ++YPL+PGHE
Sbjct  15    FGWAARDQSGVLSPFKFSRRATGEKDVAFKVLYCGICHSDLHMVKNEWGVTQYPLIPGHE  74

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG+V EVGS V++FKVGD VGVG  V SCR C+ C+  LE  CSK  + T+     DGT
Sbjct  75    IVGVVTEVGSKVEKFKVGDKVGVGCMVGSCRSCDSCDNNLENYCSK-MILTYGAKYYDGT  133

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
             VT GGYS  +V  E +  +IP N PL + APLLCAGITVY+P+    +++PG  +G++GL
Sbjct  134   VTYGGYSDNMVADEHFIVRIPNNLPLDAGAPLLCAGITVYSPLRYFGLDKPGMHVGIVGL  193

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVKF +A G+KVTV STS +KK+EAL  LGAD+F++S D+ QM A   + D +I
Sbjct  194   GGLGHVAVKFARAMGVKVTVISTSPNKKQEALENLGADSFLVSRDQDQMQAAMGTLDGII  253

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             +T S   P    ++LLK+ G L LVG P + ++     L  G K + GS  GG K TQE+
Sbjct  254   DTVSAVHPLLPLVALLKSHGKLVLVGAPEKPLELPVFPLITGRKTVGGSCVGGIKETQEM  313

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             ++F A   I  +I++IP+ YVN A+ER++K DV+YRFVID+G +LK
Sbjct  314   IDFAAKHNITADIEVIPMDYVNTAMERVLKADVRYRFVIDVGKTLK  359



>ref|XP_004972583.1| PREDICTED: putative cinnamyl alcohol dehydrogenase 5-like isoform 
X2 [Setaria italica]
Length=370

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/338 (51%), Positives = 237/338 (70%), Gaps = 2/338 (1%)
 Frame = -2

Query  1261  SGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEIVGIVKEV  1082
             SG L+P   +RR  G DDV++ I YCG+C++D+   +N    + YP+VPGHEI G+V EV
Sbjct  31    SGHLAPLTITRRSTGDDDVAIKILYCGICHSDLHSIKNEWHNAMYPVVPGHEIAGVVTEV  90

Query  1081  GSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTVTKGGYSS  902
             G  V +FK GD VGVG  VNSC+ C+ CNEG E  C +G +FT++ +D+DGTVT GGYSS
Sbjct  91    GKNVTKFKAGDRVGVGCIVNSCQSCDSCNEGFENHC-RGMIFTYNSVDLDGTVTYGGYSS  149

Query  901   YIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglgglghLAV  722
              +VVHER+  + P+  PL   APLLCAGITVY+PM  H +N PGK +GV+GLGGLGH+AV
Sbjct  150   NVVVHERFVVRFPDAMPLDQGAPLLCAGITVYSPMKHHGLNVPGKHVGVVGLGGLGHVAV  209

Query  721   KFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLINTASGDIP  542
             KF KAFG+KVTV S+S +KK+EAL   GAD F++S ++ +M A + + D +INT S +IP
Sbjct  210   KFAKAFGMKVTVISSSPAKKQEALERHGADAFIVSRNDDEMKAAAGTMDGIINTVSANIP  269

Query  541   FDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQELLEFCASRK  365
                Y+S+LK  G + +VG P + ++  P  L  G K +AGS  GG + TQE+++  A   
Sbjct  270   MAPYMSMLKPYGKMIMVGLPDKPLEIPPFDLMTGSKTLAGSCIGGMRDTQEMIDVAAKHG  329

Query  364   IYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +  +I+++   YVN A+ERL K DV+YRFVIDIG +LK
Sbjct  330   VTADIEVVGADYVNTAMERLAKADVRYRFVIDIGNTLK  367



>ref|XP_003612986.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95944.1| cinnamyl alcohol dehydrogenase family protein [Medicago truncatula]
Length=363

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 245/348 (70%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARD SGVLSP++F RR  G  DV+  + YCG+C++D+   +N  G + YPLVPG
Sbjct  14    KAFGWAARDSSGVLSPFHFFRRETGEKDVAFKVLYCGICHSDLHIMQNEWGKTTYPLVPG  73

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HE+ G+V EVGS V++FKVGD VGVG  V+SCR CE C + +E  C+K +  TF+G   D
Sbjct  74    HELTGVVTEVGSKVKKFKVGDKVGVGYMVDSCRSCENCADDIENYCTKYTQ-TFNGKSRD  132

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+T GG+S  +V  E +  +IP++ PL  A PLLCAG+TVY+P+    +++PG ++GV+
Sbjct  133   GTITYGGFSDSMVADEHFVIRIPDSLPLDGAGPLLCAGVTVYSPLRHFGLDKPGMNIGVV  192

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KAFG KVTV STS  K++EA+  LGAD+F++S D +QM A + + + 
Sbjct  193   GLGGLGHMAVKFAKAFGAKVTVISTSPKKEKEAIEHLGADSFLVSRDPEQMQAATSTLNG  252

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    + LLK+ G L +VG  ++ ++    SL  G K IAGS+ GG K TQ
Sbjct  253   IIDTVSASHPVVPLIGLLKSNGKLVMVGAVAKPLELPIFSLLGGRKSIAGSLIGGIKETQ  312

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A   + PEI+++PI YVN A+ERL+K DVKYRFVIDIG SLK
Sbjct  313   EMIDFAAKHNVTPEIEVVPIDYVNTAMERLVKGDVKYRFVIDIGNSLK  360



>ref|XP_011025421.1| PREDICTED: probable mannitol dehydrogenase [Populus euphratica]
Length=360

 Score =   335 bits (860),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 240/357 (67%), Gaps = 3/357 (1%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S    H T    GWAARD SGVLSP+ FSRR  G  DV   + +CG+C++D+   +N  G
Sbjct  5     SYEEEHPT-KAFGWAARDQSGVLSPFKFSRRSTGEKDVRFKVLFCGICHSDLHMAKNEWG  63

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
             TS YPLVPGHEIVG V EVGS V++FKVGD VGVG  V SC  C+ CN  LE  C K  +
Sbjct  64    TSIYPLVPGHEIVGEVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCNNDLENYCPK-MI  122

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
              T+     DGT T GGYS  +V  E +  +IP+N PL +AAPLLCAGITVY+P+   N++
Sbjct  123   LTYSTKYHDGTTTYGGYSDSMVTDEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRFFNLD  182

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             +PG  +GV+GLGGLGH+AVKF KA G+KVTV STS  KK+EAL  LGAD+F++S D+ +M
Sbjct  183   KPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALERLGADSFLVSRDQDEM  242

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGS  422
              A   + D +I+T S   P    +SLLKT G L LVG P + ++     L +G K + GS
Sbjct  243   QAAMGTMDGVIDTVSAMHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLIMGRKIVGGS  302

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
               GG K TQE+++F A   I  +I++I + YVN A+ERL+K DV+YRFVIDIG ++K
Sbjct  303   CIGGMKETQEMIDFAAKNNITADIEVISMDYVNTAMERLLKTDVRYRFVIDIGNTMK  359



>gb|ABK96585.1| unknown [Populus trichocarpa x Populus deltoides]
Length=362

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 240/346 (69%), Gaps = 2/346 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAARD SGVLSP+ FSRR  G  DV+  + YCG+C++D+   +N  G ++YPL+PGHE
Sbjct  15    FGWAARDQSGVLSPFKFSRRATGEKDVAFTVLYCGICHSDLHMVKNEWGVTQYPLIPGHE  74

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG+V EVGS V++FKVGD VGVG  V SCR C+ C+  LE  CSK  + T+     DGT
Sbjct  75    IVGVVTEVGSKVEKFKVGDKVGVGCMVGSCRSCDSCDNNLENYCSK-KILTYGAKYYDGT  133

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
             VT GGYS  +V  E +  +IP N PL + APLLCAGITVY+P+    +++PG  +G++GL
Sbjct  134   VTYGGYSDNMVADEHFIVRIPNNLPLDAGAPLLCAGITVYSPLRYFGLDKPGMHVGIVGL  193

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVKF +A G+KVTV STS +KK+EAL  LGAD+F++S D+ QM A   + D +I
Sbjct  194   GGLGHVAVKFARAMGVKVTVISTSPNKKQEALENLGADSFLVSRDQDQMQAAMGTLDGII  253

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             +T S   P    ++LLK+ G L LVG P + ++     L  G K + GS  GG K TQE+
Sbjct  254   DTVSAVHPLLPLVALLKSHGKLVLVGAPEKPLELPVFPLITGRKTVGGSCFGGIKETQEM  313

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             ++F A   I  +I++IP+ YVN A+ER++K DV+YRFVID+G +LK
Sbjct  314   IDFAAKHNITADIEVIPMDYVNTAMERVLKADVRYRFVIDVGKTLK  359



>ref|XP_007156455.1| hypothetical protein PHAVU_003G287400g [Phaseolus vulgaris]
 gb|ESW28449.1| hypothetical protein PHAVU_003G287400g [Phaseolus vulgaris]
Length=360

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 180/345 (52%), Positives = 240/345 (70%), Gaps = 1/345 (0%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAARD SGVLSP+NF+RR  G  DV++ + +CG+C+ D+   ++  G S YPLVPGHE
Sbjct  14    FGWAARDTSGVLSPFNFTRRETGDKDVAIKVLFCGICHTDLHNAKSEWGQSFYPLVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             I G V EVGS V++FKVG+ VGVG  V SCR C  C++ LE  CSK  V T+   D+DG+
Sbjct  74    IAGEVIEVGSKVEKFKVGEKVGVGCMVQSCRSCGNCSDNLENFCSK-LVLTYGSKDIDGS  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
             +T+GGYS  +VV E +   IP+  PL +AAPLLCAGITVY+P++   + +P   +GV+GL
Sbjct  133   ITQGGYSDMVVVDEHFVISIPDGLPLEAAAPLLCAGITVYSPLLYFGLAKPDLHVGVVGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GG+GH+AVKF KAFG KVTV STS +KK+EA+  LGAD+F+IS ++ +M A   + D +I
Sbjct  193   GGVGHMAVKFAKAFGAKVTVISTSPNKKKEAIEHLGADSFLISRNQDEMEAAKGTLDGII  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPGSLNLGMKCIAGSITGGTKLTQELL  386
             +T S   P    ++LLK+ G + +VG P +    P    L  K +AGS  GG K TQE++
Sbjct  253   DTVSAVHPLLPLINLLKSQGKIVIVGLPDKPLELPIFPLLDRKSVAGSCIGGIKETQEMI  312

Query  385   EFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              + A   I P+I+IIPI YVN A+ERL+K DVKYRFVIDIG +LK
Sbjct  313   NYAAKYDIKPDIEIIPIDYVNTAMERLLKSDVKYRFVIDIGNTLK  357



>ref|XP_006851414.1| hypothetical protein AMTR_s00040p00072630 [Amborella trichopoda]
 gb|ERN12995.1| hypothetical protein AMTR_s00040p00072630 [Amborella trichopoda]
Length=361

