BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23811_g2_i1 len=2284 path=[5623:0-788 1933:789-835 144:836-929
238:930-955 7272:956-1445 2588:1446-1475 2618:1476-1631
2774:1632-1660 8298:1661-1846 2977:1847-1883 3013:1884-2283]

Length=2284
                                                                      Score     E

ref|XP_009796491.1|  PREDICTED: uncharacterized protein LOC104243063    854   0.0      
ref|XP_009614009.1|  PREDICTED: uncharacterized protein LOC104107031    848   0.0      
ref|XP_006342883.1|  PREDICTED: uncharacterized protein LOC102584575    846   0.0      
ref|XP_004235519.1|  PREDICTED: uncharacterized protein LOC101268664    818   0.0      
ref|XP_009777360.1|  PREDICTED: uncharacterized protein LOC104226946    791   0.0      
ref|XP_009609850.1|  PREDICTED: uncharacterized protein LOC104103642    780   0.0      
ref|XP_011072708.1|  PREDICTED: uncharacterized protein LOC105157890    771   0.0      
ref|XP_006357428.1|  PREDICTED: uncharacterized protein LOC102602087    767   0.0      
ref|XP_004242264.2|  PREDICTED: uncharacterized protein LOC101262928    758   0.0      
ref|XP_002264087.1|  PREDICTED: uncharacterized protein LOC100254979    756   0.0      Vitis vinifera
gb|EYU21259.1|  hypothetical protein MIMGU_mgv1a003863mg                744   0.0      
ref|XP_010096529.1|  hypothetical protein L484_017982                   729   0.0      
ref|XP_007024790.1|  O-fucosyltransferase family protein isoform 1      728   0.0      
ref|XP_011079203.1|  PREDICTED: uncharacterized protein LOC105162777    728   0.0      
ref|XP_007024791.1|  O-fucosyltransferase family protein isoform 2      723   0.0      
emb|CDO97781.1|  unnamed protein product                                718   0.0      
gb|KHG12722.1|  GDP-fucose O-fucosyltransferase 2                       715   0.0      
ref|XP_008380716.1|  PREDICTED: uncharacterized protein LOC103443616    707   0.0      
ref|XP_010033639.1|  PREDICTED: uncharacterized protein LOC104422884    704   0.0      
ref|XP_008372913.1|  PREDICTED: uncharacterized protein LOC103436268    701   0.0      
ref|XP_010273795.1|  PREDICTED: uncharacterized protein LOC104609241    697   0.0      
gb|KHG23198.1|  GDP-fucose O-fucosyltransferase 2                       704   0.0      
ref|XP_004303772.1|  PREDICTED: uncharacterized protein LOC101299396    694   0.0      
ref|XP_004144450.1|  PREDICTED: uncharacterized protein LOC101208722    686   0.0      
ref|XP_002303337.1|  protein-O-fucosyltransferase 2                     683   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011031831.1|  PREDICTED: uncharacterized protein LOC105130840    682   0.0      
gb|EPS60947.1|  hypothetical protein M569_13853                         681   0.0      
ref|XP_008465040.1|  PREDICTED: uncharacterized protein LOC103502751    681   0.0      
ref|XP_007215906.1|  hypothetical protein PRUPE_ppa004150mg             671   0.0      
gb|KCW56440.1|  hypothetical protein EUGRSUZ_I02168                     673   0.0      
ref|XP_002533327.1|  conserved hypothetical protein                     671   0.0      Ricinus communis
ref|XP_003529861.1|  PREDICTED: uncharacterized protein LOC100776069    670   0.0      
gb|KDP40618.1|  hypothetical protein JCGZ_24617                         671   0.0      
ref|XP_006465793.1|  PREDICTED: uncharacterized protein LOC102617227    666   0.0      
gb|KHN01480.1|  hypothetical protein glysoja_009686                     662   0.0      
gb|KHN15848.1|  hypothetical protein glysoja_013064                     665   0.0      
ref|XP_003547949.1|  PREDICTED: uncharacterized protein LOC548046       664   0.0      
gb|KDO53745.1|  hypothetical protein CISIN_1g008526mg                   663   0.0      
ref|XP_006426814.1|  hypothetical protein CICLE_v10025289mg             663   0.0      
ref|XP_010442530.1|  PREDICTED: uncharacterized protein LOC104725...    663   0.0      
ref|XP_010482356.1|  PREDICTED: uncharacterized protein LOC104761036    657   0.0      
ref|XP_010029525.1|  PREDICTED: uncharacterized protein LOC104419540    657   0.0      
ref|XP_010442117.1|  PREDICTED: uncharacterized protein LOC104725193    655   0.0      
ref|XP_006280247.1|  hypothetical protein CARUB_v10026161mg             654   0.0      
ref|XP_008451086.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    652   0.0      
ref|XP_004149507.1|  PREDICTED: uncharacterized protein LOC101202868    650   0.0      
ref|XP_002892943.1|  hypothetical protein ARALYDRAFT_889130             654   0.0      
ref|XP_003627474.1|  GDP-fucose protein-O-fucosyltransferase            652   0.0      
ref|NP_199853.1|  O-fucosyltransferase family protein                   651   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008804333.1|  PREDICTED: uncharacterized protein LOC103717648    650   0.0      
gb|AAM66093.1|  unknown                                                 650   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007135356.1|  hypothetical protein PHAVU_010G122400g             649   0.0      
ref|XP_004168266.1|  PREDICTED: uncharacterized LOC101202868            647   0.0      
ref|XP_010923390.1|  PREDICTED: uncharacterized protein LOC105046499    649   0.0      
ref|XP_002865803.1|  hypothetical protein ARALYDRAFT_918074             648   0.0      
ref|XP_006307109.1|  hypothetical protein CARUB_v10008696mg             648   0.0      
ref|XP_008812999.1|  PREDICTED: uncharacterized protein LOC103723759    648   0.0      
ref|XP_010685200.1|  PREDICTED: uncharacterized protein LOC104899667    647   0.0      
ref|XP_004510588.1|  PREDICTED: uncharacterized protein LOC101496484    644   0.0      
ref|XP_006402105.1|  hypothetical protein EUTSA_v10013133mg             642   0.0      
ref|NP_173170.2|  O-fucosyltransferase family protein                   640   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416723.1|  hypothetical protein EUTSA_v10007186mg             637   0.0      
ref|XP_010537659.1|  PREDICTED: uncharacterized protein LOC104812278    636   0.0      
ref|XP_010934941.1|  PREDICTED: uncharacterized protein LOC105054968    636   0.0      
ref|XP_010498071.1|  PREDICTED: uncharacterized protein LOC104775835    631   0.0      
ref|XP_010476871.1|  PREDICTED: uncharacterized protein LOC104756057    630   0.0      
ref|NP_175780.1|  O-fucosyltransferase family protein                   630   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462285.1|  PREDICTED: uncharacterized protein LOC104742900    629   0.0      
ref|XP_002894461.1|  hypothetical protein ARALYDRAFT_474511             628   0.0      
ref|XP_006392751.1|  hypothetical protein EUTSA_v10011359mg             628   0.0      
ref|XP_006307146.1|  hypothetical protein CARUB_v10008736mg             628   0.0      
ref|XP_010501038.1|  PREDICTED: uncharacterized protein LOC104778315    627   0.0      
ref|XP_010552180.1|  PREDICTED: uncharacterized protein LOC104822610    627   0.0      
dbj|BAF00786.1|  hypothetical protein                                   625   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAD50008.1|AC007651_3  Hypothetical Protein                          624   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479955.1|  PREDICTED: uncharacterized protein LOC104758729    620   0.0      
emb|CAE30293.1|  GDP-fucose protein-O-fucosyltransferase 2              610   0.0      Solanum tuberosum [potatoes]
emb|CAN80219.1|  hypothetical protein VITISV_027891                     602   0.0      Vitis vinifera
emb|CDX83916.1|  BnaC08g17290D                                          609   0.0      
ref|XP_009413328.1|  PREDICTED: uncharacterized protein LOC103994654    610   0.0      
emb|CDX91550.1|  BnaC02g16100D                                          606   0.0      
emb|CDY16367.1|  BnaA02g11710D                                          605   0.0      
ref|XP_009127356.1|  PREDICTED: uncharacterized protein LOC103852192    605   0.0      
emb|CDY24074.1|  BnaA06g00720D                                          605   0.0      
ref|NP_001185215.1|  O-fucosyltransferase family protein                607   0.0      
emb|CDX96778.1|  BnaA08g23210D                                          604   0.0      
ref|XP_009110418.1|  PREDICTED: uncharacterized protein LOC103835964    600   0.0      
emb|CDY36604.1|  BnaC06g06570D                                          599   0.0      
ref|XP_006657870.1|  PREDICTED: uncharacterized protein LOC102711445    595   0.0      
ref|XP_009147582.1|  PREDICTED: uncharacterized protein LOC103871110    594   0.0      
ref|NP_001060060.1|  Os07g0572600                                       593   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMS52047.1|  hypothetical protein TRIUR3_21474                       585   0.0      
ref|XP_009407750.1|  PREDICTED: uncharacterized protein LOC103990369    585   0.0      
gb|EMT33342.1|  hypothetical protein F775_03160                         583   0.0      
ref|XP_004958098.1|  PREDICTED: uncharacterized protein LOC101783584    583   0.0      
ref|XP_007139055.1|  hypothetical protein PHAVU_009G261000g             577   0.0      
ref|XP_002460894.1|  hypothetical protein SORBIDRAFT_02g037060          576   0.0      Sorghum bicolor [broomcorn]
ref|XP_006842718.1|  hypothetical protein AMTR_s00147p00102480          576   0.0      
ref|XP_003562860.1|  PREDICTED: uncharacterized protein LOC100825796    573   0.0      
tpg|DAA41170.1|  TPA: hypothetical protein ZEAMMB73_622134              569   0.0      
ref|XP_008670499.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    570   0.0      
gb|KEH18522.1|  GDP-fucose protein O-fucosyltransferase                 548   0.0      
ref|XP_010459302.1|  PREDICTED: uncharacterized protein LOC104740418    542   0.0      
gb|KFK35696.1|  hypothetical protein AALP_AA4G025100                    532   2e-178   
ref|XP_008353304.1|  PREDICTED: uncharacterized protein LOC103416869    446   3e-145   
ref|XP_002970687.1|  protein-O-fucosyltransferase-like protein          435   6e-141   
gb|ACJ85563.1|  unknown                                                 410   2e-134   Medicago truncatula
ref|XP_010442531.1|  PREDICTED: uncharacterized protein LOC104725...    410   6e-131   
emb|CAE30294.1|  GDP-fucose protein-O-fucosyltransferase 2              349   7e-112   Helianthus annuus
emb|CBI35787.3|  unnamed protein product                                321   3e-101   
ref|XP_001772368.1|  predicted protein                                  319   4e-98    
emb|CAH41978.1|  protein-O-fucosyltransferase 2                         288   6e-89    Glycine max [soybeans]
gb|AAG51963.1|AC024260_1  hypothetical protein, 5' partial; 217-725     244   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002969585.1|  hypothetical protein SELMODRAFT_410382             203   2e-54    
ref|XP_002969374.1|  protein-O-fucosyltransferase-like protein          167   2e-43    
gb|AFP49325.1|  GDP-fucose protein-O-fucosyltransferase 2               161   3e-43    
ref|XP_002970857.1|  hypothetical protein SELMODRAFT_411497             131   5e-28    
gb|ACR34624.1|  unknown                                                 114   2e-26    Zea mays [maize]
gb|AES63265.2|  PPR containing plant-like protein                       116   1e-23    
ref|XP_003593013.1|  GDP-fucose protein-O-fucosyltransferase            107   6e-23    
ref|XP_003593014.1|  Pentatricopeptide repeat-containing protein      96.3    3e-17    
ref|XP_010535238.1|  PREDICTED: uncharacterized protein LOC104810589  64.7    1e-08    
gb|EJW77671.1|  O-fucosyltransferase 2                                53.9    1e-04    



>ref|XP_009796491.1| PREDICTED: uncharacterized protein LOC104243063 [Nicotiana sylvestris]
Length=555

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/565 (76%), Positives = 483/565 (85%), Gaps = 25/565 (4%)
 Frame = -3

Query  2120  NLIGDGERRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATT  1941
             NLI   ++ D  +SP RS+FQID  KDRF    RFNF   KRY LAIILP+ V++LY  T
Sbjct  16    NLI---QQNDHPKSPLRSTFQIDDVKDRFAFNRRFNFTFSKRYFLAIILPVLVLILYFIT  72

Query  1940  DIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnnt  1761
             DIKN+F+T V+ I +D   N MRESELRALYLLRQQQL LFK WNHT  N T    ++++
Sbjct  73    DIKNLFQTTVTNIKYDGSINSMRESELRALYLLRQQQLGLFKLWNHTLANDTSSTGLSSS  132

Query  1760  gnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSL  1581
              + +S+                      +EDLK+DLLSQISLNKQIQQ LLSSHQLGN L
Sbjct  133   VSKSST----------------------VEDLKSDLLSQISLNKQIQQALLSSHQLGNLL  170

Query  1580  DLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHM  1401
              +SDN+TDPS  GLGRCRKVD   S+RKT+EWKP S+KYLFAICVSGQMSNHLICLEKHM
Sbjct  171   SISDNSTDPSFGGLGRCRKVDHNLSQRKTVEWKPRSDKYLFAICVSGQMSNHLICLEKHM  230

Query  1400  FFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVIC  1221
             FFAA+LNR LV+PSSKVDYEF RVLDVDHINKCLGR+VV+TYEEFAE +K+HVHIDK+IC
Sbjct  231   FFAALLNRVLVIPSSKVDYEFNRVLDVDHINKCLGREVVVTYEEFAERRKSHVHIDKIIC  290

Query  1220  YFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAI  1041
             YFSQPQPCF+DD+R+KKLKS GVSMNK+E AWNEDVKKPK++TVQDI +KFS++DDVIAI
Sbjct  291   YFSQPQPCFLDDERVKKLKSLGVSMNKLEVAWNEDVKKPKKRTVQDIEAKFSTDDDVIAI  350

Query  1040  GDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGF  861
             GDVFFADVE  WVMQPGGPI+HKCKTLIEPSRLIMLTAQRFVQTFLG +FIALHFRRHGF
Sbjct  351   GDVFFADVEKDWVMQPGGPISHKCKTLIEPSRLIMLTAQRFVQTFLGNNFIALHFRRHGF  410

Query  860   LKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVP  681
             LKFCNAKKPSCFYPVPQAADCINRV+ERA+SPVIYLSTDAAESET LLQSLVVFNGKTVP
Sbjct  411   LKFCNAKKPSCFYPVPQAADCINRVIERASSPVIYLSTDAAESETGLLQSLVVFNGKTVP  470

Query  680   LVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRR  501
             LVKRPARNSAEKWDALLYRHGLE D+QV+AMLDKTICA+SSVFIG+ GSTFT+DILRLR+
Sbjct  471   LVKRPARNSAEKWDALLYRHGLEGDSQVDAMLDKTICAMSSVFIGSSGSTFTDDILRLRK  530

Query  500   GWGSASMCDEYLCQGEVPNFIADDE  426
              WGSAS+CDEYLCQGE+PNFIADDE
Sbjct  531   DWGSASLCDEYLCQGELPNFIADDE  555



>ref|XP_009614009.1| PREDICTED: uncharacterized protein LOC104107031 [Nicotiana tomentosiformis]
Length=552

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/566 (76%), Positives = 477/566 (84%), Gaps = 30/566 (5%)
 Frame = -3

Query  2120  NLIGDGER-RDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYAT  1944
             NLI   ER  D  +SP RS+FQID  KDRF    RFNF   KRY LAIILP+ V++LY T
Sbjct  16    NLIQQNERVNDHPKSPLRSTFQIDDVKDRFAFNRRFNFTFSKRYFLAIILPVLVLILYFT  75

Query  1943  TDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnn  1764
             TDIKN+F+T V+ I +D   N MRESELRALYLLRQQQL LFK WNHT VN + ++    
Sbjct  76    TDIKNLFQTTVTNIKYDGSINSMRESELRALYLLRQQQLGLFKLWNHTLVNDSSISKS--  133

Query  1763  tgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNS  1584
                                      SAV  ED K+DLLSQISLNKQIQQ LLSSHQLGN 
Sbjct  134   -------------------------SAV--EDFKSDLLSQISLNKQIQQALLSSHQLGNL  166

Query  1583  LDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKH  1404
             L   DN+TDPS+SGLGRCRKVD   S+RK +EWKP S+KYLFAICVSGQMSNHLICLEKH
Sbjct  167   LITPDNSTDPSLSGLGRCRKVDHNLSQRKNVEWKPRSDKYLFAICVSGQMSNHLICLEKH  226

Query  1403  MFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVI  1224
             MFFAA+LNR LV+PSSKVDYEF RVLDVDHINKCLGR+VV+TYEE AE +K+HVHIDK I
Sbjct  227   MFFAALLNRILVIPSSKVDYEFNRVLDVDHINKCLGREVVVTYEEVAERRKSHVHIDKFI  286

Query  1223  CYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIA  1044
             CYFSQPQPCF+DD+R+KKLKS GVSMNK+E AW+EDVKKPK++TVQDI +KFS++DDVIA
Sbjct  287   CYFSQPQPCFLDDERVKKLKSLGVSMNKLEVAWSEDVKKPKKRTVQDIEAKFSTDDDVIA  346

Query  1043  IGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHG  864
             IGDVFFADVE  WVMQPGGPI+HKCKTLIEPSRLIMLTAQRFVQTFLG++F+ALHFRRHG
Sbjct  347   IGDVFFADVEKDWVMQPGGPISHKCKTLIEPSRLIMLTAQRFVQTFLGDNFVALHFRRHG  406

Query  863   FLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTV  684
             FLKFCNAKKPSCFYPVPQAADCINRV+ERA+SPVIYLSTDAA+SET LLQSLVVFNGKTV
Sbjct  407   FLKFCNAKKPSCFYPVPQAADCINRVIERASSPVIYLSTDAADSETGLLQSLVVFNGKTV  466

Query  683   PLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLR  504
             PLVKRPARNSAEKWDALLYRHGLE D+QV+AMLDKTICA+SSVFIG+ GSTFT+DILRLR
Sbjct  467   PLVKRPARNSAEKWDALLYRHGLEGDSQVDAMLDKTICAMSSVFIGSSGSTFTDDILRLR  526

Query  503   RGWGSASMCDEYLCQGEVPNFIADDE  426
             + WGSAS+CDEYLCQGE+PNFI DDE
Sbjct  527   KDWGSASLCDEYLCQGELPNFIVDDE  552



>ref|XP_006342883.1| PREDICTED: uncharacterized protein LOC102584575 [Solanum tuberosum]
Length=568

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/570 (74%), Positives = 484/570 (85%), Gaps = 22/570 (4%)
 Frame = -3

Query  2120  NLIGDGER-RDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYAT  1944
             NLI   ER  D ++SP RS+FQI+  KDRF    RFNF   KRY LAIILP+ V++LY  
Sbjct  16    NLIHQNERVNDLSKSPRRSTFQIEDVKDRFALCRRFNFTSGKRYLLAIILPVLVLVLYFA  75

Query  1943  TDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnn  1764
             TDIK++F+T V+ I +D   N MR+SELRALYLLRQQQL LFK WNHT VN T       
Sbjct  76    TDIKSLFQTTVTTIKYDGSVNSMRDSELRALYLLRQQQLGLFKLWNHTLVNDT-------  128

Query  1763  tgnstssnagsgssnsslertgsSFSAV----FLEDLKADLLSQISLNKQIQQVLLSSHQ  1596
                       S +   S   +   F++V     +EDLKADLL QISLNKQIQQVLLSSHQ
Sbjct  129   ----------STTHTGSSLESTPGFASVSRSSIVEDLKADLLRQISLNKQIQQVLLSSHQ  178

Query  1595  LGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLIC  1416
             LGNSL  SDN+TDP++ GL RCRKVD   S+R+T+EWKP SNKYLFAICVSGQMSNHLIC
Sbjct  179   LGNSLITSDNSTDPTLGGLSRCRKVDHNLSQRRTVEWKPRSNKYLFAICVSGQMSNHLIC  238

Query  1415  LEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHI  1236
             LEKHMFFAA+LNR LV+PSSKVDYEF+RVLDVDHINKCLGR+V++TY+EFAE +K+H+HI
Sbjct  239   LEKHMFFAALLNRILVIPSSKVDYEFRRVLDVDHINKCLGREVIVTYDEFAERRKSHLHI  298

Query  1235  DKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSND  1056
             DK +CYFSQPQPCF+D++R+KKLKS G+SMNK+E AWNEDVK PK++TVQDI++KFS++D
Sbjct  299   DKFLCYFSQPQPCFLDEERVKKLKSLGISMNKLEAAWNEDVKNPKKRTVQDIMAKFSTDD  358

Query  1055  DVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHF  876
             DV+AIGDVFFADVE  WVMQPGGPI+HKCKTLIEPSRLIMLTAQRF+QTFLG++FIALHF
Sbjct  359   DVLAIGDVFFADVEKDWVMQPGGPISHKCKTLIEPSRLIMLTAQRFIQTFLGDNFIALHF  418

Query  875   RRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFN  696
             RRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESET LLQSLVV N
Sbjct  419   RRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETGLLQSLVVVN  478

Query  695   GKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDI  516
             GKTVPLV+RPARNSAEKWDALLYRHGLE D QV+AMLDKTICA+SSVFIG+ GSTFT+DI
Sbjct  479   GKTVPLVQRPARNSAEKWDALLYRHGLEGDPQVDAMLDKTICAMSSVFIGSSGSTFTDDI  538

Query  515   LRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             LRLR+ WGSAS+CDEYLCQGE+PN++ADDE
Sbjct  539   LRLRKDWGSASLCDEYLCQGELPNYVADDE  568



>ref|XP_004235519.1| PREDICTED: uncharacterized protein LOC101268664 [Solanum lycopersicum]
Length=565

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/566 (74%), Positives = 476/566 (84%), Gaps = 17/566 (3%)
 Frame = -3

Query  2120  NLIGDGERRDG-ARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYAT  1944
             NLI   ER +  ++SP  S+FQI+  KDRF    RFNF   K Y LAIILPL V++LY  
Sbjct  16    NLIHQNERVNHLSKSPRPSTFQIEDVKDRFALCRRFNFTSGKTYLLAIILPLLVLILYFA  75

Query  1943  TDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnn  1764
             TDIK +F+T V+ I +D   N MRESELRALYLL+QQQL LFK WNHT VN T       
Sbjct  76    TDIKALFQTTVTTIKYDGSVNSMRESELRALYLLKQQQLGLFKLWNHTLVNDTSTTHSLE  135

Query  1763  tgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNS  1584
             +    +  +                 +  +EDLK DLL QISLNKQIQQVLLSSHQLGNS
Sbjct  136   SAPGFTLVSR----------------SSIVEDLKDDLLRQISLNKQIQQVLLSSHQLGNS  179

Query  1583  LDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKH  1404
             L  SDN+TDPS+ GLGRCRKVD   SER+T+EWKP SNKYLFAICVSGQMSNHLICLEKH
Sbjct  180   LITSDNSTDPSLGGLGRCRKVDHNLSERRTVEWKPRSNKYLFAICVSGQMSNHLICLEKH  239

Query  1403  MFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVI  1224
             MFFAA+LNR LV+PSSKVDYEF+RVLDVDHINKCLGR+V++TY+EFAE +K+H+HIDK +
Sbjct  240   MFFAALLNRVLVIPSSKVDYEFRRVLDVDHINKCLGREVIVTYDEFAERRKSHLHIDKFL  299

Query  1223  CYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIA  1044
             CYFSQPQPCF+D++R+KKLKS G+SMNK+E AW+EDVK PK++T QDIV+KFS +DDV+A
Sbjct  300   CYFSQPQPCFLDEERVKKLKSLGISMNKLEAAWDEDVKNPKKRTAQDIVAKFSMDDDVLA  359

Query  1043  IGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHG  864
             IGDVFFADVE  WVMQPGGPI+HKCKTLIEPSRLIMLTAQRFVQTFLG++FIALHFRRHG
Sbjct  360   IGDVFFADVEKDWVMQPGGPISHKCKTLIEPSRLIMLTAQRFVQTFLGDNFIALHFRRHG  419

Query  863   FLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTV  684
             FLKFCNAKKPSCFYPVPQAADCINRVLERANSPV+YLSTDAAESET LLQSLVVFNGKTV
Sbjct  420   FLKFCNAKKPSCFYPVPQAADCINRVLERANSPVMYLSTDAAESETGLLQSLVVFNGKTV  479

Query  683   PLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLR  504
             PLV+RPARNSAEKWDALLYRHGLE D QVEAMLDKTICA+SSVFIG+ GSTFT+DILRLR
Sbjct  480   PLVQRPARNSAEKWDALLYRHGLEGDPQVEAMLDKTICAMSSVFIGSSGSTFTDDILRLR  539

Query  503   RGWGSASMCDEYLCQGEVPNFIADDE  426
             + WGSAS+CDEYLCQGE+PNF+ADDE
Sbjct  540   KDWGSASLCDEYLCQGELPNFVADDE  565



>ref|XP_009777360.1| PREDICTED: uncharacterized protein LOC104226946 [Nicotiana sylvestris]
Length=557

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/569 (72%), Positives = 466/569 (82%), Gaps = 30/569 (5%)
 Frame = -3

Query  2120  NLIGDGERRD-GARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYAT  1944
             NLI   E R+  + SP R++FQID   +      RFNF  +KRY LAIILP+ +++LY T
Sbjct  15    NLIAQSESRNRHSESPQRTTFQIDETAN----TRRFNFSFKKRYLLAIILPVLILILYFT  70

Query  1943  TDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnn  1764
             TDIKN+F+T V+ + +D+  NRMRESELRALYLLRQQQL LFK WNHT ++ +       
Sbjct  71    TDIKNLFKTSVTNVNYDASINRMRESELRALYLLRQQQLGLFKLWNHTLLDNS-------  123

Query  1763  tgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNS  1584
                             +        +   LE LK+DLLSQISLN QIQQ L SSHQLG+S
Sbjct  124   ---------------LNDISNKPIVNNSNLEKLKSDLLSQISLNNQIQQALFSSHQLGSS  168

Query  1583  LDLSDNNTDPSISGLG---RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICL  1413
             L  SDN TDPS+ G G   RCRKVD   SER+TIEWKP  +KYLFAICVSGQMSNHLICL
Sbjct  169   LSASDNATDPSLEGYGDLHRCRKVDYRLSERRTIEWKPRLDKYLFAICVSGQMSNHLICL  228

Query  1412  EKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHID  1233
             EKHMFFAA+LNR L++PSSKVDYEF RVLD+DHI+KCLGRKVV+T+EEFA+ +K H+HID
Sbjct  229   EKHMFFAALLNRILIIPSSKVDYEFHRVLDIDHIDKCLGRKVVVTFEEFAKGRKGHMHID  288

Query  1232  KVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDD  1053
             K ICYFSQPQPCFMD++R+KKL+S GVSMNK+E AWNEDVK PK +TVQDI+ KFSS+DD
Sbjct  289   KFICYFSQPQPCFMDEERVKKLQSLGVSMNKLEAAWNEDVKNPKPRTVQDIMIKFSSDDD  348

Query  1052  VIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFR  873
             VIAIGDVFFADVE  WVMQP GPI+HKCKTL+EPSRLI+LTAQRF+QTFLGE+FIALHFR
Sbjct  349   VIAIGDVFFADVEKEWVMQPRGPISHKCKTLVEPSRLILLTAQRFIQTFLGENFIALHFR  408

Query  872   RHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNG  693
             RHGFLKFCNAKKPSCFYPVPQAADCINRV+ERANS VIYLSTDAAESET LLQSLVVFNG
Sbjct  409   RHGFLKFCNAKKPSCFYPVPQAADCINRVVERANSAVIYLSTDAAESETGLLQSLVVFNG  468

Query  692   KTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDIL  513
             KTVPLV RPARNSAEKWDALLYRHGLE D QVEAMLDKTIC+LS VFIG+ GSTFTEDIL
Sbjct  469   KTVPLVGRPARNSAEKWDALLYRHGLEGDRQVEAMLDKTICSLSDVFIGSMGSTFTEDIL  528

Query  512   RLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             RLR+ WGSAS+CDEYLCQGE+PNFIADDE
Sbjct  529   RLRKDWGSASLCDEYLCQGELPNFIADDE  557



>ref|XP_009609850.1| PREDICTED: uncharacterized protein LOC104103642 [Nicotiana tomentosiformis]
 ref|XP_009609851.1| PREDICTED: uncharacterized protein LOC104103642 [Nicotiana tomentosiformis]
Length=554

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/569 (72%), Positives = 461/569 (81%), Gaps = 34/569 (6%)
 Frame = -3

Query  2120  NLIGDGERRDG-ARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYAT  1944
             NLI   ERR+  + SP R++FQID   +      RFNF   KRY LAIILP+ +++LY T
Sbjct  16    NLIAQSERRNHRSESPQRTTFQIDETAN----TRRFNFSFNKRYFLAIILPVIILILYFT  71

Query  1943  TDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnn  1764
             TDIK++F+T V  + +D+  NRMRESELRALYLLRQQ L LFK WNHT ++ +    + N
Sbjct  72    TDIKSLFKTSVINVNYDASINRMRESELRALYLLRQQNLGLFKLWNHTLLDNSSNKPIAN  131

Query  1763  tgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNS  1584
               N                          L+ LK+DLLSQISLNKQIQQ LL SHQLGNS
Sbjct  132   NSN--------------------------LDKLKSDLLSQISLNKQIQQALLWSHQLGNS  165

Query  1583  LDLSDNNTDPSISGLG---RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICL  1413
             L   DN TD S+ G G    CRKVD   SER+TIEWKP  +K+LFAICVSGQMSNHLICL
Sbjct  166   LSALDNATDTSLDGYGDLHSCRKVDYRLSERRTIEWKPRPDKHLFAICVSGQMSNHLICL  225

Query  1412  EKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHID  1233
             EKHMFFAA+LNR L++PSSKVDYEF RVLD+DHI+KCLGRKVV+T+EEFA+ QK H+HID
Sbjct  226   EKHMFFAALLNRILIIPSSKVDYEFHRVLDIDHIDKCLGRKVVVTFEEFAKGQKGHMHID  285

Query  1232  KVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDD  1053
             K ICYFSQPQPCFMD++R+KKLKS GVSMNK+E AW EDVK PK +TVQDI++ FSS+DD
Sbjct  286   KFICYFSQPQPCFMDEERVKKLKSLGVSMNKLEAAWIEDVKNPKPRTVQDIMTNFSSDDD  345

Query  1052  VIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFR  873
             ++AIGDVFFADVE  WVMQPGGPI+HKCKTL+EPSRLI+LTAQRF+QTFLGE+FIALHFR
Sbjct  346   IVAIGDVFFADVEKEWVMQPGGPISHKCKTLVEPSRLILLTAQRFIQTFLGENFIALHFR  405

Query  872   RHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNG  693
             RHGFLKFCNAK PSCFYPVPQAADCINRV+ERANS VIYLSTDAAESET LLQSLVV NG
Sbjct  406   RHGFLKFCNAKTPSCFYPVPQAADCINRVVERANSAVIYLSTDAAESETGLLQSLVVVNG  465

Query  692   KTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDIL  513
             KTVPLV+RPARNSAEKWDALLYRHGLE D QVEAMLDKTICALS VFIG+ GSTFTEDIL
Sbjct  466   KTVPLVRRPARNSAEKWDALLYRHGLEGDRQVEAMLDKTICALSGVFIGSMGSTFTEDIL  525

Query  512   RLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             RLR+ WGSAS+CDEYLCQGE PNFIADDE
Sbjct  526   RLRKDWGSASLCDEYLCQGERPNFIADDE  554



>ref|XP_011072708.1| PREDICTED: uncharacterized protein LOC105157890 [Sesamum indicum]
Length=578

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/577 (69%), Positives = 473/577 (82%), Gaps = 25/577 (4%)
 Frame = -3

Query  2120  NLIGDGER-RDGARSPG---RSSFQIDGNKDRFIDPARFNFICR---KRYCLAIILPLFV  1962
             NLI    R  D  +SP    RS+F ID   D F   +RF+ + R   KRY +AI LP+ +
Sbjct  15    NLISQNARSNDVVKSPNHRHRSAFHID---DDF--RSRFSGVTRRFHKRYLMAIFLPMLI  69

Query  1961  ILLYATTDIKNIFRTGVSKITF----DSPANRMRESelralyllrqqqleLFKQWNHT-F  1797
             ++LY TTD +++F+  +  I      + P +RMRESELRALYLLRQQ+LELFK WN+T  
Sbjct  70    LILYFTTDFRSLFQMRIPTIKNIGGNNPPIDRMRESELRALYLLRQQELELFKMWNYTTL  129

Query  1796  VNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQ  1617
             VNK+  + VNN+     ++A +   +          S+  LEDLK+ + SQISLNKQIQ 
Sbjct  130   VNKSNFSLVNNSNLVNLTSANNNGVDM--------LSSSMLEDLKSRVFSQISLNKQIQG  181

Query  1616  VLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQ  1437
             VLLSSH+ G SL+L++N TD S SG   CRKVDQ  SER+T+EWKP S+KYLFAICVSGQ
Sbjct  182   VLLSSHENGGSLELNENYTDASFSGWNGCRKVDQRLSERRTMEWKPRSDKYLFAICVSGQ  241

Query  1436  MSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAES  1257
             MSNHLICLEKHMFFAA+ NR LV+PSSKVDYEF RVLD++HINKCLGRKVV T+EEFAES
Sbjct  242   MSNHLICLEKHMFFAALFNRILVIPSSKVDYEFHRVLDIEHINKCLGRKVVATFEEFAES  301

Query  1256  QKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIV  1077
             +K H+HIDK++CYFS PQPC+MDD+R+KKLK  G+S+ K+E  WNEDVKKP Q+TV D++
Sbjct  302   KKKHLHIDKLMCYFSSPQPCYMDDERVKKLKGLGLSLGKMEAVWNEDVKKPNQRTVPDVL  361

Query  1076  SKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGE  897
             +KFSS+D+VIAIGDVFFADVE  WVMQPGGPIAHKCKTLIEPSRLI+LTAQRF+QTFLG+
Sbjct  362   AKFSSDDNVIAIGDVFFADVEREWVMQPGGPIAHKCKTLIEPSRLILLTAQRFIQTFLGK  421

Query  896   DFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLL  717
             DFIALHFRRHGFLKFCNAK+PSCFYPVPQAA+CINRVLERAN+PVIYLSTDAAESET LL
Sbjct  422   DFIALHFRRHGFLKFCNAKQPSCFYPVPQAAECINRVLERANTPVIYLSTDAAESETGLL  481

Query  716   QSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPG  537
             QSL+V+NGKTVPLV+RPARN AEKWDALLYRHGL+ D+QVEAMLDKT+CA+SSVFIG+ G
Sbjct  482   QSLLVWNGKTVPLVRRPARNFAEKWDALLYRHGLDGDSQVEAMLDKTVCAMSSVFIGSSG  541

Query  536   STFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             STFTEDILRLR+ WGSAS+CDEYLCQGE+PNF A+DE
Sbjct  542   STFTEDILRLRKDWGSASLCDEYLCQGELPNFTAEDE  578



>ref|XP_006357428.1| PREDICTED: uncharacterized protein LOC102602087 [Solanum tuberosum]
Length=565

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/571 (68%), Positives = 463/571 (81%), Gaps = 27/571 (5%)
 Frame = -3

Query  2120  NLIGDGERRDG-ARSPGRSSFQIDGNKDRFIDPARFNFICRK--RYCLAIILPLFVILLY  1950
             NLI   ER +  + SP R++FQID   D   D   FN  C K   +   I++ +F+ + +
Sbjct  16    NLIAQRERGNNLSESPVRTAFQID---DEIADTRPFNSSCSKCCYFLTIIVVTVFIFIRF  72

Query  1949  ATTDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAV  1770
              TTD+ N+ +TGV     +   N MRESELRALYLLRQQQL LFK WN+T ++ +  A  
Sbjct  73    YTTDVDNVSKTGVMN---NDSVNLMRESELRALYLLRQQQLGLFKLWNNTLIDNSLNATA  129