 Score =   335 bits (858),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 238/345 (69%), Gaps = 2/345 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
             +GWAARD SGVLSP NFSRR  G +DV++ I YCG+C++D+   +N  G + YP+VPGHE
Sbjct  14    VGWAARDASGVLSPLNFSRRANGEEDVTIKIVYCGICHSDLHAIKNEWGNTIYPIVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             I GI+ EVGS V+ FKVGD  GVG  V +C  CE C + LE  C K  +FT++ I  DGT
Sbjct  74    IAGIITEVGSNVKEFKVGDKAGVGCMVGACHNCEACEQSLENLCPK-VIFTYNSIYYDGT  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
              T GGYS  IV+ +RY  +IPEN PL + APLLCAG+TVY+PM  + + +PGK LG++GL
Sbjct  133   KTYGGYSDKIVLDKRYVVRIPENLPLDATAPLLCAGVTVYSPMKHYGLTEPGKHLGIVGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+A+KF KAFGLKVTV STS  K++EA  +LGAD F++S + +QM A   + D+++
Sbjct  193   GGLGHVAIKFAKAFGLKVTVISTSPKKEKEATEILGADKFLVSRNPEQMQAAMCTMDYIL  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIAGSITGGTKLTQEL  389
             +T S +      LSLLK+ G L +VG P +    P   L  G K I GSI GG K TQ++
Sbjct  253   DTVSAEHALVPLLSLLKSNGKLIVVGLPEKPFLLPAFPLIAGRKVIGGSIIGGMKETQDM  312

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             + F +   I  +I+++ + YVN A+ERL K DV+YRFVID+  SL
Sbjct  313   INFASKHNITADIELVKMDYVNTAMERLAKGDVRYRFVIDVANSL  357



>gb|KDP35308.1| hypothetical protein JCGZ_09467 [Jatropha curcas]
Length=360

 Score =   335 bits (858),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 241/345 (70%), Gaps = 2/345 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAA+D SG+LSP++FSRR  G +DV++ I YCGVC++D+   RN  G  +YP+VPGHE
Sbjct  14    FGWAAKDTSGILSPFHFSRRENGVEDVTVKILYCGVCHSDLHACRNEWGFVRYPVVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG V ++G+ V++FKVGD VGVG  V SC+ CEYCN+ LE  C K  +FT++ ID DGT
Sbjct  74    IVGTVTKIGNNVKKFKVGDRVGVGVMVGSCKSCEYCNQDLENYCPK-MIFTYNSIDHDGT  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
              T GGYS  IVV++ +    P+N P  + APLLCAGITVY+PM  + M +PGK LG++GL
Sbjct  133   RTYGGYSDMIVVNQHFVLHFPDNLPSDAGAPLLCAGITVYSPMKYYGMTEPGKHLGIVGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AV+ GKAFGL+VTV S+S  K+ EALN LGAD F++SSD  +M A   S DF+I
Sbjct  193   GGLGHVAVRIGKAFGLRVTVISSSPRKESEALNRLGADAFLVSSDPGKMKAAIGSMDFII  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             +T S        LSLLK  G L  +G P + ++     L LG K + GS  GG K TQE+
Sbjct  253   DTVSAVHALAPLLSLLKPNGKLITLGLPDKPLELPIFPLVLGRKLVGGSDIGGIKETQEM  312

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             L+FCA   I  ++++I I  +N A+ERL K DV+YRFVID+G SL
Sbjct  313   LDFCAKHNITADVEVIRIDEINTAMERLGKSDVRYRFVIDVGNSL  357



>ref|XP_002968657.1| hypothetical protein SELMODRAFT_90947 [Selaginella moellendorffii]
 gb|EFJ29773.1| hypothetical protein SELMODRAFT_90947 [Selaginella moellendorffii]
Length=352

 Score =   334 bits (857),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 241/348 (69%), Gaps = 3/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
              C GWAA+D SGVL+P+ F RR +   DV   I +CG+C+ D+    N  G+SKYP+VPG
Sbjct  6     ECGGWAAKDASGVLAPFKFPRRALRPTDVKFKITHCGICHTDLHLIHNEWGSSKYPMVPG  65

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HE+VG+V E+G G ++FKVGD VGVG  V SC +C++C  G E  C K  V+T++  + D
Sbjct  66    HEVVGLVTELGPGAKKFKVGDHVGVGCMVFSCLKCDHCKHGDEQYCDK-LVWTYNS-EED  123

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             G +T GGYS ++V  E++  ++P+N PL +AAPLLCAGITVY+PM    M Q GK+ GV+
Sbjct  124   GKITMGGYSGFLVADEKFVVRVPDNLPLDAAAPLLCAGITVYSPMKHFGMTQAGKNFGVV  183

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKFGKAFG+KVTV STS SK++EA  +LGA NF++S D  QM   +K+ D+
Sbjct  184   GLGGLGHMAVKFGKAFGMKVTVISTSPSKEKEAREVLGAHNFIVSKDSAQMKKAAKTMDY  243

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +++T S   P D  L LLK  G L +VG P + ++   G +  G + +AGS  G  + TQ
Sbjct  244   ILDTVSAPHPLDALLELLKIDGKLVMVGLPDKPLELPAGVIIFGRRSLAGSFIGSIRETQ  303

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             ++L+FC    +   I+++P+ YVN+A+ERL K DVKYRFV+D+  +LK
Sbjct  304   DMLDFCGKNNVTSMIELVPMDYVNKAMERLRKSDVKYRFVLDVEKTLK  351



>ref|XP_011100037.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Sesamum indicum]
Length=360

 Score =   335 bits (858),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 239/359 (67%), Gaps = 5/359 (1%)
 Frame = -2

Query  1315  MASSHSTDN---CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNI  1145
             MA S  T++     GWAARD SG  SP+ FSRR  G  DV   + YCGVCY+D+   +N 
Sbjct  1     MAKSPETEHPVKAFGWAARDTSGFFSPFKFSRRATGEHDVQFKVMYCGVCYSDLQMVKNE  60

Query  1144  HGTSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKG  965
              G ++YP VPGHEIVGIV EVGS V++FKVGD VGVG  V SCREC+ C   LE  C K 
Sbjct  61    WGCTQYPFVPGHEIVGIVTEVGSKVEKFKVGDKVGVGCLVGSCRECDQCASDLENYCPK-  119

Query  964   SVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHN  785
              +  +     +GT+  GGYS+ +V  + +  + PEN PL   APLLCAGIT Y+P+    
Sbjct  120   QILAYSSPYTEGTIMYGGYSNLMVADDHFVVRWPENLPLDIGAPLLCAGITTYSPLRHFG  179

Query  784   MNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEK  605
             +++PG  +GV+GLGGLGH+AVKF KAFG  VTV STS+SKK+EA+  LGAD F++S + +
Sbjct  180   LDKPGLKVGVVGLGGLGHVAVKFAKAFGTTVTVISTSLSKKKEAIENLGADKFLVSRNPE  239

Query  604   QMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIA  428
             +M A + + D +I+T S        LSLLK  G L  VG P + ++    SL +G K IA
Sbjct  240   EMQAAAGTLDGIIDTVSATHAVAPLLSLLKPHGKLICVGVPEKPLELPVFSLIIGRKLIA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS  GG K TQE+++F A + I P+++IIPI YVN A+ERL+K DVKYRFVIDI  SLK
Sbjct  300   GSAIGGLKETQEMIDFAAKQNILPDVEIIPIDYVNTAMERLLKSDVKYRFVIDIENSLK  358



>ref|XP_011042531.1| PREDICTED: probable mannitol dehydrogenase [Populus euphratica]
Length=362

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 239/346 (69%), Gaps = 2/346 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAARD SGVLSP+ FSRR  G  DV+  + YCG+C++D+   +N  G ++YPL+PGHE
Sbjct  15    FGWAARDQSGVLSPFKFSRRATGEKDVAFKVLYCGICHSDLHMVKNEWGLTQYPLIPGHE  74

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG+V EVGS V++FKVGD VGVG  V SCR C+ C   LE  CSK  + T+     DGT
Sbjct  75    IVGVVTEVGSKVEKFKVGDKVGVGCMVGSCRSCDTCQNNLENYCSK-MILTYGAKYYDGT  133

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
             VT GGYS  +V  E +  +IP+N PL + APLLCAGITVY+P+    +++PG  +GV+GL
Sbjct  134   VTYGGYSDSMVADEHFIVRIPDNLPLDAGAPLLCAGITVYSPLRYFGLDKPGMHVGVVGL  193

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVKF +A G+KVTV STS +KK+EAL  LGAD+F++S D+ QM A   + D +I
Sbjct  194   GGLGHVAVKFARAMGVKVTVISTSPNKKQEALENLGADSFLVSRDQDQMQAAKGTLDGII  253

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             +T S   P     +LLK+ G L LVG P + ++     L  G K + GS  GG K TQE+
Sbjct  254   DTVSAVHPLLPLFTLLKSHGKLVLVGAPEKPLEMPVFPLITGRKTVGGSCFGGIKETQEM  313

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             ++F A   I  +I++IP+ YVN A+ER++K DV+YRFVID+G +LK
Sbjct  314   VDFAAKHNITADIEVIPMDYVNTAMERVLKADVRYRFVIDVGKTLK  359



>dbj|BAJ94260.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 233/353 (66%), Gaps = 2/353 (1%)
 Frame = -2

Query  1309  SSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSK  1130
             S   T   +G AARD SG L+P   +RR  G DDV + I YCG+C++D+   +N    + 
Sbjct  9     SKQHTQKAVGLAARDASGHLTPLAITRRSTGDDDVQIKILYCGICHSDLHSIKNDWKDAT  68

Query  1129  YPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTF  950
             YP++PGHEI G V EVG  V RFK GD VGVG  VNSC+ CE C++G E  C  G +FT+
Sbjct  69    YPVIPGHEIAGEVTEVGKNVTRFKAGDRVGVGCMVNSCQSCESCDKGFENHCP-GVIFTY  127

Query  949   DGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPg  770
             + +D DGT T GGYSS +VVHER+  + P+  PL   APLLCAGITVY+PM  H +N PG
Sbjct  128   NRVDRDGTFTYGGYSSMVVVHERFVVRFPDAMPLDKGAPLLCAGITVYSPMKYHGLNVPG  187

Query  769   kslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMAL  590
               LGV+GLGGLGH+AVK GKAFG+KVTV S+S  KK+EAL  LGAD FV+S +  +M A 
Sbjct  188   MHLGVLGLGGLGHVAVKLGKAFGMKVTVISSSPGKKQEALERLGADAFVVSKNADEMKAA  247

Query  589   SKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITG  413
               + D +INT S +IP      LLK  G + +VG P + V+  P +L    K ++GS  G
Sbjct  248   MSTMDGIINTVSANIPMAPLFGLLKPNGKMVMVGLPEKPVEVPPFALVAKNKTLSGSFIG  307

Query  412   GTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             G   TQE+L+  A   +  +I++I  +YVN A+ERL K DV+YRFVIDIG +L
Sbjct  308   GMSDTQEMLDLAAKHGVTADIEVISAEYVNTAMERLAKADVRYRFVIDIGNTL  360



>ref|XP_003635250.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI33194.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 240/347 (69%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARD SG LSP+NFSRR  G +DV   + YCG+C++D+   +N  G + YP+VPG
Sbjct  12    KAFGWAARDHSGHLSPFNFSRRETGEEDVRFKVLYCGICHSDLHSIKNEWGNAAYPMVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V EVGS V++FKVGD VGVG  V +C  CE C++ LE  CSK  + T++    D
Sbjct  72    HEIVGVVTEVGSKVEKFKVGDKVGVGCLVGACHSCESCSDDLENYCSK-LILTYNMPYHD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T GGYS  +V  ERY  +IP+N PLA+ APLLCAGITVY+P+      QPG  +G++
Sbjct  131   GTRTYGGYSDTMVAPERYVVRIPDNMPLAAGAPLLCAGITVYSPLKYFGFTQPGMHIGIV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KAFG+KVT+ STS+SKK+EA+  LGAD+FV+S D +QM A   + D 
Sbjct  191   GLGGLGHVAVKFAKAFGVKVTLISTSLSKKKEAIEHLGADSFVVSHDPEQMQAAMGTMDG  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIAGSITGGTKLTQ  395
             +++T S   P    L LLK  G L L+G P +    P  SL +G K +AGS  GG K TQ
Sbjct  251   ILDTVSATHPLLPLLGLLKNNGKLILLGVPEKPLELPAFSLIMGRKTVAGSGIGGMKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+L+F A   +  +I+++P+ YVN A+ERL K DV+YRFVIDIG SL
Sbjct  311   EMLDFAAKHNVTADIEVVPMDYVNTAMERLAKADVRYRFVIDIGNSL  357



>ref|XP_011083438.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Sesamum indicum]
Length=397

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 240/353 (68%), Gaps = 2/353 (1%)
 Frame = -2

Query  1306  SHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKY  1127
              H T N  GWAARDPSGVLSP+ FSRR     DV + + YCG+C++D+   +N  G SKY
Sbjct  44    EHRTANAFGWAARDPSGVLSPFKFSRRATREHDVQIKVLYCGICHSDLHAVKNDWGISKY  103

Query  1126  PLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFD  947
             PLVPGHEIVG+V  VGS V++ KVGD VGVG  V SCREC+ C   LE  C +  + T++
Sbjct  104   PLVPGHEIVGVVTRVGSKVRKVKVGDKVGVGCLVGSCRECDQCVNNLENYCPQ-LILTYN  162

Query  946   GIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgk  767
              ID DGT+T GGYS+ +V  E +  + PEN P    APLLCAG T Y+ +  +  ++PG 
Sbjct  163   SIDTDGTITYGGYSNIMVADEHFIIRWPENLPPHVGAPLLCAGTTTYSALRYYGFDKPGL  222

Query  766   slgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALS  587
              +GV+GLGGLGH+AVKF KAFG KVTV STS+ KK+EA+  +GAD FV+S + ++M A +
Sbjct  223   HIGVVGLGGLGHVAVKFAKAFGSKVTVISTSVGKKKEAIETIGADAFVVSHEPEEMQAAT  282

Query  586   KSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGG  410
              S D +I+T     P +  LSLLK  G + +VG P++ ++    S+ +G + + GS+ GG
Sbjct  283   GSLDGIIDTVPAHHPIEPLLSLLKPHGKMVMVGAPTKPLELPVLSIIMGRRTVGGSMIGG  342

Query  409   TKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              K TQE+++F A   + P +++I +  VNEA+ERL K DV+YRFVIDIG +LK
Sbjct  343   LKETQEMIDFAAEHNVLPNVEVISMNDVNEAMERLEKGDVRYRFVIDIGNTLK  395



>dbj|BAJ87302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   336 bits (862),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 241/347 (69%), Gaps = 4/347 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
             LGWAARD SGVLSP++FSRR    DDV++ + YCG+C+ D+   +N  GT+ YP+VPGHE
Sbjct  72    LGWAARDASGVLSPFDFSRRAQMDDDVTIRVLYCGICHTDLYTIKNEWGTAMYPVVPGHE  131

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD--  932
             I+G+V  VGSGV +FK GD VGVG +V SCR CE C  G E  CS G V T +GID +  
Sbjct  132   ILGVVTSVGSGVSKFKAGDTVGVGYFVGSCRSCECCGNGYENYCS-GMVLTSNGIDPEHG  190

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             G VT+GG+S  ++V+E Y  ++P+  PL  AAPLLCAG+TVY+PMMR  +N PGK LGV+
Sbjct  191   GAVTQGGFSDVMLVNEDYVVRVPDGLPLDKAAPLLCAGVTVYSPMMRFGLNAPGKHLGVV  250

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKFGKAFG++VTV STS  K+EEAL  LGAD F++S D +QM A   + D 
Sbjct  251   GLGGLGHVAVKFGKAFGMRVTVISTSPGKREEALERLGADEFLVSRDPEQMQAAVGTMDG  310

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIAGSITGGTKLTQ  395
             +++T S   P     +L+K  G +  VG P++    P  ++  G K IAG+  GG +  Q
Sbjct  311   ILDTVSVWHPISPLFALMKPMGQMVFVGGPTKPLELPAYAIVPGGKGIAGNCVGGIRDCQ  370

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
              +LEF A   I  E+++I + YVN ALERL K DV+YRFVIDI GSL
Sbjct  371   AMLEFAAKHGITAEVEMIKMDYVNTALERLAKNDVRYRFVIDIAGSL  417



>ref|XP_003612978.1| Mannitol dehydrogenase [Medicago truncatula]
 gb|ACJ84617.1| unknown [Medicago truncatula]
 gb|AES95936.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
 gb|AFK47984.1| unknown [Medicago truncatula]
Length=361

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 239/349 (68%), Gaps = 2/349 (1%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             +   GWAARD SGVLSP+NFSRR  G  DV+  + YCG+C++D+   +N  G S YPLVP
Sbjct  11    NKAFGWAARDTSGVLSPFNFSRRETGEKDVAFKVLYCGICHSDLHMIKNEWGMSTYPLVP  70

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEI GIV EVGS V++FK+GD VGVG  V+SCR C+ C E LE  C K    T+     
Sbjct  71    GHEIAGIVTEVGSKVEKFKIGDKVGVGCLVDSCRACQNCEENLENYCPK-QTNTYSAKYS  129

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DG++T GGYS  +V  E +   IP+  PL SAAPLLCAGITVY+P+    +++PG ++G+
Sbjct  130   DGSITYGGYSDSMVADEHFIVHIPDGLPLESAAPLLCAGITVYSPLRYFGLDKPGMNIGI  189

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             +GLGGLGHL VKF KAFG  VTV STS +K++EA+  LGAD+F+IS D+ +M A   + D
Sbjct  190   VGLGGLGHLGVKFAKAFGANVTVISTSPNKEKEAIENLGADSFLISHDQDKMQAAMGTLD  249

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIAGSITGGTKLT  398
              +I+T S D P    + LLK  G L +VG P +    P   L +G K I+GS  GG K T
Sbjct  250   GIIDTVSADHPLLPLVGLLKYHGKLVMVGAPDKPPELPHIPLIMGRKTISGSGIGGMKET  309

Query  397   QELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             QE+++F A   I P+I++IP+ YVN A++RL+K DVKYRFV+DIG +LK
Sbjct  310   QEMIDFAAKHNIKPDIEVIPVDYVNTAMKRLLKADVKYRFVLDIGNTLK  358



>ref|XP_006379103.1| hypothetical protein POPTR_0009s06780g [Populus trichocarpa]
 gb|ERP56900.1| hypothetical protein POPTR_0009s06780g [Populus trichocarpa]
Length=360

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 239/357 (67%), Gaps = 3/357 (1%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S    H T    GWAARD SGVLSP+ FSRR  G  DV   + +CG+C++D+   +N  G
Sbjct  5     SYEEEHPT-KAFGWAARDQSGVLSPFKFSRRSTGEKDVRFKVLFCGICHSDLHMAKNEWG  63

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
             T+ YPLVPGHEIVG V EVGS V++FKVGD VGVG  V SC  C+ CN  LE  C K  +
Sbjct  64    TATYPLVPGHEIVGEVTEVGSKVEKFKVGDKVGVGCLVGSCHSCDSCNNNLENYCPK-MI  122

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
              T+     DGT T GGYS  +V  E +  +IP+N PL +AAPLLCAGITVY+P+   N++
Sbjct  123   LTYSTKYHDGTTTYGGYSDSMVTDEHFVIRIPDNLPLDAAAPLLCAGITVYSPLRFFNLD  182

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             +PG  +GV+GLGGLGH+AVKF KA G+KVTV STS  KK+EAL  LGAD+F++S D+ +M
Sbjct  183   KPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALEHLGADSFLVSRDQDEM  242

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGS  422
              A   + D +I+T S   P    +SLLKT G L LVG P + ++     L +G K + GS
Sbjct  243   QAAVGTMDGVIDTVSAIHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLIMGRKIVGGS  302

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
               GG K TQE+++F A   I  +I++I + YVN A+ERL K DV+YRFVIDIG ++K
Sbjct  303   TIGGMKETQEMIDFAAKNNITADIEVISMDYVNTAMERLSKTDVRYRFVIDIGNTMK  359



>gb|AEA36767.1| cinnamyl alcohol dehydrogenase [Sinopodophyllum hexandrum]
Length=361

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 235/346 (68%), Gaps = 2/346 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
             +GWAARD SGVLSP+NFSRR  G  DV+  + YCG+C++D+   +N  G+S YPLVPGHE
Sbjct  14    IGWAARDTSGVLSPFNFSRRETGEKDVAFKVLYCGICHSDLHMVKNEWGSSTYPLVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG+V EVGS VQ  KVGD VGVG  V SCR C+ C + LE  C K  + T    + DGT
Sbjct  74    IVGVVTEVGSKVQNIKVGDKVGVGCMVGSCRSCDSCADHLENYCPK-MILTHSAKNYDGT  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
             +T GGYS  +V  E +  +IPEN PL  AAPLLCA IT Y+P+    +++PG  +GV+GL
Sbjct  133   ITYGGYSDIMVADEHFIVRIPENLPLDGAAPLLCARITTYSPLRHFGLDKPGMHVGVVGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVKF KA G+KVTV STS  KK EA+  L AD+F++S+D+ +M A   + D +I
Sbjct  193   GGLGHVAVKFAKALGVKVTVISTSPKKKTEAVEHLHADSFLVSTDQNEMQAAMGTMDGII  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             +T S   P    + LLKT G + +VG P + ++     L +G K I GS  GG K TQE+
Sbjct  253   DTVSAVHPLVPLIGLLKTQGKIVMVGAPEKPLELPVFPLIMGRKIIGGSCIGGMKETQEM  312