Query  1769  nntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLG  1590
              N  N  S++                FS+   E+LK +L+SQISLNKQIQQ LLSSHQLG
Sbjct  130   ANNSNFVSTSL---------------FSSALSEELKLELISQISLNKQIQQALLSSHQLG  174

Query  1589  NSLDLSDNNTDPSI---SGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLI  1419
             N L+ SDN TDPS+    GL RCRK+D   S+R+TIEW+P S+KYLFAIC SGQMSNHLI
Sbjct  175   NLLNASDNATDPSLDDYGGLDRCRKMDYKLSDRRTIEWEPRSDKYLFAICASGQMSNHLI  234

Query  1418  CLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVH  1239
             CLEKHMFFAA+LNR L++PSS+VDYEF+RVLD+DHINKCLGRKVV+T+EEFA+SQK H+H
Sbjct  235   CLEKHMFFAALLNRILIIPSSRVDYEFRRVLDIDHINKCLGRKVVVTFEEFAKSQKGHMH  294

Query  1238  IDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSN  1059
             IDK ICYFSQPQPCF+DD+ +KKLKS GVSMNK+E AW+ED+K PK +TVQDI++KFS +
Sbjct  295   IDKFICYFSQPQPCFLDDEHVKKLKSLGVSMNKLEAAWDEDIKNPKPRTVQDIMTKFSLD  354

Query  1058  DDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALH  879
             DDVIAIGDVFFA+VE  WVMQPGGPI+HKCKTL+EPSRLI+LTAQRF+QTFLG++FIALH
Sbjct  355   DDVIAIGDVFFANVEKKWVMQPGGPISHKCKTLVEPSRLILLTAQRFIQTFLGKNFIALH  414

Query  878   FRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVF  699
             FRRHGFLKFCNAKKPSCFYPVPQAADCINRV+ERA +PVIYLSTDAAESET +LQSLV  
Sbjct  415   FRRHGFLKFCNAKKPSCFYPVPQAADCINRVVERATAPVIYLSTDAAESETGILQSLVAV  474

Query  698   NGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTED  519
             NGKTVPLV+RPA+NSAEKWDALLYRHGLE D QVEAMLDKTICA+S VFIG+ GSTFTED
Sbjct  475   NGKTVPLVRRPAQNSAEKWDALLYRHGLEGDRQVEAMLDKTICAMSEVFIGSMGSTFTED  534

Query  518   ILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             ILRLR+ WG++S+CDEYLC+GEVP+FIADDE
Sbjct  535   ILRLRKDWGTSSLCDEYLCRGEVPSFIADDE  565



>ref|XP_004242264.2| PREDICTED: uncharacterized protein LOC101262928 [Solanum lycopersicum]
Length=564

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/572 (68%), Positives = 460/572 (80%), Gaps = 30/572 (5%)
 Frame = -3

Query  2120  NLIGDGERRDG-ARSPGRSSFQIDGN--KDRFIDPARFNFICRKRYCLA-IILPLFVILL  1953
             NLI   +R +  +  P R++FQID      R  DP+     C K  C + II  +FVI+L
Sbjct  16    NLIAQRQRGNNLSEFPERTAFQIDDEIANTRPSDPS-----CSKCCCFSTIIFAVFVIIL  70

Query  1952  YATTDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAA  1773
               +T + N+ +TGV     +   N M ESELRAL LLRQQQL LFK WN+T ++ +  A 
Sbjct  71    CFSTGVNNVSKTGVMN---NDSVNLMLESELRALSLLRQQQLGLFKLWNNTLIDNSLNAT  127

Query  1772  VnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQL  1593
               N  N  S++                FS+V  E+LK DL+SQISLNKQIQQ LLSSHQL
Sbjct  128   AANNSNIVSTSL---------------FSSVLSEELKLDLISQISLNKQIQQALLSSHQL  172

Query  1592  GNSLDLSDNNTDPSI---SGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHL  1422
              N L+ SDN TDPS+   SGL RCRK+D   S+R+TIEWKP S+KYLFAIC SGQMSNHL
Sbjct  173   SNLLNASDNATDPSLDDYSGLHRCRKMDYKLSDRRTIEWKPRSDKYLFAICASGQMSNHL  232

Query  1421  ICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHV  1242
             ICLEKHMFFAA+LNR +++PSS+VDYEF+RVLD+DHINKCLGRKVV+T+EEFA+SQK H+
Sbjct  233   ICLEKHMFFAALLNRIMIIPSSRVDYEFRRVLDIDHINKCLGRKVVVTFEEFAKSQKGHM  292

Query  1241  HIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSS  1062
             HIDK +CYFSQPQPCF+DD+ +KKLKS GVS NK+E AW+ED+K PK +TVQDI+SKFS 
Sbjct  293   HIDKFVCYFSQPQPCFLDDEHLKKLKSLGVSTNKLEAAWDEDIKNPKPRTVQDIMSKFSL  352

Query  1061  NDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIAL  882
             +D VIAIGDVFFA+VE  WVMQPGGPI+HKCKTL+EPSRLI+LTAQRF+QTFLG++FIAL
Sbjct  353   DDAVIAIGDVFFANVEKKWVMQPGGPISHKCKTLVEPSRLILLTAQRFIQTFLGKNFIAL  412

Query  881   HFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVV  702
             HFRRHGFLKFCNAKKPSCFYPVPQAADCINRV+ERA +PVIYLSTDAAESET +LQSLVV
Sbjct  413   HFRRHGFLKFCNAKKPSCFYPVPQAADCINRVVERATAPVIYLSTDAAESETGILQSLVV  472

Query  701   FNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTE  522
              NGKTVPLV+RPA+NSAEKWDALLYRHGLE D QVEAMLDKTICA+S VFIG+ GSTFTE
Sbjct  473   VNGKTVPLVRRPAQNSAEKWDALLYRHGLEGDRQVEAMLDKTICAISEVFIGSMGSTFTE  532

Query  521   DILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             DILRLR+ WG++S+CDEYLC+GEVPNFIADDE
Sbjct  533   DILRLRKAWGTSSLCDEYLCRGEVPNFIADDE  564



>ref|XP_002264087.1| PREDICTED: uncharacterized protein LOC100254979 [Vitis vinifera]
Length=559

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/568 (68%), Positives = 454/568 (80%), Gaps = 25/568 (4%)
 Frame = -3

Query  2120  NLIGDGERRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATT  1941
             NLI + ER+     P RS FQI+  K R +   RF+F   KRY  AI  PLF++L+Y TT
Sbjct  14    NLIDENERK----LPHRSGFQIEDFKSR-LSAHRFSF--NKRYLFAIFPPLFILLIYFTT  66

Query  1940  DIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHT-FVNKTRLAAVnn  1764
             D++N+F T +S +  DSP +RMRESELRALYLLRQQQL LF  WNHT F +   + + ++
Sbjct  67    DVRNLFTTSISIVKADSPTDRMRESELRALYLLRQQQLSLFSLWNHTAFADSAPIPSNSS  126

Query  1763  tgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNS  1584
                   S      S++               D K+ LL QISLNK+IQQVLLSSH  GN 
Sbjct  127   NSTLDFSTRQVLLSSA---------------DFKSALLKQISLNKEIQQVLLSSHPSGNL  171

Query  1583  LDLSDNNTDPSISG--LGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLE  1410
              +L D+N D +       RC KV+Q  S+R TIEWKP S+KYLFAIC+SGQMSNHLICLE
Sbjct  172   SELVDDNGDLNFGAYSFNRCPKVNQNMSQRPTIEWKPRSDKYLFAICLSGQMSNHLICLE  231

Query  1409  KHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDK  1230
             KHMFFAA+LNR LV+PSSK DY++ RVLD++HIN CLGRKVV+T+EEF ES+KNH+HID+
Sbjct  232   KHMFFAALLNRILVIPSSKFDYQYNRVLDIEHINNCLGRKVVVTFEEFTESKKNHLHIDR  291

Query  1229  VICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDV  1050
             VICYFS P PC++DDD +KKLKS G+SM K+E AW ED+KKPK++T QD+ +KFSSNDDV
Sbjct  292   VICYFSLPLPCYVDDDHVKKLKSLGISMGKLEPAWAEDIKKPKKRTAQDVQAKFSSNDDV  351

Query  1049  IAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRR  870
             IAIGDVF+A+VE  WVMQPGGP+AHKC+TLIEPSRLIMLTAQRFVQTFLG+ F ALHFRR
Sbjct  352   IAIGDVFYANVEEEWVMQPGGPLAHKCQTLIEPSRLIMLTAQRFVQTFLGKSFTALHFRR  411

Query  869   HGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGK  690
             HGFLKFCNAK+PSCF+P+PQAADCI+RV+ERA++PVIYLSTDAAESET LLQSLVV NGK
Sbjct  412   HGFLKFCNAKEPSCFFPIPQAADCISRVVERADTPVIYLSTDAAESETGLLQSLVVLNGK  471

Query  689   TVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILR  510
              VPL+KRP RNSAEKWDALLYRHGL+ D+QVEAMLDKTICA++SVFIGAPGSTFTEDILR
Sbjct  472   LVPLIKRPTRNSAEKWDALLYRHGLDGDSQVEAMLDKTICAMASVFIGAPGSTFTEDILR  531

Query  509   LRRGWGSASMCDEYLCQGEVPNFIADDE  426
             LRRGWGSAS CDEYLCQGE PNFIAD+E
Sbjct  532   LRRGWGSASHCDEYLCQGEQPNFIADNE  559



>gb|EYU21259.1| hypothetical protein MIMGU_mgv1a003863mg [Erythranthe guttata]
Length=559

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/574 (68%), Positives = 454/574 (79%), Gaps = 38/574 (7%)
 Frame = -3

Query  2120  NLIGDGER-RDGARSPG----RSSFQIDGNKDRFIDPAR-FNFICRKRYCLAIILPLFVI  1959
             NLI    R  D  +SP     RS+ +IDG   R    AR FN    KRY LAI+LP+ ++
Sbjct  15    NLISQNARPNDVVKSPTNHTRRSALRIDGG-GRLSGAARGFN----KRYLLAILLPMVIL  69

Query  1958  LLYATTDIKNIFRT---GVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNK  1788
             +LY TTD+K++F+     +  I  +SP NRMRESELRALYLL+QQ+L+L K WN+T +  
Sbjct  70    ILYFTTDLKSLFQMRIPTIKDIGGNSPLNRMRESELRALYLLKQQELQLLKMWNYTTLQN  129

Query  1787  TRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLL  1608
                ++  N                         S  F EDLK+ + SQISLNKQIQ +LL
Sbjct  130   QSNSSSVNN------------------------SNSFDEDLKSRVFSQISLNKQIQGILL  165

Query  1607  SSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSN  1428
             SSH+     DL++NNTD S+SG   C KVDQ  SER+TIEWKP SNKYL AICVSGQMSN
Sbjct  166   SSHESEGFPDLNENNTDASLSGWNMCGKVDQKLSERRTIEWKPRSNKYLLAICVSGQMSN  225

Query  1427  HLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN  1248
             HLICLEKHMFFAA+LNR LV+PSSKVD+ F RVLD++ INKCLGRKVV+T+EEFAE +KN
Sbjct  226   HLICLEKHMFFAALLNRVLVIPSSKVDFPFHRVLDIETINKCLGRKVVVTFEEFAEIKKN  285

Query  1247  HVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKF  1068
             H+HIDK +CYFS PQPCFMDDD +KKLK  G+S+ KIET W EDVKKP Q+ V D+ +KF
Sbjct  286   HLHIDKFMCYFSLPQPCFMDDDHLKKLKGLGLSLGKIETVWKEDVKKPNQRKVDDVTAKF  345

Query  1067  SSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFI  888
             SS+DDVIA+GDVFFADVE  WVMQPGGPIAHKCKTLIEPSRLI+LTA RF+QTFLG+DFI
Sbjct  346   SSDDDVIAVGDVFFADVEREWVMQPGGPIAHKCKTLIEPSRLILLTAHRFIQTFLGKDFI  405

Query  887   ALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSL  708
             ALHFRRHGFLKFCNAK+PSCF+PVPQAA+CINRV+ERAN+PV+YLSTDAA SET LLQSL
Sbjct  406   ALHFRRHGFLKFCNAKQPSCFFPVPQAAECINRVVERANTPVVYLSTDAAASETGLLQSL  465

Query  707   VVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTF  528
             VV+NGKTVPLV+RPARN AEKWDALLYRHGLE D+QVEAMLDKTICALSSVFIG+ GSTF
Sbjct  466   VVWNGKTVPLVQRPARNLAEKWDALLYRHGLEGDSQVEAMLDKTICALSSVFIGSSGSTF  525

Query  527   TEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             TEDILR+R+ WGSAS+CDEYLCQGE+PNFIA+DE
Sbjct  526   TEDILRIRKDWGSASVCDEYLCQGELPNFIAEDE  559



>ref|XP_010096529.1| hypothetical protein L484_017982 [Morus notabilis]
 gb|EXB64649.1| hypothetical protein L484_017982 [Morus notabilis]
Length=578

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/574 (65%), Positives = 466/574 (81%), Gaps = 20/574 (3%)
 Frame = -3

Query  2120  NLIGDGERRDGARSPGRSSFQID----GNKDRFIDPARFNF---ICRKRYCLAIILPLFV  1962
             NLI   ER+   ++  RS+F ID    GN++      R      +  K++  AI LPLF+
Sbjct  16    NLIEQNERK--LQNHPRSTFHIDDVDGGNREFRSRIRRRLSSLGLLNKKFMFAIFLPLFI  73

Query  1961  ILLYATTDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTR  1782
             ++L+ +TD++ +F   +S + FDS ++R+RESELRAL+LLRQQQL LF  WN TF +   
Sbjct  74    VVLFLSTDVRGLFSADLSGVRFDSFSDRLRESELRALFLLRQQQLGLFALWNQTFHDSPP  133

Query  1781  LAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSS  1602
             +++ +   +S+SS+  S +S +             ++DLK  +L Q+SLNK+IQQVLLS 
Sbjct  134   ISSNSTNNSSSSSSINSSASGTEQNSV--------IDDLKFAVLRQLSLNKEIQQVLLSP  185

Query  1601  HQLGNSLDLSDNNTDPSISG--LGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSN  1428
             H+ GNS  ++D   DP++ G     CRKVDQ +S+R+TIEWKP SNK+LFAIC+SGQMSN
Sbjct  186   HRSGNSSSITDAG-DPNLGGSDFDTCRKVDQKFSQRRTIEWKPNSNKFLFAICLSGQMSN  244

Query  1427  HLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN  1248
              LICLEKHMFFAA+LNR LV+PSSKVDY++ RVLD+DHINKCLGRKVV+++E+FAE++KN
Sbjct  245   RLICLEKHMFFAALLNRVLVIPSSKVDYQYNRVLDIDHINKCLGRKVVISFEDFAETKKN  304

Query  1247  HVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKF  1068
             H+HI++ ICYFSQPQPC++DD+ IKKLK  G++M K+E+AW ED+K P ++TVQD+ SKF
Sbjct  305   HMHINRFICYFSQPQPCYVDDEHIKKLKGLGLTMGKLESAWTEDIKGPNKRTVQDVQSKF  364

Query  1067  SSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFI  888
             S+NDDVIAIGDVF+ADVE  WVMQPGGP+AHKC+TLIEPSRLIMLTAQRF+QTFLG++F+
Sbjct  365   STNDDVIAIGDVFYADVEQEWVMQPGGPLAHKCQTLIEPSRLIMLTAQRFIQTFLGKNFV  424

Query  887   ALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSL  708
             ALHFRRHGFLKFCNAK+PSCF+P+PQAADCI  V+ERAN+PVIYLSTDAAESET LLQSL
Sbjct  425   ALHFRRHGFLKFCNAKQPSCFFPIPQAADCITSVVERANAPVIYLSTDAAESETGLLQSL  484

Query  707   VVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTF  528
             +V NGK VPLVKRPARNSAEKWDALLYRHGLE D+QVEAMLDKTICA+SSVFIGAPGSTF
Sbjct  485   IVLNGKPVPLVKRPARNSAEKWDALLYRHGLEGDSQVEAMLDKTICAMSSVFIGAPGSTF  544

Query  527   TEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             TEDILRLR+ WGSAS CD+YLCQGE PNF+AD+E
Sbjct  545   TEDILRLRKDWGSASSCDKYLCQGEEPNFVADNE  578



>ref|XP_007024790.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY27412.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=558

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/554 (65%), Positives = 435/554 (79%), Gaps = 39/554 (7%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFD  1893
             RSSF I+  + +     RF     KRY  AI LPL +I +Y +TDI+++F + +S + F+
Sbjct  39    RSSFHIEELESQI--RRRFKLTFNKRYLFAIFLPLLIIPIYFSTDIRSLFSSNISSLKFN  96

Query  1892  SPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnss  1713
             + ++R+RES+L+ALYLL QQQ  L   WNHTFVN                          
Sbjct  97    TVSDRIRESQLQALYLLNQQQNSLLSLWNHTFVNSNN-----------------------  133

Query  1712  lertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNT--DPSISGL  1539
                   + +AV  +D+KA LL+QI+LNK IQQ+LLS H+ GNS     N T  DP+ +G 
Sbjct  134   ------NITAVQFDDIKASLLTQITLNKHIQQILLSPHKTGNS---PQNGTLLDPNFAGY  184

Query  1538  G--RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVV  1365
                RCRKVDQ ++ERKT EWKP+ NK+LFAIC+SGQMSNHLICLEKHMFFAAVLNR LV+
Sbjct  185   SFDRCRKVDQKFAERKTFEWKPKPNKFLFAICLSGQMSNHLICLEKHMFFAAVLNRALVI  244

Query  1364  PSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDD  1185
             PSS+ DY++ RVLD++HIN C+G+K V+ +EEF E +KNH HIDK ICYFS PQPC++D+
Sbjct  245   PSSRFDYQYNRVLDIEHINGCIGKKAVIPFEEFMEIKKNHAHIDKFICYFSSPQPCYVDE  304

Query  1184  DRIKKLKSSGVSMNKIETAW-NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETG  1008
             + +KKLKS G+S  K+ETAW NED+KKP QKT++D+  KF S+DDVIAIGDVF+ADVE  
Sbjct  305   EHLKKLKSLGISTGKLETAWKNEDIKKPSQKTIKDVEEKFGSDDDVIAIGDVFYADVERD  364

Query  1007  WVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSC  828
             WV+QPGGPIAHKCKTLIEPS+LI+LTA+RF+QTFLG +FIALHFRRHGFLKFCNAKKPSC
Sbjct  365   WVLQPGGPIAHKCKTLIEPSKLILLTAERFIQTFLGSNFIALHFRRHGFLKFCNAKKPSC  424

Query  827   FYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAE  648
             FYP+PQAADCI R++ERAN+PVIYLSTDAAESETSLLQS+VV NGKT+PLVKRP RNSAE
Sbjct  425   FYPIPQAADCITRMVERANTPVIYLSTDAAESETSLLQSMVVLNGKTIPLVKRPPRNSAE  484

Query  647   KWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEY  468
             KWDALLYRHGL ED QVEAMLDKTICA+SSVFIGAPGSTFT DILRLR+ WG+AS+CDEY
Sbjct  485   KWDALLYRHGLAEDPQVEAMLDKTICAMSSVFIGAPGSTFTGDILRLRKDWGTASLCDEY  544

Query  467   LCQGEVPNFIADDE  426
             LCQGE PNF A +E
Sbjct  545   LCQGEDPNFTAGEE  558



>ref|XP_011079203.1| PREDICTED: uncharacterized protein LOC105162777 [Sesamum indicum]
Length=577

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/571 (67%), Positives = 459/571 (80%), Gaps = 24/571 (4%)
 Frame = -3

Query  2105  GERRDGARSPGR---SSFQIDGNKDRFIDPARFNFICRK---RYCLAIILPLFVILLYAT  1944
             G   D   SP     S+FQID   D    P  F+ +CR+   R  +AI L + +++L  T
Sbjct  20    GRPNDVLNSPNSRRPSTFQID---DGLKSP--FSGVCRRFKSRCLVAICLLVPILVLCFT  74

Query  1943  TDIKNIFRTGVSKITFDS----PANRMRESelralyllrqqqleLFKQWNHT-FVNKTRL  1779
              D KN+      +I   +    P NRMR SEL+ALYLL+QQ+ ELFK WN+T  VNK+ L
Sbjct  75    IDFKNMLPIRFPRIEVLTNSSIPVNRMRGSELQALYLLKQQEFELFKMWNYTALVNKSEL  134

Query  1778  AAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSH  1599
               VN++ +   S+A   ++ S         S+  LEDLK+ + SQISLNK+IQ VLLSS 
Sbjct  135   NLVNSSTSLNMSSANHDAAASP--------SSSLLEDLKSRIFSQISLNKRIQGVLLSSQ  186

Query  1598  QLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLI  1419
             + G+ +DL +N TD +  G  RC KVDQ  SER+TIEWKP S+KYLFAICVSGQMSNHLI
Sbjct  187   ENGDKVDLYENYTDANFLGWNRCGKVDQRLSERRTIEWKPRSDKYLFAICVSGQMSNHLI  246

Query  1418  CLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVH  1239
             CLEKHMFFAA+L+R LV+PS+KVDYEF+ VLD++HINKCLGRKVV+T+EEFAES+KNH+H
Sbjct  247   CLEKHMFFAALLDRVLVIPSAKVDYEFRNVLDIEHINKCLGRKVVVTFEEFAESKKNHLH  306

Query  1238  IDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSN  1059
             +DK +CYFS PQPCF+DDD +KKLK  G++++KIE  W EDVK+PKQ+TVQDI++ FSS+
Sbjct  307   VDKFMCYFSLPQPCFVDDDHVKKLKGLGLALSKIEAVWEEDVKQPKQRTVQDILANFSSD  366

Query  1058  DDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALH  879
             DD+IAIGDVFFADV+   VMQ GGPIAHKCKTLIEPSRLI+LTAQRF+QTFLG+DFIALH
Sbjct  367   DDIIAIGDVFFADVDRQRVMQSGGPIAHKCKTLIEPSRLILLTAQRFIQTFLGKDFIALH  426

Query  878   FRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVF  699
             FRRHGFLKFCNAK+PSCFYPVPQAADCINRV+ERANSPVIYLSTDAA+SET LLQSLV++
Sbjct  427   FRRHGFLKFCNAKQPSCFYPVPQAADCINRVVERANSPVIYLSTDAADSETGLLQSLVIW  486

Query  698   NGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTED  519
             NGKT+PLV+RPA NSAEKWDALLYRHGLE D+QVEAMLDKTICALS+VFIG+ GSTFTED
Sbjct  487   NGKTIPLVQRPAVNSAEKWDALLYRHGLEGDSQVEAMLDKTICALSTVFIGSSGSTFTED  546

Query  518   ILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             ILRLR+ WGSAS CDEYLC+GE+PNFIA+DE
Sbjct  547   ILRLRKDWGSASKCDEYLCEGELPNFIAEDE  577



>ref|XP_007024791.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY27413.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
Length=559

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/555 (65%), Positives = 435/555 (78%), Gaps = 40/555 (7%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFD  1893
             RSSF I+  + +     RF     KRY  AI LPL +I +Y +TDI+++F + +S + F+
Sbjct  39    RSSFHIEELESQI--RRRFKLTFNKRYLFAIFLPLLIIPIYFSTDIRSLFSSNISSLKFN  96

Query  1892  SPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnss  1713
             + ++R+RES+L+ALYLL QQQ  L   WNHTFVN                          
Sbjct  97    TVSDRIRESQLQALYLLNQQQNSLLSLWNHTFVNSNN-----------------------  133

Query  1712  lertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNT--DPSISGL  1539
                   + +AV  +D+KA LL+QI+LNK IQQ+LLS H+ GNS     N T  DP+ +G 
Sbjct  134   ------NITAVQFDDIKASLLTQITLNKHIQQILLSPHKTGNS---PQNGTLLDPNFAGY  184

Query  1538  G--RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVV  1365
                RCRKVDQ ++ERKT EWKP+ NK+LFAIC+SGQMSNHLICLEKHMFFAAVLNR LV+
Sbjct  185   SFDRCRKVDQKFAERKTFEWKPKPNKFLFAICLSGQMSNHLICLEKHMFFAAVLNRALVI  244

Query  1364  PSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDD  1185
             PSS+ DY++ RVLD++HIN C+G+K V+ +EEF E +KNH HIDK ICYFS PQPC++D+
Sbjct  245   PSSRFDYQYNRVLDIEHINGCIGKKAVIPFEEFMEIKKNHAHIDKFICYFSSPQPCYVDE  304

Query  1184  DRIKKLKSSGVSMNKIETAW-NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETG  1008
             + +KKLKS G+S  K+ETAW NED+KKP QKT++D+  KF S+DDVIAIGDVF+ADVE  
Sbjct  305   EHLKKLKSLGISTGKLETAWKNEDIKKPSQKTIKDVEEKFGSDDDVIAIGDVFYADVERD  364

Query  1007  WVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSC  828
             WV+QPGGPIAHKCKTLIEPS+LI+LTA+RF+QTFLG +FIALHFRRHGFLKFCNAKKPSC
Sbjct  365   WVLQPGGPIAHKCKTLIEPSKLILLTAERFIQTFLGSNFIALHFRRHGFLKFCNAKKPSC  424

Query  827   FYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAE  648
             FYP+PQAADCI R++ERAN+PVIYLSTDAAESETSLLQS+VV NGKT+PLVKRP RNSAE
Sbjct  425   FYPIPQAADCITRMVERANTPVIYLSTDAAESETSLLQSMVVLNGKTIPLVKRPPRNSAE  484

Query  647   KWDALLYRHGLEEDTQ-VEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDE  471
             KWDALLYRHGL ED Q VEAMLDKTICA+SSVFIGAPGSTFT DILRLR+ WG+AS+CDE
Sbjct  485   KWDALLYRHGLAEDPQVVEAMLDKTICAMSSVFIGAPGSTFTGDILRLRKDWGTASLCDE  544

Query  470   YLCQGEVPNFIADDE  426
             YLCQGE PNF A +E
Sbjct  545   YLCQGEDPNFTAGEE  559



>emb|CDO97781.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/425 (80%), Positives = 384/425 (90%), Gaps = 4/425 (1%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLD-LSDN-NTDPSI-SGLGRCRKVD  1518
             S   LEDLK+DLL  ISLNKQIQQVLLSSH+LG+ LD LS N +TDP++ +G   CRKV+
Sbjct  55    SPARLEDLKSDLLRHISLNKQIQQVLLSSHRLGDPLDSLSSNTSTDPTLGAGFDGCRKVE  114

Query  1517  QG-WSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYE  1341
             QG  S+R+TI+W P+SNKYLFA+CVSGQMSNHLICLEKHMFFAA LNR LV+PSSKVDYE
Sbjct  115   QGPSSQRRTIDWNPKSNKYLFAMCVSGQMSNHLICLEKHMFFAAALNRVLVIPSSKVDYE  174

Query  1340  FQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKS  1161
             F RVLD+DHINKCLGRKVV+T+EEFA S+KN   IDK +CYFS PQPCFMDD+R+KKLKS
Sbjct  175   FHRVLDIDHINKCLGRKVVVTFEEFAASRKNRPRIDKFLCYFSSPQPCFMDDERVKKLKS  234

Query  1160  SGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPI  981
              GVS+ K+E+AW +DVK PKQ+T+QD++SKFS++DDVIAIGDVFFADVE  WV QPGGPI
Sbjct  235   LGVSLPKLESAWTDDVKNPKQRTIQDVLSKFSTDDDVIAIGDVFFADVEREWVTQPGGPI  294

Query  980   AHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAAD  801
             AHKCKTLIEPSR I+LTAQRFVQTFLG DFIALHFRRHGFLKFCNAK+PSCFYPVPQAAD
Sbjct  295   AHKCKTLIEPSRFILLTAQRFVQTFLGRDFIALHFRRHGFLKFCNAKQPSCFYPVPQAAD  354

Query  800   CINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRH  621
             CINRV+ERAN+PVIYLSTDAAESET LLQSL+V NGKTVPLVKRP R+SAEKWDALLYRH
Sbjct  355   CINRVVERANTPVIYLSTDAAESETGLLQSLLVLNGKTVPLVKRPGRSSAEKWDALLYRH  414

Query  620   GLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNF  441
             GLE D+QVEAMLDKTICALS+ FIG+ GSTFTEDILRLR+GWGSASMCDEYLCQ EVPNF
Sbjct  415   GLEADSQVEAMLDKTICALSTAFIGSSGSTFTEDILRLRKGWGSASMCDEYLCQDEVPNF  474

Query  440   IADDE  426
             IA+DE
Sbjct  475   IAEDE  479



>gb|KHG12722.1| GDP-fucose O-fucosyltransferase 2 [Gossypium arboreum]
Length=558

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/557 (63%), Positives = 433/557 (78%), Gaps = 35/557 (6%)
 Frame = -3

Query  2087  ARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVS  1908
             A +  RS F I+  + +     RF     KRY  AI LPL +I ++ +TDI+++F + +S
Sbjct  34    ASTASRSGFHIEELESQI--RRRFKLTFNKRYLFAIFLPLVLIPIFLSTDIRSLFSSNIS  91

Query  1907  KITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsg  1728
              + F+  +++++ES+L+ALYLL QQ   L   WNHTFVN                     
Sbjct  92    SLKFNKVSDQLKESQLQALYLLNQQLTSLLSLWNHTFVNSN-------------------  132

Query  1727  ssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSI  1548
                        + SAV  +D+KA LL QI+LNK IQQ LLS H+ GN+L  +    DP+ 
Sbjct  133   ----------DNVSAVQFDDIKASLLKQITLNKHIQQTLLSPHKTGNTLQ-NATVLDPAY  181

Query  1547  SGLG--RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRF  1374
             +G    RCRK D  +SER+TIEWKP+ NK+LFAIC+SGQMSNHLICLEKHMFFAAVLNR 
Sbjct  182   AGYSFDRCRKGDLKFSERRTIEWKPKPNKFLFAICLSGQMSNHLICLEKHMFFAAVLNRA  241

Query  1373  LVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCF  1194
             LV+PSSK DY++ RVLD +HIN C+G+K V+ +E+F E +KNH HID+ ICYFS PQPC+
Sbjct  242   LVIPSSKFDYQYNRVLDTEHINDCVGKKAVIPFEDFMEMKKNHAHIDRFICYFSSPQPCY  301

Query  1193  MDDDRIKKLKSSGVSMNKIETAW-NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADV  1017
             +D++ +KKL+S G+SM K+E+AW NE++KKP QKT++D+  KF+S+DDVIAIGDVFFA++
Sbjct  302   VDEEHLKKLRSLGISMGKLESAWKNENIKKPSQKTIKDLEEKFASDDDVIAIGDVFFAEM  361

Query  1016  ETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKK  837
             E  WV QPGGPIAHKCKTLIEPS+LI+LTAQRF+QTFLG +FIALHFRRHGFLKFCNAKK
Sbjct  362   ERDWVTQPGGPIAHKCKTLIEPSKLILLTAQRFIQTFLGSNFIALHFRRHGFLKFCNAKK  421

Query  836   PSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARN  657
             PSCFYP+PQAADCI R++ERAN+P+IYLSTDAAESET LLQS+VV NGKT+PLVKRP RN
Sbjct  422   PSCFYPIPQAADCITRMVERANTPIIYLSTDAAESETGLLQSMVVLNGKTIPLVKRPPRN  481

Query  656   SAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMC  477
             SAEKWDALLYRHG+E+D QVEAMLDKTICA++SVFIGAPGSTFTEDILRLR+ WG+AS+C
Sbjct  482   SAEKWDALLYRHGIEDDPQVEAMLDKTICAMASVFIGAPGSTFTEDILRLRKDWGTASLC  541

Query  476   DEYLCQGEVPNFIADDE  426
             DEYLCQGE PNFIA +E
Sbjct  542   DEYLCQGEGPNFIASEE  558



>ref|XP_008380716.1| PREDICTED: uncharacterized protein LOC103443616 [Malus domestica]
Length=586

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/532 (68%), Positives = 423/532 (80%), Gaps = 27/532 (5%)
 Frame = -3

Query  2003  RKRYCLAIILPLFVILLYATTDIKNIFRTG--VSKITFDSPANRMRESelralyllrqqq  1830
             R    LAI +P F I+L+  TDIK +  T    S   +DS + ++RESELRALYLL+QQQ
Sbjct  76    RSFVVLAIFVPTFFIILFFVTDIKALLFTAGNFSSXPYDSASGKLRESELRALYLLKQQQ  135

Query  1829  leLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLL  1650
             + LF  W  T  N T  +   +  + ++                       L+DLK+ +L
Sbjct  136   VSLFNLWKQTLPNPTNSSNSTSNHSDSTQIP-------------------LLDDLKSAVL  176

Query  1649  SQISLNKQIQQVLLSSHQLGNSL--DLSD--NNTDPSISGLGRCRKVDQGWSERKTIEWK  1482
              QIS+N+ IQQVLLS H+ GNS   D  D  +  +PS+    RCR VDQ +S+R+TIEWK
Sbjct  177   RQISINRDIQQVLLSPHRTGNSTEPDFRDFGDFENPSLGD--RCRTVDQQFSQRRTIEWK  234

Query  1481  PESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKC  1302
             P SNKYLFAICVSGQMSNHLICLEKHMFFAA+LNR LV+PS KVDY+F RVLD+DHINKC
Sbjct  235   PNSNKYLFAICVSGQMSNHLICLEKHMFFAALLNRVLVIPSHKVDYQFSRVLDIDHINKC  294

Query  1301  LGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWN  1122
             LGR VV+T+EE AE +KNH+HIDK ICYF  P PC++D++ +KKLK +GVSMNK+E+AW 
Sbjct  295   LGRTVVVTFEELAEKKKNHIHIDKFICYFLHPTPCYVDNEHVKKLKGAGVSMNKLESAWV  354

Query  1121  EDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRL  942
             EDVKKP ++TVQD+ SKFSSNDDVIAIGDVFFAD+E  WVMQPGGP+AHKCKTLIEPSRL
Sbjct  355   EDVKKPTKRTVQDVQSKFSSNDDVIAIGDVFFADLEQEWVMQPGGPLAHKCKTLIEPSRL  414

Query  941   IMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPV  762
             IMLTAQRF+QTFLG++F+ALHFRRHGFLKFCN K+PSCFYP+PQAADCI RV +RAN+ V
Sbjct  415   IMLTAQRFIQTFLGKNFVALHFRRHGFLKFCNNKQPSCFYPIPQAADCITRVAQRANAAV  474

Query  761   IYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLD  582
             IYLSTDAAESET LLQSLVV NGKTVPLVKRPARNSAEKWDALLYRHG+E D QVEAMLD
Sbjct  475   IYLSTDAAESETGLLQSLVVVNGKTVPLVKRPARNSAEKWDALLYRHGIEGDAQVEAMLD  534

Query  581   KTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             KTICA+SSVFIGA GSTFTEDILRLR+ WGSAS+CDEYLCQGE PNFIA++E
Sbjct  535   KTICAMSSVFIGASGSTFTEDILRLRKDWGSASLCDEYLCQGEDPNFIAENE  586



>ref|XP_010033639.1| PREDICTED: uncharacterized protein LOC104422884 [Eucalyptus grandis]
 gb|KCW53340.1| hypothetical protein EUGRSUZ_J02587 [Eucalyptus grandis]
Length=580

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/525 (69%), Positives = 432/525 (82%), Gaps = 13/525 (2%)
 Frame = -3

Query  2000  KRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleL  1821
             KRY  A+ LP+F++++Y T D+ ++F   VS I  DS  +RMRESELRALYLL+QQQ+ L
Sbjct  69    KRYLFAVFLPVFIVVVYFTADLHSLFSYDVSSIKADSFGDRMRESELRALYLLKQQQVGL  128

Query  1820  FKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQI  1641
                WN  F +   L A  N+  S S+++     + SL  + +SF     +D K+ +L QI
Sbjct  129   QTLWNRAFRD---LVADQNSSLSGSNSSEINKGHQSLASSSASF-----DDFKSSVLKQI  180

Query  1640  SLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYL  1461
             SLNK+IQ VLL +HQ GN   LS    D    G  RC+KVDQ +SER+TIEW P+SNK+L
Sbjct  181   SLNKEIQDVLLLAHQSGN---LSVEGADGF--GFDRCKKVDQWFSERRTIEWNPKSNKFL  235

Query  1460  FAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVL  1281
              AIC+SGQMSNHLICLEKHMFFAAVLNR LV+PS +VDY + RVLD+DHIN+CLGRKVV+
Sbjct  236   LAICLSGQMSNHLICLEKHMFFAAVLNRVLVIPSFRVDYRYHRVLDIDHINQCLGRKVVI  295

Query  1280  TYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPK  1101
             ++EEF+E +KNH+HID+ ICYFS PQ C++DD+ +KKLK+ G+SM K+E+ W EDVK+P 
Sbjct  296   SFEEFSEIRKNHLHIDRFICYFSSPQHCYVDDEHVKKLKNLGLSMAKLESPWKEDVKRPN  355

Query  1100  QKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQR  921
             ++T+QDI +KF+SNDDVIAIGDVFFADVE  WVMQPGGP+AHKCKTLIEPSRLIMLTA+R
Sbjct  356   KRTLQDIQAKFASNDDVIAIGDVFFADVEQEWVMQPGGPLAHKCKTLIEPSRLIMLTAER  415

Query  920   FVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDA  741
             F+QTFLG+D+IALHFRRHGFLKFCNAKKPSCFYP+PQAADCI+RV+ERAN+PVIYLSTDA
Sbjct  416   FIQTFLGKDYIALHFRRHGFLKFCNAKKPSCFYPIPQAADCISRVVERANTPVIYLSTDA  475

Query  740   AESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALS  561
             AESET LLQSLVV N K VPLVKRPA NSAEKWDALLYRHGL+ D+QVEAMLDKTICA+S
Sbjct  476   AESETGLLQSLVVVNEKVVPLVKRPASNSAEKWDALLYRHGLQGDSQVEAMLDKTICAMS  535

Query  560   SVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             SVFIGA GSTFTEDILRLR+ WGSAS+CDEYLCQGE PNFIA +E
Sbjct  536   SVFIGASGSTFTEDILRLRKDWGSASICDEYLCQGEDPNFIAGNE  580



>ref|XP_008372913.1| PREDICTED: uncharacterized protein LOC103436268 [Malus domestica]
Length=584

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/531 (68%), Positives = 419/531 (79%), Gaps = 30/531 (6%)
 Frame = -3

Query  2003  RKRYCLAIILPLFVILLYATTDIKNI-FRTG-VSKITFDSPANRMRESelralyllrqqq  1830
             R    LAI +P F+++L+  TD+K++ F TG  S   +DS + ++ ESELRALYLL+QQQ
Sbjct  74    RSFVLLAIFVPTFLVILFFVTDMKSLLFTTGNFSSSPYDSASGKLLESELRALYLLKQQQ  133

Query  1829  leLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLL  1650
             + LF  WN T  N T   +                                L+D K+ +L
Sbjct  134   VSLFNLWNXTLPNPTNSTS----------------------NHSDPXQIPLLDDFKSAVL  171

Query  1649  SQISLNKQIQQVLLSSHQLGNSL--DLSD--NNTDPSISGLGRCRKVDQGWSERKTIEWK  1482
              QISLN+ IQQVLLS H+ GNS   D  D  +  +PS+    RCR VDQ +S+R+TIEWK
Sbjct  172   RQISLNRDIQQVLLSPHRTGNSTEPDFRDFGDFENPSLGD--RCRAVDQQFSQRRTIEWK  229

Query  1481  PESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKC  1302
             P SNKYLFAICVSGQMSNHLICLEKHMFFAA+LNR LV+PS KVDY+F RVLD++HINKC
Sbjct  230   PNSNKYLFAICVSGQMSNHLICLEKHMFFAALLNRVLVIPSPKVDYQFSRVLDIEHINKC  289

Query  1301  LGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWN  1122
             LGR VV+T+EE  E +KNHVHIDK ICYFS P PC++DD+ +KKLK +GVSMNK+E+AW 
Sbjct  290   LGRTVVVTFEELDEKKKNHVHIDKFICYFSHPTPCYVDDEHVKKLKGAGVSMNKLESAWV  349

Query  1121  EDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRL  942
             EDVKKP ++TVQD+ SKFSSNDDVIAIGDVFFAD+E  WVMQ  GP+AHKCKTLIEPSRL
Sbjct  350   EDVKKPTKRTVQDVQSKFSSNDDVIAIGDVFFADLEQEWVMQARGPLAHKCKTLIEPSRL  409

Query  941   IMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPV  762
             IMLTAQRF+QTFLG++F+ALHFRRHGFLKFCN K+PSCFYP+PQAADCI RV ERAN+PV
Sbjct  410   IMLTAQRFIQTFLGKNFVALHFRRHGFLKFCNNKQPSCFYPIPQAADCIIRVAERANAPV  469

Query  761   IYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLD  582
             +YLSTDAAESET LLQSLVV NGKTVPLVKRPARNSAEKWDALLYR G+E D QVEAMLD
Sbjct  470   VYLSTDAAESETGLLQSLVVVNGKTVPLVKRPARNSAEKWDALLYRQGIEGDAQVEAMLD  529

Query  581   KTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADD  429
             KTICA+SSVFIGA GSTFTEDILRLR+ WGSAS+CDEYLCQGE PNFIA++
Sbjct  530   KTICAMSSVFIGASGSTFTEDILRLRKDWGSASLCDEYLCQGEDPNFIAEN  580



>ref|XP_010273795.1| PREDICTED: uncharacterized protein LOC104609241 [Nelumbo nucifera]
Length=573

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/551 (63%), Positives = 433/551 (79%), Gaps = 8/551 (1%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFD  1893
             RS+F+I   K +   P RF+    KRY LA  L L +I LY + D  N+FR+  +    D
Sbjct  29    RSTFEIGHLKTQLARPLRFS----KRYLLAFCLMLSLIFLYFSVDFGNLFRSVSTMKIAD  84

Query  1892  SPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnss  1713
             S  +RMRE+ELRALYLL+QQQL L   WN T ++   ++ +N        +  + ++NS+
Sbjct  85    SGTDRMREAELRALYLLKQQQLGLLSLWNATSIHSRSISVINPNSTLDIISNSTKNANSN  144

Query  1712  lertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG-  1536
                         +ED +  +++QI LNK+IQ+ LLSSH++GN L+L D N  P   G G 
Sbjct  145   STLQMEDLIPS-IEDFRYAVVNQIKLNKEIQEALLSSHRIGNLLELGDGNVVPEFGGYGF  203

Query  1535  -RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPS  1359
              RCRKV+   SE +TIEWKP+ NKYL AICVSGQMSNHLICLEKHMFFAAVL R LV+PS
Sbjct  204   DRCRKVEPK-SEERTIEWKPKGNKYLLAICVSGQMSNHLICLEKHMFFAAVLGRILVIPS  262

Query  1358  SKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             ++VD+++ RVLD+DHINKC GRKVV+++EEF+E +KNH+HID+ ICY S PQPC++DD+ 
Sbjct  263   ARVDFQYNRVLDIDHINKCFGRKVVVSFEEFSEMKKNHLHIDRFICYVSSPQPCYVDDEH  322

Query  1178  IKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVM  999
             IKKL++ G++  K+E  W ED+K+PK++T  D++ KFS+NDDV+AIGDVFFADVE  W+M
Sbjct  323   IKKLRALGITTGKLEAPWVEDIKEPKKRTFNDVLEKFSANDDVLAIGDVFFADVEQEWIM  382

Query  998   QPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYP  819
             QPGGP+AHKC+T+IEPSRLIMLTAQRF+QTFLG++FIALHFRRHGFLKFCNAKKPSCF+ 
Sbjct  383   QPGGPLAHKCQTVIEPSRLIMLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAKKPSCFFS  442

Query  818   VPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWD  639
             +PQAADCI RV+ERA+ PVIYLSTDAAESET LLQSL+  NGK +PLVKRPARNSAEKWD
Sbjct  443   IPQAADCITRVVERADVPVIYLSTDAAESETDLLQSLIRLNGKAIPLVKRPARNSAEKWD  502

Query  638   ALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQ  459
             ALLYRHGLE D+QVEAMLDKTICA+SSVFIG+ GSTFTEDILRLR+ W SAS+CDEYLCQ
Sbjct  503   ALLYRHGLEGDSQVEAMLDKTICAMSSVFIGSAGSTFTEDILRLRKDWRSASICDEYLCQ  562

Query  458   GEVPNFIADDE  426
             GE PNFI+D E
Sbjct  563   GEEPNFISDSE  573



>gb|KHG23198.1| GDP-fucose O-fucosyltransferase 2 [Gossypium arboreum]
Length=775

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/549 (62%), Positives = 427/549 (78%), Gaps = 36/549 (7%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFD  1893
             RS F ++G + +    ++  F   K Y  A++LPL ++ +Y +TDI+++F + +S   F+
Sbjct  23    RSGFNVEGLEPQMRRRSKLTF--HKGYLFALVLPLLIVFIYFSTDIRSLFTSDISSFKFN  80

Query  1892  SPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnss  1713
             + + ++RES+L+AL+LL QQQ  L   WNHT VN   +  V                   
Sbjct  81    TVSGQIRESQLQALHLLNQQQSSLLSIWNHTLVNSNNITTVQ------------------  122

Query  1712  lertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG-  1536
                          +D+KA LL+QI+LNK IQQ+LLS ++ G++L  +    DPS +G   
Sbjct  123   ------------FDDIKATLLTQITLNKHIQQILLSPYKAGDTLQ-NGTALDPSSAGYSF  169

Query  1535  -RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPS  1359
              RCRKVDQ +SER+TIEWKP  NK+LFAIC+SGQMSNHLICLEKHMFFAA+LNR LV+PS
Sbjct  170   HRCRKVDQKFSERRTIEWKPRRNKFLFAICLSGQMSNHLICLEKHMFFAAILNRALVIPS  229

Query  1358  SKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             S+ DY++ RVLD+ HIN C+G+KVV+ +E+F + +KNH HIDK ICYFS PQPC+MD++ 
Sbjct  230   SRFDYQYNRVLDIAHINDCIGKKVVVPFEDFMKLKKNHAHIDKFICYFSTPQPCYMDEEH  289

Query  1178  IKKLKSSGVSMNKIETAW-NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWV  1002
             +KKLKS G+S  K+E AW NEDVK P +KTV+D+  KF S+DDVIAIGDV+FADV+  W+
Sbjct  290   LKKLKSLGISTGKLEAAWKNEDVKNPSRKTVKDVEEKFGSDDDVIAIGDVYFADVDRDWM  349

Query  1001  MQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFY  822
             +QPGGPIAHKCKTLIEPS+LI+LTA+RF+QTFLG +FIALHFRRHGFLKFCNAKKPSCFY
Sbjct  350   LQPGGPIAHKCKTLIEPSKLILLTAERFIQTFLGSNFIALHFRRHGFLKFCNAKKPSCFY  409

Query  821   PVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKW  642
             P+PQAADCI R++ERANSPVIYLSTDAA SET LLQS+++ NGKT+PLVKRP RNSAEKW
Sbjct  410   PIPQAADCITRMVERANSPVIYLSTDAAGSETGLLQSMIMLNGKTIPLVKRPPRNSAEKW  469

Query  641   DALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLC  462
             DALLYRHGLE D+QVEAMLDKTICA++SVFIGA GSTFTEDILRLR+ WG+AS+CDEYLC
Sbjct  470   DALLYRHGLEGDSQVEAMLDKTICAMASVFIGASGSTFTEDILRLRKDWGTASICDEYLC  529

Query  461   QGEVPNFIA  435
             QGE PNFI+
Sbjct  530   QGENPNFIS  538



>ref|XP_004303772.1| PREDICTED: uncharacterized protein LOC101299396 [Fragaria vesca 
subsp. vesca]
Length=556

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/519 (68%), Positives = 418/519 (81%), Gaps = 39/519 (8%)
 Frame = -3

Query  1982  IILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNH  1803
             I +PLFV++L+ +TDIK++F + +S    DS + ++RESELRALYLLRQQQL LF  WN 
Sbjct  77    IFIPLFVLVLFFSTDIKSLFFSHLS--VSDSVSGKLRESELRALYLLRQQQLGLFGLWNS  134

Query  1802  TFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQI  1623
             T                                  S+ S   L+DLK+ +L QISLNK+I
Sbjct  135   T----------------------------------SNHSNPDLDDLKSSVLRQISLNKEI  160

Query  1622  QQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVS  1443
             QQVLLS H  GNS + S++  DPS+    RCR VDQ +SER+TIEWKP S+KYL AICVS
Sbjct  161   QQVLLSPHSSGNSSE-SEDFRDPSLGD--RCRVVDQRFSERRTIEWKPNSDKYLLAICVS  217

Query  1442  GQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFA  1263
             GQMSNHLICLEKHMFFAA+LNR LV+PSSKVDY++  VLD++HINKC+GRKVV+T+EE A
Sbjct  218   GQMSNHLICLEKHMFFAALLNRILVIPSSKVDYQYSTVLDIEHINKCIGRKVVVTFEELA  277

Query  1262  ESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQD  1083
             E +KNH+HID+ ICYFS+P  C++DD+ +KKLK+ G+S    E AW EDVKKP +KTVQD
Sbjct  278   EEKKNHIHIDRFICYFSKPTLCYVDDEHLKKLKALGISYKSREPAWGEDVKKPSKKTVQD  337

Query  1082  IVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFL  903
             + SKFSS D+VIAIGDVFFAD E  WVMQPGGP+AHKCKTLIEPSRLI+LTAQRF+QTFL
Sbjct  338   VQSKFSSGDEVIAIGDVFFADAEQDWVMQPGGPLAHKCKTLIEPSRLILLTAQRFIQTFL  397

Query  902   GEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETS  723
             G++F+ALHFRRHGFLKFCN K+PSCFYP+PQAADCI R+ ERAN+PV+YLSTDAAESET 
Sbjct  398   GKNFVALHFRRHGFLKFCNNKQPSCFYPIPQAADCITRIAERANAPVVYLSTDAAESETG  457

Query  722   LLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGA  543
             LLQSLVV NGKTVPLVKRPARNSAEKWDALLYRHG+E D QVEAMLDKTI A+SSVFIGA
Sbjct  458   LLQSLVVVNGKTVPLVKRPARNSAEKWDALLYRHGIEGDPQVEAMLDKTISAMSSVFIGA  517

Query  542   PGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
              GSTFTEDILRLR+GWGSAS+CDEYLCQGE PNFIA++E
Sbjct  518   SGSTFTEDILRLRKGWGSASVCDEYLCQGEEPNFIAENE  556



>ref|XP_004144450.1| PREDICTED: uncharacterized protein LOC101208722 [Cucumis sativus]
 ref|XP_004165989.1| PREDICTED: uncharacterized protein LOC101230373 [Cucumis sativus]
Length=573

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/535 (65%), Positives = 420/535 (79%), Gaps = 21/535 (4%)
 Frame = -3

Query  2021  RFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKI--TFDSPANRMRESelraly  1848
             +F F  R  Y LA  LPL +++L+ + DI ++F T +S    T DS  +RMRESEL ALY
Sbjct  57    KFAFDKRYYYLLAAALPLCILVLFFSVDITSLFSTTLSSTLKTSDSLTDRMRESELTALY  116

Query  1847  llrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLED  1668
             LLRQQQL  F  WNH+   ++                   SS +S      S ++   E 
Sbjct  117   LLRQQQLGFFHLWNHSLFLQSN------------------SSFNSTPSNNLSSNSALTEY  158

Query  1667  LKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIE  1488
             +K+ LL QI+LNK+IQ VLLS H+ GN  +   +        L RCRK+DQ  S+R+TIE
Sbjct  159   IKSALLKQITLNKEIQNVLLSPHRSGNLSEEVGDALPMDTFALDRCRKMDQKLSDRRTIE  218

Query  1487  WKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHIN  1308
             WKP+SNK+LFAIC SGQMSNHLICLEKHMFFAA+LNR LV+PS KVDY+F RV+D+D +N
Sbjct  219   WKPKSNKFLFAICTSGQMSNHLICLEKHMFFAAILNRVLVIPSHKVDYQFSRVIDIDRMN  278

Query  1307  KCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETA  1128
              CLGRKVV+++EEF+E +K+H+HID+ ICYFS+P PC++DD+ I KLK+ G+SM K+E+A
Sbjct  279   MCLGRKVVISFEEFSEIKKHHLHIDRFICYFSKPNPCYVDDEHISKLKNLGISMGKLESA  338

Query  1127  WNEDVKKPKQKTVQDIVSKFSSN-DDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEP  951
             WNED K P +KTV D+ SKFSSN DDVIA+GD+FFA+VE  WV QPGGPIAHKC+TLIEP
Sbjct  339   WNEDTKHPNRKTVSDVESKFSSNNDDVIAVGDIFFANVEQEWVNQPGGPIAHKCQTLIEP  398

Query  950   SRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERAN  771
             S LI LTAQRF+QTFLG+++IALHFRRHGFLKFCNAK+PSCFYP+PQAADCI R++ERAN
Sbjct  399   SHLIKLTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKQPSCFYPIPQAADCIIRMVERAN  458

Query  770   SPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEA  591
              PVIYLSTDAAESE  LLQSL+V NGK +PLVKRP RNSAEKWDALLYRHGLEED+QVEA
Sbjct  459   VPVIYLSTDAAESEHGLLQSLLVLNGKPIPLVKRPPRNSAEKWDALLYRHGLEEDSQVEA  518

Query  590   MLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             MLDKTICA+SS FIGAPGSTFTEDILRLR+ WG+ASMCDEYLCQGE PNFI+++E
Sbjct  519   MLDKTICAMSSTFIGAPGSTFTEDILRLRKDWGTASMCDEYLCQGEEPNFISENE  573



>ref|XP_002303337.1| protein-O-fucosyltransferase 2 [Populus trichocarpa]
 gb|EEE78316.1| protein-O-fucosyltransferase 2 [Populus trichocarpa]
Length=527

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/530 (66%), Positives = 418/530 (79%), Gaps = 36/530 (7%)
 Frame = -3

Query  1997  RYCL----AIILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelralyllrqqq  1830
             RY L     I LPLF++ L  +TDI+N+F T +     DS + RMRESELRALYLL++QQ
Sbjct  28    RYSLFAAAIIFLPLFILFLSFSTDIRNLFSTHLK--VGDSLSIRMRESELRALYLLKKQQ  85

Query  1829  leLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLL  1650
             L LF  WN T  N T L                              ++V  EDLK+ LL
Sbjct  86    LSLFSLWNST-GNSTLLEK--------------------------DLNSVSFEDLKSALL  118

Query  1649  SQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISG--LGRCRKVDQGWSERKTIEWKPE  1476
              QISLNK+IQQVLL+ H+ GN +  S ++ D S +G  + RC KVDQ +++RKTIEWKP+
Sbjct  119   KQISLNKEIQQVLLAPHESGN-VSSSSSDLDFSNAGGFVQRCEKVDQRFADRKTIEWKPK  177

Query  1475  SNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLG  1296
              NK+LFA+C+SGQMSNHLICLEKHMFFAA+LNR LV+PSS+ DY++ RVLD++H+N CLG
Sbjct  178   PNKFLFALCLSGQMSNHLICLEKHMFFAALLNRVLVIPSSRFDYQYNRVLDIEHVNDCLG  237

Query  1295  RKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNED  1116
             RKVV+T+EEF E  KN  HID+  CYFS P PC++D++ +KKLK  GVSM K+E+ W ED
Sbjct  238   RKVVVTFEEFVEIMKNKPHIDRFFCYFSDPTPCYVDEEHVKKLKGLGVSMGKLESPWKED  297

Query  1115  VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIM  936
             +KKP + TV+D+  KF S+D+VIA+GDVFFADVE  W+MQPGGPIAHKCKTLIEP+R+IM
Sbjct  298   IKKPSKLTVKDVEGKFVSDDNVIAVGDVFFADVEEEWIMQPGGPIAHKCKTLIEPTRIIM  357

Query  935   LTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIY  756
             LTAQRF+QTFLG +FIALHFRRHGFLKFCNAKKPSCFYPVPQAADCI RV+ERAN+PV+Y
Sbjct  358   LTAQRFIQTFLGSNFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCIARVVERANAPVVY  417

Query  755   LSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKT  576
             LSTDAAESET LLQSLVV NG+TVPLV RP+RN+AEKWDALLYRHGL+ED QVEAMLDKT
Sbjct  418   LSTDAAESETGLLQSLVVVNGRTVPLVTRPSRNAAEKWDALLYRHGLQEDAQVEAMLDKT  477

Query  575   ICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             ICA+SSVFIGA GSTFTEDI RLR+GW SAS CDEYLCQGE+PN+IA++E
Sbjct  478   ICAMSSVFIGASGSTFTEDIFRLRKGWESASSCDEYLCQGELPNYIAENE  527



>ref|XP_011031831.1| PREDICTED: uncharacterized protein LOC105130840 [Populus euphratica]
Length=556

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/538 (65%), Positives = 419/538 (78%), Gaps = 36/538 (7%)
 Frame = -3

Query  2021  RFNFICRKRYCL----AIILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelra  1854
             R  F   KRY L     I LPLF++ L  +TDI+N+F T +     DS + RMRESELRA
Sbjct  49    RHRFTFNKRYSLLAAAIIFLPLFILFLSFSTDIRNLFSTHLK--VGDSLSIRMRESELRA  106

Query  1853  lyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFL  1674
             LYLL++QQL LF  WN T  N T L                              ++V  
Sbjct  107   LYLLKKQQLSLFSLWNFT-GNSTLLEK--------------------------DLNSVSF  139

Query  1673  EDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISG--LGRCRKVDQGWSER  1500
             EDLK+ LL QISLNK+IQQVLL+ H+ GN +  S ++ D S +G  + RC K+DQ +++R
Sbjct  140   EDLKSALLKQISLNKEIQQVLLAPHESGN-VSSSSSDLDFSNAGGFVQRCEKMDQRFADR  198

Query  1499  KTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDV  1320
             KTIEWKP+ NK+LFA+C+SGQMSNHLICLEKHMFFAA+LNR LV+PSS+ DY++ RVLD+
Sbjct  199   KTIEWKPKPNKFLFALCLSGQMSNHLICLEKHMFFAALLNRVLVIPSSRFDYQYNRVLDI  258

Query  1319  DHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNK  1140
             +H+N CLGRKVV+T+EEF E  KN   ID+  CYFS P PC++D++ +KKLK  GVSM K
Sbjct  259   EHVNDCLGRKVVVTFEEFVEIMKNKPRIDRFFCYFSDPTPCYVDEEHVKKLKGLGVSMGK  318

Query  1139  IETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTL  960
             +++ W ED+KKP + TV+D+  KF S+D+VIA+GDVFFADVE  W+MQPGGPIAHKCKTL
Sbjct  319   LQSPWKEDIKKPSKLTVKDVEGKFVSDDNVIAVGDVFFADVEEEWIMQPGGPIAHKCKTL  378

Query  959   IEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLE  780
             IEP+R+IMLTAQRF+QTFLG +FIALHFRRHGFLKFCNAKKPSCFYPVPQAADCI RV+E
Sbjct  379   IEPTRIIMLTAQRFIQTFLGSNFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCIARVVE  438

Query  779   RANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQ  600
             RAN+PV+YLSTDAAESET LLQSLVV NG+TVPLV RP RNSAEKWDALLYRHGL+ED Q
Sbjct  439   RANAPVVYLSTDAAESETGLLQSLVVVNGRTVPLVTRPPRNSAEKWDALLYRHGLQEDAQ  498

Query  599   VEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             VEAMLDKTICA+SSVFIGA GSTFTEDI RLR+GW SAS CDEYLCQGE+PN+IA++E
Sbjct  499   VEAMLDKTICAMSSVFIGASGSTFTEDIFRLRKGWESASSCDEYLCQGELPNYIAENE  556



>gb|EPS60947.1| hypothetical protein M569_13853, partial [Genlisea aurea]
Length=568

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/531 (65%), Positives = 417/531 (79%), Gaps = 24/531 (5%)
 Frame = -3

Query  2003  RKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITF---DSPANRMRESelralyllrqq  1833
             +KRY LAI+LP  +++LY TTD+KN+F   + KI +   D+ ++RMRESEL+AL LLRQQ
Sbjct  57    KKRYFLAIVLPALILVLYFTTDLKNVFAMSIPKIGYHGGDALSDRMRESELQALNLLRQQ  116

Query  1832  qleLFKQWNHTF-VNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKAD  1656
             + ELFK WN+T   NK   +      NS++ +                   +FL DLK+ 
Sbjct  117   EAELFKLWNYTSSANKLNYSHDPVNVNSSAIHNLD----------------LFL-DLKSQ  159

Query  1655  LLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG-RCRKVDQGWSERKTIEWKP  1479
             + SQ+SLNK+IQ +LLSSH  GN     D+N   +  GL  RC   ++    R+ +EW P
Sbjct  160   VFSQLSLNKRIQTLLLSSH--GNGEAFHDSNYSFTDDGLTTRCPTANRNLLGRRKMEWDP  217

Query  1478  ESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCL  1299
               NK+L AIC+SGQMSNHLICLEKHMFFAA+L R LV+PSSKVDY F RVLD+DHIN CL
Sbjct  218   LPNKFLLAICISGQMSNHLICLEKHMFFAALLKRILVIPSSKVDYAFHRVLDIDHINTCL  277

Query  1298  GRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNE  1119
             G+K V+T+EEF+  QKNH+HID+ +CYFS PQPC+MDD+ +KKLK  G+S++K+E+ W E
Sbjct  278   GKKAVVTFEEFSVMQKNHLHIDRFLCYFSSPQPCYMDDEYVKKLKGVGLSLSKVESVWKE  337

Query  1118  DVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLI  939
             DVK P++  V+D+VSKFSSN+ V+A+GD+FFA VE  WVMQPGGPI HKCKTLIEPSRLI
Sbjct  338   DVKSPRKTKVEDVVSKFSSNEAVVAVGDLFFAQVEEDWVMQPGGPIEHKCKTLIEPSRLI  397

Query  938   MLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVI  759
              LTAQRFVQTFLG+DFIALHFRRHGFLKFCNAK+PSCFYPVPQAA+CINRV+ERAN+PVI
Sbjct  398   RLTAQRFVQTFLGKDFIALHFRRHGFLKFCNAKQPSCFYPVPQAAECINRVIERANAPVI  457

Query  758   YLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDK  579
             YLSTDAAESET LLQSLV   G TVPLVKRPARNSAEKWDALLYRHGLE D+QVEAMLDK
Sbjct  458   YLSTDAAESETGLLQSLVTRYGNTVPLVKRPARNSAEKWDALLYRHGLEGDSQVEAMLDK  517

Query  578   TICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
              ICALSSVFIG+ GSTFTEDILRLRR W S S+CDEYLC+G +PN+IA+DE
Sbjct  518   AICALSSVFIGSSGSTFTEDILRLRRVWESESVCDEYLCEGRLPNYIAEDE  568



>ref|XP_008465040.1| PREDICTED: uncharacterized protein LOC103502751 [Cucumis melo]
Length=628

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/535 (64%), Positives = 422/535 (79%), Gaps = 21/535 (4%)
 Frame = -3

Query  2021  RFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKI--TFDSPANRMRESelraly  1848
             +F F  R  Y LA  LPL +++L+ + DI+++F T VS    T DS ++RMRESEL ALY
Sbjct  112   KFAFDKRYYYLLAAALPLCILVLFFSVDIRSLFSTTVSSTLKTSDSLSDRMRESELTALY  171

Query  1847  llrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLED  1668
             LLRQQQL  F  WNH+   ++                   SS +S      + ++  +E 
Sbjct  172   LLRQQQLGFFHLWNHSSFLQSN------------------SSFNSTASNNLNSNSALIEY  213

Query  1667  LKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIE  1488
             +K+ LL QI+LNK+IQ VLLS H+ GN  ++  +        L RCRK++Q  S+R+TIE
Sbjct  214   IKSALLKQITLNKEIQNVLLSPHRSGNLSEVVGDALPMDTFALDRCRKMEQKLSDRRTIE  273

Query  1487  WKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHIN  1308
             WKP+ NK+LFA+C SGQMSNHLICLEKHMFFAA+LNR LV+PS KVDY+F RV+D+D IN
Sbjct  274   WKPKLNKFLFALCTSGQMSNHLICLEKHMFFAAILNRVLVIPSHKVDYQFSRVIDIDRIN  333

Query  1307  KCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETA  1128
              CLGRKVV+++EEF+E +K+H+HID+ ICYFS+P PC++DD+ I KLK+ G+SM K+E+A
Sbjct  334   MCLGRKVVISFEEFSEIKKHHLHIDRFICYFSKPNPCYVDDEHISKLKNLGISMGKLESA  393

Query  1127  WNEDVKKPKQKTVQDIVSKFSSN-DDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEP  951
             WNED K P  KTV D+ SKFSSN DDVIA+GD+FFA+VE  WV QPGGPIAHKC+TLIEP
Sbjct  394   WNEDTKHPNSKTVSDVESKFSSNNDDVIAVGDIFFANVEQEWVNQPGGPIAHKCQTLIEP  453

Query  950   SRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERAN  771
             SRLI LTAQRF+QTFLG+++IALHFRRHGFLKFCNAK+PSCFYP+PQ+ADCI R++ERAN
Sbjct  454   SRLIKLTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKQPSCFYPIPQSADCIIRMVERAN  513

Query  770   SPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEA  591
              PVIYLSTDAAESE  LLQSL+V NGK +PLVKRP RNSAEKWDALLYRHG+E D+QVEA
Sbjct  514   VPVIYLSTDAAESEHGLLQSLLVLNGKPIPLVKRPPRNSAEKWDALLYRHGIEGDSQVEA  573

Query  590   MLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             MLDKTICA+SS FIGAPGSTFTEDILRLR+ WG+AS+CDEYLCQGE PNFI+++E
Sbjct  574   MLDKTICAMSSTFIGAPGSTFTEDILRLRKDWGTASLCDEYLCQGEEPNFISENE  628



>ref|XP_007215906.1| hypothetical protein PRUPE_ppa004150mg [Prunus persica]
 gb|EMJ17105.1| hypothetical protein PRUPE_ppa004150mg [Prunus persica]
Length=526

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 371/422 (88%), Gaps = 6/422 (1%)
 Frame = -3

Query  1679  FLEDLKADLLSQISLNKQIQQVLLSSHQLGNSL--DLSD--NNTDPSISGLGRCRKVDQG  1512
             F  D K+ +L QIS+NK IQQVLLS H+ GNS   D  D  +  +PS+    RC  +DQ 
Sbjct  107   FGSDFKSAVLRQISINKDIQQVLLSPHRSGNSTESDFRDFGDFENPSLGD--RCGILDQK  164

Query  1511  WSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQR  1332
             +++R+TIEWKP ++KYLFAICVSGQMSNHLICLEKHMFFAA+LNR LV+PS+KVDY++ R
Sbjct  165   FAQRRTIEWKPNASKYLFAICVSGQMSNHLICLEKHMFFAALLNRVLVIPSAKVDYQYSR  224

Query  1331  VLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGV  1152
             VLD++HINKCLGRKVV+T+EE A+++KNHVH+DK ICYFS P PC++D++R+KKLK SGV
Sbjct  225   VLDIEHINKCLGRKVVVTFEELADAKKNHVHVDKFICYFSHPTPCYVDEERLKKLKGSGV  284

Query  1151  SMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHK  972
             S++K+E AW EDVKKP ++TVQD+ SKFS++DDVIAIGDVFFAD+E  WVMQP GP+AHK
Sbjct  285   SLSKLEPAWVEDVKKPSKRTVQDVQSKFSTSDDVIAIGDVFFADLEQDWVMQPRGPLAHK  344

Query  971   CKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCIN  792
             CKTLIEPSRLIMLTAQRF+QTFLG++FIALHFRRHGFLKFCN K+ SCFYP+PQAADCI 
Sbjct  345   CKTLIEPSRLIMLTAQRFIQTFLGKNFIALHFRRHGFLKFCNNKQRSCFYPIPQAADCIT  404

Query  791   RVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLE  612
             RV ERAN+PV+YLSTDAAESE  LLQSLVV NGK VPLVKRPARNSAEKWDALLYRHG+E
Sbjct  405   RVAERANAPVVYLSTDAAESEIGLLQSLVVVNGKAVPLVKRPARNSAEKWDALLYRHGIE  464

Query  611   EDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIAD  432
              D+QVEAMLDKTICA+SSVFIGA GSTFTEDILRLR+ WGSAS+CDEYLCQGE PNF+A+
Sbjct  465   GDSQVEAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGSASLCDEYLCQGEDPNFLAE  524

Query  431   DE  426
             +E
Sbjct  525   NE  526



>gb|KCW56440.1| hypothetical protein EUGRSUZ_I02168 [Eucalyptus grandis]
Length=583

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/551 (63%), Positives = 424/551 (77%), Gaps = 6/551 (1%)
 Frame = -3

Query  2066  SFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFDSP  1887
             +F ++    R     RF F   K Y LAI++ +  ++ + + DI+ +F    S     S 
Sbjct  35    AFDVEDLDSRIGAARRFPFRFNKSYLLAILISVLFLVAFFSADIRGLFSGHASAFGLGST  94

Query  1886  ANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnssle  1707
             A+RMRESELRAL LL+QQ+L LF  WNHTF++ + +A       + SS+  S        
Sbjct  95    ADRMRESELRALSLLKQQRLGLFGLWNHTFLD-SAIARNGTANFTLSSSNSSVLKKRDSG  153

Query  1706  rtgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGN-SLDLSDNN-TDPSIS--GL  1539
                +S SA+F ED K+ +L QI LNK I++VLL  HQ GN S++  D +  D + S  G 
Sbjct  154   HLLASSSALF-EDFKSAVLRQIKLNKDIEEVLLLPHQSGNVSVENGDGDMVDVNFSDFGF  212

Query  1538  GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPS  1359
              +CR VDQ  S RKTIEWKP+ +K+L AICVSGQMSNHLICLEKHMFFAAVL R LVVPS
Sbjct  213   DQCRTVDQNSSGRKTIEWKPKPDKFLLAICVSGQMSNHLICLEKHMFFAAVLGRILVVPS  272

Query  1358  SKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             SKVDYE+ +VLDVDHIN CLGRKVV+++EEF+  +K H+HID+ ICYFS PQ C++DD+ 
Sbjct  273   SKVDYEYNKVLDVDHINDCLGRKVVMSFEEFSGVKKTHLHIDRFICYFSSPQHCYVDDEH  332

Query  1178  IKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVM  999
             +KKLK  G+SM K+E+ W ED +KP ++T+QD+ +KF+ +DDVIAIGDVFFAD+E  WV 
Sbjct  333   VKKLKGLGISMGKLESPWVEDTQKPNKRTIQDVEAKFTVDDDVIAIGDVFFADLEQEWVT  392

Query  998   QPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYP  819
             QPGGP+AHKCK LIEPS LI+LTAQRF+QTFLG+++IALHFRRHGFLKFCNAK PSCFYP
Sbjct  393   QPGGPLAHKCKALIEPSHLIVLTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKTPSCFYP  452

Query  818   VPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWD  639
             VPQAA+CI RV+ER ++PVIYLSTDAAESET LLQ+L+  NGK +PLVKRP R+ AEKWD
Sbjct  453   VPQAAECIKRVVERTDAPVIYLSTDAAESETGLLQTLIFSNGKPIPLVKRPDRSPAEKWD  512

Query  638   ALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQ  459
             ALLYRHGL++D+QVEAMLDKTICA+S VFIGA GSTFTEDILRLR+ WGSAS CDEYLCQ
Sbjct  513   ALLYRHGLQDDSQVEAMLDKTICAMSRVFIGASGSTFTEDILRLRKDWGSASRCDEYLCQ  572

Query  458   GEVPNFIADDE  426
             GE PNFIADDE
Sbjct  573   GEEPNFIADDE  583



>ref|XP_002533327.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29063.1| conserved hypothetical protein [Ricinus communis]
Length=565