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             + F A   I  +I++IPI YVN A++RL+K DV+YRFVIDIG +LK
Sbjct  313   INFAAKHNITADIEVIPIDYVNTAMDRLVKADVRYRFVIDIGNTLK  358



>ref|XP_009764994.1| PREDICTED: probable mannitol dehydrogenase [Nicotiana sylvestris]
Length=360

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 237/347 (68%), Gaps = 2/347 (1%)
 Frame = -2

Query  1288  CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGH  1109
               GWAARD SG LS + FSRR  G  DV L + YCG+C++D+   +N  G+S YPLVPGH
Sbjct  13    AFGWAARDTSGFLSSFKFSRRATGDKDVKLKLLYCGICHSDIHQLKNEWGSSLYPLVPGH  72

Query  1108  EIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDG  929
             EIVG V EVG  V++FK GD V VG Y  SCR CE C   LE  CSKG + T++ I  DG
Sbjct  73    EIVGEVTEVGIKVEKFKAGDKVAVGGYCGSCRSCENCTNDLENYCSKG-IATYNAIYHDG  131

Query  928   TVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvig  749
             T T GGYS+ IVV E + + +PEN PLA+AAPLLCAGIT+Y+P+    +++PG  +GV+G
Sbjct  132   TPTYGGYSNMIVVDEHFVFHVPENLPLATAAPLLCAGITMYSPLRYFGLDKPGLHIGVVG  191

Query  748   lgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFL  569
             LGGLGH+ VKF KA GLKVTV STS +K++EAL  L AD+F++S+DE Q+ A   + D +
Sbjct  192   LGGLGHVGVKFAKAMGLKVTVISTSRNKQKEALERLSADSFLVSTDEDQLQAAMGTMDGI  251

Query  568   INTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQE  392
             ++T S D P    + LLK+ G L  +G P + V+     L +G K +AGS  GG   TQE
Sbjct  252   LDTVSADHPIHPLIGLLKSHGKLIFLGAPEKPVELPVFPLLMGRKLVAGSGIGGMTETQE  311

Query  391   LLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +L+F A   I  E+++IP+ YVN ALERL K DVKYRFVID+  +LK
Sbjct  312   MLDFAAKHNITAEVEVIPMDYVNTALERLAKGDVKYRFVIDVAKTLK  358



>ref|XP_003635435.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI18801.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 235/359 (65%), Gaps = 7/359 (2%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S    H T    GWAA DPSGVLSP+ FSRR  G  DV   + YCG+C++D+   +N  G
Sbjct  4     SPEQEHPT-KAFGWAASDPSGVLSPFKFSRRATGEKDVRFKVLYCGICHSDLHMLKNEWG  62

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              S YPLVPGHEIVGIV EVGS V++ KVGD VGVG  V +C  C+ C   LE  C K ++
Sbjct  63    FSTYPLVPGHEIVGIVTEVGSKVEKLKVGDKVGVGCLVGACHSCDNCANDLENYCPK-NI  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
              T+     DGT T GGYS  +V  ERY  + PEN PL + APLLCAGITVY+P+      
Sbjct  122   LTYGATYYDGTTTYGGYSDVMVAEERYVVRFPENLPLDAGAPLLCAGITVYSPLQHFGFT  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             +PG  +GV+GLGGLGH+AVKF KAFG+KVTV STS SKK+EA   LGAD+F++S D  QM
Sbjct  182   KPGMHIGVVGLGGLGHVAVKFAKAFGVKVTVISTSTSKKKEATEHLGADSFLVSRDPDQM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPS---EVKFSPGSLNLGMKCIA  428
              A   + D +I+T S   P    + LLK+ G L +VG P+   E+   P  L +G K +A
Sbjct  242   QAALGTMDGIIDTVSAVHPLLPLIDLLKSHGKLVMVGAPNRPLELPIFP--LLMGRKIVA  299

Query  427   GSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             GS  GG K TQE+++F     I  +++++P+ YVN ALERL K DV+YRFVIDIG +LK
Sbjct  300   GSNIGGMKETQEMIDFAGKHNITADVEVVPMDYVNTALERLEKADVRYRFVIDIGNTLK  358



>ref|XP_009400342.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 239/351 (68%), Gaps = 2/351 (1%)
 Frame = -2

Query  1312  ASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTS  1133
              + + T    GWAA+D SG ++P+ F RR  G DDV++ I YCG+C+ D+ + +N  G +
Sbjct  4     TTPNHTQTVFGWAAKDSSGKITPFVFKRRKNGVDDVTIKILYCGMCHTDLHYIKNDWGIT  63

Query  1132  KYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFT  953
              YP+VPGHEI GI+  VGS V  FKVGD VGVG    SC +CE+C +  E  C +   FT
Sbjct  64    MYPVVPGHEITGIITMVGSNVSNFKVGDRVGVGCLAASCLKCEFCKDSQENYCDQLQ-FT  122

Query  952   FDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQP  773
             ++GI  DG++T GGYS  +V   RY   IP++ PL  AAPLLCAGITV++PM +HNM QP
Sbjct  123   YNGIFWDGSITYGGYSQMLVADNRYVVHIPDSLPLDKAAPLLCAGITVFSPMKQHNMLQP  182

Query  772   gkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMA  593
             GK LGV+GLGGLGH+AVKFGKAFGL VTV STS SK+ EA   LGAD+F++S+D KQM A
Sbjct  183   GKKLGVVGLGGLGHIAVKFGKAFGLHVTVISTSPSKETEAKMRLGADDFLVSTDPKQMQA  242

Query  592   LSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIAGSIT  416
              ++S DF+I+T S +      L LLK  GTLALVG P +    P   L  G + ++GSI 
Sbjct  243   CARSLDFIIDTVSANHSLGPILELLKIRGTLALVGAPDKPMELPSFPLIFGKRTVSGSII  302

Query  415   GGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIG  263
             GG K TQE+++ C    I  EI+++   ++NEAL+RL + DV+YRFVIDI 
Sbjct  303   GGMKETQEMMDVCGKYNITSEIELVTPDHINEALDRLARNDVRYRFVIDIA  353



>ref|XP_008236502.1| PREDICTED: probable mannitol dehydrogenase [Prunus mume]
Length=360

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
             +GWAARD SGVLSP+ FSRR  G  DV+  + YCG+C+ D+   +N  G+SKYPLVPGHE
Sbjct  14    IGWAARDSSGVLSPFKFSRRATGEKDVTFKVLYCGICHTDLHTAKNDWGSSKYPLVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG+V EVGS VQ+FKVGD VGVG  V SC  C+ C+  LE  C K  + T+ G   DGT
Sbjct  74    IVGVVTEVGSKVQKFKVGDKVGVGCMVGSCGSCDNCSHNLENYCPK-YILTYGGKYHDGT  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
             +T GGYS ++V  E +  +IP+N PL  AAPLLCAGIT Y+P+  + +++PG  +GV+GL
Sbjct  133   ITYGGYSDFMVTEEGFVIRIPDNIPLDGAAPLLCAGITTYSPLRHYGLDKPGMHVGVVGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVKF KA G +VTV STS +KK+EA+  L AD F++S ++ QM A   + D +I
Sbjct  193   GGLGHVAVKFAKALGARVTVISTSPNKKDEAIKSLKADAFLVSREQDQMKAAMGTMDGII  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPS---EVKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +T S   P    + LLK  G L +VG P    E+  +P  L LG K IAGS  GG K TQ
Sbjct  253   DTVSAVHPLLPLIGLLKCDGKLVMVGLPEKPFELPITP--LVLGRKIIAGSCIGGIKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A   I  +I++IPI Y+N A ERL+K DV+YRFVID+  +LK
Sbjct  311   EMIDFAAEHNITSDIEVIPIDYLNTATERLLKADVRYRFVIDVANTLK  358



>ref|XP_010244709.1| PREDICTED: probable mannitol dehydrogenase [Nelumbo nucifera]
Length=360

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 240/345 (70%), Gaps = 2/345 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
             +GWAARD SGVLSP+ FSRR  G +DV+  + YCG+C++D+   +N  G + YP+VPGHE
Sbjct  14    IGWAARDSSGVLSPFKFSRRETGDEDVAFKVLYCGICHSDLHSVKNDWGNAIYPMVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG+V EVG  V +FKVGD VGVG  V +C  C+ C   LE  C K  + T++ I  DGT
Sbjct  74    IVGVVTEVGRNVDKFKVGDKVGVGCMVGACHSCDSCKNDLENYCPK-MILTYNSIYYDGT  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
             +T GGYS  +V ++RY  + P+N PL + APLLCAGITVY+PM    + +PG  LGV+GL
Sbjct  133   MTYGGYSDMMVANQRYVIRFPDNLPLDAGAPLLCAGITVYSPMKYFGLCEPGMHLGVLGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVKF KAFG+KVTV S+S +K++EA+  LGAD F++S +++QM A + + D +I
Sbjct  193   GGLGHVAVKFAKAFGIKVTVISSSPNKEKEAIERLGADAFLVSRNQEQMQAAAGTMDGII  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             +T S       YLSLLK+ G L +VG P + V+ +   L +G K +AGS  GG K TQE+
Sbjct  253   DTVSAVHSLMPYLSLLKSHGKLVMVGLPEKPVEIAVFPLVMGRKILAGSCIGGMKETQEM  312

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             ++F     I  +I++IPI YVN A+ERL K DVKYRFVID+  SL
Sbjct  313   IDFAGKHNITADIEVIPIDYVNTAMERLAKADVKYRFVIDVAKSL  357



>sp|Q9ZRF1.1|MTDH_FRAAN RecName: Full=Probable mannitol dehydrogenase; AltName: Full=NAD-dependent 
mannitol dehydrogenase [Fragaria x ananassa]
 gb|AAD10327.1| cinnamyl alcohol dehydrogenase [Fragaria x ananassa]
Length=359

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 235/345 (68%), Gaps = 2/345 (1%)
 Frame = -2

Query  1282  GWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEI  1103
             GWAARD SGVLSP+NF RR  G  DV+  + YCG+C++D+   +N  G S YPLVPGHEI
Sbjct  13    GWAARDSSGVLSPFNFYRRETGEKDVTFKVLYCGICHSDLHMVKNEWGFSTYPLVPGHEI  72

Query  1102  VGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTV  923
             VG V EVGS VQ+FKVGD VGVG  V SCR CE C + LE  C K  + T+     DG+ 
Sbjct  73    VGEVTEVGSKVQKFKVGDRVGVGCIVGSCRSCENCTDHLENYCPK-QILTYGAKYYDGST  131

Query  922   TKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglg  743
             T GGYS  +V  E +  +IP+N PL  AAPLLCAGIT Y+P+    +++PG  +GV+GLG
Sbjct  132   TYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGLDKPGMHVGVVGLG  191

Query  742   glghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLIN  563
             GLGH+AVKF KA G+KVTV STS  K+EEAL  LGAD+F++S D+ QM A   + D +I+
Sbjct  192   GLGHVAVKFAKAMGVKVTVISTSPKKEEEALKHLGADSFLVSRDQDQMQAAIGTMDGIID  251

Query  562   TASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQELL  386
             T S   P    + LL + G L +VG P + ++     L +G K +AGS  GG K TQE++
Sbjct  252   TVSAQHPLLPLIGLLNSHGKLVMVGAPEKPLELPVFPLLMGRKMVAGSGIGGMKETQEMI  311

Query  385   EFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +F A   I  +I++IPI Y+N A+ERL+K DV+YRFVIDIG +LK
Sbjct  312   DFAARHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLK  356



>gb|AFK34702.1| unknown [Medicago truncatula]
Length=362

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 240/348 (69%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARDPSGVLSP+NFSRR  G  DV+  + YCG+C++D+   +N  GTS YPLVPG
Sbjct  13    KAFGWAARDPSGVLSPFNFSRRETGEKDVAFKVLYCGICHSDLHMAKNEWGTSFYPLVPG  72

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HE+ GIV EVGS V++FKVGD VGVG  ++SCR C+ CN+ LE  C K  V T      D
Sbjct  73    HELAGIVTEVGSKVEKFKVGDKVGVGYLIDSCRSCQDCNDNLENYCPK-FVVTCGAKYRD  131

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GTVT GGYS  +V  E +  +IP+N PL  A PLLCAG+TVY+P+    +++PG  +GV+
Sbjct  132   GTVTYGGYSDSMVADEHFVIRIPDNIPLEFAGPLLCAGVTVYSPLRFFGLDKPGLHIGVV  191

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KAFG  VTV STS +K++EA+  LGAD+F+ISSD KQ+     + D 
Sbjct  192   GLGGLGHMAVKFAKAFGANVTVISTSPNKEKEAIEHLGADSFLISSDPKQIQGAIGTLDG  251

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    + LLK+ G L ++G   + ++    +L  G K +AGS  GG K TQ
Sbjct  252   IIDTVSAVHPLLPMIGLLKSHGKLIMLGVIVQPLQLPEYTLIQGRKILAGSQVGGLKETQ  311

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E++ F A   + P+I+++PI YVN A++RL+K DVKYRFVIDIG +LK
Sbjct  312   EMINFAAEHNVKPDIEVVPIDYVNTAMQRLVKGDVKYRFVIDIGNTLK  359



>ref|XP_002313297.2| hypothetical protein POPTR_0009s06740g [Populus trichocarpa]
 gb|EEE87252.2| hypothetical protein POPTR_0009s06740g [Populus trichocarpa]
Length=360

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 239/357 (67%), Gaps = 3/357 (1%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S    H T    GWAARD SGVLSP+ FSRR  G +DV   + +CG+C++D+   +N  G
Sbjct  5     SYEEEHPT-KAFGWAARDQSGVLSPFKFSRRSTGENDVRFKVLFCGICHSDLHMAKNEWG  63

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
             TS YPLVPGHEIVG V EVGS V++FKVGD VGVG  V SC  C  CN  LE  C K  +
Sbjct  64    TSTYPLVPGHEIVGEVTEVGSKVEKFKVGDKVGVGCMVGSCHSCGSCNNDLENYCPK-MI  122

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
              T+     DGT T GGYS  +V  E +  +IP+N PL +AAPLLCAGITVY+P+   N++
Sbjct  123   LTYSTKYHDGTTTYGGYSDSMVTDEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRFFNLD  182

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             +PG  +GV+GLGGLGH+AVKF KA G+KVTV STS  KK+EAL  LGAD+F++S D+ +M
Sbjct  183   KPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALEHLGADSFLVSRDQDEM  242

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGS  422
              A   + D +I+T S   P    +SLLKT G L LVG P + ++     L +G K + GS
Sbjct  243   QAAMGTMDGVIDTVSAMHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLIMGRKIVGGS  302

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
               GG K TQE+++F A   I  +I++I + YVN A+ERL K DV+YRFVIDIG ++K
Sbjct  303   CIGGMKETQEMIDFAAKNNITADIEVISMDYVNTAMERLSKTDVRYRFVIDIGNTMK  359



>ref|XP_002279832.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI37637.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/345 (52%), Positives = 243/345 (70%), Gaps = 2/345 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAARDPSG LSP++FSRR  G +DV++ I YCGVC++D+   +N  G ++YP+VPGHE
Sbjct  14    FGWAARDPSGTLSPFHFSRRENGDEDVTVKILYCGVCHSDLHSVKNEWGITRYPIVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVGIV ++G+ V++FK+GD VGVG  V SC+ CE C + LE  C    +FT++    DGT
Sbjct  74    IVGIVIQLGNNVKKFKMGDRVGVGVLVGSCKTCETCQQDLENYCPS-MIFTYNSTSQDGT  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
              T GGYS  +VV +RY  +IP+N PL + APLLCAGITVY+PM  + M +PGK LGV GL
Sbjct  133   RTYGGYSDIVVVDQRYVLRIPDNMPLDAGAPLLCAGITVYSPMKYYGMTEPGKHLGVAGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVK GKAFGLKVTV STS +K++EA+N LGAD F++S++ +++ A   + D++I
Sbjct  193   GGLGHVAVKLGKAFGLKVTVISTSPNKEDEAINKLGADCFLVSTNPEKVQAALGTMDYII  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             +T S        L++LK  G L  VG P + ++     L +G K I GS  GG K TQE+
Sbjct  253   DTVSAIHSLGPLLAMLKLNGKLITVGLPDKPLELPIFPLVMGRKLIGGSDIGGIKETQEM  312

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             L+FCA   I  +I++I + Y+N A++RL K DVKYRFVID+  SL
Sbjct  313   LDFCAKHNITADIELIQMDYINTAMKRLSKSDVKYRFVIDVANSL  357



>gb|KCW76091.1| hypothetical protein EUGRSUZ_D00471 [Eucalyptus grandis]
Length=245

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/245 (73%), Positives = 203/245 (83%), Gaps = 1/245 (0%)
 Frame = -2

Query  982  VQCSKGSVFTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYT  803
            + C KG V T  G   DG+  KGGYS +IVVHERYCYKIP+ YPLA AAPLLCAGITVYT
Sbjct  1    MHCLKGGVPTIGGTYADGSTCKGGYSQFIVVHERYCYKIPDKYPLAQAAPLLCAGITVYT  60

Query  802  PMMRHNMNQPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFV  623
            PM+RHNMNQPGKSLGVIGLGGLGHL VKFGKAFGL VTVFSTS SKK++ALNLL ADNFV
Sbjct  61   PMIRHNMNQPGKSLGVIGLGGLGHLTVKFGKAFGLNVTVFSTSASKKDDALNLLKADNFV  120

Query  622  ISSDEKQMMALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFP-SEVKFSPGSLNL  446
            +SSD++QM ALSKS DF+++TASGD P DLY+SLL+  G LALVGFP  E+K SP SL +
Sbjct  121  LSSDKEQMSALSKSLDFIVDTASGDHPLDLYMSLLRAGGVLALVGFPGEELKLSPLSLLM  180

Query  445  GMKCIAGSITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDI  266
             M+ I+GS  GGTK TQE+LEFCA  +I+PEI++IPIQY NEALERL K DVKYRFVIDI
Sbjct  181  DMRSISGSTVGGTKRTQEMLEFCAEHEIHPEIEVIPIQYSNEALERLQKNDVKYRFVIDI  240

Query  265  GGSLK  251
              SL+
Sbjct  241  ENSLE  245



>ref|XP_002989906.1| hypothetical protein SELMODRAFT_428454 [Selaginella moellendorffii]
 gb|EFJ08919.1| hypothetical protein SELMODRAFT_428454 [Selaginella moellendorffii]
Length=352

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 240/348 (69%), Gaps = 3/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
              C GWAA+D SGVL+P+ F RR     DV   I +CG+C+ D+    N  G+SKYP+VPG
Sbjct  6     ECGGWAAKDASGVLAPFKFPRRAPRPTDVKFKITHCGICHTDLHLIHNEWGSSKYPMVPG  65

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HE+VG+V E+G G ++FKVGD VGVG  V SC +C++C  G E  C K  V+T++  + D
Sbjct  66    HEVVGLVTELGPGAKKFKVGDHVGVGCMVFSCLKCDHCKHGDEQYCDK-LVWTYNS-EED  123

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             G +T GGYS ++V  E++  ++P+N PL +AAPLLCAGITVY+PM    M Q GK+ GV+
Sbjct  124   GKITMGGYSGFLVADEKFVVRVPDNLPLDAAAPLLCAGITVYSPMKHFGMTQAGKNFGVV  183

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKFGKAFG+KVTV STS SK++EA  +LGA NF++S D  QM   +K+ D+
Sbjct  184   GLGGLGHMAVKFGKAFGMKVTVISTSPSKEKEAREVLGAHNFIVSKDSAQMKKAAKTMDY  243

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +++T S   P D  L LLK  G L +VG P + ++   G +  G + +AGS  G  + TQ
Sbjct  244   ILDTVSAPHPLDALLELLKIDGKLVMVGLPDKPLELPAGVIIFGRRSLAGSFIGSIRETQ  303

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             ++L+FC    +   I+++P+ YVN+A+ERL K DVKYRFV+D+  +LK
Sbjct  304   DMLDFCGKNNVTSMIELVPMDYVNKAMERLRKSDVKYRFVLDVEKTLK  351



>ref|XP_008236460.1| PREDICTED: probable mannitol dehydrogenase [Prunus mume]
Length=360

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 240/347 (69%), Gaps = 2/347 (1%)
 Frame = -2

Query  1288  CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGH  1109
               GWAARD SGVLSP+NFSRR  G  DV+  + YCG+C+ D+   +N  G+S YPLVPGH
Sbjct  13    AFGWAARDSSGVLSPFNFSRRETGEKDVTFKVLYCGICHTDLHMVKNDWGSSTYPLVPGH  72

Query  1108  EIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDG  929
             EIVG+V EVGS V++FKVGD VGVG  V SC+ C+ C   LE  C K  + T+   + DG
Sbjct  73    EIVGVVTEVGSKVEKFKVGDKVGVGCVVGSCQSCDNCANNLENYCPK-YILTYGAKNHDG  131

Query  928   TVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvig  749
             T+T GGYS ++V  E +  ++P+N PL  AAPLLCAGIT Y+ +  + +++PG  +GV+G
Sbjct  132   TITYGGYSDFMVADEHFVIRVPDNLPLDGAAPLLCAGITTYSALRYYGLDKPGMHVGVVG  191

Query  748   lgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFL  569
             LGGLGH+AVKF KA G++VTV STS++KKEEA+  L AD+F++S D+ QM A   + D +
Sbjct  192   LGGLGHVAVKFAKALGVRVTVISTSLNKKEEAIEHLRADSFLVSLDQDQMQAAVGTMDGI  251

Query  568   INTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQE  392
             I+T S   P    ++LLK  G L +VG P + ++     L +G K +AGS  GG K TQE
Sbjct  252   IDTVSAVHPLLPSIALLKPNGKLVMVGAPEKPLELPVFPLLMGRKMVAGSNIGGMKETQE  311