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/523 (63%), Positives = 418/523 (80%), Gaps = 21/523 (4%)
 Frame = -3

Query  1994  YCLAIILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFK  1815
             Y LAI LPL +I++Y + D++++F   +S + F+S ++RMRE+EL+ALYLL QQQL L  
Sbjct  64    YLLAIFLPLLIIIVYFSADLRSLFSANISSLNFNSASDRMREAELQALYLLEQQQLSLLS  123

Query  1814  QWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISL  1635
              +N +F ++ +  + N++  ++                      V +E+ ++ LL Q++ 
Sbjct  124   IFNQSFPSRNKNFSSNSSFINSF-------------------DNVKIENFRSALLKQMTF  164

Query  1634  NKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFA  1455
             NKQIQQ+LLS H+ GN  +    +   S  G  RC+KV+  + +RKTIEWKP S+K+LF 
Sbjct  165   NKQIQQILLSPHKSGN--ENVSGSFSGSGFGFDRCKKVESRFLDRKTIEWKPRSDKFLFP  222

Query  1454  ICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTY  1275
             IC+SGQMSNHLICLEKHMFFAA+LNR LV+PSSK DY++ RVLD++HIN C+GRKVV+T+
Sbjct  223   ICLSGQMSNHLICLEKHMFFAALLNRVLVMPSSKFDYQYNRVLDIEHINLCVGRKVVVTF  282

Query  1274  EEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQK  1095
             EEF + +KNHVHID+ ICYFS P  C++D++ +KKLK  G+ M K E+ W EDVKKP QK
Sbjct  283   EEFVQMRKNHVHIDRFICYFSSPTACYVDEEHVKKLKGLGILMGKPESPWKEDVKKPSQK  342

Query  1094  TVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFV  915
             TVQD+++KF+SNDDVIAIGDVF+AD+E  WVMQPGGP+AHKCKTLIEPSRLI++TAQRF+
Sbjct  343   TVQDVLAKFTSNDDVIAIGDVFYADMEQDWVMQPGGPLAHKCKTLIEPSRLILVTAQRFI  402

Query  914   QTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAE  735
             QTFLG++FIALHFRRHGFLKFCNAK PSCFYP+PQAADCI RV ERAN+PVIYLSTDAAE
Sbjct  403   QTFLGKNFIALHFRRHGFLKFCNAKNPSCFYPIPQAADCIARVAERANAPVIYLSTDAAE  462

Query  734   SETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSV  555
             SET LLQSL++ NGKTVPLVKRP+  S EKWD+LL RHG+E+D+QVEAMLDKTI A+S+V
Sbjct  463   SETDLLQSLIIVNGKTVPLVKRPSHTSVEKWDSLLSRHGIEDDSQVEAMLDKTISAMSNV  522

Query  554   FIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             FIGA GSTFTEDILRLR+ W SAS+CDEYLCQGE+PNFIA+DE
Sbjct  523   FIGASGSTFTEDILRLRKDWESASLCDEYLCQGELPNFIAEDE  565



>ref|XP_003529861.1| PREDICTED: uncharacterized protein LOC100776069 [Glycine max]
Length=543

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/567 (61%), Positives = 426/567 (75%), Gaps = 38/567 (7%)
 Frame = -3

Query  2120  NLIGDGERRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATT  1941
             NL+ D   R     P  ++F ++    RF    R +F  +K+Y +AI+  LF++L ++ T
Sbjct  13    NLV-DNNHRKPPSPPPSAAFHVEDLSSRF---RRVSFALQKKYIIAILALLFLLLFFSIT  68

Query  1940  DIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnnt  1761
             D   +F T  S   FDS  +RM+ESELRA+ LL QQQ  L   WNHT             
Sbjct  69    DFHQLFSTP-SSFKFDSITDRMKESELRAINLLYQQQQSLLTAWNHTLRTNAS-------  120

Query  1760  gnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSL  1581
                                         LEDLK+ L  QISLN++IQQ+LL+ H  G + 
Sbjct  121   ------------------------DPNLLEDLKSSLFKQISLNREIQQILLNPHSTGGNA  156

Query  1580  DLSDNNTDPSISGL--GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEK  1407
                + + + +++G+   RCR VDQ  S+RKTIEW P   K+L AICVSGQMSNHLICLEK
Sbjct  157   IEPELDLNATLNGVVYDRCRTVDQNLSQRKTIEWNPRDGKFLLAICVSGQMSNHLICLEK  216

Query  1406  HMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKV  1227
             HMFFAA+LNR LV+PSSKVDY++ RV+D+DHINKCLG+KVV+++EEF+  +K H+HIDK 
Sbjct  217   HMFFAALLNRVLVIPSSKVDYQYDRVVDIDHINKCLGKKVVVSFEEFSNLKKGHLHIDKF  276

Query  1226  ICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVI  1047
             +CYFS PQPC++DD+R+KKL + G++M+K E  W+ED +KPK+KTVQD++ KFS +DDV+
Sbjct  277   LCYFSHPQPCYLDDERLKKLGALGLTMSKPEAVWDEDTRKPKKKTVQDVLGKFSFDDDVM  336

Query  1046  AIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRH  867
             AIGDVF+A+VE  WVMQPGGPIAHKCKTLIEP+RLI+LTAQRF+QTFLG +FIALHFRRH
Sbjct  337   AIGDVFYAEVEREWVMQPGGPIAHKCKTLIEPNRLILLTAQRFIQTFLGRNFIALHFRRH  396

Query  866   GFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKT  687
             GFLKFCNAKKPSCFYP+PQAADCI RV+E A++P+IYLSTDAAESET LLQSLVV NG+ 
Sbjct  397   GFLKFCNAKKPSCFYPIPQAADCILRVVEMADAPIIYLSTDAAESETGLLQSLVVLNGRP  456

Query  686   VPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRL  507
             VPLV RPARNSAEKWDALLYRH ++ D+QVEAMLDKTICA+SSVFIGAPGSTFTEDILRL
Sbjct  457   VPLVIRPARNSAEKWDALLYRHNMDGDSQVEAMLDKTICAMSSVFIGAPGSTFTEDILRL  516

Query  506   RRGWGSASMCDEYLCQGEVPNFIADDE  426
             R+ WGSASMCDEYLCQGE PN IA++E
Sbjct  517   RKDWGSASMCDEYLCQGEEPNIIAENE  543



>gb|KDP40618.1| hypothetical protein JCGZ_24617 [Jatropha curcas]
Length=607

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/423 (73%), Positives = 369/423 (87%), Gaps = 7/423 (2%)
 Frame = -3

Query  1676  LEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG------RCRKVDQ  1515
             +ED ++ LL+Q++LNKQIQQVLLS H  GN +++S ++ D + S LG      RCRKV+ 
Sbjct  186   IEDFRSALLNQLTLNKQIQQVLLSPHNSGN-VNISTSDVDSAASFLGSGFGYDRCRKVES  244

Query  1514  GWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQ  1335
              +S+RKTIEWKP S+K+LF IC+SGQMSNHLICLEKHMFFAA+LNR LV+PSSK DY++ 
Sbjct  245   RFSDRKTIEWKPRSDKFLFPICLSGQMSNHLICLEKHMFFAALLNRVLVIPSSKFDYQYS  304

Query  1334  RVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSG  1155
             RVLD++HIN+CL RKVV+T+EEFA  +KNHVHID+ ICYFS P PC++D+D +KKLK  G
Sbjct  305   RVLDIEHINQCLRRKVVVTFEEFAPMRKNHVHIDRFICYFSLPTPCYVDEDHVKKLKGLG  364

Query  1154  VSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAH  975
             +SM K+E+ W EDVKKP +KTVQD+ +KF+SNDDVIAIGDV+FAD+E  WVMQPGGP+AH
Sbjct  365   ISMGKLESPWKEDVKKPSKKTVQDVQTKFTSNDDVIAIGDVYFADLEQEWVMQPGGPLAH  424

Query  974   KCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCI  795
             +CKTLIEPSRLI+LTAQRF+QTFLG++FIALHFRRHGFLKFCN KKPSCFYP+PQAADCI
Sbjct  425   RCKTLIEPSRLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNVKKPSCFYPIPQAADCI  484

Query  794   NRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGL  615
              RV+ERAN+PVIYLSTDAAESET LLQSL+V NGKTVPLVKRP+  S EKWDALL RHG+
Sbjct  485   ARVVERANAPVIYLSTDAAESETDLLQSLIVVNGKTVPLVKRPSHTSVEKWDALLSRHGI  544

Query  614   EEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIA  435
             + D QVEAMLDKTICA+SSVFIGA GSTFTEDILRLR+ W S S+CDEYLCQGE+PNFIA
Sbjct  545   DGDPQVEAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWESTSLCDEYLCQGELPNFIA  604

Query  434   DDE  426
             +DE
Sbjct  605   EDE  607



>ref|XP_006465793.1| PREDICTED: uncharacterized protein LOC102617227 [Citrus sinensis]
Length=563

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/561 (62%), Positives = 421/561 (75%), Gaps = 38/561 (7%)
 Frame = -3

Query  2093  DGARSPGRSSFQIDGNKDRFIDPARFNF----ICRKRYCLAIILPLFVILLYATTDIKNI  1926
             D   +   S+F ID   +      RF F    +  KRY  A+ LPL +ILLY + +++++
Sbjct  36    DEEHNRRHSTFHIDDLPNASPIRRRFTFDFKKLNNKRYLFALSLPLLIILLYFSVNLRSL  95

Query  1925  FRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnsts  1746
             F        FDS A+RMRESELRAL LL+QQQ  L   WN +FVN +             
Sbjct  96    FSGNYVNFRFDSLADRMRESELRALSLLKQQQSHLLSLWNQSFVNNSYGNNT--------  147

Query  1745  snagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN  1566
                                +  F +D K+ LL+QISLNKQI+Q+LLS H++ N    + N
Sbjct  148   -------------------NNPFFQDAKSALLNQISLNKQIEQILLSPHKVSN---FTPN  185

Query  1565  NTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAV  1386
             +   ++ G   CRKVD     ++T+EWKP+S+K+LFAIC+SGQMSNHLICLEKHMF AA+
Sbjct  186   D---AVWGFEGCRKVDSIIPNKRTVEWKPKSDKFLFAICLSGQMSNHLICLEKHMFLAAL  242

Query  1385  LNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQP  1206
             LNR LV+PSSK DY++ RVLD++HIN CLGRKVV+++E F E +KNH HID+ +CYF  P
Sbjct  243   LNRVLVIPSSKFDYQYSRVLDIEHINDCLGRKVVVSFENFMEMEKNHAHIDRFLCYFGLP  302

Query  1205  QPCFMDDDRIKKLKSSGVSMNKIETAW-NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVF  1029
             +PCF+DD+ IKKLK  G+SM K ET W NED +KP ++TVQDI  KF ++DDVIA+GD+F
Sbjct  303   EPCFVDDEHIKKLKQLGISMGKTETVWKNEDTRKPSKRTVQDIEGKFKTDDDVIAVGDLF  362

Query  1028  FADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFC  849
             +ADVE  WVMQPGGPI H+CKTLIEPSRLIM+TAQRFVQTFLG +FIALHFRRHGFLKFC
Sbjct  363   YADVERDWVMQPGGPINHRCKTLIEPSRLIMVTAQRFVQTFLGSNFIALHFRRHGFLKFC  422

Query  848   NAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKR  669
             NAKKPSCFYP+PQAADCI R+ ERAN+PVIYLSTDAAESETSLLQSLVV NGKT+ LVKR
Sbjct  423   NAKKPSCFYPIPQAADCITRLAERANAPVIYLSTDAAESETSLLQSLVVLNGKTIALVKR  482

Query  668   PARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGS  489
             P RNSAEKWD+LLYRH LE+D+QVEAMLDKTICA+S+VFIGA GSTFTEDI+RLR+ WGS
Sbjct  483   PPRNSAEKWDSLLYRHHLEDDSQVEAMLDKTICAMSNVFIGASGSTFTEDIMRLRKDWGS  542

Query  488   ASMCDEYLCQGEVPNFIADDE  426
              S+CDEYLCQGE PNFIA+DE
Sbjct  543   TSLCDEYLCQGEEPNFIAEDE  563



>gb|KHN01480.1| hypothetical protein glysoja_009686 [Glycine soja]
Length=455

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/420 (72%), Positives = 366/420 (87%), Gaps = 2/420 (0%)
 Frame = -3

Query  1679  FLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGL--GRCRKVDQGWS  1506
              LEDLK+ L  QISLN++IQQ+LL+ H  G +    + + + +++G+   RCR VDQ  S
Sbjct  36    LLEDLKSSLFKQISLNREIQQILLNPHSTGGNAIEPEPDLNATLNGVVYDRCRTVDQNLS  95

Query  1505  ERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVL  1326
             +RKTIEW P   K+L AICVSGQMSNHLICLEKHMFFAA+LNR LV+PSSKVDY++ RV+
Sbjct  96    QRKTIEWNPRDGKFLLAICVSGQMSNHLICLEKHMFFAALLNRVLVIPSSKVDYQYDRVV  155

Query  1325  DVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSM  1146
             D+DHINKCLG+KVV+++EEF+  +K H+HIDK +CYFS+PQPC++DD+R+KKL + G++M
Sbjct  156   DIDHINKCLGKKVVVSFEEFSNLKKGHLHIDKFLCYFSRPQPCYLDDERLKKLGALGLTM  215

Query  1145  NKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCK  966
             +K E  W+ED +KPK+KTVQD++ KFS +DDV+AIGDVF+A+VE  WVMQPGGPIAHKCK
Sbjct  216   SKPEAVWDEDTRKPKKKTVQDVLGKFSFDDDVMAIGDVFYAEVEREWVMQPGGPIAHKCK  275

Query  965   TLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRV  786
             TL+EP+RLI+LTAQRF+QTFLG +FIALHFRRHGFLKFCNAKKPSCFYP+PQAADCI RV
Sbjct  276   TLVEPNRLILLTAQRFIQTFLGRNFIALHFRRHGFLKFCNAKKPSCFYPIPQAADCILRV  335

Query  785   LERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEED  606
             +E A++P+IYLSTDAAESET LLQSLVV NG+ VPLV RPARNSAEKWDALLYRH ++ D
Sbjct  336   VEMADAPIIYLSTDAAESETGLLQSLVVLNGRPVPLVIRPARNSAEKWDALLYRHNMDGD  395

Query  605   TQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             +QVEAMLDKTICA+SSVFIGAPGSTFTEDILRLR+ WGSASMCDEYLCQGE PN IA++E
Sbjct  396   SQVEAMLDKTICAMSSVFIGAPGSTFTEDILRLRKDWGSASMCDEYLCQGEEPNIIAENE  455



>gb|KHN15848.1| hypothetical protein glysoja_013064 [Glycine soja]
Length=543

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/567 (60%), Positives = 424/567 (75%), Gaps = 38/567 (7%)
 Frame = -3

Query  2120  NLIGDGERRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATT  1941
             NL+ D   R    SP   +F ++    RF    R NF  +K+Y  AI+  LF++L ++ T
Sbjct  13    NLV-DNNHRKPPSSPAAVAFHVEDPSPRF---RRANFTLQKKYIFAILAILFLLLFFSIT  68

Query  1940  DIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnnt  1761
             D+  +F T  S   FDS  +RM+ESELRA+ LL QQQ  L   WNHT             
Sbjct  69    DLHKLFST-TSSFRFDSLTDRMKESELRAINLLNQQQQALLTAWNHTLRTNAS-------  120

Query  1760  gnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSL  1581
                                         LEDLK+ +  QISLN++IQQ+LL+ H  GN+ 
Sbjct  121   ------------------------DPNLLEDLKSSIFKQISLNREIQQILLNPHSTGNNA  156

Query  1580  DLSDNNTDPSISGL--GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEK  1407
                + + + +++G+   RCR VDQ  S+RKTIEW P+  K+L AICVSGQMSNHLICLEK
Sbjct  157   IEPELDLNATLNGVVYDRCRTVDQNLSQRKTIEWNPKDGKFLLAICVSGQMSNHLICLEK  216

Query  1406  HMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKV  1227
             H+FFAA+LNR LV+PSSKVDY++ RV+D+DHINKCLG+KVV+++E F+  +K H+HIDK 
Sbjct  217   HIFFAALLNRVLVIPSSKVDYQYDRVVDIDHINKCLGKKVVVSFEVFSNLKKGHLHIDKF  276

Query  1226  ICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVI  1047
             +CYFSQPQPC++DD+R+KKL + G++M+K    W+ED + PK+KTVQD++ KFS +DDV+
Sbjct  277   LCYFSQPQPCYLDDERLKKLGALGLTMSKPVAVWDEDTRNPKKKTVQDVLGKFSFDDDVM  336

Query  1046  AIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRH  867
             AIGDVF+A+VE  WVMQPGGPIAHKC TLIEP+RLI+LTAQRF+QTFLG +F+ALHFRRH
Sbjct  337   AIGDVFYAEVEREWVMQPGGPIAHKCTTLIEPNRLILLTAQRFIQTFLGRNFVALHFRRH  396

Query  866   GFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKT  687
             GFLKFCNAKKPSCFY + QAADCI RV+ERA++P+IYLSTDAAESET LLQSLVV NG+ 
Sbjct  397   GFLKFCNAKKPSCFYSITQAADCILRVVERADAPIIYLSTDAAESETGLLQSLVVLNGRP  456

Query  686   VPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRL  507
             VPLV RPARNSAEKWDALLYRH ++ D+QVEAMLDK+ICA+SSVFIGAPGSTFTEDILRL
Sbjct  457   VPLVIRPARNSAEKWDALLYRHRMDGDSQVEAMLDKSICAMSSVFIGAPGSTFTEDILRL  516

Query  506   RRGWGSASMCDEYLCQGEVPNFIADDE  426
             R+ WGSASMCDEYLCQGE PN +A++E
Sbjct  517   RKDWGSASMCDEYLCQGEEPNIVAENE  543



>ref|XP_003547949.1| PREDICTED: uncharacterized protein LOC548046 [Glycine max]
Length=543

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/567 (60%), Positives = 423/567 (75%), Gaps = 38/567 (7%)
 Frame = -3

Query  2120  NLIGDGERRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATT  1941
             NL+ D   R    SP   +F ++    RF    R NF  +K+Y  AI+  LF++L ++ T
Sbjct  13    NLV-DNNHRKPPSSPAAVAFHVEDPSPRF---RRANFTLQKKYIFAILAILFLLLFFSIT  68

Query  1940  DIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnnt  1761
             D+  +F T  S   FDS  +RM+ESELRA+ LL QQQ  L   WNHT             
Sbjct  69    DLHKLFST-TSSFRFDSLTDRMKESELRAINLLNQQQQALLTAWNHTLRTNAS-------  120

Query  1760  gnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSL  1581
                                         LEDLK+ +  QISLN++IQQ+LL+ H  GN+ 
Sbjct  121   ------------------------DPNLLEDLKSSIFKQISLNREIQQILLNPHSTGNNA  156

Query  1580  DLSDNNTDPSISGL--GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEK  1407
                + + + +++G+   RCR VDQ  S+RKTIEW P   K+L AICVSGQMSNHLICLEK
Sbjct  157   IEPEFDLNATLNGVVYDRCRTVDQNLSQRKTIEWNPRDGKFLLAICVSGQMSNHLICLEK  216

Query  1406  HMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKV  1227
             H+FFAA+LNR LV+PSSKVDY++ RV+D+DHINKCLG+KVV+++E F+  +K H+HIDK 
Sbjct  217   HIFFAALLNRVLVIPSSKVDYQYDRVVDIDHINKCLGKKVVVSFEVFSNLKKGHLHIDKF  276

Query  1226  ICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVI  1047
             +CYFSQPQPC++DD+R+KKL + G++M+K    W+ED + PK+KTVQD++ KFS +DDV+
Sbjct  277   LCYFSQPQPCYLDDERLKKLGALGLTMSKPVAVWDEDTRNPKKKTVQDVLGKFSFDDDVM  336

Query  1046  AIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRH  867
             AIGDVF+A+VE  WVMQPGGPIAHKC TLIEP+RLI+LTAQRF+QTFLG +F+ALHFRRH
Sbjct  337   AIGDVFYAEVEREWVMQPGGPIAHKCTTLIEPNRLILLTAQRFIQTFLGRNFVALHFRRH  396

Query  866   GFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKT  687
             GFLKFCNAKKPSCFY + QAADCI RV+ERA++P+IYLSTDAAESET LLQSLVV NG+ 
Sbjct  397   GFLKFCNAKKPSCFYSITQAADCILRVVERADAPIIYLSTDAAESETGLLQSLVVLNGRP  456

Query  686   VPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRL  507
             VPLV RPARNSAEKWDALLYRH ++ D+QVEAMLDK+ICA+SSVFIGAPGSTFTEDILRL
Sbjct  457   VPLVIRPARNSAEKWDALLYRHRMDGDSQVEAMLDKSICAMSSVFIGAPGSTFTEDILRL  516

Query  506   RRGWGSASMCDEYLCQGEVPNFIADDE  426
             R+ WGSASMCDEYLCQGE PN +A++E
Sbjct  517   RKDWGSASMCDEYLCQGEEPNIVAENE  543



>gb|KDO53745.1| hypothetical protein CISIN_1g008526mg [Citrus sinensis]
Length=563

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/561 (61%), Positives = 421/561 (75%), Gaps = 38/561 (7%)
 Frame = -3

Query  2093  DGARSPGRSSFQIDGNKDRFIDPARFNF----ICRKRYCLAIILPLFVILLYATTDIKNI  1926
             D   +   S+F ID   +      RF F    +  KRY  A+ LPL +ILLY + +++++
Sbjct  36    DEEHNRRHSTFHIDDFPNAPPIRRRFTFDFKKLNNKRYLFALSLPLLIILLYFSVNLRSL  95

Query  1925  FRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnsts  1746
             F        FDS A+RMRESELRAL LL+QQQ  L   WN +FVN +             
Sbjct  96    FSGNYVNFRFDSLADRMRESELRALSLLKQQQSHLLSLWNQSFVNNSYGNNT--------  147

Query  1745  snagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN  1566
                                +  F ++ K+ LL+QISLN+QI+Q+LLS H++ N    + N
Sbjct  148   -------------------NNPFFQEAKSVLLNQISLNRQIEQILLSPHKVSN---FTPN  185

Query  1565  NTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAV  1386
             +   ++ GL  CRK+D     ++T+EWKP+S+K+LFAIC+SGQMSNHLICLEKHMF AA+
Sbjct  186   D---AVWGLESCRKIDSIIPNKRTVEWKPKSDKFLFAICLSGQMSNHLICLEKHMFLAAL  242

Query  1385  LNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQP  1206
             LNR LV+PSSK DY++ RVLD++HIN CLGRKVV+++E F E +KNH HID+ +CYF  P
Sbjct  243   LNRVLVIPSSKFDYQYSRVLDIEHINDCLGRKVVVSFENFMEMEKNHAHIDRFLCYFGLP  302

Query  1205  QPCFMDDDRIKKLKSSGVSMNKIETAW-NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVF  1029
             QPCF+DD+ IKKLK  G+SM K ET W NED +KP ++TVQDI  KF ++DDVIA+GD+F
Sbjct  303   QPCFVDDEHIKKLKQLGISMGKTETVWKNEDTRKPSKRTVQDIEGKFKTDDDVIAVGDLF  362

Query  1028  FADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFC  849
             +ADVE  WVMQPGGPI H+CKTLIEPSRLIM+TAQRFVQTFLG +FIALHFRRHGFLKFC
Sbjct  363   YADVERDWVMQPGGPINHRCKTLIEPSRLIMVTAQRFVQTFLGSNFIALHFRRHGFLKFC  422

Query  848   NAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKR  669
             NAKKPSCFYP+PQAADCI R+ ERA +PVIYLSTDAAESETSLLQSLVV NGKT+ LVKR
Sbjct  423   NAKKPSCFYPIPQAADCITRLAERAKAPVIYLSTDAAESETSLLQSLVVLNGKTIALVKR  482

Query  668   PARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGS  489
             P RNSAEKWD+LLYRH LE+D+QVEAMLDKTICA+S+VFIGA GSTFTEDI+RLR+ WGS
Sbjct  483   PPRNSAEKWDSLLYRHHLEDDSQVEAMLDKTICAMSNVFIGASGSTFTEDIMRLRKDWGS  542

Query  488   ASMCDEYLCQGEVPNFIADDE  426
              S+CDEYLCQGE PNFIA+DE
Sbjct  543   TSLCDEYLCQGEEPNFIAEDE  563



>ref|XP_006426814.1| hypothetical protein CICLE_v10025289mg [Citrus clementina]
 gb|ESR40054.1| hypothetical protein CICLE_v10025289mg [Citrus clementina]
Length=563

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/561 (61%), Positives = 421/561 (75%), Gaps = 38/561 (7%)
 Frame = -3

Query  2093  DGARSPGRSSFQIDGNKDRFIDPARFNF----ICRKRYCLAIILPLFVILLYATTDIKNI  1926
             D   +   S+F ID   +      RF F    +  KRY  A+ LPL +ILLY + +++++
Sbjct  36    DEEHNRRHSTFHIDDFPNAPPIRRRFTFDFKKLNNKRYLFALSLPLLIILLYFSVNLRSL  95

Query  1925  FRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnsts  1746
             F        FDS A+RMRESELRAL LL+QQQ  L   WN +FVN +             
Sbjct  96    FSGNYVNFRFDSLADRMRESELRALSLLKQQQSHLLSLWNQSFVNNSYGNNT--------  147

Query  1745  snagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN  1566
                                +  F ++ K+ LL+QISLN+QI+Q+LLS H++ N    + N
Sbjct  148   -------------------NNPFFQEAKSVLLNQISLNRQIEQILLSPHKVSN---FTPN  185

Query  1565  NTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAV  1386
             +   ++ GL  CRK+D     ++T+EWKP+S+K+LFAIC+SGQMSNHLICLEKHMF AA+
Sbjct  186   D---AVWGLESCRKIDSIIPNKRTVEWKPKSDKFLFAICLSGQMSNHLICLEKHMFLAAL  242

Query  1385  LNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQP  1206
             LNR LV+PSSK DY++ RVLD++HIN CLGRKVV+++E F E +KNH HID+ +CYF  P
Sbjct  243   LNRVLVIPSSKFDYQYSRVLDIEHINDCLGRKVVVSFENFMEMKKNHAHIDRFLCYFGLP  302

Query  1205  QPCFMDDDRIKKLKSSGVSMNKIETAW-NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVF  1029
             QPCF+DD+ IKKLK  G+SM K ET W NED +KP ++TVQDI  KF ++DDVIA+GD+F
Sbjct  303   QPCFVDDEHIKKLKQLGISMGKTETVWKNEDTRKPSKRTVQDIEGKFKTDDDVIAVGDLF  362

Query  1028  FADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFC  849
             +ADVE  WVMQPGGPI H+CKTLIEPSRLIM+TAQRFVQTFLG +FIALHFRRHGFLKFC
Sbjct  363   YADVERDWVMQPGGPINHRCKTLIEPSRLIMVTAQRFVQTFLGSNFIALHFRRHGFLKFC  422

Query  848   NAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKR  669
             NAKKPSCFYP+PQAADCI R+ ERA +PVIYLSTDAAESETSLLQSLVV NGKT+ LVKR
Sbjct  423   NAKKPSCFYPIPQAADCITRLAERAKAPVIYLSTDAAESETSLLQSLVVLNGKTIALVKR  482

Query  668   PARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGS  489
             P RNSAEKWD+LLYRH LE+D+QVEAMLDKTICA+S+VFIGA GSTFTEDI+RLR+ WGS
Sbjct  483   PPRNSAEKWDSLLYRHHLEDDSQVEAMLDKTICAMSNVFIGASGSTFTEDIMRLRKDWGS  542

Query  488   ASMCDEYLCQGEVPNFIADDE  426
              S+CDEYLCQGE PNFIA+DE
Sbjct  543   TSLCDEYLCQGEEPNFIAEDE  563



>ref|XP_010442530.1| PREDICTED: uncharacterized protein LOC104725559 isoform X1 [Camelina 
sativa]
Length=569

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/558 (61%), Positives = 423/558 (76%), Gaps = 25/558 (4%)
 Frame = -3

Query  2090  GARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCL-AIILPLFVILLYATTDIKNIFRTG  1914
              A SP  S+FQI+    R +   R+     KRY + A+ L + + LL+  TD + +F   
Sbjct  34    AATSPRSSTFQIEDIMQR-VQQHRWKISLNKRYVIVAVSLIVSIGLLFLLTDPRELFSAN  92

Query  1913  VSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnag  1734
             +S    D  ANR++ESELRALYLLRQQQLEL   WN T VN +                 
Sbjct  93    LSSFKLDPLANRVKESELRALYLLRQQQLELLSLWNGTLVNPS-----------------  135

Query  1733  sgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDP  1554
                  +      S  S+V  ED+K+ +  QISLNK+IQ+VLLS H+  N         D 
Sbjct  136   ----LNQSANASSLGSSVLFEDVKSAVSKQISLNKEIQEVLLSPHRTANYSGGGGTGVDS  191

Query  1553  SISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRF  1374
                   RCRKVDQ  S+R+T+EWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R 
Sbjct  192   VNFLYDRCRKVDQNLSDRRTVEWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRV  251

Query  1373  LVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQPC  1197
             LV+PS K DY++ RV+D+D IN CLGR VV+++++F E ++KNH  ID+ ICYFS PQ C
Sbjct  252   LVIPSPKFDYQYDRVIDIDRINTCLGRNVVVSFDQFKEKAKKNHFRIDRFICYFSSPQLC  311

Query  1196  FMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFAD  1020
             ++D++ IKKLK  G+S++ K+E  W+ED+KKP ++TVQD+ +KF S+DDVIAIGDVF+AD
Sbjct  312   YVDEEHIKKLKGLGISIDGKLEAPWSEDIKKPSKRTVQDVQTKFKSDDDVIAIGDVFYAD  371

Query  1019  VETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAK  840
             +E  WVMQPGGPI HKCKTLIEPS+LI+LTAQRF+QTFLG++FIALHFRRHGFLKFCNAK
Sbjct  372   MEQDWVMQPGGPINHKCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAK  431

Query  839   KPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPAR  660
              PSCFYP+PQAA+CI R++ER+N  VIYLSTDAAESETSLLQSLVV +GK VPLVKRP R
Sbjct  432   SPSCFYPIPQAAECIARIVERSNGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPR  491

Query  659   NSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASM  480
             NSAEKWDALLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++SM
Sbjct  492   NSAEKWDALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSM  551

Query  479   CDEYLCQGEVPNFIADDE  426
             CDEYLC+GE PNFIA+DE
Sbjct  552   CDEYLCRGEEPNFIAEDE  569



>ref|XP_010482356.1| PREDICTED: uncharacterized protein LOC104761036 [Camelina sativa]
 ref|XP_010482357.1| PREDICTED: uncharacterized protein LOC104761036 [Camelina sativa]
 ref|XP_010482358.1| PREDICTED: uncharacterized protein LOC104761036 [Camelina sativa]
Length=567

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/556 (61%), Positives = 427/556 (77%), Gaps = 29/556 (5%)
 Frame = -3

Query  2081  SPGRSSFQIDGNKDRFIDPARFNFICRKRYCL-AIILPLFVILLYATTDIKNIFRTGVSK  1905
             SP  S+FQI+    R +   R+     KRY + A+ L + + LL+  TD + +F   +S 
Sbjct  37    SPRSSAFQIEDIMQR-VQQHRWKISLNKRYVIVAVSLIVSIGLLFLLTDPRELFSANLSS  95

Query  1904  ITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgs  1725
                D  ANR++ESELRALYLLRQQQLEL   WN T VN +                    
Sbjct  96    FKLDPLANRVKESELRALYLLRQQQLELLSLWNGTLVNPS--------------------  135

Query  1724  snsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSIS  1545
               +      S  S+V  ED+K+ +  QISLNK+IQ+VLLS H+  N    S      S++
Sbjct  136   -LNQSANASSLGSSVLFEDVKSAVSKQISLNKEIQEVLLSPHRTSN---YSGGGEVDSVN  191

Query  1544  GL-GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLV  1368
              L  RCRKVDQ  S+R+T+EWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV
Sbjct  192   FLYDRCRKVDQNLSDRRTVEWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLV  251

Query  1367  VPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQPCFM  1191
             +PS K DY++ RV+D++ IN CLGR VV+++++F E ++KNH  ID+ ICYFS PQ C++
Sbjct  252   IPSPKFDYQYDRVIDIERINTCLGRNVVVSFDQFKEKAKKNHFRIDRFICYFSSPQLCYV  311

Query  1190  DDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVE  1014
             D++ IKKLK  G+S++ K+E  W+ED+K+P ++TVQD+ +KF S+DDVIAIGDVF+AD+E
Sbjct  312   DEEHIKKLKVLGISIDGKLEAPWSEDIKRPSKRTVQDVQTKFKSDDDVIAIGDVFYADME  371

Query  1013  TGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKP  834
               WVMQPGGPI HKCKTLIEPS+LI+LTAQRF+QTFLG++FIALHFRRHGFLKFCNAK P
Sbjct  372   QDWVMQPGGPINHKCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAKSP  431

Query  833   SCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNS  654
             SCFYP+PQAA+CI+R++ER+N  VIYLSTDAAESETSLLQSLVV +GK VPLVKRP RNS
Sbjct  432   SCFYPIPQAAECISRIVERSNGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPRNS  491

Query  653   AEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCD  474
             AEKWDALLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++SMCD
Sbjct  492   AEKWDALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSMCD  551

Query  473   EYLCQGEVPNFIADDE  426
             EYLC+GE PNFIA+DE
Sbjct  552   EYLCRGEEPNFIAEDE  567



>ref|XP_010029525.1| PREDICTED: uncharacterized protein LOC104419540 [Eucalyptus grandis]
Length=585

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/542 (62%), Positives = 416/542 (77%), Gaps = 6/542 (1%)
 Frame = -3

Query  2066  SFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFDSP  1887
             +F ++    R     RF F   K Y LAI++ +  ++ + + DI+ +F    S     S 
Sbjct  35    AFDVEDLDSRIGAARRFPFRFNKSYLLAILISVLFLVAFFSADIRGLFSGHASAFGLGST  94

Query  1886  ANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnssle  1707
             A+RMRESELRAL LL+QQ+L LF  WNHTF++ + +A       + SS+  S        
Sbjct  95    ADRMRESELRALSLLKQQRLGLFGLWNHTFLD-SAIARNGTANFTLSSSNSSVLKKRDSG  153

Query  1706  rtgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGN-SLDLSDNN-TDPSIS--GL  1539
                +S SA+F ED K+ +L QI LNK I++VLL  HQ GN S++  D +  D + S  G 
Sbjct  154   HLLASSSALF-EDFKSAVLRQIKLNKDIEEVLLLPHQSGNVSVENGDGDMVDVNFSDFGF  212

Query  1538  GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPS  1359
              +CR VDQ  S RKTIEWKP+ +K+L AICVSGQMSNHLICLEKHMFFAAVL R LVVPS
Sbjct  213   DQCRTVDQNSSGRKTIEWKPKPDKFLLAICVSGQMSNHLICLEKHMFFAAVLGRILVVPS  272

Query  1358  SKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             SKVDYE+ +VLDVDHIN CLGRKVV+++EEF+  +K H+HID+ ICYFS PQ C++DD+ 
Sbjct  273   SKVDYEYNKVLDVDHINDCLGRKVVMSFEEFSGVKKTHLHIDRFICYFSSPQHCYVDDEH  332

Query  1178  IKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVM  999
             +KKLK  G+SM K+E+ W ED +KP ++T+QD+ +KF+ +DDVIAIGDVFFAD+E  WV 
Sbjct  333   VKKLKGLGISMGKLESPWVEDTQKPNKRTIQDVEAKFTVDDDVIAIGDVFFADLEQEWVT  392

Query  998   QPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYP  819
             QPGGP+AHKCK LIEPS LI+LTAQRF+QTFLG+++IALHFRRHGFLKFCNAK PSCFYP
Sbjct  393   QPGGPLAHKCKALIEPSHLIVLTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKTPSCFYP  452