Query  391   LLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +++F A   I  ++++IPI Y+N A+ERL K DV+YRFVID+G +LK
Sbjct  312   MIDFAAKHNITAQVEVIPIDYLNTAMERLAKTDVRYRFVIDVGNTLK  358



>ref|XP_004512560.1| PREDICTED: probable mannitol dehydrogenase-like [Cicer arietinum]
Length=361

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 240/348 (69%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARD SGVLSP+ FSRR  G  DV+  + YCG+C++D+   +N  G+S YP+VPG
Sbjct  12    KAFGWAARDSSGVLSPFKFSRRETGEKDVTFKVLYCGICHSDLHMLKNEWGSSIYPIVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEI G V EVGS V++FKVGD VGVG  V SC  C+ C++ LE  CSK  + T+   +VD
Sbjct  72    HEIAGEVTEVGSKVKKFKVGDKVGVGCLVGSCDSCQSCSDDLENYCSK-MILTYSAKNVD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GTVT GGYS  +V  E +   IP+  PL  AAPLLCAGITVY+P+    +++PG +LGV+
Sbjct  131   GTVTYGGYSDTMVADEHFVILIPDGLPLDVAAPLLCAGITVYSPLKYFGLDKPGLNLGVV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KAFG  VTV STS +KK+EA+  LGAD+FV+S ++ QM A+  SFD 
Sbjct  191   GLGGLGHMAVKFAKAFGANVTVISTSPNKKKEAIEHLGADSFVVSREQDQMQAVMGSFDG  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    + LLK  G L +VG P + ++     L  G K I GS  GG K TQ
Sbjct  251   IIDTVSAMHPLLPLIGLLKNHGKLVMVGAPEKPLELPVFPLIGGRKIIGGSCIGGLKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A   + P+I+++P+ Y+N A+ERL+K DVKYRFVIDIG +LK
Sbjct  311   EMIDFAAKHDVKPDIEVVPVDYINTAMERLLKGDVKYRFVIDIGNTLK  358



>gb|AAK28509.1| cinnamyl alcohol dehydrogenase [Fragaria x ananassa]
Length=359

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 183/345 (53%), Positives = 233/345 (68%), Gaps = 2/345 (1%)
 Frame = -2

Query  1282  GWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHEI  1103
             GWAARD SGVLSP+NFSRR  G  DV   + YCG+C++D    +N  G S YPLVPGHEI
Sbjct  13    GWAARDSSGVLSPFNFSRRETGEKDVMFKVLYCGICHSDHHMVKNEWGFSTYPLVPGHEI  72

Query  1102  VGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGTV  923
             VG V EVGS VQ+FKVGD VGVG  V SCR CE C + LE  C K  + T+     DGT 
Sbjct  73    VGEVTEVGSKVQKFKVGDRVGVGCIVGSCRSCENCTDHLENYCPK-QILTYGANYYDGTT  131

Query  922   TKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgviglg  743
             T GG S  +V HE +  +IP+N PL  AAPLLCAGIT Y+P+    +++PG  +GV+GLG
Sbjct  132   TYGGCSDIMVAHEHFVVRIPDNLPLDGAAPLLCAGITTYSPLRYFGLDKPGMHVGVVGLG  191

Query  742   glghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLIN  563
             GLGH+AVKF KA G+KVTV STS  K+EEAL  LGAD+F++S D+  M A   + D +I+
Sbjct  192   GLGHVAVKFAKAMGVKVTVISTSPKKEEEALKHLGADSFLVSRDQDHMQAAIGTMDGIID  251

Query  562   TASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQELL  386
             T S   P    + LLK+ G L +VG P + ++     L +G K +AGS  GG   TQE++
Sbjct  252   TVSAQHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLMGRKMVAGSGIGGMMETQEMI  311

Query  385   EFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             +F A   I  +I++IPI Y+N A+ERL+K DV+YRFVIDIG +LK
Sbjct  312   DFAAKHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLK  356



>gb|AGU43751.1| cinnamyl alcohol dehydrogenase 9 [Populus tomentosa]
Length=362

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 242/347 (70%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAA+D SGVLSP++F+RR  G +DV++ I YCGVC++D+   +N  G S+YPLVPG
Sbjct  12    KAFGWAAKDSSGVLSPFHFTRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPLVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVGIV ++GS V++FKV D VGVG  VNSC+ CEYC++  E  C K  +FT++  + D
Sbjct  72    HEIVGIVTKIGSNVKKFKVDDQVGVGVMVNSCKSCEYCDQDSENYCPK-MIFTYNAQNYD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T GGYS  IVV   +  +IP++ P   AAPLLCAGITVY+PM  + M +PGK LG++
Sbjct  131   GTKTYGGYSDTIVVDHHFVLRIPDSMPADGAAPLLCAGITVYSPMKYYGMTEPGKHLGIV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVK GKAFGLKVTV S+S  K+ EAL+ LGAD+F++SSD ++M A   + D+
Sbjct  191   GLGGLGHVAVKIGKAFGLKVTVISSSSRKEREALDRLGADSFLVSSDPEKMKAAFGTMDY  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S        LSLLKT G L  +G P + ++     L LG K + GS  GG K TQ
Sbjct  251   IIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGMKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+L+FCA   I  ++++I +  +N A+ERL K DV+YRFV D+  SL
Sbjct  311   EMLDFCAKHNITSDVEVIRMDQINTAMERLAKSDVRYRFVTDVANSL  357



>ref|XP_008440516.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Cucumis melo]
Length=361

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 241/346 (70%), Gaps = 2/346 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAA D SG+LSP++FSRR  G +DV+  + YCG+C++D+   +N  G + YP+VPGHE
Sbjct  14    FGWAASDTSGILSPFHFSRRETGENDVAFKVLYCGICHSDLHMVKNEWGNTIYPIVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG V EVGS V+ FKVGD VGVG  V SCR C+ C+  LE  C K  + T+   D DG+
Sbjct  74    IVGEVTEVGSKVKNFKVGDKVGVGCMVGSCRSCDNCSNDLENYCPK-MILTYSSKDSDGS  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
             +T GGYS  +V +E +  +IP++ PL + APLLCAGITVY+P+    +++PG  +GV+GL
Sbjct  133   ITYGGYSDCMVANEHFIVRIPDSIPLQAGAPLLCAGITVYSPLRYFGLDKPGMKIGVVGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVKF KAFG KVTV STS +KK+EA   LGAD+F++S D++QM A   + D +I
Sbjct  193   GGLGHVAVKFAKAFGAKVTVISTSPNKKQEATERLGADSFLVSRDQEQMQAARGTLDGII  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIAGSITGGTKLTQEL  389
             +T S   P    LSL+KT G L LVG P +    P  +L  G K +AGS  GG K TQE+
Sbjct  253   DTVSATHPLLPLLSLVKTHGKLVLVGAPEKPLEIPAFALIGGRKTMAGSCIGGMKETQEM  312

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             ++F A   I  +I++IP+  VN+A+ER++K+DVKYRFVIDI  SLK
Sbjct  313   IDFAAKHNITADIELIPMDDVNKAMERMLKQDVKYRFVIDIANSLK  358



>gb|EYU23717.1| hypothetical protein MIMGU_mgv1a008843mg [Erythranthe guttata]
Length=360

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 239/348 (69%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARD SG LSP++FSRR  G +DV   + YCG+C++D+   +N  G + YP+VPG
Sbjct  12    KAFGWAARDKSGHLSPFHFSRRATGEEDVQFKVLYCGICHSDLHHIKNEWGFAMYPMVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG V E+GS V+ FKVGD VGVG  VNSCR C+ C   LE  C K  + T+  I+ D
Sbjct  72    HEIVGEVTEIGSKVRNFKVGDKVGVGCIVNSCRSCDNCENDLENYCPK-LIPTYSSINQD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT+T+GGYS  +V +E +   IP++ PL +AAPLLCAGIT Y+P+    +++PG  +GV+
Sbjct  131   GTLTQGGYSDIMVSNEHFVVHIPDSLPLDAAAPLLCAGITTYSPLKYFGLDKPGMHIGVV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KAFG+KVTV STS+ KK+EAL  LGAD+F+IS DE+QM A   + D 
Sbjct  191   GLGGLGHVAVKFAKAFGVKVTVISTSLGKKDEALGHLGADSFLISKDEEQMQAAMGTMDG  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    + LLK+ G L ++G P   ++     L  G K IAGS  GG K TQ
Sbjct  251   IIDTVSAFHPLLPLIGLLKSHGKLIMLGAPDRPLELPVFPLLAGRKIIAGSGIGGMKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+L+F A   I  +I++IP+ Y+N A+ RL K DVKYRFVIDIG +LK
Sbjct  311   EMLDFAAKHNITADIEVIPVDYLNTAIARLEKADVKYRFVIDIGNTLK  358



>gb|AAM95578.1| putative sinapyl alcohol dehydrogenase [Populus tremula x Populus 
tremuloides]
Length=362

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 242/347 (70%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GW A+D SGVLSP++FSRR  G +DV++ I YCGVC++D+   +N  G S+YPLVPG
Sbjct  12    KAFGWTAKDSSGVLSPFHFSRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPLVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVGIV ++GS V++FKV D VGVG  VNSC+ CEYC++  E  C K  +FT++  + D
Sbjct  72    HEIVGIVTKIGSNVKKFKVDDQVGVGVMVNSCKSCEYCDQDSENYCPK-MIFTYNAQNYD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T GGYS  IVV + +   IP++ P   AAPLLCAGITVY+PM  + M +PGK LG++
Sbjct  131   GTKTYGGYSDTIVVDQHFVLHIPDSMPADGAAPLLCAGITVYSPMKYYGMTEPGKHLGIV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVK GKAFGLKVTV S+S  K+ EAL+ LGAD+F++SSD ++M A   + D+
Sbjct  191   GLGGLGHVAVKIGKAFGLKVTVISSSSRKEREALDRLGADSFLVSSDPEKMKAAFGTMDY  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S        LSLLKT G L  +G P + ++     L LG K + GS  GG K TQ
Sbjct  251   IIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGMKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E+L+FCA   I  ++++I +  +N A++RL K DV+YRFVID+  SL
Sbjct  311   EMLDFCAKHNIIADVEVIRMDQINTAMDRLAKSDVRYRFVIDVANSL  357



>sp|Q40976.1|CADH_PINRA RecName: Full=Probable cinnamyl alcohol dehydrogenase; Short=CAD 
[Pinus radiata]
 gb|AAB38774.1| cinnamyl alcohol dehydrogenase [Pinus radiata]
Length=357

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 246/354 (69%), Gaps = 2/354 (1%)
 Frame = -2

Query  1315  MASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGT  1136
             M S  +     G+AARD SG LSPY ++ R  G +DV + + YCG+C++D++  RN  G 
Sbjct  1     MGSLETEKTVTGYAARDSSGHLSPYTYNLRKKGPEDVIVKVIYCGICHSDLVQMRNEMGM  60