Query  818   VPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWD  639
             VPQAA+CI RV+ER ++PVIYLSTDAAESET LLQ+L+  NGK +PLVKRP R+ AEKWD
Sbjct  453   VPQAAECIKRVVERTDAPVIYLSTDAAESETGLLQTLIFSNGKPIPLVKRPDRSPAEKWD  512

Query  638   ALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQ  459
             ALLYRHGL++D+QVEAMLDKTICA+S VFIGA GSTFTEDILRLR+ WGSAS CDEYLCQ
Sbjct  513   ALLYRHGLQDDSQVEAMLDKTICAMSRVFIGASGSTFTEDILRLRKDWGSASRCDEYLCQ  572

Query  458   GE  453
             GE
Sbjct  573   GE  574



>ref|XP_010442117.1| PREDICTED: uncharacterized protein LOC104725193 [Camelina sativa]
Length=568

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/555 (61%), Positives = 422/555 (76%), Gaps = 26/555 (5%)
 Frame = -3

Query  2081  SPGRSSFQIDGNKDRFIDPARFNFICRKRYCL-AIILPLFVILLYATTDIKNIFRTGVSK  1905
             SP  S+FQI+    R +   R+     KRY + A+ L + + LL+  TD + +F   +S+
Sbjct  37    SPRPSTFQIEDIMQR-VQQHRWKISLNKRYVIVAVSLVISIGLLFLLTDPRELFSANLSR  95

Query  1904  ITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgs  1725
                D  ANR++ESELRALYLLR+QQLEL   WN T VN +                    
Sbjct  96    FKLDPLANRVKESELRALYLLRKQQLELLSLWNGTLVNPS--------------------  135

Query  1724  snsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSIS  1545
               +      S  S+V  ED+K+ +  QISLNK+IQ+VLLS H+  N         D    
Sbjct  136   -LNQSANASSLGSSVLFEDVKSAVSKQISLNKEIQEVLLSPHRTAN-YSGGGTGVDSVNF  193

Query  1544  GLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVV  1365
                RCRKVDQ  S+R+T+EWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+
Sbjct  194   LYDRCRKVDQNLSDRRTVEWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVI  253

Query  1364  PSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQPCFMD  1188
             PS K DY++ RV+D++ IN CLGR VV+++++F E ++KNH  ID+ ICYFS PQ C++D
Sbjct  254   PSPKFDYQYDRVIDIERINTCLGRNVVVSFDQFKEKAKKNHFRIDRFICYFSLPQLCYVD  313

Query  1187  DDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVET  1011
             ++ +KKLK  G+S++ K++  W ED+KKP ++TVQD+ +KF S+DDVIAIGDVF+AD+E 
Sbjct  314   EEHVKKLKGLGISIDGKLQAPWTEDIKKPSKRTVQDVQTKFKSDDDVIAIGDVFYADMEQ  373

Query  1010  GWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPS  831
              WVMQPGGPI HKCKTLIEPS+LI+LTAQRF+QTFLG++FIALHFRRHGFLKFCNAK PS
Sbjct  374   DWVMQPGGPINHKCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAKSPS  433

Query  830   CFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSA  651
             CFYP+PQAA+CI R++ER+N  VIYLSTDAAESETSLLQSLVV +GK VPLVKRP RNSA
Sbjct  434   CFYPIPQAAECIARIVERSNGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPRNSA  493

Query  650   EKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDE  471
             EKWDALLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++SMCDE
Sbjct  494   EKWDALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSMCDE  553

Query  470   YLCQGEVPNFIADDE  426
             YLC+GE PNFIA+DE
Sbjct  554   YLCRGEEPNFIAEDE  568



>ref|XP_006280247.1| hypothetical protein CARUB_v10026161mg [Capsella rubella]
 gb|EOA13145.1| hypothetical protein CARUB_v10026161mg [Capsella rubella]
Length=568

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/552 (61%), Positives = 420/552 (76%), Gaps = 28/552 (5%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCL-AIILPLFVILLYATTDIKNIFRTGVSKITF  1896
             RS+FQI+    R     R+     KRY + A+ L + + LL+  TD + +F   +S    
Sbjct  42    RSAFQIEDIVQRV--QHRWKISLNKRYVIVAVSLIISIGLLFILTDPRELFSANLSSFKR  99

Query  1895  DSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssns  1716
             D  +NR++ESELRALYLLRQQQL L   WN T VN +   + N +               
Sbjct  100   DPLSNRVKESELRALYLLRQQQLALLSLWNGTLVNPSLNQSANASSLE------------  147

Query  1715  slertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG  1536
                      S+V  ED+K+ +  QISLNK+IQ+VLLS H+  N         D       
Sbjct  148   ---------SSVLFEDVKSAVSKQISLNKEIQEVLLSPHRTANYS--GGTEVDSVNLAYD  196

Query  1535  RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSS  1356
             RCRKVDQ  S+R+T+EWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PS 
Sbjct  197   RCRKVDQNLSDRRTVEWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIPSP  256

Query  1355  KVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             K DY++ RV+D++ IN CLGR VV+++++F E ++KNH  ID+ ICYFS PQ C++D++ 
Sbjct  257   KFDYQYDRVIDIERINTCLGRNVVVSFDQFKEKAKKNHFRIDRFICYFSSPQLCYVDEEH  316

Query  1178  IKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWV  1002
             IKKLK  G+S++ K+E  W+ED+KKP ++TVQD+ +KF S+DDVIAIGDVF+AD+E  WV
Sbjct  317   IKKLKGLGISIDGKLEAPWSEDIKKPSKRTVQDVQTKFKSDDDVIAIGDVFYADMEQDWV  376

Query  1001  MQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFY  822
             MQPGGPI HKCKTLIEPS+LI+LTAQRF+QTFLG++FIALHFRRHGFLKFCNAK PSCFY
Sbjct  377   MQPGGPINHKCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAKSPSCFY  436

Query  821   PVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKW  642
             P+PQAA+CI R++ER+N  VIYLSTDAAESETSLLQSLVV +GK VPLVKRP RNSAEKW
Sbjct  437   PIPQAAECIARIVERSNGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPRNSAEKW  496

Query  641   DALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLC  462
             DALLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++SMCDEYLC
Sbjct  497   DALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSMCDEYLC  556

Query  461   QGEVPNFIADDE  426
             +GE PNFIA+DE
Sbjct  557   RGEEPNFIAEDE  568



>ref|XP_008451086.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103492463 
[Cucumis melo]
Length=542

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/566 (61%), Positives = 418/566 (74%), Gaps = 37/566 (7%)
 Frame = -3

Query  2120  NLIGDGERRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATT  1941
             NLI   E  + + SP   +F +  N        R  F  +KRY  AI  PLF++LLY +T
Sbjct  13    NLIHHNEI-NHSPSPHSDAFHVGVNPHLRSTSPRRPFSFKKRYLFAIFFPLFLLLLYFST  71

Query  1940  DIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnnt  1761
                N+F +  +   FD    RM ESEL AL+LL+QQ+L L   WN +F + +   +    
Sbjct  72    HFTNLFSSSFT--AFDLLRYRMTESELHALFLLKQQRLGLLTMWNISFTSHSNSTS----  125

Query  1760  gnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSL  1581
                                          EDLK  LL+QISLNK+IQ VLLSSHQ GNS 
Sbjct  126   -----------------------------EDLKLSLLTQISLNKEIQNVLLSSHQTGNSS  156

Query  1580  -DLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKH  1404
              ++ D+  D   SG  RCRKVDQ    R+TIEW P+SNK+LFAIC SGQMSNHLICLEKH
Sbjct  157   NEVYDDGLDLVGSGFDRCRKVDQEVLNRRTIEWNPKSNKFLFAICASGQMSNHLICLEKH  216

Query  1403  MFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVI  1224
             MFFAA+LNR +V+PSSKVDY++ RVLDVDH+N CLGRKVV+++EEF+E QKN + IDK  
Sbjct  217   MFFAAILNRVVVIPSSKVDYQYSRVLDVDHVNNCLGRKVVISFEEFSEIQKNRMKIDKFF  276

Query  1223  CYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIA  1044
             CYFS+P  C++DD+ +K+L + GVS  K+E+ W+ED+K P  +TVQDI SKFSS+ DVIA
Sbjct  277   CYFSKPDHCYLDDEHVKQLNNIGVSTAKLESPWDEDIKNPNNRTVQDIESKFSSDADVIA  336

Query  1043  IGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHG  864
             IGDVF+ADVE  W +QPGGPIAHKCKTLIEPS+LI +TAQRF+QTFLG DF+A+HFRRHG
Sbjct  337   IGDVFYADVENDWFVQPGGPIAHKCKTLIEPSQLIKVTAQRFIQTFLGSDFVAIHFRRHG  396

Query  863   FLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTV  684
             FLKFCNAK+PSCFYP+PQAA+CI  V+ER+NSPVIYLSTDAA+SET LLQSLV+ NGK +
Sbjct  397   FLKFCNAKRPSCFYPIPQAANCIASVVERSNSPVIYLSTDAADSETGLLQSLVMVNGKPI  456

Query  683   PLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLR  504
             PLVKRP RNSAEKWDALLYRH +EED+QVEAMLDK ICA+S VFIG  GSTFTEDILRLR
Sbjct  457   PLVKRPPRNSAEKWDALLYRHEIEEDSQVEAMLDKAICAMSRVFIGTSGSTFTEDILRLR  516

Query  503   RGWGSASMCDEYLCQGEVPNFIADDE  426
             + W SAS+CDEYLCQG+ PNFIA++E
Sbjct  517   KDWRSASLCDEYLCQGQDPNFIAENE  542



>ref|XP_004149507.1| PREDICTED: uncharacterized protein LOC101202868 [Cucumis sativus]
 gb|KGN61181.1| hypothetical protein Csa_2G061580 [Cucumis sativus]
Length=495

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/525 (63%), Positives = 396/525 (75%), Gaps = 40/525 (8%)
 Frame = -3

Query  1979  ILPLFVILLYATTDIKNIFRT------GVSKITFDSPANRMRESelralyllrqqqleLF  1818
             I PL +I   +T+ +  IF          SK  FD    RM ESEL AL+LL+QQ+L L 
Sbjct  4     ITPLHLIPTPSTSALTTIFALPPPVVLSPSKRAFDLLRYRMTESELHALFLLKQQRLGLL  63

Query  1817  KQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQIS  1638
               WNH+F + +   +                                 EDLK  LL QIS
Sbjct  64    TMWNHSFTSHSNSTS---------------------------------EDLKLSLLRQIS  90

Query  1637  LNKQIQQVLLSSHQLGNSL-DLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYL  1461
             LNK+IQ VLLSSHQ GNS  ++ D+  D   S   RCRKVDQ    R+TIEW P+SNK+L
Sbjct  91    LNKEIQNVLLSSHQTGNSSNEVYDDGLDLVGSDFDRCRKVDQEVLNRRTIEWNPKSNKFL  150

Query  1460  FAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVL  1281
             FAIC SGQMSNHLICLEKHMFFAA+LNR +V+PSSKVDY++ RVLDVDH+N CLGRKVV+
Sbjct  151   FAICASGQMSNHLICLEKHMFFAAILNRIVVIPSSKVDYQYSRVLDVDHVNNCLGRKVVI  210

Query  1280  TYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPK  1101
             ++EEF+E QKN + IDK  CYFS+P  C++DD+ +K+L + GVS  K+E+ W+ED+K P 
Sbjct  211   SFEEFSEIQKNQMKIDKFFCYFSKPDHCYLDDEHVKQLNNIGVSTAKLESPWDEDIKNPS  270

Query  1100  QKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQR  921
             ++TVQDI SKFSS+ DVIAIGDVF+ADVE GW +QPGGPIAHKCKTLIEPS LI +TAQR
Sbjct  271   KRTVQDIESKFSSDADVIAIGDVFYADVENGWFVQPGGPIAHKCKTLIEPSHLIKVTAQR  330

Query  920   FVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDA  741
             F+QTFLG DFIA+HFRRHGFLKFCNAK+PSCFYP+PQAA+CI  V+ER++SPVIYLSTDA
Sbjct  331   FIQTFLGSDFIAIHFRRHGFLKFCNAKRPSCFYPIPQAANCIASVVERSHSPVIYLSTDA  390

Query  740   AESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALS  561
             A+SET LLQSLV+ NGK +PLVKRP RNSAEKWDALLYRH +E+D+QVEAMLDK ICA+S
Sbjct  391   ADSETGLLQSLVMVNGKPIPLVKRPPRNSAEKWDALLYRHEIEDDSQVEAMLDKAICAMS  450

Query  560   SVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
              VFIG  GSTFTEDILRLR+ W SAS+CDEYLCQG+ PNFIA++E
Sbjct  451   RVFIGTSGSTFTEDILRLRKDWRSASLCDEYLCQGQDPNFIAENE  495



>ref|XP_002892943.1| hypothetical protein ARALYDRAFT_889130 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69202.1| hypothetical protein ARALYDRAFT_889130 [Arabidopsis lyrata subsp. 
lyrata]
Length=583

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/561 (60%), Positives = 424/561 (76%), Gaps = 39/561 (7%)
 Frame = -3

Query  2090  GARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAII-LPLFVILLYATTDIKNIFRTG  1914
             G RSP RS+FQID    R  +  R+     KRY +A++ L LFV  L+  TD +  F   
Sbjct  49    GGRSP-RSAFQIDEIVSRARN--RWKISVNKRYVVAVVSLTLFVGFLFLFTDTRRFFSVD  105

Query  1913  VSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnag  1734
             +S    D  ++R++ESEL+AL LLRQQQL L    N    N +                 
Sbjct  106   LSSFKLDPMSSRVKESELQALNLLRQQQLALVSLLNRAIFNSSNAIG-------------  152

Query  1733  sgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDP  1554
                            S+V ++++KA LL QIS+NK+I++VLLS H+ GN   ++ + +D 
Sbjct  153   ---------------SSVLIDNVKAALLKQISVNKEIEEVLLSPHKTGN-YSVTGSGSD-  195

Query  1553  SISGL---GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVL  1383
             SI+G     RC+KVDQ   ERKTIEWKP   K+LFAIC+SGQMSNHLICLEKHMFFAA+L
Sbjct  196   SITGSYYDDRCKKVDQKLLERKTIEWKPRPEKFLFAICLSGQMSNHLICLEKHMFFAALL  255

Query  1382  NRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQP  1206
             +R LV+PSSK DY++ RV+D++ IN CLGR VV+++++F E  +KN+ HID+ ICYFS P
Sbjct  256   DRVLVIPSSKFDYQYDRVIDIERINTCLGRTVVISFDQFKEIDKKNNAHIDRFICYFSSP  315

Query  1205  QPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVF  1029
             QPC++D+D IKKLK  GVS+  K+E  W ED+KKP ++T +++V KF S+D VIAIGDVF
Sbjct  316   QPCYVDEDHIKKLKGLGVSIGGKLEAPWIEDIKKPTKRTSKEVVEKFKSDDGVIAIGDVF  375

Query  1028  FADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFC  849
             +AD+E   VMQPGGPI HKCKTLIEPSRLI++TAQRF+QTFLG++FI+LH RRHGFLKFC
Sbjct  376   YADMEQDLVMQPGGPINHKCKTLIEPSRLILVTAQRFIQTFLGKNFISLHLRRHGFLKFC  435

Query  848   NAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKR  669
             NAK PSCFYP+PQAADCI+R++ERAN+PVIYLSTDAAESET LLQSLVV NGK VPLVKR
Sbjct  436   NAKSPSCFYPIPQAADCISRMVERANAPVIYLSTDAAESETGLLQSLVVVNGKVVPLVKR  495

Query  668   PARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGS  489
             P RNSAEKWD+LLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG+
Sbjct  496   PPRNSAEKWDSLLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGT  555

Query  488   ASMCDEYLCQGEVPNFIADDE  426
             +SMCDEYLC+GE PNFIA++E
Sbjct  556   SSMCDEYLCRGEEPNFIAENE  576



>ref|XP_003627474.1| GDP-fucose protein-O-fucosyltransferase [Medicago truncatula]
 gb|AET01950.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=542

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/421 (70%), Positives = 364/421 (86%), Gaps = 3/421 (1%)
 Frame = -3

Query  1679  FLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN--NTDPSISGLGRCRKVDQGWS  1506
              +EDLK+ L  QIS+N +IQQ+LL+ H+ GN +D   N  N++ ++    RCR VDQ  S
Sbjct  122   LIEDLKSALFKQISINNEIQQILLNPHRTGNVIDPEFNFGNSNFNVGNYDRCRTVDQSLS  181

Query  1505  ERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVL  1326
             +RKTIEW P+ +K+L AICVSGQMSNHLICLEKHMFFAA+LNR LV+PSSKVDY++ RV+
Sbjct  182   KRKTIEWNPKKDKFLVAICVSGQMSNHLICLEKHMFFAAILNRVLVIPSSKVDYQYDRVV  241

Query  1325  DVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSM  1146
             D+DHINKCLG+KVV++++EF+  +K H+HIDK +CYF+ PQPC++DD+R+KKL   G+ M
Sbjct  242   DIDHINKCLGKKVVMSFDEFSNVKKGHLHIDKFLCYFALPQPCYLDDERLKKLDGLGLGM  301

Query  1145  NKIETAW-NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKC  969
             +K +  W +ED + PK+KTVQD++ KFS +DDV+AIGDVF+A VE  WVMQPGGPIAH+C
Sbjct  302   SKPKAVWEDEDTRNPKKKTVQDVMDKFSYDDDVMAIGDVFYAKVEHEWVMQPGGPIAHQC  361

Query  968   KTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINR  789
             KTLIEP+RLI+LTAQRF+QTFLG +FIALHFRRHGFLKFCNAKKPSCF+P+PQAADCI R
Sbjct  362   KTLIEPNRLILLTAQRFIQTFLGRNFIALHFRRHGFLKFCNAKKPSCFFPIPQAADCILR  421

Query  788   VLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEE  609
             V+ERA++P+IYLSTDAAESET LLQSL+V NGK+VPLV RPARNSAEKWDALLYRH +E 
Sbjct  422   VIERADAPIIYLSTDAAESETGLLQSLIVLNGKSVPLVIRPARNSAEKWDALLYRHHIEG  481

Query  608   DTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADD  429
             D+QVEAMLDKTICA+SSVFIGAPGSTFTEDILRLR+ WGSAS+CDEYLC GE PN +A++
Sbjct  482   DSQVEAMLDKTICAMSSVFIGAPGSTFTEDILRLRKDWGSASLCDEYLCHGEEPNIVAEN  541

Query  428   E  426
             E
Sbjct  542   E  542



>ref|NP_199853.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAB09461.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABO38769.1| At5g50420 [Arabidopsis thaliana]
 gb|AED95941.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AHL38584.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=566

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/552 (61%), Positives = 417/552 (76%), Gaps = 30/552 (5%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAII-LPLFVILLYATTDIKNIFRTGVSKITF  1896
             RS+FQID    R     + +    KRY +  + L + + LL+  TD + +F    S    
Sbjct  42    RSAFQIDDILHRVQHRGKISL--NKRYVIVFVSLIISIGLLFLLTDPRELFAANFSSFKL  99

Query  1895  DSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssns  1716
             D  +NR++ESELRALYLLRQQQL L   WN T VN +                       
Sbjct  100   DPLSNRVKESELRALYLLRQQQLALLSLWNGTLVNPS-----------------------  136

Query  1715  slertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG  1536
               +   +  S+V  ED+K+ +  QISLNK+IQ+VLLS H+  N    +D   D       
Sbjct  137   LNQSENALGSSVLFEDVKSAVSKQISLNKEIQEVLLSPHRSSNYSGGTD--VDSVNFSYN  194

Query  1535  RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSS  1356
             RCRKVDQ  S+RKT+EWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PSS
Sbjct  195   RCRKVDQKLSDRKTVEWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIPSS  254

Query  1355  KVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             K DY++ RV+D++ IN CLGR VV+ +++F E ++KNH  ID+ ICYFS PQ C++D++ 
Sbjct  255   KFDYQYDRVIDIERINTCLGRNVVVAFDQFKEKAKKNHFRIDRFICYFSSPQLCYVDEEH  314

Query  1178  IKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWV  1002
             IKKLK  G+S++ K+E  W+ED+KKP ++TVQD+  KF S+DDVIAIGDVF+AD+E  WV
Sbjct  315   IKKLKGLGISIDGKLEAPWSEDIKKPSKRTVQDVQMKFKSDDDVIAIGDVFYADMEQDWV  374

Query  1001  MQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFY  822
             MQPGGPI HKCKTLIEPS+LI+LTAQRF+QTFLG++FIALHFRRHGFLKFCNAK PSCFY
Sbjct  375   MQPGGPINHKCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAKSPSCFY  434

Query  821   PVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKW  642
             P+PQAA+CI R++ER+N  VIYLSTDAAESETSLLQSLVV +GK VPLVKRP RNSAEKW
Sbjct  435   PIPQAAECIARIVERSNGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPRNSAEKW  494

Query  641   DALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLC  462
             DALLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++S CDEYLC
Sbjct  495   DALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSTCDEYLC  554

Query  461   QGEVPNFIADDE  426
             +GE PNFIA+DE
Sbjct  555   RGEEPNFIAEDE  566



>ref|XP_008804333.1| PREDICTED: uncharacterized protein LOC103717648 [Phoenix dactylifera]
Length=578

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/535 (63%), Positives = 420/535 (79%), Gaps = 8/535 (1%)
 Frame = -3

Query  2021  RFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelralyll  1842
             R  F   KRY L I LPL VILL+ + D+ ++FR GVS I  DS   RMRESELRA++LL
Sbjct  45    RRGFWTSKRYLLVICLPLVVILLFFSLDLGSLFR-GVSIIQADSTGERMRESELRAIHLL  103

Query  1841  rqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLK  1662
             R QQL   + WN T       + V+ +  S   N+ + +++  +     S ++V  E+ +
Sbjct  104   RNQQLGFLRLWNRTLSVAHSGSEVSRSPPSVPFNSSNSNTSGKVVDLPQSLNSVSFEEFR  163

Query  1661  ADLLSQISLNKQIQQVLLSSHQLGN-SLDLSDNNTD--PSISGLGRCRKVDQGWSERKTI  1491
               LL QI LNKQIQ  LLS+H++GN SL  SD+N D  PS SG+  CRKV++  +ER+TI
Sbjct  164   LALLEQIKLNKQIQNTLLSTHRVGNASLGSSDDNVDFDPSSSGVDVCRKVERP-AERRTI  222

Query  1490  EWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHI  1311
             EWKP+ ++YLFAIC+SGQMSNHLICLEKHMFFAA+L R L+ PSSK+DY++ RVLD+DHI
Sbjct  223   EWKPQKDRYLFAICLSGQMSNHLICLEKHMFFAALLGRTLIFPSSKLDYQYDRVLDIDHI  282

Query  1310  NKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIET  1131
             N+C GRKVV+T+EEF E + + + ID+ ICY + P PC++D + IK+L+ SG+S+ KIE 
Sbjct  283   NECFGRKVVITFEEFHEMKNHKMRIDRFICYIASP-PCYLDGEHIKRLEKSGISLGKIEA  341

Query  1130  AWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLI  957
             AW ED  +K  K++ V DIV KFSS+D+V+AIGD+F+ADVE  WVMQPGGP+AHKCKT+I
Sbjct  342   AWPEDAKLKTQKKRVVDDIVPKFSSDDEVLAIGDMFYADVEEEWVMQPGGPLAHKCKTVI  401

Query  956   EPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLER  777
             +PSRLI+LTAQRFVQTFLG ++IALHFRR+GFLKFCN KK SCFYP+PQAA+CI RV+ER
Sbjct  402   QPSRLIILTAQRFVQTFLGSNYIALHFRRNGFLKFCNVKKESCFYPIPQAAECILRVVER  461

Query  776   ANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQV  597
             AN+PVIYLSTDAA SET LLQSLVVFN K VPLVKRPA  SAEKWDALLYR+ +  D+QV
Sbjct  462   ANAPVIYLSTDAATSETDLLQSLVVFNDKPVPLVKRPAHASAEKWDALLYRNHIAGDSQV  521

Query  596   EAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIAD  432
             EAMLDKTICALS+VFIGA GSTFTEDI+RLRRGW SAS CDEYLCQGE+PN+IA+
Sbjct  522   EAMLDKTICALSNVFIGASGSTFTEDIIRLRRGWESASQCDEYLCQGELPNYIAE  576



>gb|AAM66093.1| unknown [Arabidopsis thaliana]
Length=566

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/552 (61%), Positives = 417/552 (76%), Gaps = 30/552 (5%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAII-LPLFVILLYATTDIKNIFRTGVSKITF  1896
             RS+FQID    R     + +    KRY +  + L + + LL+  TD + +F    S    
Sbjct  42    RSAFQIDDILHRVQHRGKISL--NKRYVIVFVSLIISIGLLFLLTDPRELFAANFSSFKL  99

Query  1895  DSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssns  1716
             D  +NR++ESELRALYLLRQQQL L   WN T VN +                       
Sbjct  100   DPLSNRVKESELRALYLLRQQQLALLSLWNGTLVNPS-----------------------  136

Query  1715  slertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG  1536
               +   +  S+V  ED+K+ +  QISLNK+IQ+VLLS H+  N    +D   D       
Sbjct  137   LNQSENALGSSVLFEDVKSAVSKQISLNKEIQEVLLSPHRSSNYSGGTD--VDSVNFSYN  194

Query  1535  RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSS  1356
             RCRKVDQ  S+RKT+EWKP S+K+LFAIC+SGQMSNHL+CLEKHMFFAA+L+R LV+PSS
Sbjct  195   RCRKVDQKLSDRKTVEWKPRSDKFLFAICLSGQMSNHLLCLEKHMFFAALLDRVLVIPSS  254

Query  1355  KVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             K DY++ RV+D++ IN CLGR VV+ +++F E ++KNH  ID+ ICYFS PQ C++D++ 
Sbjct  255   KFDYQYDRVIDIERINTCLGRNVVVAFDQFKEKAKKNHFRIDRFICYFSSPQLCYVDEEH  314

Query  1178  IKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWV  1002
             IKKLK  G+S++ K+E  W+ED+KKP ++TVQD+  KF S+DDVIAIGDVF+AD+E  WV
Sbjct  315   IKKLKGLGISIDGKLEAPWSEDIKKPSKRTVQDVQMKFKSDDDVIAIGDVFYADMEQDWV  374

Query  1001  MQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFY  822
             MQPGGPI HKCKTLIEPS+LI+LTAQRF+QTFLG++FIALHFRRHGFLKFCNAK PSCFY
Sbjct  375   MQPGGPINHKCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAKSPSCFY  434

Query  821   PVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKW  642
             P+PQAA+CI R++ER+N  VIYLSTDAAESETSLLQSLVV +GK VPLVKRP RNSAEKW
Sbjct  435   PIPQAAECIARIVERSNGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPRNSAEKW  494

Query  641   DALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLC  462
             DALLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++S CDEYLC
Sbjct  495   DALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSTCDEYLC  554

Query  461   QGEVPNFIADDE  426
             +GE PNFIA+DE
Sbjct  555   RGEEPNFIAEDE  566



>ref|XP_007135356.1| hypothetical protein PHAVU_010G122400g [Phaseolus vulgaris]
 gb|ESW07350.1| hypothetical protein PHAVU_010G122400g [Phaseolus vulgaris]
Length=544

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/550 (59%), Positives = 422/550 (77%), Gaps = 39/550 (7%)
 Frame = -3

Query  2069  SSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFDS  1890
             ++F ++    RF   +  N   +K+Y +AI+  L VIL ++  D  ++  +   +    +
Sbjct  32    AAFHVEDPSSRF---SHVNSRFQKKYIVAILAILLVILFFSVADFHSLSSSSSFQFDSIT  88

Query  1889  PANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnssl  1710
               +RM+ESELRA+ LLR+QQL L   WN      TR + V++                  
Sbjct  89    --DRMKESELRAINLLRRQQLGLLTAWN-----TTRQSNVSDPNQ---------------  126

Query  1709  ertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGL--G  1536
                        LEDLK+ L  QISLN++I+Q+LL+ H +GNS++  + + + +++G+   
Sbjct  127   -----------LEDLKSTLFKQISLNREIEQILLNPHSMGNSVE-PEFDLNATLNGVIYD  174

Query  1535  RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSS  1356
             RCR VDQ  SER+TI+W P   K+L AICVSGQMSNHLICLEKH+FFAA+LNR LV+PSS
Sbjct  175   RCRTVDQNLSERRTIQWNPRDGKFLLAICVSGQMSNHLICLEKHIFFAALLNRILVIPSS  234

Query  1355  KVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRI  1176
             KVDY F RV+D+D INKCLG+KVV+++E+F+  +K H+HIDK +CYFS+P PC++DD+ +
Sbjct  235   KVDYRFDRVVDIDRINKCLGKKVVVSFEDFSNLKKGHMHIDKFLCYFSKPSPCYLDDEWL  294

Query  1175  KKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQ  996
             KKL+  G++MNK E  W+ED + PK KTVQD++ KFS +DDV+AIGDVF+A+VE  WVMQ
Sbjct  295   KKLEGLGLTMNKPEVVWDEDTRNPKNKTVQDVLGKFSYDDDVMAIGDVFYAEVEPEWVMQ  354

Query  995   PGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPV  816
             PGGPIAH+CKTLIEP+RLI LTAQRF+QTFLG++F+ALHFRRHGFLKFCNAKKPSCF+P+
Sbjct  355   PGGPIAHQCKTLIEPNRLISLTAQRFIQTFLGKNFVALHFRRHGFLKFCNAKKPSCFFPI  414

Query  815   PQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDA  636
             PQAA+CI RV+ERA++P++YLSTDAAESET LLQSLVV NG+ VPLV RPARNSAEKWDA
Sbjct  415   PQAAECILRVVERADAPIVYLSTDAAESETGLLQSLVVLNGRPVPLVIRPARNSAEKWDA  474

Query  635   LLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQG  456
             LLYRHGL+ DTQVEAMLDKTICA+SSVFIGAPGSTFTEDILRLRRGW +AS+CDEYLCQG
Sbjct  475   LLYRHGLDGDTQVEAMLDKTICAMSSVFIGAPGSTFTEDILRLRRGWETASICDEYLCQG  534

Query  455   EVPNFIADDE  426
             E P+ +A++E
Sbjct  535   EEPDIVAENE  544



>ref|XP_004168266.1| PREDICTED: uncharacterized LOC101202868 [Cucumis sativus]
Length=512

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/417 (72%), Positives = 356/417 (85%), Gaps = 1/417 (0%)
 Frame = -3

Query  1673  EDLKADLLSQISLNKQIQQVLLSSHQLGNSL-DLSDNNTDPSISGLGRCRKVDQGWSERK  1497
             EDLK  LL QISLNK+IQ VLLSSHQ GNS  ++ D+  D   S   RCRKVDQ    R+
Sbjct  96    EDLKLSLLRQISLNKEIQNVLLSSHQTGNSSNEVYDDGLDLVGSDFDRCRKVDQEVLNRR  155

Query  1496  TIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVD  1317
             TIEW P+SNK+LFAIC SGQMSNHLICLEKHMFFAA+LNR +V+PSSKVDY++ +VLDVD
Sbjct  156   TIEWNPKSNKFLFAICASGQMSNHLICLEKHMFFAAILNRIVVIPSSKVDYQYSKVLDVD  215

Query  1316  HINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKI  1137
             H+N CLGRKVV+++EEF+E QKN + IDK  CYFS+P  C++DD+ +K+L + GVS  K+
Sbjct  216   HVNNCLGRKVVISFEEFSEIQKNQMKIDKFFCYFSKPDHCYLDDEHVKQLNNIGVSTAKL  275

Query  1136  ETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLI  957
             E+ W+ED+K P ++TVQDI SKFSS+ DVIAIGDVF+ADVE GW +QPGGPIAHKCKTLI
Sbjct  276   ESPWDEDIKNPSKRTVQDIESKFSSDADVIAIGDVFYADVENGWFVQPGGPIAHKCKTLI  335

Query  956   EPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLER  777
             EPS LI +TAQRF+QTFLG DFIA+HFRRHGFLKFCNAK+PSCFYP+PQAA+CI  V+ER
Sbjct  336   EPSHLIKVTAQRFIQTFLGSDFIAIHFRRHGFLKFCNAKRPSCFYPIPQAANCIASVVER  395

Query  776   ANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQV  597
             ++SPVIYLSTDAA+SET LLQSLV+ NGK +PLVKRP RNSAEKWDALLYRH +E+D+QV
Sbjct  396   SHSPVIYLSTDAADSETGLLQSLVMVNGKPIPLVKRPPRNSAEKWDALLYRHEIEDDSQV  455

Query  596   EAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             EAMLDK ICA+S VFIG  GSTFTEDILRLR+ W SAS+CDEYLCQG+ PNFIA++E
Sbjct  456   EAMLDKAICAMSRVFIGTSGSTFTEDILRLRKDWRSASLCDEYLCQGQDPNFIAENE  512



>ref|XP_010923390.1| PREDICTED: uncharacterized protein LOC105046499 [Elaeis guineensis]
Length=579

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/539 (63%), Positives = 425/539 (79%), Gaps = 10/539 (2%)
 Frame = -3

Query  2027  PARF--NFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelra  1854
             PAR    F  RK Y LAI LPL +ILL+ + D+ ++FR GVS I  DS  +RMRESEL+A
Sbjct  42    PARIRRGFWTRKCYLLAICLPLVIILLFFSLDLGSLFR-GVSIIRADSTGDRMRESELQA  100

Query  1853  lyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFL  1674
             +YLLR QQL L + WN T       + V+ +  S   N+ + +++  +     S ++V  
Sbjct  101   IYLLRNQQLGLMRLWNRTLSFAHSRSEVSPSPPSAPFNSSNSTTSDRVVDPSQSLNSVSF  160

Query  1673  EDLKADLLSQISLNKQIQQVLLSSHQLGN-SLDLSDNNTD--PSISGLGRCRKVDQGWSE  1503
             E+ ++ LL QI LNK+IQ  LLS+H++GN SL  SD+N D  PS SG+  CRKV++  +E
Sbjct  161   EEFRSALLEQIKLNKRIQNTLLSNHRVGNTSLASSDDNVDFDPSNSGVDVCRKVERP-TE  219

Query  1502  RKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLD  1323
             R+TIEWKP  ++YLFAIC+SGQMSNHLICLEKHMFFAA+L R L+ PSSK+DY++ RVLD
Sbjct  220   RRTIEWKPRKDRYLFAICLSGQMSNHLICLEKHMFFAALLGRTLIFPSSKLDYQYDRVLD  279

Query  1322  VDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN  1143
             +DHIN+C GRKVV+T+EEF E +KN + ID+ +CY + P PC++D++ IK+LK  G+S+ 
Sbjct  280   IDHINECFGRKVVITFEEFHEMKKNKMRIDRFVCYIASP-PCYLDEEHIKRLKKLGISLG  338

Query  1142  KIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKC  969
             KIE AW +D  +K  K++ V DIV KFSS+D+V+AIGD+F+ADVE  WVMQPGGP+AHKC
Sbjct  339   KIEAAWPKDAKLKTQKKRVVDDIVPKFSSDDEVLAIGDMFYADVEEEWVMQPGGPLAHKC  398

Query  968   KTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINR  789
             KT+I+PSRLI+LTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCFYP+PQAA+CI R
Sbjct  399   KTVIQPSRLIILTAQRFVQTFLGSNYIALHFRRHGFLKFCNLKKESCFYPIPQAAECILR  458

Query  788   VLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEE  609
             V+ERAN+PVIYLSTDAA SET+LLQS+V FN K VPLVKRP   SAEKWDALLYR+ +  
Sbjct  459   VVERANAPVIYLSTDAATSETNLLQSMVAFNDKPVPLVKRPDHASAEKWDALLYRNHIGG  518

Query  608   DTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIAD  432
             D+QVEAMLDKTICALS+VFIGA GSTFTEDI+RLRRGW SAS CDEYLCQGE+PN+IA+
Sbjct  519   DSQVEAMLDKTICALSNVFIGASGSTFTEDIIRLRRGWDSASQCDEYLCQGELPNYIAE  577



>ref|XP_002865803.1| hypothetical protein ARALYDRAFT_918074 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42062.1| hypothetical protein ARALYDRAFT_918074 [Arabidopsis lyrata subsp. 
lyrata]
Length=566

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/552 (61%), Positives = 415/552 (75%), Gaps = 30/552 (5%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAII-LPLFVILLYATTDIKNIFRTGVSKITF  1896
             RS+FQI+    R     R+     KRY +  + L + + LL+  TD + +F    S    
Sbjct  42    RSAFQIEDILQRV--QRRWKISLNKRYVIVFVSLIISIGLLFLLTDPRELFSANFSSFKL  99

Query  1895  DSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssns  1716
             D  +NR++ESELRALYLLRQQQL L   WN T VN +                       
Sbjct  100   DPLSNRVKESELRALYLLRQQQLALLSLWNGTLVNPS-----------------------  136

Query  1715  slertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG  1536
               +      S+V  ED+K+ +  QISLNK+IQ VLLS H+  N         D       
Sbjct  137   LNQSENDLRSSVLFEDVKSAVSKQISLNKEIQNVLLSPHRSSNYS--GGTEVDSVNFSYD  194

Query  1535  RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSS  1356
             RCRKVDQ  S+RKT+EWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PSS
Sbjct  195   RCRKVDQKLSDRKTVEWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIPSS  254

Query  1355  KVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             K DY++ RV+D++ IN CLGR VV+++++F E ++KNH  ID+ ICYFS PQ C++D++ 
Sbjct  255   KFDYQYDRVIDIEGINTCLGRNVVVSFDQFKEKAKKNHFRIDRFICYFSSPQLCYVDEEH  314

Query  1178  IKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWV  1002
             IKKLK  G+S++ K+E  W+ED+KKP ++TVQD+ +KF S+DDVIAIGDVF+AD+E  WV
Sbjct  315   IKKLKGLGISIDGKLEAPWSEDIKKPSKRTVQDVQTKFKSDDDVIAIGDVFYADMEQDWV  374

Query  1001  MQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFY  822
             MQPGGPI HKCKTLIEPS+LI+LTAQRF+QTFLG++FIALHFRRHGFLKFCNAK PSCFY
Sbjct  375   MQPGGPINHKCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAKSPSCFY  434

Query  821   PVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKW  642
             P+PQAA+CI R++ER+N  VIYLSTDAAESETSLLQSLVV +GK VPLVKRP RNSAEKW
Sbjct  435   PIPQAAECIARIVERSNGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPRNSAEKW  494

Query  641   DALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLC  462
             DALLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++S CDEYLC
Sbjct  495   DALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSTCDEYLC  554

Query  461   QGEVPNFIADDE  426
             +GE PNFIA+DE
Sbjct  555   RGEEPNFIAEDE  566



>ref|XP_006307109.1| hypothetical protein CARUB_v10008696mg [Capsella rubella]
 gb|EOA40007.1| hypothetical protein CARUB_v10008696mg [Capsella rubella]
Length=576

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/562 (60%), Positives = 432/562 (77%), Gaps = 34/562 (6%)
 Frame = -3

Query  2090  GARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCL-AIILPLFVILLYATTDIKNIFRTG  1914
             G RSP RS+FQID    R  +  R+     KRY + A+ L LF+ +L+  TD +  F   
Sbjct  42    GGRSP-RSAFQIDEFASRAGN--RWKISLNKRYVVGAVSLTLFLGVLFLFTDTRRFFSVD  98

Query  1913  VSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnag  1734
             +S    D  ++R++ESELRALYLLRQQQL L    N T V+++                 
Sbjct  99    LSTFQLDPLSSRVKESELRALYLLRQQQLALVSLLNRTLVDQS-----------------  141

Query  1733  sgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDP  1554
                  ++   + +  +++ ++++KA L++QIS+NK+I++VLLS H+ GN    S  +   
Sbjct  142   -----ANFNSSNAIGTSLVIDNVKAALVNQISINKEIEEVLLSPHRTGNYS--STGSGLD  194

Query  1553  SISGL----GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAV  1386
             SISG      RCRKVDQ   +RKTIEWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+
Sbjct  195   SISGSYYDDARCRKVDQKLLDRKTIEWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAAL  254

Query  1385  LNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQ  1209
             L+R LV+PS K DY++ RV+D+D IN CLGR VV+++++F E  +KN+ HID+ ICYFS 
Sbjct  255   LDRVLVIPSPKFDYQYDRVIDIDRINTCLGRTVVVSFDQFKEIDKKNNAHIDRFICYFSS  314

Query  1208  PQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDV  1032
             PQPC++D++ IKKLK  G+S+  K+E  W+ED+KKP ++T Q++V KF S+D VIAIGD+
Sbjct  315   PQPCYVDEEHIKKLKGLGISIGGKLEAPWSEDIKKPTKRTSQEVVEKFKSDDGVIAIGDL  374

Query  1031  FFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKF  852
             F+AD+E   VMQPGGPI HKCKTLIEPSRLI++TAQRF+QTFLG++FI+LH RRHGFLKF
Sbjct  375   FYADMEQDLVMQPGGPIKHKCKTLIEPSRLILVTAQRFIQTFLGKNFISLHLRRHGFLKF  434

Query  851   CNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVK  672
             CNAK PSCFYP+PQAADCI+R++ERAN+PVIYLSTDAAESET LLQSLVV +GK VPLVK
Sbjct  435   CNAKSPSCFYPIPQAADCISRMVERANAPVIYLSTDAAESETGLLQSLVVVDGKVVPLVK  494

Query  671   RPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWG  492
             RP RNSAEKWD+LLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG
Sbjct  495   RPPRNSAEKWDSLLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWG  554

Query  491   SASMCDEYLCQGEVPNFIADDE  426
             ++SMCDEYLC+GE PNFIA++E
Sbjct  555   TSSMCDEYLCRGEEPNFIAENE  576



>ref|XP_008812999.1| PREDICTED: uncharacterized protein LOC103723759 [Phoenix dactylifera]
Length=578

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/539 (63%), Positives = 428/539 (79%), Gaps = 10/539 (2%)
 Frame = -3

Query  2027  PARF--NFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelra  1854
             PAR    F   KRY  AI LPL +ILL+ + D+ ++F  GVS +  D P +RMRESELRA
Sbjct  41    PARIRRGFWTSKRYLFAICLPLVLILLFFSLDLGSLFH-GVSIVRADYPGDRMRESELRA  99

Query  1853  lyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFL  1674
             LYLLR QQL L K WN T       + V+ +  +  SN+ + +++  +     SF++V  
Sbjct  100   LYLLRNQQLGLLKLWNQTLSAAHPGSEVSPSTPAVPSNSSNSTTSGKVVDLPRSFNSVSF  159

Query  1673  EDLKADLLSQISLNKQIQQVLLSSHQLGN-SLDLSDNNTDPSISGLGR--CRKVDQGWSE  1503
             E+ ++ LL QI LNKQIQ+ LLS+H++GN S + SDNN D  +SG G   C+KV +G +E
Sbjct  160   EEFRSALLEQIKLNKQIQKTLLSTHRVGNTSSESSDNNVDFDLSGSGVDVCKKV-EGPAE  218

Query  1502  RKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLD  1323
             R+TIEWKP+ ++YLFAIC+SGQMSNHLICLEKHMFFAA+L R LV+PSSKVDY++ RVLD
Sbjct  219   RRTIEWKPKKDRYLFAICLSGQMSNHLICLEKHMFFAALLGRTLVLPSSKVDYQYDRVLD  278

Query  1322  VDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN  1143
             +DHINKC  RKVV+T+EEF E +KN + ID+ ICY + P PC++D++ IK+L+  G+S+ 
Sbjct  279   IDHINKCFSRKVVITFEEFYEMKKNKMRIDRFICYIASP-PCYLDEEHIKRLEKLGISLG  337

Query  1142  KIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKC  969
             KIE AW ED  +K  K++ V+DI+ KFSS+D+V+AIGD+F+ADVE  WVMQPGGP+AHKC
Sbjct  338   KIEAAWPEDAKLKMQKKRVVEDIMPKFSSDDEVLAIGDMFYADVEEEWVMQPGGPLAHKC  397

Query  968   KTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINR  789
             +T+I+PSRL++LTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCFYP+PQAA+CI R
Sbjct  398   RTVIQPSRLVILTAQRFVQTFLGSNYIALHFRRHGFLKFCNVKKESCFYPIPQAAECILR  457

Query  788   VLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEE  609
             V+ERAN+PVIYLSTDAA+SET+LLQS+VVFN K V LVKRP   +AEKWDALLYR+ +  
Sbjct  458   VVERANAPVIYLSTDAADSETNLLQSMVVFNDKPVALVKRPDHTNAEKWDALLYRNHMGG  517

Query  608   DTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIAD  432
             D+QVEAMLDKTICALS+VFIGA GSTFTEDI+RLR+GW SAS CDEYLCQGE+PN+IA+
Sbjct  518   DSQVEAMLDKTICALSNVFIGASGSTFTEDIIRLRKGWESASQCDEYLCQGELPNYIAE  576



>ref|XP_010685200.1| PREDICTED: uncharacterized protein LOC104899667 [Beta vulgaris 
subsp. vulgaris]
Length=575

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/417 (71%), Positives = 355/417 (85%), Gaps = 0/417 (0%)
 Frame = -3

Query  1676  LEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERK  1497
              EDLK+ +   + LNK+IQ+VLLS+H  GN  +L   N D    G+  C KVDQ  SERK
Sbjct  159   FEDLKSRIFDGLMLNKEIQKVLLSTHNNGNVSELGVGNDDLVEGGISICGKVDQKLSERK  218

Query  1496  TIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVD  1317
             TIEW P S+KYL AIC+SGQMSNHLICLEKHMFFAA+L R LV+PS KVDYEF RVLD++
Sbjct  219   TIEWNPRSDKYLIAICLSGQMSNHLICLEKHMFFAALLGRVLVIPSHKVDYEFNRVLDIE  278

Query  1316  HINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKI  1137
             H+NKCLGRK V+T+EEF+E +K  + IDK ICYFSQPQ C++D++ +KKLKS G+S+ K+
Sbjct  279   HMNKCLGRKAVVTFEEFSEEKKKDLRIDKFICYFSQPQKCYVDEEHVKKLKSLGLSVPKL  338

Query  1136  ETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLI  957
             E+ W EDVKKPK++TV+D+  KFSS++ VIAIGDVFFADV+  WVMQPGGPIAHKCKTLI
Sbjct  339   ESPWEEDVKKPKKRTVEDVKDKFSSDEGVIAIGDVFFADVDKDWVMQPGGPIAHKCKTLI  398

Query  956   EPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLER  777
             EPSRLIMLTAQRFVQTFLG+DF+ALHFRRHG+LKFCNAK PSC++ +PQAA CI RV+ R
Sbjct  399   EPSRLIMLTAQRFVQTFLGKDFVALHFRRHGWLKFCNAKNPSCYFSIPQAASCIARVVAR  458

Query  776   ANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQV  597
             AN+PV+YLSTDAA+SET LLQSL+V +GK VPLV+RP  NSAEKWDALLYRHGL  D+QV
Sbjct  459   ANTPVVYLSTDAADSETGLLQSLIVIDGKPVPLVQRPVHNSAEKWDALLYRHGLAGDSQV  518

Query  596   EAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             EAMLDKTICA+SS FIG+ GSTFTEDILRLR+GWG+ S+CDEY+CQGEVPNFIA+DE
Sbjct  519   EAMLDKTICAMSSAFIGSSGSTFTEDILRLRKGWGTLSVCDEYICQGEVPNFIAEDE  575



>ref|XP_004510588.1| PREDICTED: uncharacterized protein LOC101496484 [Cicer arietinum]
Length=549

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/421 (70%), Positives = 359/421 (85%), Gaps = 3/421 (1%)
 Frame = -3

Query  1679  FLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLD--LSDNNTDPSISGLGRCRKVDQGWS  1506
              +EDLK+ L  QIS+N +IQQ+LL+ H++GN  D      N + S      CR +DQ  S
Sbjct  129   LIEDLKSALSKQISINSEIQQILLNPHRIGNVFDPEFDFGNVNVSNGNYDTCRTIDQNLS  188

Query  1505  ERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVL  1326
             +RKT+EW P+  K+L AICVSGQMSNHLICLEKHMFFAA+LNR LV+PSSK DY++ RV+
Sbjct  189   KRKTVEWNPKEGKFLLAICVSGQMSNHLICLEKHMFFAALLNRVLVIPSSKFDYQYDRVV  248

Query  1325  DVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSM  1146
             ++DHINKCLG+KVV++++EF+  +K+H+HIDK +CYFS PQPC++DD+++KKL   G+SM
Sbjct  249   NIDHINKCLGKKVVISFDEFSNVKKDHLHIDKFLCYFSLPQPCYLDDEKLKKLSGLGLSM  308

Query  1145  NKIETAWN-EDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKC  969
             +K +  W+ ED + PK+K+V+D++SKFS +DDV+AIGDVF+A+VE  WVMQPGGPIAHKC
Sbjct  309   SKPKAVWDDEDTRNPKKKSVEDVMSKFSYDDDVMAIGDVFYAEVEHEWVMQPGGPIAHKC  368

Query  968   KTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINR  789
             KTLIEP+RLI LTAQRF+QTFLG +FIALHFRRHGFLKFCNAKKPSCFYP+PQAADCI R
Sbjct  369   KTLIEPNRLITLTAQRFIQTFLGRNFIALHFRRHGFLKFCNAKKPSCFYPIPQAADCILR  428

Query  788   VLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEE  609
             V+ERA++P+IYLSTDAA+SET LLQSLVV NGK VPLV RPARNSAEKWDALLYRHG+E 
Sbjct  429   VVERADAPIIYLSTDAAQSETGLLQSLVVLNGKPVPLVIRPARNSAEKWDALLYRHGIEG  488

Query  608   DTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADD  429
             D QVEAMLDKTICA+SSVFIGAPGSTFTEDI RLR+ WGS SMCDEYLCQGE PN +A++
Sbjct  489   DAQVEAMLDKTICAMSSVFIGAPGSTFTEDIRRLRKDWGSLSMCDEYLCQGEEPNIVAEN  548

Query  428   E  426
             E
Sbjct  549   E  549



>ref|XP_006402105.1| hypothetical protein EUTSA_v10013133mg [Eutrema salsugineum]
 gb|ESQ43558.1| hypothetical protein EUTSA_v10013133mg [Eutrema salsugineum]
Length=563

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/552 (60%), Positives = 420/552 (76%), Gaps = 32/552 (6%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAII-LPLFVILLYATTDIKNIFRTGVSKITF  1896
             RS+FQI+         +R      KRY LA + L + + L++  TD   +F    S    
Sbjct  41    RSAFQIEDIL------SRRKISLNKRYILAAVSLTISIGLVFLITDPPRLFSANFSSFKV  94

Query  1895  DSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssns  1716
             D  ++R++ES+LRALYLLRQQQL +   WN T VN +                       
Sbjct  95    DPMSSRVKESQLRALYLLRQQQLAILSLWNGTLVNPS----------------------P  132

Query  1715  slertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG  1536
             + +   ++ S+V  ED+K+ +  QISLNK+IQ+VLL+ H+ GN    +++ +D       
Sbjct  133   NHQSANANGSSVLFEDVKSAVSKQISLNKEIQEVLLAPHRTGN-YSGNESESDSGDYSYN  191

Query  1535  RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSS  1356
             RCRKVDQ  S+RKTIEW P S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PSS
Sbjct  192   RCRKVDQNLSDRKTIEWNPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIPSS  251

Query  1355  KVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             K DY++ RV+D+D IN CLGR VV+++++F E ++KN   ID+ ICYFS PQ C++D++ 
Sbjct  252   KFDYQYDRVIDIDRINTCLGRNVVVSFDQFKEKAKKNRPRIDRFICYFSSPQLCYVDEEH  311

Query  1178  IKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWV  1002
             IKKLKS G+S++ K+++ W+ED+KKP +KT++++   F S+DDVIAIGDVF+AD+E   V
Sbjct  312   IKKLKSLGISIDGKLDSPWSEDIKKPSKKTMEEVKRSFKSDDDVIAIGDVFYADMEQDLV  371

Query  1001  MQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFY  822
             MQPGGPI H CKTLIEPS+LI+LTAQRF+QTFLG++FIALHFRRHGFLKFCNAKKPSCFY
Sbjct  372   MQPGGPINHNCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAKKPSCFY  431

Query  821   PVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKW  642
             P+PQAA+CI R++ER+N  VIYLSTDAAESETSLLQSLVV NGK VP VKRP RNSAEKW
Sbjct  432   PIPQAAECIARIVERSNGAVIYLSTDAAESETSLLQSLVVVNGKIVPFVKRPPRNSAEKW  491

Query  641   DALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLC  462
             DALLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++SMCDEYLC
Sbjct  492   DALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSMCDEYLC  551

Query  461   QGEVPNFIADDE  426
             +GE PNFIA+DE
Sbjct  552   RGEEPNFIAEDE  563



>ref|NP_173170.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAO22598.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29566.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AHL38942.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=564

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/559 (60%), Positives = 420/559 (75%), Gaps = 39/559 (7%)
 Frame = -3

Query  2090  GARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAII-LPLFVILLYATTDIKNIFRTG  1914
             G RSP RS+ QID    R  +  R+     KRY +A + L LFV LL+  TD +  F   
Sbjct  41    GGRSP-RSALQIDEILSRARN--RWKISVNKRYVVAAVSLTLFVGLLFLFTDTRTFF---  94

Query  1913  VSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnag  1734
              S    D  ++R++ESEL+AL LLRQQQL L    N T  N +   +             
Sbjct  95    -SSFKLDPMSSRVKESELQALNLLRQQQLALVSLLNRTNFNSSNAIS-------------  140

Query  1733  sgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGN-SLDLSDNNTD  1557
                            S+V ++++KA LL QIS+NK+I++VLLS H+ GN S+  S +++ 
Sbjct  141   ---------------SSVVIDNVKAALLKQISVNKEIEEVLLSPHRTGNYSITASGSDSF  185

Query  1556  PSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNR  1377
                     CRKVDQ   +RKTIEWKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R
Sbjct  186   TGSYNADICRKVDQKLLDRKTIEWKPRPDKFLFAICLSGQMSNHLICLEKHMFFAALLDR  245

Query  1376  FLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQP  1200
              LV+PSSK DY++ +V+D++ IN CLGR VV+++++F E  +KN+ HID+ ICY S PQP
Sbjct  246   VLVIPSSKFDYQYDKVIDIERINTCLGRTVVISFDQFKEIDKKNNAHIDRFICYVSSPQP  305

Query  1199  CFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFA  1023
             C++D+D IKKLK  GVS+  K+E  W+ED+KKP ++T Q++V KF S+D VIAIGDVF+A
Sbjct  306   CYVDEDHIKKLKGLGVSIGGKLEAPWSEDIKKPTKRTSQEVVEKFKSDDGVIAIGDVFYA  365

Query  1022  DVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNA  843
             D+E   VMQPGGPI HKCKTLIEPSRLI++TAQRF+QTFLG++FI+LH RRHGFLKFCNA
Sbjct  366   DMEQDLVMQPGGPINHKCKTLIEPSRLILVTAQRFIQTFLGKNFISLHLRRHGFLKFCNA  425

Query  842   KKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPA  663
             K PSCFYP+PQAADCI+R++ERAN+PVIYLSTDAAESET LLQSLVV +GK VPLVKRP 
Sbjct  426   KSPSCFYPIPQAADCISRMVERANAPVIYLSTDAAESETGLLQSLVVVDGKVVPLVKRPP  485

Query  662   RNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSAS  483
             +NSAEKWD+LLYRHG+E+D+QV AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++S
Sbjct  486   QNSAEKWDSLLYRHGIEDDSQVYAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSS  545

Query  482   MCDEYLCQGEVPNFIADDE  426
             MCDEYLC+GE PNFIA++E
Sbjct  546   MCDEYLCRGEEPNFIAENE  564



>ref|XP_006416723.1| hypothetical protein EUTSA_v10007186mg [Eutrema salsugineum]
 gb|ESQ35076.1| hypothetical protein EUTSA_v10007186mg [Eutrema salsugineum]
Length=579

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/562 (60%), Positives = 422/562 (75%), Gaps = 42/562 (7%)
 Frame = -3

Query  2084  RSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAII----LPLFVILLYATTDIKNIFRT  1917
             RSP RS+FQID    R    +R+N    KRY +A +    L +F  LLY         R 
Sbjct  51    RSP-RSAFQIDETVTR--TRSRWNISLDKRYVVAAVSLTLLVVFFFLLYTNP------RR  101

Query  1916  GVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssna  1737
               S    D  + R+RESELRALYLLRQQQL L    N T V++T                
Sbjct  102   FSSSFKLDPLSTRVRESELRALYLLRQQQLALVSLLNRTLVDQT----------------  145

Query  1736  gsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTD  1557
                   ++L  + S  S++ ++++KA L  QISL+KQI+ VLLS H+ GN   ++D  +D
Sbjct  146   ------ANLNSSNSIGSSLLVDNVKAALAKQISLSKQIEDVLLSPHRTGNH-SVTDPGSD  198

Query  1556  PSISG---LGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAV  1386
              SI+G     RCRKVDQ   ERKTIEWKP   K+LFAIC+SGQMSNHLICLEKHMFFAA+
Sbjct  199   -SITGSYNYERCRKVDQKLLERKTIEWKPRPGKFLFAICLSGQMSNHLICLEKHMFFAAL  257

Query  1385  LNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQ  1209
             L+R LV+PSSK DY++ RV+D++ IN CLGR VV+++++F E  +K + HID+ ICYFS 
Sbjct  258   LDRALVIPSSKFDYQYDRVIDIERINTCLGRTVVISFDQFKEIDKKKNAHIDRFICYFSS  317

Query  1208  PQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDV  1032
             PQPC++D+D +KKLK  G+S+  K+E  W+ED+KKP +++ Q++  KF S+D VIAIGDV
Sbjct  318   PQPCYVDEDHVKKLKGLGISIGGKLEAPWSEDIKKPTKRSFQEVQEKFKSDDGVIAIGDV  377

Query  1031  FFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKF  852
             F+AD+E   VMQPGGPI HKCKTLIEPSRLI+LTAQRF+QTFLG++F ALH RRHGFLKF
Sbjct  378   FYADMEQDLVMQPGGPIKHKCKTLIEPSRLILLTAQRFIQTFLGKNFTALHLRRHGFLKF  437

Query  851   CNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVK  672
             CNAK PSCFYP+PQAADCI+R++ERAN+PVIYLSTDAAESET LLQSLVV +GK VPLVK
Sbjct  438   CNAKSPSCFYPIPQAADCISRIVERANAPVIYLSTDAAESETGLLQSLVVVDGKVVPLVK  497

Query  671   RPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWG  492
             RP R+SAEKWDALLYRHG+E+D+QV+AMLDKTI A+SSVFIGA GSTFTEDILRLR+ WG
Sbjct  498   RPPRDSAEKWDALLYRHGIEDDSQVDAMLDKTISAMSSVFIGASGSTFTEDILRLRKDWG  557

Query  491   SASMCDEYLCQGEVPNFIADDE  426
             ++SMCDEYLC+GE PNFIA+DE
Sbjct  558   TSSMCDEYLCRGEEPNFIAEDE  579



>ref|XP_010537659.1| PREDICTED: uncharacterized protein LOC104812278 [Tarenaya hassleriana]
Length=579

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/528 (61%), Positives = 410/528 (78%), Gaps = 17/528 (3%)
 Frame = -3

Query  1997  RYCL-AIILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleL  1821
             RY +  +   + ++L++  +D +  F T +S +  D  ++R++ESELRALYLLRQQQL L
Sbjct  65    RYIVFGVSFSIVLVLVFLFSDARGFFSTDLSGLKLDPMSSRVKESELRALYLLRQQQLAL  124

Query  1820  FKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQI  1641
                WN T  + +              N    S++S+   + +  S+V  ED+++ +  QI
Sbjct  125   VSLWNSTLFDHS-------------LNRTMNSNSSNAIGSSNLGSSVVFEDVRSAVAKQI  171

Query  1640  SLNKQIQQVLLSSHQLGN-SLDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKY  1464
             SLNK+IQ+ LLS H+  N S D   +          RCRKVDQ  SER+TIEW P S+KY
Sbjct  172   SLNKEIQEALLSPHRTENFSNDSGSSGGVADYYNYERCRKVDQKLSERRTIEWNPRSDKY  231

Query  1463  LFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVV  1284
             LFAIC+SGQMSNHLICLEKHMFFAA+L R LV+PS K DY++ RV+D+D IN CLG+ VV
Sbjct  232   LFAICLSGQMSNHLICLEKHMFFAALLGRVLVIPSPKFDYQYDRVIDIDRINTCLGKNVV  291

Query  1283  LTYEEFAESQKN-HVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVK  1110
             +++++F E +K  H  ID++ICYFS PQPC++DDD +KKLK  G+++  K+E+ W+ED+K
Sbjct  292   ISFDQFMEKEKKKHARIDRLICYFSSPQPCYVDDDHVKKLKGLGIAIGGKLESPWSEDIK  351

Query  1109  KPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLT  930
             KP ++T Q++  KF S+D+VIAIGDVF+ADVE  WVMQPGGPI HKCKTLIEPSRLI+LT
Sbjct  352   KPTKRTSQEVEEKFKSDDEVIAIGDVFYADVEQDWVMQPGGPIKHKCKTLIEPSRLILLT  411

Query  929   AQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLS  750
             AQRF+QTFLG++FIA+HFRRHGFLKFCNAK PSCFYP+PQAA+CI R++ERA++PVIYLS
Sbjct  412   AQRFIQTFLGKNFIAIHFRRHGFLKFCNAKTPSCFYPIPQAAECITRIVERADAPVIYLS  471

Query  749   TDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTIC  570
             TDAAESETSLLQSLVV +GK VPLVKRP RNSAEKWDALLYRHG+E+D+QVEAMLDKTIC
Sbjct  472   TDAAESETSLLQSLVVVDGKVVPLVKRPPRNSAEKWDALLYRHGIEDDSQVEAMLDKTIC  531

Query  569   ALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             A +SVFIGA GSTFT+DILRLR+ WG++S+CDE+LC GE PNFIA+DE
Sbjct  532   AKASVFIGASGSTFTDDILRLRKDWGTSSICDEFLCHGEDPNFIAEDE  579



>ref|XP_010934941.1| PREDICTED: uncharacterized protein LOC105054968 [Elaeis guineensis]
Length=578

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/539 (62%), Positives = 420/539 (78%), Gaps = 10/539 (2%)
 Frame = -3

Query  2027  PARF--NFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFDSPANRMRESelra  1854
             PAR    F   KRY LAI LPL +ILL+ + D+ ++F  GVS +  DSP +RMRESELRA
Sbjct  41    PARIRRGFWTSKRYLLAICLPLVLILLFFSLDLGSLF-NGVSIVRTDSPGDRMRESELRA  99

Query  1853  lyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFL  1674
             LYLLR QQL L K WN T       +  +    S  SN+ + +++  +     SF +V  
Sbjct  100   LYLLRNQQLGLLKLWNQTLSTAHSGSEASPATPSVPSNSSNSTTSGKVVDLPQSFKSVSF  159

Query  1673  EDLKADLLSQISLNKQIQQVLLSSHQLGN-SLDLSDNNT--DPSISGLGRCRKVDQGWSE  1503
              + ++ LL QI LNKQIQ  LLS+H++GN S +LSD+N   D S SG+  C+ V++   E
Sbjct  160   AEFRSALLEQIKLNKQIQTTLLSAHRVGNTSSELSDDNMGFDLSGSGVDVCKIVERP-KE  218

Query  1502  RKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLD  1323
             RKTIEWKP+ ++YLFAIC+SGQMSNHLICLEKHMFFAA+L R L++PSSK DY++ RVLD
Sbjct  219   RKTIEWKPKKDRYLFAICLSGQMSNHLICLEKHMFFAALLGRTLILPSSKFDYQYDRVLD  278

Query  1322  VDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN  1143
             +DHIN+C  RKVV+T+EEF E +KN + ID+ ICY + P PC++D++  K+L+  G+S+ 
Sbjct  279   IDHINQCFDRKVVITFEEFYEMKKNKMRIDRFICYIASP-PCYLDEEHTKRLEKLGISLG  337

Query  1142  KIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKC  969
             KIE AW ED  +K  K++ V DI+ KFSS+D+V+AIGD+F+ADVE  WVMQPGGP+ HKC
Sbjct  338   KIEAAWPEDAKLKTQKKRVVDDIMPKFSSDDEVLAIGDMFYADVEEEWVMQPGGPLDHKC  397

Query  968   KTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINR  789
             KT+I+PSRLI+LTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCFYP+PQAA+CI R
Sbjct  398   KTVIQPSRLIILTAQRFVQTFLGSNYIALHFRRHGFLKFCNVKKESCFYPIPQAAECILR  457

Query  788   VLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEE  609
             ++ERAN+PVIYLSTDAA+SET+LLQS+V+ N K VPLVKRP  NSAEKWDALLYR+ +  
Sbjct  458   MVERANAPVIYLSTDAADSETNLLQSMVLVNDKPVPLVKRPDHNSAEKWDALLYRNHMGG  517

Query  608   DTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIAD  432
             D QVEAMLDKTICALS+VFIGA GSTFTEDI+RLRRGW SAS CDEYLCQGE+PN++A+
Sbjct  518   DGQVEAMLDKTICALSNVFIGASGSTFTEDIIRLRRGWESASQCDEYLCQGELPNYVAE  576



>ref|XP_010498071.1| PREDICTED: uncharacterized protein LOC104775835 [Camelina sativa]
Length=577

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/563 (59%), Positives = 430/563 (76%), Gaps = 35/563 (6%)
 Frame = -3

Query  2090  GARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCL-AIILPLFVILLYATTDIKNIFRTG  1914
             G RSP RS+FQID    R  +  R+     KRY + A+ L LF+ +L+  TD +  F   
Sbjct  42    GGRSP-RSAFQIDDIASRARN--RWKISLNKRYVVGAVSLALFLGVLFFFTDTRRFFSVD  98

Query  1913  VSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnag  1734
             +S    D  ++R++ESEL+ALYLLR+QQL L    N T V+++                 
Sbjct  99    LSSFKLDPLSSRVKESELQALYLLRKQQLALVSLLNRTLVDQS-----------------  141

Query  1733  sgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDP  1554
                  ++   + +  S+V  +++KA L+ QIS+NK+I++VLLS H+ GN   ++ +  D 
Sbjct  142   -----ANFNSSNAIGSSVVTDNVKAALVKQISVNKEIEEVLLSPHRTGND-SITGSGLD-  194

Query  1553  SISGL----GRCRKVDQG-WSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAA  1389
             SISG     GRCRKVDQ    +RKTIEW P S+++LFAIC+SGQMSNHLICLEKHMFFAA
Sbjct  195   SISGSYYDDGRCRKVDQKKLLDRKTIEWNPRSDRFLFAICLSGQMSNHLICLEKHMFFAA  254

Query  1388  VLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFS  1212
             +L+R LV+ S K DY++ RV+D+D IN CLGR VV+++++F E  +KN+ HID+ ICYFS
Sbjct  255   LLDRVLVILSPKFDYQYDRVIDIDRINTCLGRTVVISFDQFKEVDKKNNAHIDRFICYFS  314

Query  1211  QPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGD  1035
              PQPC++D++ IKKLK  G+S+  K+E  W+ED+KKP ++T Q++V KF S+D VIAIGD
Sbjct  315   SPQPCYVDEEHIKKLKGLGISIGGKLEAPWSEDIKKPTKRTSQEVVEKFKSDDGVIAIGD  374

Query  1034  VFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLK  855
             VF+AD+E   VMQPGGPI HKCKTLIEPS+LI++TAQRF+QTFLG++FI+LH RRHGFLK
Sbjct  375   VFYADMEQDLVMQPGGPIKHKCKTLIEPSKLILVTAQRFIQTFLGKNFISLHLRRHGFLK  434

Query  854   FCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLV  675
             FCNAK PSCFYP+PQAADCI+R++ERAN+PVIYLSTDAAESET LLQSLVV +GK +P V
Sbjct  435   FCNAKSPSCFYPIPQAADCISRMVERANAPVIYLSTDAAESETGLLQSLVVVDGKVIPFV  494

Query  674   KRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGW  495
             KRP RNSAEKWD+LLYRHG+E+DTQV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ W
Sbjct  495   KRPPRNSAEKWDSLLYRHGIEDDTQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDW  554

Query  494   GSASMCDEYLCQGEVPNFIADDE  426
             G++SMCDEYLC+GE PNFIA++E
Sbjct  555   GTSSMCDEYLCRGEEPNFIAENE  577



>ref|XP_010476871.1| PREDICTED: uncharacterized protein LOC104756057 [Camelina sativa]
Length=579

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/564 (59%), Positives = 429/564 (76%), Gaps = 35/564 (6%)
 Frame = -3

Query  2090  GARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAII--LPLFVILLYATTDIKNIFRT  1917
             G RSP RS FQID    R  +  R+     KRY +  +  + LF+ +L+  TD +  F  
Sbjct  42    GGRSP-RSPFQIDDIASRARN--RWKISLNKRYVVGAVSLITLFLGVLFFFTDTRRFFSV  98

Query  1916  GVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssna  1737
              +S    D   +R++ESEL+ALYLLRQQQL L    NHT  +++                
Sbjct  99    DLSSFKLDPLTSRVKESELQALYLLRQQQLALVSLLNHTLEDQS----------------  142

Query  1736  gsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTD  1557
                   ++   + +  S++ ++++KA L+ QI +NK+I++VLLS H+ GN   ++ +  D
Sbjct  143   -----ANNFNSSNAIGSSLVIDNVKAALVKQILVNKEIEEVLLSPHRTGND-SVTGSGLD  196

Query  1556  PSISGL----GRCRKVDQG-WSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFA  1392
              SISG     GRCRKVDQ    +RKT+EW P S+++LFAIC+SGQMSNHLICLEKHMFFA
Sbjct  197   -SISGSYYDDGRCRKVDQKKLLDRKTVEWNPRSDRFLFAICLSGQMSNHLICLEKHMFFA  255

Query  1391  AVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYF  1215
             A+L+R LV+PS K DY++ RV+D+D IN CLGR VV++++EF E  +KN+ HID+ ICYF
Sbjct  256   ALLDRVLVIPSPKFDYQYDRVIDIDRINTCLGRTVVISFDEFKEVDKKNNAHIDRFICYF  315

Query  1214  SQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIG  1038
             S PQPC++D++ IKKLK  G+S+  K+E  W+ED+KKP ++T Q+++ KF S+D VIAIG
Sbjct  316   SSPQPCYVDEEHIKKLKGLGISIGGKLEAPWSEDIKKPTKRTSQEVMEKFKSDDGVIAIG  375

Query  1037  DVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFL  858
             DVF+AD+E   VMQPGGPI HKCKTLIEPSRLI++TAQRF+QTFLG++FI+LH RRHGFL
Sbjct  376   DVFYADMEQDLVMQPGGPIKHKCKTLIEPSRLILVTAQRFIQTFLGKNFISLHLRRHGFL  435

Query  857   KFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPL  678
             KFCNAK PSCFYP+PQAADCI+R++ERAN+PVIYLSTDAAESET LLQSLVV +GK +PL
Sbjct  436   KFCNAKSPSCFYPIPQAADCISRMVERANAPVIYLSTDAAESETGLLQSLVVVDGKFIPL  495

Query  677   VKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRG  498
             VKRP RNSAEKWD+LLYRHG+E+DTQV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ 
Sbjct  496   VKRPPRNSAEKWDSLLYRHGIEDDTQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKD  555

Query  497   WGSASMCDEYLCQGEVPNFIADDE  426
             WG++SMCDEYLC+GE PNFIA++E
Sbjct  556   WGTSSMCDEYLCRGEEPNFIAENE  579



>ref|NP_175780.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAY25443.1| At1g53770 [Arabidopsis thaliana]
 gb|AEE32995.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AHL38903.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=563