Query  1135  SKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVF  956
             S YP+VPGHE+VGIV E+GS V++FKVG+ VGVG  V SCR C  CN+ +E  CSK  ++
Sbjct  61    SHYPMVPGHEVVGIVTEIGSEVKKFKVGEHVGVGCIVGSCRSCGNCNQSMEQYCSK-RIW  119

Query  955   TFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQ  776
             T++ ++ DGT T+GG++S +VV + +  +IPEN PL  AAPLLCAG+TV++PM    M +
Sbjct  120   TYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVFSPMKHFAMTE  179

Query  775   PgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMM  596
             PGK  G++GLGG+GH+ VK  KAFGL VTV S+S  KKEEA+ +LGAD +++S D ++MM
Sbjct  180   PGKKCGILGLGGVGHMGVKIAKAFGLHVTVISSSDKKKEEAMEVLGADAYLVSKDTEKMM  239

Query  595   ALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVG-FPSEVKFSPGSLNLGMKCIAGSI  419
               ++S D++++T     P + YL+LLKT G L ++G  P  + F    L LG + IAGS 
Sbjct  240   EAAESLDYIMDTIPVAHPLEPYLALLKTNGKLVMLGVVPEPLHFVTPLLILGRRSIAGSF  299

Query  418   TGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGS  257
              G  + TQE L+FCA +K+   I+++ + Y+N A+ERL K DV+YRFV+D+ GS
Sbjct  300   IGSMEETQETLDFCAEKKVSSMIEVVGLDYINTAMERLEKNDVRYRFVVDVAGS  353



>ref|XP_003612977.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95935.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=361

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 242/351 (69%), Gaps = 6/351 (2%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             +   GWAARD SGVLSP+NFSRR  G  DV+  I YCG+C++DV   +N  G S YPLVP
Sbjct  11    NKAFGWAARDTSGVLSPFNFSRRETGEKDVAFKILYCGICHSDVHMAKNEWGISTYPLVP  70

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEIVGIV +VGS V++F VGD VGVG  V+SCR C+ C + LE  C   + FT      
Sbjct  71    GHEIVGIVTKVGSKVEKFNVGDKVGVGYMVDSCRSCQNCVDNLENYCPTFT-FTCGAKYR  129

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             DGT T GGYS  +V  E +   IP+  PL +AAPLLCAGITVY+P+  + +++PG  +GV
Sbjct  130   DGTSTYGGYSDSLVADENFVVHIPDGLPLEAAAPLLCAGITVYSPLRYYGLDKPGLRIGV  189

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
             +GLGGLGH+AVKF KAFG  VTV STS +K++EA+  LGAD+F+IS D+++M +   + D
Sbjct  190   VGLGGLGHMAVKFAKAFGAIVTVISTSPNKEKEAIEHLGADSFLISRDQEKMQSALGTLD  249

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPS---EVKFSPGSLNLGMKCIAGSITGGTK  404
              +I+T S + P    + LLK+ G L +VG P    E+   P  L LG K +AGS  GG K
Sbjct  250   GIIDTVSANHPILPLIGLLKSHGKLVMVGVPDKPLEIPVFP--LILGRKLVAGSNIGGIK  307

Query  403   LTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              TQE+L+F A   + P+I+++P+ YVN A+ERL+K DVKYRFV+DIG +LK
Sbjct  308   ETQEMLDFAAKHSVKPDIEVVPVDYVNTAIERLLKADVKYRFVLDIGNTLK  358



>ref|XP_010095885.1| putative mannitol dehydrogenase [Morus notabilis]
 gb|EXB62435.1| putative mannitol dehydrogenase [Morus notabilis]
Length=364

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 179/352 (51%), Positives = 238/352 (68%), Gaps = 2/352 (1%)
 Frame = -2

Query  1285  LGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGHE  1106
              GWAARD SG+LSP++FSRR  G  DV+  + YCG+C++D+   +N  G S YPLVPGHE
Sbjct  14    FGWAARDTSGLLSPFHFSRRETGEKDVTFKVLYCGICHSDLHMVKNEWGNSTYPLVPGHE  73

Query  1105  IVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDGT  926
             IVG+V EVGS VQ+FKVGD VGVG  V +CR CE C   LE  C K  + T+     DGT
Sbjct  74    IVGVVTEVGSKVQKFKVGDKVGVGCMVGACRSCESCANDLENYCPK-MILTYSATYYDGT  132

Query  925   VTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvigl  746
              T GGYS  +V  E +  +IP+N PL + APLLCAGITVY+P+    +++PG  +G++GL
Sbjct  133   TTYGGYSDVMVADEHFIVRIPDNLPLDAGAPLLCAGITVYSPLKYFGLDKPGLHVGIVGL  192

Query  745   gglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFLI  566
             GGLGH+AVKF KA G+KVTV STS +KK+EA+  LGAD+F++S D+ +M A   + D +I
Sbjct  193   GGLGHVAVKFAKAMGVKVTVISTSPNKKKEAIEHLGADSFLVSRDQDEMKAAMGTMDGII  252

Query  565   NTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQEL  389
             +T S   P    + LLK  G L +VG P + ++     L +G K + GS  GG K TQE+
Sbjct  253   DTVSAVHPLLPLIGLLKPHGKLVMVGAPEKPLELPVFPLLMGRKIVGGSCNGGMKETQEM  312

Query  388   LEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK*GGCSS  233
             ++F A   I  E+++IP+ YVN A+ERL+K DV+YRFVIDI  +LK    SS
Sbjct  313   IDFAAKHNIRAEVEVIPMDYVNTAMERLLKADVRYRFVIDIANTLKPSTASS  364



>ref|XP_002534367.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF28018.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=362

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 235/350 (67%), Gaps = 2/350 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARD SGVLSP+ FSRR  G  DVS  + YCG+C++D+   +N  GTS YPLVPG
Sbjct  13    KAFGWAARDQSGVLSPFTFSRRETGEKDVSFKVLYCGMCHSDLHMVKNEWGTSTYPLVPG  72

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V EVGS V++ KVGD VGVG  V SCR C  CN+ LE  C K  + T+     D
Sbjct  73    HEIVGVVTEVGSKVEKIKVGDKVGVGCMVGSCRSCNNCNKDLENYCPK-MILTYGAKYYD  131

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T GGYS  +V  E +  +IP+N PL + APLLCAGITVY+P+  + +++PG  LGV+
Sbjct  132   GTTTYGGYSDIMVSDEHFVVRIPDNLPLDATAPLLCAGITVYSPLKYYGLDKPGMQLGVV  191

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KA G KVTV STS +KK+EA+  LGAD+F++S D+ QM     + D 
Sbjct  192   GLGGLGHMAVKFAKAMGAKVTVISTSPNKKQEAIERLGADSFLVSRDQDQMKGAIGTMDG  251

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSEVKFSPG-SLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    + LLK+ G L LVG P +    P   L  G K + GS  GG K TQ
Sbjct  252   IIDTVSAMHPLSPLIGLLKSDGKLVLVGAPEKPLELPAFPLIGGRKLVGGSCIGGMKETQ  311

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK*G  245
             E+++F A   I  +I++IP  YVN A+ER++K DV+YRFVIDIG +LK G
Sbjct  312   EMIDFAAKHSITADIEVIPANYVNTAMERMLKADVRYRFVIDIGNTLKPG  361



>ref|XP_007156456.1| hypothetical protein PHAVU_003G287500g [Phaseolus vulgaris]
 gb|ESW28450.1| hypothetical protein PHAVU_003G287500g [Phaseolus vulgaris]
Length=357

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 243/347 (70%), Gaps = 2/347 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
               +GWAARD SGVLSP+NF+RR  G  DV++ + +CGVC++D+   ++  G S YPLVPG
Sbjct  12    KAIGWAARDTSGVLSPFNFTRRETGDKDVAIKVLFCGVCHSDLHNAKSDWGQSFYPLVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEI G V EVGS V +FKVG+ VGVG  V SCR C+ C E LE  C +G V T+   D+D
Sbjct  72    HEIAGEVIEVGSKVGKFKVGEKVGVGCMVQSCRSCKSCGENLENYC-QGMVLTYGSKDID  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             G++T+GGYS  +VV E +   IP+  PL +AAPLLCAGITVY+P++   + +P   +GV+
Sbjct  131   GSITQGGYSDMVVVDEHFVISIPDGLPLEAAAPLLCAGITVYSPLLYFGLAKPDLHVGVV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGG+GH+AVKF K+FG KVTV STS +K++EA+  LGAD+FV+S ++ QM A   + D 
Sbjct  191   GLGGVGHMAVKFAKSFGAKVTVISTSPNKRKEAIEHLGADSFVVSREQDQMQAAKGTLDG  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    L LLKT G L +VG P + ++ S   L +  K +AGS  GG K TQ
Sbjct  251   IIDTVSAVHPLLPLLELLKTHGKLVIVGLPDKPLELSAFPLVVARKMVAGSCIGGIKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             E++ F A   + P+I++IPI Y+N+A+ERL+K DVKYRFVIDIG +L
Sbjct  311   EMINFAAKHDVKPDIEVIPIDYLNKAMERLVKADVKYRFVIDIGNTL  357



>ref|XP_003635434.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CAN79856.1| hypothetical protein VITISV_014752 [Vitis vinifera]
 emb|CBI18800.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 235/357 (66%), Gaps = 3/357 (1%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S    H T    GWAA D SGVLSP+ FSRR  G  DV   + YCG+C++D+   +N  G
Sbjct  4     SAEQEHPT-KAFGWAATDTSGVLSPFKFSRRETGEKDVRFKVLYCGICHSDLHMAKNDWG  62

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
              S YP+VPGHEIVGIV EVGS V +FKVGD VGVG  V +C  C+ C+  LE  C K  +
Sbjct  63    MSTYPIVPGHEIVGIVTEVGSKVGKFKVGDRVGVGCVVGACHSCDICDNDLENYCPK-MI  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FT+     DGT T GGYS  +V  ERY  +IP+N PL + APLLCAGITVY+P+    + 
Sbjct  122   FTYSAPYHDGTTTYGGYSDVMVAEERYVVRIPDNLPLDAGAPLLCAGITVYSPLQHFGLT  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             +PG  +GV+GLGGLGH+AVKF K FG+KVTV STS SKK+EA+  LGAD F++S D  QM
Sbjct  182   KPGMHIGVVGLGGLGHVAVKFAKGFGVKVTVISTSPSKKKEAIEHLGADYFLVSRDPDQM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGS  422
              A   + D +I+T S   P    + LLK  G L +VG P+  ++     L +G K +AGS
Sbjct  242   QAAMGTMDGIIDTVSAVHPLLPLIGLLKFQGKLVMVGGPNRPLELPVFPLLMGRKVVAGS  301

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
              TGG K TQE+++F     I  ++++IP+ YVN A+ERL K DVKYRFVIDIG +LK
Sbjct  302   CTGGMKETQEMIDFAGKHNITADVEVIPMDYVNTAMERLEKADVKYRFVIDIGNTLK  358