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/557 (57%), Positives = 406/557 (73%), Gaps = 48/557 (9%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFD  1893
             R +F ++  + R     + N    K+  + I LP+ +IL+Y +TD  N F   V    F 
Sbjct  47    RPTFDVESLRSRLRRSFKLNLT--KKQSIFIFLPIVIILIYLSTDFSNYFSVKVPNSAFR  104

Query  1892  SPA--NRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssn  1719
             S     R+ ES+L+ALYLLR+Q+ +LF  WNHT  N + +                    
Sbjct  105   SNTLTGRVHESDLQALYLLRKQESDLFSIWNHTVSNLSTI--------------------  144

Query  1718  sslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGL  1539
                            +D+K+ +  QISLN+QIQ  LLS H+ GN +D+   ++D   +G 
Sbjct  145   ---------------DDVKSAVFRQISLNRQIQNALLSPHKTGN-VDIG-GSSDGYFAG-  186

Query  1538  GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPS  1359
             G CRKVDQ  + RKTI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L R LV+PS
Sbjct  187   GSCRKVDQKLNGRKTIQWKPRPDKFLFAICLSGQMSNHLICLEKHMFFAALLKRVLVIPS  246

Query  1358  SKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN-----HVHIDKVICYFSQPQPCF  1194
              + DY + R++D+D IN CLGR VV+++EEF +  KN     HVHI++ ICYFS+P+PC+
Sbjct  247   HRFDYHYSRIIDIDRINTCLGRTVVVSFEEFWKKDKNRKKHHHVHINRFICYFSKPEPCY  306

Query  1193  MDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADV  1017
             +D + I KLK+ G+++  K++T W ED+ +P  KT +++ + F S+DDVIAIGDVF+A+V
Sbjct  307   VDKEHITKLKALGITVGGKLDTPWEEDIARPSNKTAEEVEANFRSDDDVIAIGDVFYANV  366

Query  1016  ETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKK  837
             E  WVMQPGGP+AHKC+TLIEP+RLI+LTAQRF+QTFLG+++IALHFRRHGFLKFCNAK 
Sbjct  367   EREWVMQPGGPVAHKCRTLIEPNRLILLTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKN  426

Query  836   PSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARN  657
             PSCF+P+PQAA CI R++E+  +PV+YLSTDAAESET LLQSL++ NGKTVPLVKRPAR+
Sbjct  427   PSCFFPIPQAASCITRLIEKVEAPVLYLSTDAAESETGLLQSLLILNGKTVPLVKRPARD  486

Query  656   SAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMC  477
             SAEKWDALLYRHGLE D+QVEAMLDKTICALSSVFIGA GSTFTEDILRLR+ WG+AS C
Sbjct  487   SAEKWDALLYRHGLEGDSQVEAMLDKTICALSSVFIGASGSTFTEDILRLRKDWGTASEC  546

Query  476   DEYLCQGEVPNFIADDE  426
             DEYLC  E PNFIAD E
Sbjct  547   DEYLCANEQPNFIADHE  563



>ref|XP_010462285.1| PREDICTED: uncharacterized protein LOC104742900 [Camelina sativa]
Length=560

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/566 (56%), Positives = 410/566 (72%), Gaps = 48/566 (8%)
 Frame = -3

Query  2099  RRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFR  1920
             R   A +  R +F ++  + R     + N    K+  + I LP+ +IL+Y +TD  N F 
Sbjct  35    RGSDAAAEQRPTFDVESLRSRLRRSLKLNLT--KKQSIVIFLPIVIILIYLSTDFSNYFS  92

Query  1919  TGVSKITFDSP--ANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnsts  1746
               V    F S   + R  ES+L+ALYLLR+Q+ +LF  WNHT  N + +           
Sbjct  93    VKVPDSVFRSNTLSGRAHESDLQALYLLRKQESDLFSIWNHTLSNLSTI-----------  141

Query  1745  snagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN  1566
                                     ED+K+ +  Q+SLN+QIQ  LLS H+ GN ++L   
Sbjct  142   ------------------------EDVKSAIFRQVSLNRQIQNALLSPHKTGN-VELG-G  175

Query  1565  NTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAV  1386
             + D  ++G G CRK+D+  + R+TI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+
Sbjct  176   SADSYLAG-GNCRKIDRKLNGRRTIQWKPRPDKFLFAICLSGQMSNHLICLEKHMFFAAL  234

Query  1385  LNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQK-----NHVHIDKVIC  1221
             LNR LV+PS + DY + R++D+D IN CLGR VV+++EEF +  K     +HVHID+ IC
Sbjct  235   LNRVLVIPSHRFDYHYSRIIDIDRINTCLGRTVVVSFEEFWKKDKSRKKHHHVHIDRFIC  294

Query  1220  YFSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIA  1044
             YFS+P+PC++D + I KLK+ G+++  K++T W ED  +P  KT +++ + F S+DD+IA
Sbjct  295   YFSKPEPCYVDKEHITKLKALGITIGGKLDTPWEEDTARPSNKTAEEVETNFRSDDDMIA  354

Query  1043  IGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHG  864
             IGDVF+A+VE  WVMQPGGP+AHKCKTLIEP+RLI+LTAQRF+QTFLG+++I+LHFRRHG
Sbjct  355   IGDVFYANVEREWVMQPGGPVAHKCKTLIEPNRLILLTAQRFIQTFLGKNYISLHFRRHG  414

Query  863   FLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTV  684
             FLKFCNAK PSCFYP+PQAA+CI R++E+  +PVIYLSTDAAESET LLQSL++ NGKTV
Sbjct  415   FLKFCNAKNPSCFYPIPQAANCITRLIEKVEAPVIYLSTDAAESETGLLQSLLILNGKTV  474

Query  683   PLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLR  504
             PLVKRPAR+SAEKWDALLYRHGLE D+QVEAMLDKTICA+SSVFIGA GSTFTEDILRLR
Sbjct  475   PLVKRPARDSAEKWDALLYRHGLEGDSQVEAMLDKTICAMSSVFIGASGSTFTEDILRLR  534

Query  503   RGWGSASMCDEYLCQGEVPNFIADDE  426
             + WG+AS CDEYLC  E PNF+AD E
Sbjct  535   KDWGTASECDEYLCANEQPNFVADHE  560



>ref|XP_002894461.1| hypothetical protein ARALYDRAFT_474511 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70720.1| hypothetical protein ARALYDRAFT_474511 [Arabidopsis lyrata subsp. 
lyrata]
Length=563

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/569 (56%), Positives = 408/569 (72%), Gaps = 48/569 (8%)
 Frame = -3

Query  2108  DGERRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKN  1929
             D  R   A +  R +F ++  + R     + N    K+  + I LP+ +IL+Y +TD  N
Sbjct  35    DQFRVSDAAAEQRPTFDVESLRSRLRRNLKLNLT--KKQSIVIFLPIVIILIYLSTDFSN  92

Query  1928  IFRTGVSKITFDSPA--NRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgn  1755
              F   V    F S     R  ES+L+ALYLLR+Q+ +LF  WNHT  N + +        
Sbjct  93    YFSVRVPDSVFRSNTLTGRAHESDLQALYLLRKQESDLFSIWNHTLSNLSTI--------  144

Query  1754  stssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDL  1575
                                        ED+K+ +  QISLN+QIQ  LLS H+ GN +++
Sbjct  145   ---------------------------EDVKSAVFRQISLNRQIQNALLSPHKTGN-VEI  176

Query  1574  SDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFF  1395
                ++D   +G G CRKVDQ  + RKTI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFF
Sbjct  177   G-GSSDVYFAG-GSCRKVDQKLNGRKTIQWKPRPDKFLFAICLSGQMSNHLICLEKHMFF  234

Query  1394  AAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN-----HVHIDK  1230
             AA+L R LV+PS + DY + R++D+D IN CLGR VV+++EEF +  KN     HVHI++
Sbjct  235   AALLKRVLVIPSHRFDYHYSRIIDIDRINTCLGRNVVVSFEEFWKKDKNRKKHHHVHINR  294

Query  1229  VICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDD  1053
              ICYFS+P+PC++D + I KLK+ G+++  K++T W ED+  P  KT +++ + F S+DD
Sbjct  295   FICYFSKPEPCYVDKEHITKLKALGITIGGKLDTPWEEDIASPSNKTAEEVETNFRSDDD  354

Query  1052  VIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFR  873
             +IAIGDVF+A+VE  WVMQPGGP+AHKC+TLIEP+RLI+LTAQRF+QTFLG+++IALHFR
Sbjct  355   LIAIGDVFYANVEREWVMQPGGPVAHKCRTLIEPNRLILLTAQRFIQTFLGKNYIALHFR  414

Query  872   RHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNG  693
             RHGFLKFCNAK PSCFYP+PQAA+CI R++E+  +PVIYLSTDAAESET LLQSL++ NG
Sbjct  415   RHGFLKFCNAKNPSCFYPIPQAANCITRLIEKVEAPVIYLSTDAAESETGLLQSLLILNG  474

Query  692   KTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDIL  513
             KTVPLVKRPAR+SAEKWDALLYRHGLE D QVEAMLDKTICA+SSVF+GA GSTFTEDIL
Sbjct  475   KTVPLVKRPARDSAEKWDALLYRHGLEGDPQVEAMLDKTICAMSSVFVGASGSTFTEDIL  534

Query  512   RLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             RLR+ WG+AS CDEYLC  E PNF+AD E
Sbjct  535   RLRKDWGTASECDEYLCANEHPNFVADPE  563



>ref|XP_006392751.1| hypothetical protein EUTSA_v10011359mg [Eutrema salsugineum]
 gb|ESQ30037.1| hypothetical protein EUTSA_v10011359mg [Eutrema salsugineum]
Length=559

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/560 (57%), Positives = 404/560 (72%), Gaps = 54/560 (10%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKN-IFRTGVSKITF  1896
             R +F ++  + R     + N    KR  + I LPL ++ LY +TD  N  F   V    F
Sbjct  43    RPTFDVESLRSRLTRSFKLNIT--KRQFIVIFLPLVLVFLYLSTDFSNYFFSVKVPDSVF  100

Query  1895  D--SPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgss  1722
                +   R +ES+L+ALYLLR+Q+++LF  WNHT  N + +                   
Sbjct  101   RPITGTGRAQESDLQALYLLRKQEIDLFSIWNHTLSNLSTI-------------------  141

Query  1721  nsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISG  1542
                             ED+K+ +  QISLN+QIQ  LLS H+ GN       + D S  G
Sbjct  142   ----------------EDVKSAVFRQISLNRQIQNALLSPHKTGNV------SIDGSSDG  179

Query  1541  L--GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLV  1368
             L  G CRKVDQ  + RKTI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L R LV
Sbjct  180   LPVGSCRKVDQKLTGRKTIQWKPRPDKFLFAICLSGQMSNHLICLEKHMFFAALLKRILV  239

Query  1367  VPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN-----HVHIDKVICYFSQPQ  1203
             +PS + DY + R++D+D IN CLGR VV+++EEF +  KN     HVHI++ ICYFS+P+
Sbjct  240   IPSHRFDYHYSRIIDIDRINTCLGRNVVVSFEEFWKKDKNRKKHHHVHINRFICYFSKPE  299

Query  1202  PCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFF  1026
             PC++D + I KLK+ G+++  K++T W ED+ +P  KT +++ + F S+DDVIAIGDVF+
Sbjct  300   PCYVDKEHITKLKALGITIGGKLDTPWEEDIARPSNKTAEEVETNFRSDDDVIAIGDVFY  359

Query  1025  ADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCN  846
             A+VE  WVMQPGGPIAHKC+TLIEP+RLI LTAQRF+QTFLG+++IALHFRRHGFLKFCN
Sbjct  360   ANVEREWVMQPGGPIAHKCQTLIEPNRLISLTAQRFIQTFLGKNYIALHFRRHGFLKFCN  419

Query  845   AKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRP  666
             AK PSCFYP+PQAA+CI R++E+  +PVIYLSTDAAESET LLQSL++ NGKTVPLVKRP
Sbjct  420   AKNPSCFYPIPQAANCITRLIEKVEAPVIYLSTDAAESETGLLQSLLMLNGKTVPLVKRP  479

Query  665   ARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSA  486
             AR+SAEKWDALLYRHGLE D+QVEAMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG+A
Sbjct  480   ARDSAEKWDALLYRHGLEGDSQVEAMLDKTICAVSSVFIGASGSTFTEDILRLRKDWGTA  539

Query  485   SMCDEYLCQGEVPNFIADDE  426
             S CDEYLCQ E PNF+AD E
Sbjct  540   SDCDEYLCQNEQPNFVADHE  559



>ref|XP_006307146.1| hypothetical protein CARUB_v10008736mg [Capsella rubella]
 gb|EOA40044.1| hypothetical protein CARUB_v10008736mg [Capsella rubella]
Length=559

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/569 (56%), Positives = 409/569 (72%), Gaps = 48/569 (8%)
 Frame = -3

Query  2108  DGERRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKN  1929
             D  R   A +  R +F ++  + R     + N    K+  + I LP+ +IL+Y +TD  N
Sbjct  31    DQYRGIDAAAEQRPTFDVESLRSRIRRSLKLNLT--KKQSIVIFLPIVIILIYLSTDFSN  88

Query  1928  IFRTGVSKITFDSPA--NRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgn  1755
              F   V    F S     R  ES+L+ALYLLR+Q+ +LF  WNHT  N + +        
Sbjct  89    YFSVEVPNSVFRSNTLTGRSHESDLQALYLLRKQESDLFSIWNHTLSNSSTI--------  140

Query  1754  stssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDL  1575
                                        ED+K+ +  Q+SLN+QIQ  LLS H+ GN ++L
Sbjct  141   ---------------------------EDVKSAVFRQVSLNRQIQNALLSPHKSGN-VEL  172

Query  1574  SDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFF  1395
                ++D   +G G CRK+DQ  + R+TI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFF
Sbjct  173   G-GSSDGFFAG-GSCRKIDQKLNGRRTIQWKPRPDKFLFAICLSGQMSNHLICLEKHMFF  230

Query  1394  AAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN-----HVHIDK  1230
             AA+L R LV+PS   DY + R++D+D IN CLGR VV+++EEF +  KN     HVHI++
Sbjct  231   AALLKRVLVIPSHSFDYHYSRIIDIDRINTCLGRNVVVSFEEFWKKDKNRKKHHHVHINR  290

Query  1229  VICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDD  1053
              ICYFS+P+PC++D + I KLK+ GV++  K+++ W ED+ KP  KT +++ + F S++D
Sbjct  291   FICYFSKPEPCYVDKEHIAKLKALGVTIGGKLDSPWEEDIAKPSNKTAEEVETNFRSDND  350

Query  1052  VIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFR  873
             VIAIGDVF+A+VE  WVMQPGGP+AHKCKTLIEP+RLI+LTAQRF+QTFLG+++I+LHFR
Sbjct  351   VIAIGDVFYANVEREWVMQPGGPVAHKCKTLIEPNRLILLTAQRFIQTFLGKNYISLHFR  410

Query  872   RHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNG  693
             RHGFLKFCNAK PSCFYP+PQAA+CI R++E+  +PV+YLSTDAAESET LLQSL++ NG
Sbjct  411   RHGFLKFCNAKNPSCFYPIPQAANCITRLIEKVKAPVLYLSTDAAESETGLLQSLLILNG  470

Query  692   KTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDIL  513
             KTVPLVKRPAR+SAEKWDALLYRHGLE D+QVEAMLDKTICA+SSVFIGA GSTFTEDIL
Sbjct  471   KTVPLVKRPARDSAEKWDALLYRHGLEGDSQVEAMLDKTICAMSSVFIGASGSTFTEDIL  530

Query  512   RLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             RLR+ WG+AS CDEYLC  E PNF+AD E
Sbjct  531   RLRKDWGTASECDEYLCAKEQPNFVADHE  559



>ref|XP_010501038.1| PREDICTED: uncharacterized protein LOC104778315 [Camelina sativa]
Length=557

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/569 (56%), Positives = 409/569 (72%), Gaps = 54/569 (9%)
 Frame = -3

Query  2099  RRDGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFR  1920
             R   A +  R +F ++  + R     + N    K+  + I LP+ +IL+Y +TD  N F 
Sbjct  32    RGSDAAAEQRPTFDVESLRSRLRRSLKLNLT--KKQSIVIFLPIVIILIYLSTDFSNYFS  89

Query  1919  TGVSKITFDSP--ANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnsts  1746
               V    F S   + R  ES+L+ALYLLR+Q+++LF  WNHT  N + +           
Sbjct  90    VKVPDSVFRSNTLSGRAHESDLQALYLLRKQEIDLFSLWNHTLSNLSTI-----------  138

Query  1745  snagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN  1566
                                     ED+K+ +  Q+SLN+QIQ  LLS H+ GN ++L   
Sbjct  139   ------------------------EDVKSAVFRQVSLNRQIQSALLSPHKTGN-VELGG-  172

Query  1565  NTDPSISGL---GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFF  1395
                 S+ G    G CRK+D+  + R+TI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFF
Sbjct  173   ----SLGGYLAGGSCRKIDRKLNGRRTIQWKPRPDKFLFAICLSGQMSNHLICLEKHMFF  228

Query  1394  AAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN-----HVHIDK  1230
             AA+LNR LV+PS + DY + R++D+D IN CLGR VV+++EEF +  KN     HVHID+
Sbjct  229   AALLNRVLVIPSHRFDYHYSRIIDIDRINTCLGRTVVVSFEEFWKKDKNRKKHHHVHIDR  288

Query  1229  VICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDD  1053
              ICYFS P+PC++D + + KLK+ G+++  K++T W ED+ +P  KT +++ + F S+DD
Sbjct  289   FICYFSIPEPCYVDKEHVTKLKALGITIGGKLDTPWEEDIARPSNKTAEEVETNFRSDDD  348

Query  1052  VIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFR  873
             VIAIGDVF+A+VE  WVMQPGGP+AHKCKTLIEP+RLI+LTAQRF+QTFLG++FI+LHFR
Sbjct  349   VIAIGDVFYANVEREWVMQPGGPVAHKCKTLIEPNRLILLTAQRFIQTFLGKNFISLHFR  408

Query  872   RHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNG  693
             RHGFLKFCNAK PSCFYP+PQAA+CI R++E+  +PVIYLSTDAAESET LLQSL++ NG
Sbjct  409   RHGFLKFCNAKNPSCFYPIPQAANCITRLIEKVEAPVIYLSTDAAESETGLLQSLLILNG  468

Query  692   KTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDIL  513
             KT+PLVKRPAR+SAEKWDALLYRHGLE D+QVEAMLDKTICA+SSVFIGA GSTFTEDIL
Sbjct  469   KTIPLVKRPARDSAEKWDALLYRHGLEGDSQVEAMLDKTICAMSSVFIGASGSTFTEDIL  528

Query  512   RLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             RLR+ WG+AS CDEYLC  E PNF+AD E
Sbjct  529   RLRKDWGTASECDEYLCANEQPNFVADHE  557



>ref|XP_010552180.1| PREDICTED: uncharacterized protein LOC104822610 [Tarenaya hassleriana]
 ref|XP_010552181.1| PREDICTED: uncharacterized protein LOC104822610 [Tarenaya hassleriana]
 ref|XP_010552182.1| PREDICTED: uncharacterized protein LOC104822610 [Tarenaya hassleriana]
Length=585

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/537 (59%), Positives = 401/537 (75%), Gaps = 50/537 (9%)
 Frame = -3

Query  2000  KRYCLAIILPLFVILLYATTDIKNIFRTGVSKI-TFDSPANRMRESelralyllrqqqle  1824
             KR  + I LPL ++L+Y + D+++ F   V      D+ ++R++ESELRALYLLRQQ+  
Sbjct  87    KRQAIVIFLPLVIVLVYLSVDVRSYFSVEVPPFGPSDTVSDRVQESELRALYLLRQQESA  146

Query  1823  LFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQ  1644
             L   WN T  N + +                                   +D+K+++  Q
Sbjct  147   LLSLWNRTSSNSSAI-----------------------------------DDVKSEVFRQ  171

Query  1643  ISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGL----GRCRKVDQGWSERKTIEWKPE  1476
             +SLN+QIQ  LLS H++G   D+ +N    S S      GRCR+VDQ  SERKTI WKP 
Sbjct  172   VSLNRQIQGALLSPHRVG---DVPENGGFSSGSAAYLSGGRCRRVDQKLSERKTIRWKPR  228

Query  1475  SNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLG  1296
              +K+LFAIC+SGQMSNHLICLEKHMFFAA+LNR LV+PS + DY + RV+D+D IN CLG
Sbjct  229   QDKFLFAICLSGQMSNHLICLEKHMFFAALLNRVLVIPSHRFDYHYSRVVDIDRINTCLG  288

Query  1295  RKVVLTYEEFAESQ------KNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSM-NKI  1137
             R VV+++EEF E +       +HV ID+ ICYFS+PQPC++D++ IKKLK+SGVS+ +K+
Sbjct  289   RNVVVSFEEFVEKKNKNKKGHHHVRIDRFICYFSKPQPCYVDEEHIKKLKASGVSVGSKL  348

Query  1136  ETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLI  957
             E  W ED+ KP  KTV+++ + F S+DDVIAIGDVF+A+VE  W MQPGGPIAHKCKTLI
Sbjct  349   EAPWEEDITKPSNKTVEEVEANFRSDDDVIAIGDVFYANVEKEWAMQPGGPIAHKCKTLI  408

Query  956   EPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLER  777
             EP++LI++TAQRF+QTFLG+++IALHFRRHGFLKFCNAK PSCFYP+PQAA+CI R++ER
Sbjct  409   EPNQLILVTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKSPSCFYPIPQAANCIIRLVER  468

Query  776   ANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQV  597
               + VIYLSTDAAESET LLQSL++ +GKTVPLVKRP RNSAEKWDALLYRHGLE+D+QV
Sbjct  469   VGASVIYLSTDAAESETGLLQSLLMLDGKTVPLVKRPPRNSAEKWDALLYRHGLEDDSQV  528

Query  596   EAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             EAMLDKTI A+SSVFIGA GSTFTEDILRLR+ W +AS CDEYLCQ E P+FIAD+E
Sbjct  529   EAMLDKTISAMSSVFIGASGSTFTEDILRLRKDWRTASECDEYLCQHEQPDFIADNE  585



>dbj|BAF00786.1| hypothetical protein [Arabidopsis thaliana]
Length=563

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/557 (57%), Positives = 405/557 (73%), Gaps = 48/557 (9%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFD  1893
             R +F ++  + R     + N    K+  + I LP+ +IL+Y +TD  N F   V    F 
Sbjct  47    RPTFDVESLRSRLRRSFKLNLT--KKQSIFIFLPIVIILIYLSTDFSNYFSVKVPNSAFR  104

Query  1892  SPA--NRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssn  1719
             S     R+ ES+L+ALYLLR+Q+ +LF  WNHT  N + +                    
Sbjct  105   SNTLTGRVHESDLQALYLLRKQESDLFSIWNHTVSNLSTI--------------------  144

Query  1718  sslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGL  1539
                            +D+K+ +  QISLN+QIQ  LLS H+ GN +D+   ++D   +G 
Sbjct  145   ---------------DDVKSAVFRQISLNRQIQNALLSPHKTGN-VDIG-GSSDGYFAG-  186

Query  1538  GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPS  1359
             G CRKVDQ  + RKTI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L R LV+PS
Sbjct  187   GSCRKVDQKLNGRKTIQWKPRPDKFLFAICLSGQMSNHLICLEKHMFFAALLKRVLVIPS  246

Query  1358  SKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN-----HVHIDKVICYFSQPQPCF  1194
              + DY + R++D+D IN  LGR VV+++EEF +  KN     HVHI++ ICYFS+P+PC+
Sbjct  247   HRFDYHYSRIIDIDRINTYLGRTVVVSFEEFWKKDKNRKKHHHVHINRFICYFSKPEPCY  306

Query  1193  MDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADV  1017
             +D + I KLK+ G+++  K++T W ED+ +P  KT +++ + F S+DDVIAIGDVF+A+V
Sbjct  307   VDKEHITKLKALGITVGGKLDTPWEEDIARPSNKTAEEVEANFRSDDDVIAIGDVFYANV  366

Query  1016  ETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKK  837
             E  WVMQPGGP+AHKC+TLIEP+RLI+LTAQRF+QTFLG+++IALHFRRHGFLKFCNAK 
Sbjct  367   EREWVMQPGGPVAHKCRTLIEPNRLILLTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKN  426

Query  836   PSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARN  657
             PSCF+P+PQAA CI R++E+  +PV+YLSTDAAESET LLQSL++ NGKTVPLVKRPAR+
Sbjct  427   PSCFFPIPQAASCITRLIEKVEAPVLYLSTDAAESETGLLQSLLILNGKTVPLVKRPARD  486

Query  656   SAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMC  477
             SAEKWDALLYRHGLE D+QVEAMLDKTICALSSVFIGA GSTFTEDILRLR+ WG+AS C
Sbjct  487   SAEKWDALLYRHGLEGDSQVEAMLDKTICALSSVFIGASGSTFTEDILRLRKDWGTASEC  546

Query  476   DEYLCQGEVPNFIADDE  426
             DEYLC  E PNFIAD E
Sbjct  547   DEYLCANEQPNFIADHE  563



>gb|AAD50008.1|AC007651_3 Hypothetical Protein [Arabidopsis thaliana]
Length=594

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/589 (57%), Positives = 420/589 (71%), Gaps = 69/589 (12%)
 Frame = -3

Query  2090  GARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAII-LPLFVILLYATTDIKNIFRTG  1914
             G RSP RS+ QID    R  +  R+     KRY +A + L LFV LL+  TD +  F   
Sbjct  41    GGRSP-RSALQIDEILSRARN--RWKISVNKRYVVAAVSLTLFVGLLFLFTDTRTFF---  94

Query  1913  VSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnag  1734
              S    D  ++R++ESEL+AL LLRQQQL L    N T  N +   +             
Sbjct  95    -SSFKLDPMSSRVKESELQALNLLRQQQLALVSLLNRTNFNSSNAIS-------------  140

Query  1733  sgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGN-SLDLSDNNTD  1557
                            S+V ++++KA LL QIS+NK+I++VLLS H+ GN S+  S +++ 
Sbjct  141   ---------------SSVVIDNVKAALLKQISVNKEIEEVLLSPHRTGNYSITASGSDSF  185

Query  1556  PSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNR  1377
                     CRKVDQ   +RKTIEWKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R
Sbjct  186   TGSYNADICRKVDQKLLDRKTIEWKPRPDKFLFAICLSGQMSNHLICLEKHMFFAALLDR  245

Query  1376  FLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQP  1200
              LV+PSSK DY++ +V+D++ IN CLGR VV+++++F E  +KN+ HID+ ICY S PQP
Sbjct  246   VLVIPSSKFDYQYDKVIDIERINTCLGRTVVISFDQFKEIDKKNNAHIDRFICYVSSPQP  305

Query  1199  CFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFA  1023
             C++D+D IKKLK  GVS+  K+E  W+ED+KKP ++T Q++V KF S+D VIAIGDVF+A
Sbjct  306   CYVDEDHIKKLKGLGVSIGGKLEAPWSEDIKKPTKRTSQEVVEKFKSDDGVIAIGDVFYA  365

Query  1022  DVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKF---  852
             D+E   VMQPGGPI HKCKTLIEPSRLI++TAQRF+QTFLG++FI+LH RRHGFLKF   
Sbjct  366   DMEQDLVMQPGGPINHKCKTLIEPSRLILVTAQRFIQTFLGKNFISLHLRRHGFLKFWLQ  425

Query  851   ---------------------------CNAKKPSCFYPVPQAADCINRVLERANSPVIYL  753
                                        CNAK PSCFYP+PQAADCI+R++ERAN+PVIYL
Sbjct  426   NLAIVAIMYLDSVAHTQLIGIPEHLSTCNAKSPSCFYPIPQAADCISRMVERANAPVIYL  485

Query  752   STDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTI  573
             STDAAESET LLQSLVV +GK VPLVKRP +NSAEKWD+LLYRHG+E+D+QV AMLDKTI
Sbjct  486   STDAAESETGLLQSLVVVDGKVVPLVKRPPQNSAEKWDSLLYRHGIEDDSQVYAMLDKTI  545

Query  572   CALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             CA+SSVFIGA GSTFTEDILRLR+ WG++SMCDEYLC+GE PNFIA++E
Sbjct  546   CAMSSVFIGASGSTFTEDILRLRKDWGTSSMCDEYLCRGEEPNFIAENE  594



>ref|XP_010479955.1| PREDICTED: uncharacterized protein LOC104758729 [Camelina sativa]
Length=548

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/566 (54%), Positives = 395/566 (70%), Gaps = 62/566 (11%)
 Frame = -3

Query  2093  DGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTG  1914
             D A +  R +F ++  + R     + N    K+  + I LP+ + L+Y +TD  N F   
Sbjct  35    DAAAAEQRPTFDVESLRSRLRRSLKLNLT--KKQSIVIFLPIVITLIYLSTDFTNYFSVK  92

Query  1913  VSKITFDS---PANRMRESelralyllrqqqle-LFKQWNHTFVNKTRLAAVnntgnsts  1746
             V    F S      R  ES+L     L ++Q   LF  WN+T                  
Sbjct  93    VPDSVFRSNTLTGRRAHESDLLQALYLLRKQESDLFSLWNYTLS----------------  136

Query  1745  snagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN  1566
                                    +ED+K+ +  Q+SLN+QIQ  LLS H  GN       
Sbjct  137   -----------------------IEDVKSAVFRQVSLNRQIQNALLSPHNTGNV------  167

Query  1565  NTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAV  1386
                  ++G G CRK+D+  + R+TI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+
Sbjct  168   ----ELAG-GSCRKIDRKLNGRRTIQWKPRPDKFLFAICLSGQMSNHLICLEKHMFFAAL  222

Query  1385  LNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN-----HVHIDKVIC  1221
             LNR LV+PS + DY + R++D+D IN CLGR VV+++EEF +  KN     HVHID+ IC
Sbjct  223   LNRVLVIPSHRFDYHYSRIIDIDRINTCLGRTVVVSFEEFWKKDKNRKKHHHVHIDRFIC  282

Query  1220  YFSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIA  1044
             YFS+P+PC++D + I KLK+ G+++  K++T W ED+ +P  KT +++ + F S+DDVIA
Sbjct  283   YFSKPEPCYVDKEHITKLKALGITIGGKLDTPWEEDIARPSNKTAEEVETNFRSDDDVIA  342

Query  1043  IGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHG  864
             IGDVF+A+VE  WVMQPGGP+AHKCKTLIEP+RLI+LTAQRF+QTFLG+++++LHFRRHG
Sbjct  343   IGDVFYANVEREWVMQPGGPVAHKCKTLIEPNRLILLTAQRFIQTFLGKNYVSLHFRRHG  402

Query  863   FLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTV  684
             FLKFCNAK PSCFYP+PQAA+CI R++E+  +PVIYLSTDAAESETSLLQSL++ NGKT+
Sbjct  403   FLKFCNAKNPSCFYPIPQAANCITRLIEKVEAPVIYLSTDAAESETSLLQSLLILNGKTI  462

Query  683   PLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLR  504
             PLVKRPAR+SAEKWDALLYRHGLE D+QVEAMLDKTICA+SSVFIGA GSTFTEDILRLR
Sbjct  463   PLVKRPARDSAEKWDALLYRHGLEGDSQVEAMLDKTICAMSSVFIGASGSTFTEDILRLR  522

Query  503   RGWGSASMCDEYLCQGEVPNFIADDE  426
             + WG+AS CDEYLC  E PNF+AD E
Sbjct  523   KDWGTASECDEYLCANEQPNFVADHE  548



>emb|CAE30293.1| GDP-fucose protein-O-fucosyltransferase 2 [Solanum tuberosum]
Length=337

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/337 (83%), Positives = 317/337 (94%), Gaps = 0/337 (0%)
 Frame = -3

Query  1436  MSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAES  1257
             MSNHLICLEKHMFFAA+LNR LV+PSSKVDYEF+RV+DVDHINKCLGR+V++TY+EFAE 
Sbjct  1     MSNHLICLEKHMFFAALLNRILVIPSSKVDYEFRRVIDVDHINKCLGREVIVTYDEFAER  60

Query  1256  QKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIV  1077
             +K+H+HIDK +CYFSQPQPCF+D++R+KKLKS G+SMNK+E AWNEDVK PK++ VQDI+
Sbjct  61    RKSHLHIDKFLCYFSQPQPCFLDEERVKKLKSLGISMNKLEAAWNEDVKNPKKRAVQDIM  120

Query  1076  SKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGE  897
             +KFS++DDV+AIGD FF +VE  WVMQ G PIAHK KTLIEPS LIMLTAQRFVQTFLG+
Sbjct  121   AKFSADDDVLAIGDAFFPNVEKDWVMQHGSPIAHKYKTLIEPSHLIMLTAQRFVQTFLGD  180

Query  896   DFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLL  717
             +FIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESET LL
Sbjct  181   NFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETGLL  240

Query  716   QSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPG  537
             QSLVVFNGKTVPLV+RPARNSAEKWDALLYRHGLE D QV+AMLDKTICA+SSVFIG+ G
Sbjct  241   QSLVVFNGKTVPLVQRPARNSAEKWDALLYRHGLEGDPQVDAMLDKTICAMSSVFIGSSG  300

Query  536   STFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             STFT+DILRLR+ WGSAS+CDEYLCQGE+PNF+ADDE
Sbjct  301   STFTDDILRLRKDWGSASLCDEYLCQGELPNFVADDE  337



>emb|CAN80219.1| hypothetical protein VITISV_027891 [Vitis vinifera]
Length=337

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/337 (81%), Positives = 312/337 (93%), Gaps = 0/337 (0%)
 Frame = -3

Query  1436  MSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAES  1257
             MSNHLICLEKHMFFAA+LNR LV+PSSK DY++ RVLD++HIN CLGRKVV+T+EEF ES
Sbjct  1     MSNHLICLEKHMFFAALLNRILVIPSSKFDYQYNRVLDIEHINNCLGRKVVVTFEEFTES  60

Query  1256  QKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIV  1077
             +KNH+HID+VICYFS P PC++DDD +KKLKS G+SM K+E AW ED+KKPK++T QD+ 
Sbjct  61    KKNHLHIDRVICYFSLPLPCYVDDDHVKKLKSLGISMGKLEPAWAEDIKKPKKRTAQDVQ  120

Query  1076  SKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGE  897
             +KFSSNDDVIAIGDVF+A+VE  WVMQPGGP+AHKC+TLIEPSRLIMLTAQRFVQTFLG+
Sbjct  121   AKFSSNDDVIAIGDVFYANVEEEWVMQPGGPLAHKCQTLIEPSRLIMLTAQRFVQTFLGK  180

Query  896   DFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLL  717
              F ALHFRRHGFLKFCNAK+PSCF+P+PQAADCI+RV+ERA++PVIYLSTDAAESET LL
Sbjct  181   SFTALHFRRHGFLKFCNAKEPSCFFPIPQAADCISRVVERADTPVIYLSTDAAESETGLL  240

Query  716   QSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPG  537
             QSLVV NGK VPL+KRP RNSAEKWDALLYRHGL+ D+QVEAMLDKTICA++SVFIGAPG
Sbjct  241   QSLVVLNGKLVPLIKRPTRNSAEKWDALLYRHGLDGDSQVEAMLDKTICAMASVFIGAPG  300

Query  536   STFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             STFTEDILRLRRGWGSAS CDEYLCQGE PNFIAD+E
Sbjct  301   STFTEDILRLRRGWGSASHCDEYLCQGEQPNFIADNE  337



>emb|CDX83916.1| BnaC08g17290D [Brassica napus]
Length=543

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/410 (69%), Positives = 344/410 (84%), Gaps = 12/410 (3%)
 Frame = -3

Query  1649  SQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERK-TIEWKPES  1473
             S ISL+KQI++ LLS H  GNS          S+ G  RC+KVDQ  SER+ TI WKP  
Sbjct  144   SAISLSKQIEEALLSPHGTGNS--------SLSVLGSDRCKKVDQSLSERRRTIGWKPRE  195