>ref|XP_007205415.1| hypothetical protein PRUPE_ppa007626mg [Prunus persica]
 gb|EMJ06614.1| hypothetical protein PRUPE_ppa007626mg [Prunus persica]
Length=361

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 237/348 (68%), Gaps = 2/348 (1%)
 Frame = -2

Query  1291  NCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPG  1112
                GWAARD SGVLSP+ FSRR  G  DVS  + YCG+C++D+   +N  G+S YPLVPG
Sbjct  12    KAFGWAARDSSGVLSPFKFSRRETGEKDVSFKVLYCGICHSDLHMVKNEWGSSTYPLVPG  71

Query  1111  HEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVD  932
             HEIVG+V EVGS V++FKVGD VGVG  V SC  C+ C   LE  C K  + T+    +D
Sbjct  72    HEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCANNLENYCPK-MILTYGSKYLD  130

Query  931   GTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvi  752
             GT T GGYS  +V  E +  ++P++ PL  AAPLLCAGIT Y+P+    +++PG  +GV+
Sbjct  131   GTTTYGGYSDIMVADEHFIVRVPDSLPLDGAAPLLCAGITTYSPLRYFGLDKPGMHVGVV  190

Query  751   glgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDF  572
             GLGGLGH+AVKF KA G+KVTV STS +KKEEA++ L AD+F++S DE QM A   + D 
Sbjct  191   GLGGLGHVAVKFAKAMGVKVTVISTSPNKKEEAIDHLHADSFLVSRDEDQMQAALGTMDG  250

Query  571   LINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQ  395
             +I+T S   P    + LLK+ G L +VG P + ++     L +G K +AGS  GG K TQ
Sbjct  251   IIDTVSAVHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLMGRKIVAGSCVGGMKETQ  310

Query  394   ELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
             E+++F A   +  +I++IPI YVN A+ERL K DV+YRFVIDIG +LK
Sbjct  311   EMIDFAAKHNVTADIEVIPIDYVNTAMERLAKTDVRYRFVIDIGNTLK  358



>ref|XP_009759255.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Nicotiana sylvestris]
 gb|ABD73280.1| sinapyl alcohol dehydrogenase-like 1 [Nicotiana tabacum]
Length=359

 Score =   332 bits (852),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 236/346 (68%), Gaps = 3/346 (1%)
 Frame = -2

Query  1288  CLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVPGH  1109
               GWAARD SGVLSP+NF+RR  G  DV   + YCG+C++D+   +N   TS YP+VPG+
Sbjct  13    AFGWAARDASGVLSPFNFTRRATGEKDVQFKVMYCGICHSDLQQLKNEWSTSIYPMVPGY  72

Query  1108  EIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDVDG  929
             E+VG+V E+G  V++FKVGD VGVG  V SCR+CE C+  LE+ C  G + T++ I  DG
Sbjct  73    EVVGVVTEIGRKVEKFKVGDKVGVGCLVGSCRKCENCDNNLEIYCP-GHIMTYNDIYTDG  131

Query  928   TVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgvig  749
               T GGYS  +V  E Y    PEN P+  AAPLL AGIT Y+P+    +++PG  +GV+G
Sbjct  132   ITTYGGYSDIMVTDEHYMVHWPENLPM-EAAPLLNAGITTYSPLKYFGLDKPGMRIGVVG  190

Query  748   lgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFDFL  569
             LGGLGH+AVKF KAFG KVT  STS SKK+EAL  LGAD+F++S D  QM A + S D +
Sbjct  191   LGGLGHMAVKFSKAFGTKVTAISTSASKKQEALERLGADSFLLSRDPDQMQAAAGSLDGI  250

Query  568   INTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLTQE  392
             I+T S   P    ++LLKT G L +VG P + ++     L LG K +AGS  GG K TQE
Sbjct  251   IDTVSAIHPLLPLINLLKTNGKLVIVGAPEKPLELPVFPLLLGRKLVAGSCIGGIKETQE  310

Query  391   LLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             +++F A   I P+++++P+ YVN A+ERL K DVKYRFV+DIG +L
Sbjct  311   MVDFAAKHNITPDVEVVPMDYVNTAMERLAKSDVKYRFVLDIGNTL  356



>ref|XP_003635278.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI33212.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   332 bits (852),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 236/357 (66%), Gaps = 3/357 (1%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S    H T    GWAA D SGVLSP+ FSRR  G  DV   + YCG+C++D+   +N  G
Sbjct  4     SAEQEHPT-KAFGWAATDTSGVLSPFKFSRRETGEKDVRFKVLYCGICHSDLHMAKNDWG  62

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
             TS YP+VPGHEIVGIV EVGS V +FKVGD VGVG  V +C  C+ C+  LE  C K  V
Sbjct  63    TSTYPIVPGHEIVGIVTEVGSKVGKFKVGDRVGVGCMVGACHSCDSCDNDLENYCPK-MV  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FT+     DGT T GGYS  +V  ERY  +IP+N PL + APLLCAGITVY+P+    + 
Sbjct  122   FTYSAPYHDGTTTYGGYSDVMVAEERYVVRIPDNLPLDAGAPLLCAGITVYSPLQHFGLT  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             +PG  +GV+GLGGLGH+AVKF K FG+KVTV STS SKK+EA+  LGAD F++S +  QM
Sbjct  182   KPGMHIGVVGLGGLGHVAVKFAKGFGVKVTVISTSPSKKKEAIEHLGADYFLVSREPDQM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGS  422
              A   + D +I+T S   P    + LLK+ G L +VG P+  ++     L +G K +AGS
Sbjct  242   QAAMGTMDGIIDTVSAVHPLLPLIGLLKSQGKLVMVGAPNRPLELPVFPLIMGRKVVAGS  301

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
               GG K TQE+++F     I  ++++IP+ YVN A+ERL K DV+YRFVIDIG +LK
Sbjct  302   CIGGMKETQEMIDFAGKHNITADVEVIPMDYVNTAMERLEKADVRYRFVIDIGNTLK  358



>ref|XP_007211488.1| hypothetical protein PRUPE_ppa007678mg [Prunus persica]
 gb|EMJ12687.1| hypothetical protein PRUPE_ppa007678mg [Prunus persica]
Length=359

 Score =   332 bits (852),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 239/348 (69%), Gaps = 2/348 (1%)
 Frame = -2

Query  1294  DNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHGTSKYPLVP  1115
             +   GWAARD SG+LSP+ FSRR    DDV++ + YCGVC++DV   +N  G + YP+VP
Sbjct  11    EKAFGWAARDTSGILSPFRFSRRENADDDVTIKVLYCGVCHSDVHSVKNEWGFTNYPIVP  70

Query  1114  GHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSVFTFDGIDV  935
             GHEIVG+V + G  V++FKVGD VGVG  V SC +CE C++ LE  C + ++FT++ +D 
Sbjct  71    GHEIVGVVTKAGKNVEKFKVGDRVGVGVIVGSCMKCETCDQDLENYCPR-TIFTYNSLDH  129

Query  934   DGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMNQPgkslgv  755
             D T T GGYS  IVVH RY  + P+N  L + APLLCAGITVY+PM  + M +PGK LGV
Sbjct  130   DRTKTYGGYSDMIVVHHRYVLRFPDNLALDAGAPLLCAGITVYSPMKYYGMTEPGKHLGV  189

Query  754   iglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQMMALSKSFD  575
              GLGGLGH+AVK GKAFGLKVTV S+S  K++EA+  LGAD+F++SSD  ++ A   + D
Sbjct  190   AGLGGLGHVAVKIGKAFGLKVTVISSSPGKEDEAVKRLGADSFLLSSDPAKLKAAMGTMD  249

Query  574   FLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGSITGGTKLT  398
             ++I+T S        + LLK  G L  VG P + ++     L LG K + GS  GG K T
Sbjct  250   YIIDTVSAVHALAPLIGLLKLNGKLVTVGLPDKPLELPIFPLVLGRKLVGGSDIGGVKET  309

Query  397   QELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSL  254
             QE+L+FCA   I  +I++I + Y+N A+ER+ K DV+YRFVID+G SL
Sbjct  310   QEMLDFCAKHNITSDIELIRMDYINTAMERIAKSDVRYRFVIDVGNSL  357



>gb|AGY96956.1| mannitol dehydrogenase 1 [Vitis vinifera]
Length=360

 Score =   332 bits (852),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 236/357 (66%), Gaps = 3/357 (1%)
 Frame = -2

Query  1318  SMASSHSTDNCLGWAARDPSGVLSPYNFSRRVVGSDDVSLDIAYCGVCYADVIWTRNIHG  1139
             S    H T    GWAA D SGVLSP+ FSRR  G  DV   + YCG+C++D+   +N  G
Sbjct  4     SAEQEHPT-KAFGWAATDTSGVLSPFKFSRRETGEKDVRFKVLYCGICHSDLHMAKNDWG  62

Query  1138  TSKYPLVPGHEIVGIVKEVGSGVQRFKVGDPVGVGTYVNSCRECEYCNEGLEVQCSKGSV  959
             TS YP+VPGHEIVGIV EVGS V +FKVGD VGVG  V +C  C+ C+  LE  C K  V
Sbjct  63    TSTYPIVPGHEIVGIVTEVGSKVGKFKVGDRVGVGFMVGACHSCDSCDNDLENYCPK-MV  121

Query  958   FTFDGIDVDGTVTKGGYSSYIVVHERYCYKIPENYPLASAAPLLCAGITVYTPMMRHNMN  779
             FT+     DGT T GGYS  +V  ERY  +IP+N PL + APLLCAGITVY+P+    + 
Sbjct  122   FTYSAPYHDGTTTYGGYSDVMVAEERYVVRIPDNLPLDAGAPLLCAGITVYSPLQHFGLT  181

Query  778   QPgkslgviglgglghLAVKFGKAFGLKVTVFSTSISKKEEALNLLGADNFVISSDEKQM  599
             +PG  +GV+GLGGLGH+AVKF K FG+KVTV STS SKK+EA+  LGAD F++S +  QM
Sbjct  182   KPGMHIGVVGLGGLGHVAVKFAKGFGVKVTVISTSPSKKKEAIEHLGADYFLVSREPDQM  241

Query  598   MALSKSFDFLINTASGDIPFDLYLSLLKTAGTLALVGFPSE-VKFSPGSLNLGMKCIAGS  422
              A   + D +I+T S   P    + LLK+ G L +VG P+  ++     L +G K +AGS
Sbjct  242   QAAMGTMDGIIDTVSAVHPLLPLIGLLKSQGKLVMVGAPNRPLELPVFPLIMGRKVVAGS  301

Query  421   ITGGTKLTQELLEFCASRKIYPEIDIIPIQYVNEALERLIKKDVKYRFVIDIGGSLK  251
               GG K TQE+++F     I  ++++IP+ YVN A+ERL K DV+YRFVIDIG +LK
Sbjct  302   CIGGMKETQEMIDFAGKHNITADVEVIPMDYVNTAMERLEKADVRYRFVIDIGNTLK  358



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4152661970184