Query  1472  NKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGR  1293
             +K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PS K DY++ RV+DVD IN CLGR
Sbjct  196   DKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIPSPKFDYQYDRVIDVDRINTCLGR  255

Query  1292  KVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNED  1116
              VV+++++F E +K    ID+ ICYFS PQPC++DD+ + KLK  GV +  K+E+ W+ED
Sbjct  256   TVVVSFDQFKEKKK--ARIDRFICYFSSPQPCYVDDEHVGKLKGLGVLIGGKLESPWSED  313

Query  1115  VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIM  936
             +KKP ++  +++V KF  +D VIAIGDVF+AD+E  WVMQPGGPI HKCKTLIEPSRLI+
Sbjct  314   IKKPSKRGFEEVVEKFKGDDGVIAIGDVFYADLEREWVMQPGGPIKHKCKTLIEPSRLIV  373

Query  935   LTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIY  756
             LTAQRF+QTFLG++FIALH RRHGFLKFCNAK PSCFYP+PQAADCI+R++ERAN+PVIY
Sbjct  374   LTAQRFIQTFLGKNFIALHLRRHGFLKFCNAKSPSCFYPIPQAADCISRIVERANAPVIY  433

Query  755   LSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKT  576
             LSTDAAESET LLQSLVV +GK +PLVKRP RNSAEKWD+LLYRHG+E+D+QV+AMLDKT
Sbjct  434   LSTDAAESETGLLQSLVVVDGKVIPLVKRPPRNSAEKWDSLLYRHGIEDDSQVDAMLDKT  493

Query  575   ICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             ICA+SSVFIGA GSTFTEDILRLR+ WG++SMCDEYLC+GE PNFIA+DE
Sbjct  494   ICAMSSVFIGASGSTFTEDILRLRKDWGTSSMCDEYLCRGEEPNFIAEDE  543



>ref|XP_009413328.1| PREDICTED: uncharacterized protein LOC103994654 [Musa acuminata 
subsp. malaccensis]
Length=604

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/425 (68%), Positives = 360/425 (85%), Gaps = 7/425 (2%)
 Frame = -3

Query  1685  AVFLEDLKADLLSQISLNKQIQQVLLSSHQLGN--SLDLSDNNT-DPSISGLGRCRKVDQ  1515
             A  +++ ++ L+ QI LNKQIQ  LLSSH+LGN  S  L +N + D S  G G CRKVD+
Sbjct  182   ASTMDEFRSTLIRQIKLNKQIQGALLSSHRLGNLSSEALDENGSFDVSGPGTGVCRKVDR  241

Query  1514  GWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQ  1335
               + R+TIEWKP+ +++LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PSSKVDY++ 
Sbjct  242   P-AGRRTIEWKPKKDRFLFAICLSGQMSNHLICLEKHMFFAALLDRILVLPSSKVDYQYD  300

Query  1334  RVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSG  1155
             RVLD++HIN+C GRKVV+++EEFAE +KN + I++ ICY + P PC++D++  K+LK+ G
Sbjct  301   RVLDINHINECFGRKVVISFEEFAEMKKNKMRINRFICYIASP-PCYLDEEHAKRLKNLG  359

Query  1154  VSMNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPI  981
             +S+ KIE AW ED  +K  K++ V DI+ KF+SND+VIAIGD+F+ADVE  WVMQPGGP+
Sbjct  360   LSLGKIEAAWPEDAKLKTQKKRVVGDIMPKFASNDEVIAIGDMFYADVEEEWVMQPGGPL  419

Query  980   AHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAAD  801
             AHKCKT+I+PSRLI LTAQRFVQTFLG +FIALHFRRHGFLKFCN KK SCF+PVPQAA+
Sbjct  420   AHKCKTVIQPSRLIYLTAQRFVQTFLGSNFIALHFRRHGFLKFCNVKKESCFFPVPQAAE  479

Query  800   CINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRH  621
             CI R +E+A++PVIYLSTDAAESET+LLQSLVV N K VPLVKRPA NSAEKWDALLYR+
Sbjct  480   CILRTVEKADAPVIYLSTDAAESETNLLQSLVVLNDKQVPLVKRPAHNSAEKWDALLYRN  539

Query  620   GLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNF  441
              L  D+QVEAMLDKTICALS+VFIG+ GSTFTEDI+RLRRGW SAS CDEYLCQGE+PN+
Sbjct  540   RLGGDSQVEAMLDKTICALSTVFIGSSGSTFTEDIIRLRRGWESASHCDEYLCQGELPNY  599

Query  440   IADDE  426
             IA++E
Sbjct  600   IAENE  604



>emb|CDX91550.1| BnaC02g16100D [Brassica napus]
Length=533

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/408 (69%), Positives = 346/408 (85%), Gaps = 8/408 (2%)
 Frame = -3

Query  1646  QISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNK  1467
             QISLNK+IQ+ LLS H+ GN      + +  ++    RC KVDQ  S+RKT+EWKP S+K
Sbjct  133   QISLNKEIQEALLSPHKTGNY-----SGSVANLYLYERCVKVDQKLSDRKTVEWKPRSDK  187

Query  1466  YLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKV  1287
             +LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PSSK DY++ RV+D++ IN CLGR V
Sbjct  188   FLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIPSSKFDYQYDRVIDIERINTCLGRNV  247

Query  1286  VLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVK  1110
             V+++++F +S+     ID+ ICYFS PQ C++DD+ IKKLK  GVS+  K+E+ W+ED+K
Sbjct  248   VVSFDQFKKSRPPR--IDRFICYFSSPQLCYVDDEHIKKLKGLGVSVERKLESPWSEDIK  305

Query  1109  KPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLT  930
             KP ++ V ++   F S+DDVIAIGDVF+AD+E  WVMQPGGPI HKCKTLIEP++LI+LT
Sbjct  306   KPSKRNVDEVQRSFKSDDDVIAIGDVFYADMEQDWVMQPGGPINHKCKTLIEPNKLILLT  365

Query  929   AQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLS  750
             AQRF+QTFLG +FIALHFRRHGFLKFCNAK PSCFYP+PQAA+CI R++ER+N  VIYLS
Sbjct  366   AQRFIQTFLGNNFIALHFRRHGFLKFCNAKAPSCFYPIPQAAECIARMVERSNGAVIYLS  425

Query  749   TDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTIC  570
             TDAAESETSLLQSLVV +GK VPLVKRP RNSAEKWDALLYRHG+E+D+QV+AMLDKTIC
Sbjct  426   TDAAESETSLLQSLVVVDGKIVPLVKRPPRNSAEKWDALLYRHGIEDDSQVDAMLDKTIC  485

Query  569   ALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             A+SSVFIGA GSTFTEDILRLR+ WG++SMCDEYLC+GE PNFIA+DE
Sbjct  486   AMSSVFIGASGSTFTEDILRLRKDWGTSSMCDEYLCRGEEPNFIAEDE  533



>emb|CDY16367.1| BnaA02g11710D [Brassica napus]
Length=528

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/416 (68%), Positives = 349/416 (84%), Gaps = 11/416 (3%)
 Frame = -3

Query  1667  LKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGL-GRCRKVDQGWSERKTI  1491
             ++  +  QISLN +IQ+ LLS H+ GN        +   ++ L  RC KVDQ  S+R+T+
Sbjct  122   VRVAVAKQISLNNEIQEELLSPHKTGNY-------SGSVVANLYERCVKVDQKLSDRRTV  174

Query  1490  EWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHI  1311
             EWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PSSK DY++ RV+DV+ I
Sbjct  175   EWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIPSSKFDYQYDRVIDVERI  234

Query  1310  NKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIE  1134
             N CLGR VV+++++F +S+  H  ID+ ICYFS PQ C++DD+ IKKLK  GVS+  K+E
Sbjct  235   NTCLGRNVVVSFDQFKKSRPPH--IDRFICYFSSPQLCYVDDEHIKKLKGLGVSIERKLE  292

Query  1133  TAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIE  954
             + W+ED+KKP ++ V ++   F S+DDVIAIGDVF+AD+E  WVMQPGGPI HKCKTLIE
Sbjct  293   SPWSEDIKKPSKRNVDEVRRSFKSDDDVIAIGDVFYADMEQDWVMQPGGPINHKCKTLIE  352

Query  953   PSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERA  774
             P++LI+LTAQRF+QTFLG +FIALHFRRHGFLKFCNAK PSCFYP+PQAA+CI R++ER+
Sbjct  353   PNKLILLTAQRFIQTFLGNNFIALHFRRHGFLKFCNAKAPSCFYPIPQAAECIARMVERS  412

Query  773   NSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVE  594
             N  VIYLSTDAAESETSLLQSLVV +GK VPLVKRP RNSAEKWDALLYRHG+E+D+QV+
Sbjct  413   NGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPRNSAEKWDALLYRHGIEDDSQVD  472

Query  593   AMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++SMCDEYLC+GE PNFIA+DE
Sbjct  473   AMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSMCDEYLCRGEEPNFIAEDE  528



>ref|XP_009127356.1| PREDICTED: uncharacterized protein LOC103852192 [Brassica rapa]
Length=529

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/553 (58%), Positives = 404/553 (73%), Gaps = 59/553 (11%)
 Frame = -3

Query  2075  GRSSFQIDGNKDRFIDPARFNFICRKRYCLAII-LPLFVILLYATTDIKNIFRTGVSKIT  1899
             G SSFQI+      I  +R      KRY LA + L + + L++  TD++  F    S   
Sbjct  33    GGSSFQIED-----IILSRRKISLNKRYLLAAVSLTILIGLIFLFTDLRQQF----SSFK  83

Query  1898  FDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssn  1719
              D  ++R++ESELRALYLLRQQQLEL   WN T    +                      
Sbjct  84    VDPLSSRVKESELRALYLLRQQQLELLSIWNGTTSANS----------------------  121

Query  1718  sslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGL  1539
                              ++  +  QISLN +IQ+ LLSSH+ GN        +   ++ L
Sbjct  122   ----------------SVRVAVAKQISLNNEIQEELLSSHKTGNY-------SGSVVANL  158

Query  1538  -GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVP  1362
               RC KVDQ  S+R+T+EWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+P
Sbjct  159   YERCVKVDQKLSDRRTVEWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIP  218

Query  1361  SSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDD  1182
             SSK DY++ RV++V+ IN CLGR VV+++++F +S+     ID+ ICYFS PQ C++DD+
Sbjct  219   SSKFDYQYDRVIEVERINTCLGRNVVVSFDQFKKSRPPR--IDRFICYFSSPQLCYVDDE  276

Query  1181  RIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGW  1005
              IKKLK  GVS+  K+E+ W+ED+KKP ++ V ++   F S+DDVIAIGDVF+AD+E  W
Sbjct  277   HIKKLKGLGVSIERKLESPWSEDIKKPSKRNVDEVRRSFKSDDDVIAIGDVFYADMEQDW  336

Query  1004  VMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCF  825
             VMQPGGPI HKCKTLIEP++LI+LTAQRF+QTFLG +FIALHFRRHGFLKFCNAK PSCF
Sbjct  337   VMQPGGPINHKCKTLIEPNKLILLTAQRFIQTFLGNNFIALHFRRHGFLKFCNAKAPSCF  396

Query  824   YPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEK  645
             YP+PQAA+CI R++ER+N  VIYLSTDAAESETSLLQSLVV +GK VPLVKRP RNSAEK
Sbjct  397   YPIPQAAECIARMVERSNGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPRNSAEK  456

Query  644   WDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYL  465
             WDALLYRHG+E+D+QV+AMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++SMCDEYL
Sbjct  457   WDALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSMCDEYL  516

Query  464   CQGEVPNFIADDE  426
             C+GE PNFIA+DE
Sbjct  517   CRGEEPNFIAEDE  529



>emb|CDY24074.1| BnaA06g00720D [Brassica napus]
Length=544

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/571 (55%), Positives = 402/571 (70%), Gaps = 56/571 (10%)
 Frame = -3

Query  2120  NLIGDGERR-DGARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYAT  1944
             NL+ + + + D A      +F ++  + R +  + F     KR C+ I LPL ++ +Y +
Sbjct  24    NLLDESDSQIDAAEQRPPPTFDVESLRSR-LRRSFFKLNLTKRQCIVIFLPLLLVFVYLS  82

Query  1943  TDIKNIFRTGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnn  1764
             TD+ N F +     +   P +   E +LRALYLLR+Q+ +L   WN T            
Sbjct  83    TDLTNYFSSVKVPDSVFRPNHGPEEPDLRALYLLRKQETDLSSLWNRTLS----------  132

Query  1763  tgnstssnagsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNS  1584
                                          + D+K+ L  Q+SLN+QIQ  LLS H+   S
Sbjct  133   -----------------------------VSDMKSALFRQMSLNRQIQNALLSPHK-AES  162

Query  1583  LDLSDNNTDPSISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKH  1404
             L L          G G CR+V+    +RKTI+WKP  +K+LFAIC+SGQMSNHLICLEKH
Sbjct  163   LGLY---------GGGGCRRVEHKLLKRKTIQWKPRRDKFLFAICLSGQMSNHLICLEKH  213

Query  1403  MFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQK--NHVHIDK  1230
             MFFAA+L R LV+PS + DY + R++D+D IN CLGRKVV+++EEF +S+K  +HVHID+
Sbjct  214   MFFAALLKRTLVIPSHRFDYHYSRIIDIDRINTCLGRKVVVSFEEFWKSRKKHHHVHIDR  273

Query  1229  VICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNE--DVKKPKQKTVQDIVSKFSSN  1059
              ICYFS+P+PC++D + I KLK  G+S+  K+++ W E  D+ KP  KT +++   F S+
Sbjct  274   FICYFSKPEPCYVDKEHIAKLKGLGISIGGKVDSPWEEEEDIAKPSNKTAEEVERSFRSD  333

Query  1058  DDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALH  879
             DDVIAIGDVF+A+VE  WVMQPGGP+AHKCKTL+EP+RLI+LTAQRF+QTFLG ++++LH
Sbjct  334   DDVIAIGDVFYANVEREWVMQPGGPLAHKCKTLVEPNRLILLTAQRFIQTFLGRNYVSLH  393

Query  878   FRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVF  699
             FRRHGFLKFCNAK PSCFYP+PQAA CI R++E+ ++PVIYLSTDAAESET LLQSL++ 
Sbjct  394   FRRHGFLKFCNAKNPSCFYPIPQAAHCIARLVEKVDAPVIYLSTDAAESETGLLQSLLII  453

Query  698   NGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTED  519
             NGKTVP VKRP R+SAEKWDALLYRHGLE D+QVEAMLDKTICA+SSVFIGA GSTFTED
Sbjct  454   NGKTVPFVKRPPRDSAEKWDALLYRHGLEGDSQVEAMLDKTICAMSSVFIGASGSTFTED  513

Query  518   ILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             ILRLR+ WG+AS+CDEYLCQ E PNFIAD E
Sbjct  514   ILRLRKDWGTASVCDEYLCQNEQPNFIADHE  544



>ref|NP_001185215.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AEE32996.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=601

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/595 (53%), Positives = 405/595 (68%), Gaps = 86/595 (14%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFRTGVSKITFD  1893
             R +F ++  + R     + N    K+  + I LP+ +IL+Y +TD  N F   V    F 
Sbjct  47    RPTFDVESLRSRLRRSFKLNLT--KKQSIFIFLPIVIILIYLSTDFSNYFSVKVPNSAFR  104

Query  1892  SPA--NRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssn  1719
             S     R+ ES+L+ALYLLR+Q+ +LF  WNHT  N + +                    
Sbjct  105   SNTLTGRVHESDLQALYLLRKQESDLFSIWNHTVSNLSTI--------------------  144

Query  1718  sslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGL  1539
                            +D+K+ +  QISLN+QIQ  LLS H+ GN +D+   ++D   +G 
Sbjct  145   ---------------DDVKSAVFRQISLNRQIQNALLSPHKTGN-VDIG-GSSDGYFAG-  186

Query  1538  GRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPS  1359
             G CRKVDQ  + RKTI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L R LV+PS
Sbjct  187   GSCRKVDQKLNGRKTIQWKPRPDKFLFAICLSGQMSNHLICLEKHMFFAALLKRVLVIPS  246

Query  1358  SKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKN-----HVHIDKVICYFSQPQPCF  1194
              + DY + R++D+D IN CLGR VV+++EEF +  KN     HVHI++ ICYFS+P+PC+
Sbjct  247   HRFDYHYSRIIDIDRINTCLGRTVVVSFEEFWKKDKNRKKHHHVHINRFICYFSKPEPCY  306

Query  1193  MDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADV  1017
             +D + I KLK+ G+++  K++T W ED+ +P  KT +++ + F S+DDVIAIGDVF+A+V
Sbjct  307   VDKEHITKLKALGITVGGKLDTPWEEDIARPSNKTAEEVEANFRSDDDVIAIGDVFYANV  366

Query  1016  ETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKF-----  852
             E  WVMQPGGP+AHKC+TLIEP+RLI+LTAQRF+QTFLG+++IALHFRRHGFLKF     
Sbjct  367   EREWVMQPGGPVAHKCRTLIEPNRLILLTAQRFIQTFLGKNYIALHFRRHGFLKFWYDLF  426

Query  851   ---------------------------------CNAKKPSCFYPVPQAADCINRVLERAN  771
                                               NAK PSCF+P+PQAA CI R++E+  
Sbjct  427   STSLLHSTFDDNVVHFITKIKSGTLAKKFSWCASNAKNPSCFFPIPQAASCITRLIEKVE  486

Query  770   SPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEA  591
             +PV+YLSTDAAESET LLQSL++ NGKTVPLVKRPAR+SAEKWDALLYRHGLE D+QVEA
Sbjct  487   APVLYLSTDAAESETGLLQSLLILNGKTVPLVKRPARDSAEKWDALLYRHGLEGDSQVEA  546

Query  590   MLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             MLDKTICALSSVFIGA GSTFTEDILRLR+ WG+AS CDEYLC  E PNFIAD E
Sbjct  547   MLDKTICALSSVFIGASGSTFTEDILRLRKDWGTASECDEYLCANEQPNFIADHE  601



>emb|CDX96778.1| BnaA08g23210D [Brassica napus]
Length=540

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/415 (67%), Positives = 348/415 (84%), Gaps = 6/415 (1%)
 Frame = -3

Query  1667  LKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIE  1488
             +++++ S ISL+KQI++ LLS H+ GNS     ++   +    G C KVDQ  SER+TIE
Sbjct  131   IESNVKSAISLSKQIEEALLSPHKTGNSSLSGLDSDSIT----GSCGKVDQSLSERRTIE  186

Query  1487  WKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHIN  1308
             WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PS K DY+++RV+D+D IN
Sbjct  187   WKPREDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIPSPKFDYQYERVIDIDRIN  246

Query  1307  KCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIET  1131
              CLGR VV+++++F + +K    ID+ ICYFS PQPC++D++ + KLK  GV +  K+E 
Sbjct  247   TCLGRTVVVSFDQF-KKEKGGARIDRFICYFSSPQPCYVDEEHVGKLKGLGVLIGGKLEA  305

Query  1130  AWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEP  951
              W+ED+KKP ++   ++V KF   D VIAIGDVF+AD+E  WVMQPGGPI HKCKTL+EP
Sbjct  306   PWSEDIKKPSKRGFGEVVEKFKGEDGVIAIGDVFYADLERDWVMQPGGPIKHKCKTLVEP  365

Query  950   SRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERAN  771
             SRLI+LTAQRF+QTFLG++F+A+H RRHGFLKFCNAK PSCFYP+PQAADCI+R++ERAN
Sbjct  366   SRLIVLTAQRFIQTFLGKNFVAMHLRRHGFLKFCNAKSPSCFYPIPQAADCISRIVERAN  425

Query  770   SPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEA  591
             +PVIYLSTDAAESET LLQSLVV +GK +PLVKRP RNSAEKWD+LLYRHG+E+D+QV+A
Sbjct  426   APVIYLSTDAAESETGLLQSLVVVDGKVIPLVKRPPRNSAEKWDSLLYRHGIEDDSQVDA  485

Query  590   MLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             MLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++SMCDEYLC+GE PNFIA+DE
Sbjct  486   MLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSMCDEYLCRGEEPNFIAEDE  540



>ref|XP_009110418.1| PREDICTED: uncharacterized protein LOC103835964 [Brassica rapa]
Length=546

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/415 (67%), Positives = 346/415 (83%), Gaps = 6/415 (1%)
 Frame = -3

Query  1667  LKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIE  1488
             +++++ S ISL+KQI++ LLS H+ GNS     ++   + S    C KVDQ  SER+TIE
Sbjct  137   IESNVESAISLSKQIEEALLSPHKTGNSSLSGLDSDSITSS----CGKVDQSLSERRTIE  192

Query  1487  WKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHIN  1308
             WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+PS K DY++ RV+D+D IN
Sbjct  193   WKPREDKFLFAICLSGQMSNHLICLEKHMFFAALLDRVLVIPSPKFDYQYDRVIDIDRIN  252

Query  1307  KCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN-KIET  1131
              CLGR VV+++++F + +K    ID+ ICYFS PQPC++D++ + KLK  GV++  K+E 
Sbjct  253   TCLGRTVVVSFDQF-KKEKGGARIDRFICYFSSPQPCYVDEEHVGKLKGLGVAVGGKLEA  311

Query  1130  AWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEP  951
              W+ED+KKP ++   ++V KF   D VIAIGDVF+AD+E  WVMQPGGPI HKCKTLIEP
Sbjct  312   PWSEDIKKPSKRGFGEVVEKFKGEDGVIAIGDVFYADLEREWVMQPGGPIKHKCKTLIEP  371

Query  950   SRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERAN  771
             SRLI+LTAQRF+QTFLG+ F+A+H RRHGFLKFCNAK PSCFYP+PQAADCI+R++E AN
Sbjct  372   SRLIVLTAQRFIQTFLGKHFVAMHLRRHGFLKFCNAKSPSCFYPIPQAADCISRIVEMAN  431

Query  770   SPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEA  591
             +PVIYLSTDAAESET LLQSLVV +GK VPLVKRP RNSAEKWD+LLYRHG+E+D+QV+A
Sbjct  432   APVIYLSTDAAESETGLLQSLVVVDGKVVPLVKRPPRNSAEKWDSLLYRHGIEDDSQVDA  491

Query  590   MLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             MLDKTICA+SSVFIGA GSTFTEDILRLR+ WG++SMCDEYLC+GE PNFIA+DE
Sbjct  492   MLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTSSMCDEYLCRGEEPNFIAEDE  546



>emb|CDY36604.1| BnaC06g06570D [Brassica napus]
Length=543

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/421 (66%), Positives = 345/421 (82%), Gaps = 14/421 (3%)
 Frame = -3

Query  1676  LEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERK  1497
             + D+K+ L  Q+SLN+QIQ  LLS H+   SL L          G G CR+VDQ   +RK
Sbjct  133   VSDMKSALFRQMSLNRQIQNALLSPHK-AESLGLY---------GGGSCRRVDQKLLKRK  182

Query  1496  TIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVD  1317
             TI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L R LV+PS + DY + R++D+D
Sbjct  183   TIQWKPRRDKFLFAICLSGQMSNHLICLEKHMFFAALLKRTLVIPSHRFDYHYSRIIDID  242

Query  1316  HINKCLGRKVVLTYEEFAESQK--NHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN  1143
               N CLGRKVV+++EEF +S+K  +HVHID+ ICYFS+P+PC++D + I KLK+ G+++ 
Sbjct  243   RTNTCLGRKVVVSFEEFWKSRKKHHHVHIDRFICYFSKPEPCYVDKEHIAKLKALGITIG  302

Query  1142  -KIETAWNE-DVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKC  969
              K+++ W E D+ KP  KT +++   F S+DDVIAIGDVF+A+VE  WVMQPGGP+AHKC
Sbjct  303   GKVDSPWEEEDIAKPSNKTAEEVERSFRSDDDVIAIGDVFYANVERDWVMQPGGPLAHKC  362

Query  968   KTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINR  789
             KTL+EP+RLI+LTAQRF+QTFLG +++ALH RRHGFLKFCNAK PSCFYP+PQAA CI R
Sbjct  363   KTLLEPNRLILLTAQRFIQTFLGRNYVALHLRRHGFLKFCNAKNPSCFYPIPQAAHCITR  422

Query  788   VLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEE  609
             ++E+ ++PVIYLSTDAAESET LLQSL++ NGKTVP VKRP R+SAEKWDALLYRHGLE 
Sbjct  423   LVEKVDAPVIYLSTDAAESETGLLQSLLIINGKTVPFVKRPPRDSAEKWDALLYRHGLEG  482

Query  608   DTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADD  429
             D+QVEAMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG+AS+CDEYLCQ E PNFIAD 
Sbjct  483   DSQVEAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTASVCDEYLCQNEQPNFIADH  542

Query  428   E  426
             E
Sbjct  543   E  543



>ref|XP_006657870.1| PREDICTED: uncharacterized protein LOC102711445 [Oryza brachyantha]
Length=564

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/423 (66%), Positives = 354/423 (84%), Gaps = 6/423 (1%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGW  1509
             +A+   DL   LLSQI +N++IQ  LLS+H+ G + +++D+  D  +   G CR+ +   
Sbjct  146   TAISYSDLHDALLSQIKINREIQSALLSAHRSGAAGNVTDDGLDLDLPVAG-CRRRELP-  203

Query  1508  SERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRV  1329
             S R+TIEW P+ +++LFAIC+SGQMSNHLICLEKHMFFAA+L R LVVPS KVDY++ RV
Sbjct  204   SNRRTIEWNPKKDRFLFAICLSGQMSNHLICLEKHMFFAALLGRILVVPSQKVDYQYDRV  263

Query  1328  LDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVS  1149
             LD++HIN C+GRKVV++YEEF E +K  V ID+ ICY + P PCF+D+D IKKLK  G+S
Sbjct  264   LDINHINDCIGRKVVMSYEEFTEKRKK-VSIDQFICYAASP-PCFLDEDHIKKLKGLGIS  321

Query  1148  MNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAH  975
             + KI+ AW ED  +K+PK++ V DI+ KF+++ +V+AIGD+F+ADVE  WVMQPGGP+AH
Sbjct  322   LGKIQAAWPEDAKLKEPKKRIVDDIMPKFTTDAEVLAIGDMFYADVEEEWVMQPGGPLAH  381

Query  974   KCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCI  795
             KCKTLI+PSRLIMLTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCF+P+PQAA+CI
Sbjct  382   KCKTLIQPSRLIMLTAQRFVQTFLGGNYIALHFRRHGFLKFCNVKKESCFFPIPQAAECI  441

Query  794   NRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGL  615
              R++E+AN+PVIYLSTDAAESET++LQSLVVFN + VPLV+RP  +S+EKWDALLYR+ +
Sbjct  442   LRIVEKANAPVIYLSTDAAESETNVLQSLVVFNDRQVPLVRRPEHHSSEKWDALLYRNHM  501

Query  614   EEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIA  435
               D+QVEAMLDKTICALS+VFIG+ GSTFT+DILRLRRGWGSAS CDEYLCQGE+PNFIA
Sbjct  502   GGDSQVEAMLDKTICALSNVFIGSSGSTFTDDILRLRRGWGSASHCDEYLCQGELPNFIA  561

Query  434   DDE  426
             + +
Sbjct  562   EQD  564



>ref|XP_009147582.1| PREDICTED: uncharacterized protein LOC103871110 [Brassica rapa]
Length=543

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/421 (66%), Positives = 344/421 (82%), Gaps = 14/421 (3%)
 Frame = -3

Query  1676  LEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERK  1497
             + D+K+ L  ++SLN+QIQ  LLS H+   SL L          G G CR+V+Q   +RK
Sbjct  133   VSDMKSALFREMSLNRQIQNALLSPHK-AESLGLY---------GGGSCRRVEQKLLKRK  182

Query  1496  TIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVD  1317
             TI+WKP  +K+LFAIC+SGQMSNHLICLEKHMFFAA+L R LV+PS + DY + R++D+D
Sbjct  183   TIQWKPRRDKFLFAICLSGQMSNHLICLEKHMFFAALLKRTLVIPSHRFDYHYSRIIDID  242

Query  1316  HINKCLGRKVVLTYEEFAESQK--NHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMN  1143
              IN CLGRKVV+++EEF +S+K  +HVHID+ ICYFS+P+ C++D + I KLK  G+S+ 
Sbjct  243   RINTCLGRKVVVSFEEFWKSRKKHHHVHIDRFICYFSKPEACYVDKEHIAKLKGLGISIG  302

Query  1142  -KIETAWNE-DVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKC  969
              K+++ W E D+ KP  KT +++   F S+DDVIAIGDVF+A+VE  WVMQPGGP+AHKC
Sbjct  303   GKVDSPWEEEDIAKPSNKTAEEVERSFRSDDDVIAIGDVFYANVEREWVMQPGGPLAHKC  362

Query  968   KTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINR  789
             KTL+EP+RLI+LTAQRF+QTFLG +++ALHFRRHGFLKFCNAK PSCFYP+PQAA CI R
Sbjct  363   KTLVEPNRLILLTAQRFIQTFLGRNYVALHFRRHGFLKFCNAKNPSCFYPIPQAAHCIAR  422

Query  788   VLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEE  609
             ++E+ ++PV+YLSTDAAESET LLQ L++ NGKTVP VKRP R+SAEKWDALLYRHGLE 
Sbjct  423   LVEKVDAPVVYLSTDAAESETGLLQLLLIINGKTVPFVKRPPRDSAEKWDALLYRHGLEG  482

Query  608   DTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADD  429
             D+QVEAMLDKTICA+SSVFIGA GSTFTEDILRLR+ WG+AS+CDEYLCQ E PNFIAD 
Sbjct  483   DSQVEAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWGTASVCDEYLCQNEQPNFIADH  542

Query  428   E  426
             E
Sbjct  543   E  543



>ref|NP_001060060.1| Os07g0572600 [Oryza sativa Japonica Group]
 dbj|BAC83142.1| putative GDP-fucose protein-O-fucosyltransferase 2 [Oryza sativa 
Japonica Group]
 dbj|BAD31871.1| putative GDP-fucose protein-O-fucosyltransferase 2 [Oryza sativa 
Japonica Group]
 dbj|BAF21974.1| Os07g0572600 [Oryza sativa Japonica Group]
 gb|EAZ04416.1| hypothetical protein OsI_26561 [Oryza sativa Indica Group]
 gb|EAZ40374.1| hypothetical protein OsJ_24820 [Oryza sativa Japonica Group]
Length=557

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/421 (67%), Positives = 350/421 (83%), Gaps = 6/421 (1%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGW  1509
             +AV   DL   LL QI +N++IQ  LLS+H+ G + + +++  D  +   G CR+ +   
Sbjct  139   NAVSYADLHDALLGQIKINREIQAALLSAHRTGAAGNATEDGLDLDLPADG-CRRRELP-  196

Query  1508  SERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRV  1329
             S R+TIEW P+ +++LFAICVSGQMSNHLICLEKHMFFAA+L R LVVPS K+DY++ RV
Sbjct  197   SNRRTIEWNPKKDRFLFAICVSGQMSNHLICLEKHMFFAALLGRILVVPSQKLDYQYDRV  256

Query  1328  LDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVS  1149
             LD++HIN C+GRKVV+TYEEF E +K  V ID+ ICY + P PCF+D+D +KKLK  G+S
Sbjct  257   LDINHINDCIGRKVVITYEEFTEKRKK-VSIDQFICYAASP-PCFIDEDHVKKLKGLGIS  314

Query  1148  MNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAH  975
             + KI+ AW ED  +K+PK++ V+DI+ KF+++ +V+AIGD+F+ADVE  WVMQPGGP+AH
Sbjct  315   LGKIQAAWPEDAKLKEPKKRFVEDIMPKFTTDAEVLAIGDMFYADVEEEWVMQPGGPLAH  374

Query  974   KCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCI  795
             KC TLI+PSRLIMLTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCF+P+PQAA+CI
Sbjct  375   KCNTLIQPSRLIMLTAQRFVQTFLGGNYIALHFRRHGFLKFCNVKKESCFFPIPQAAECI  434

Query  794   NRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGL  615
              R++E+AN+PVIYLSTDAAESETSLLQSLVVFN + VPLVKRP  +++EKWDALLYR+ +
Sbjct  435   LRIVEKANAPVIYLSTDAAESETSLLQSLVVFNDRQVPLVKRPEHHNSEKWDALLYRNHM  494

Query  614   EEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIA  435
               D QVEAMLDKTICALS+VFIGA GSTFTEDILRLRRGWGSAS CDEYLCQGE+PNFIA
Sbjct  495   GGDNQVEAMLDKTICALSNVFIGASGSTFTEDILRLRRGWGSASHCDEYLCQGELPNFIA  554

Query  434   D  432
             +
Sbjct  555   E  555



>gb|EMS52047.1| hypothetical protein TRIUR3_21474 [Triticum urartu]
Length=513

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/423 (65%), Positives = 347/423 (82%), Gaps = 7/423 (2%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGW  1509
             + V L DL+A LLSQI +N++IQ+ LLS+H  G   + +++  D  + G G CR+ +  +
Sbjct  96    APVSLSDLQAALLSQIKINREIQESLLSTHHSGTG-NATEDALDLDLPGPG-CRRRELPY  153

Query  1508  SERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRV  1329
             + R+TIEW P+ N+YLFAIC+SGQMSNHLICLEKHMFFAA+L R LVVPS KVDY++ +V
Sbjct  154   N-RRTIEWNPKKNRYLFAICLSGQMSNHLICLEKHMFFAALLGRILVVPSQKVDYQYDKV  212

Query  1328  LDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVS  1149
             LD++HIN C+GRKVV+TYEEF + +K  V ID+ ICY + P PC+MD++ IKKLK+ G+S
Sbjct  213   LDINHINDCIGRKVVITYEEFVDKRKK-VSIDQFICYVASP-PCYMDEEHIKKLKAVGIS  270

Query  1148  MNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAH  975
             M KIE AW ED  +K PK++ V DI +KF+++ +V+A+G++F+AD E  W+MQPGGP+AH
Sbjct  271   MGKIEAAWPEDAKLKVPKKRYVADITAKFTTDAEVLAVGELFYADAEEEWIMQPGGPLAH  330

Query  974   KCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCI  795
             KCKTLI+PSRLIMLTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCF+P+PQAA CI
Sbjct  331   KCKTLIQPSRLIMLTAQRFVQTFLGGNYIALHFRRHGFLKFCNVKKESCFFPIPQAAGCI  390

Query  794   NRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGL  615
              RV+E+AN+PVIYLSTDAA SET+LLQSLVVFN + VPLV+RP    +EKWDALLYR  +
Sbjct  391   LRVIEKANAPVIYLSTDAAGSETNLLQSLVVFNDRQVPLVRRPEHEGSEKWDALLYRKHM  450

Query  614   EEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIA  435
               D QVEAMLDKTICALS+VFIG+ GSTFTEDI RLRRGWGS S CDEYLCQGE+PN+IA
Sbjct  451   GGDDQVEAMLDKTICALSNVFIGSSGSTFTEDIFRLRRGWGSMSYCDEYLCQGELPNYIA  510

Query  434   DDE  426
             + E
Sbjct  511   ELE  513



>ref|XP_009407750.1| PREDICTED: uncharacterized protein LOC103990369 [Musa acuminata 
subsp. malaccensis]
Length=572

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/494 (62%), Positives = 379/494 (77%), Gaps = 21/494 (4%)
 Frame = -3

Query  1889  PANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnssl  1710
             P +RMRESELRAL+LLR QQL L K WN     +TR  A++ +   +S+   +       
Sbjct  94    PLDRMRESELRALFLLRDQQLGLLKLWN-----RTRSVALDVSAPPSSAPNSTSVRTDLA  148

Query  1709  ertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLD--LSDNNTDPSISGLG  1536
                     A   ++ ++ L  QI LNK+IQ  LLSSH +GNS     SD+N    +SG G
Sbjct  149   -------KAAAFDEFRSALFEQIKLNKKIQNALLSSHNVGNSSSSGTSDDNVFFGMSGPG  201

Query  1535  R--CRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVP  1362
                CRKVD+  S  +TIEW+P+ ++YLFAIC+SGQMSNHLICLEKHMFFAA+L+R LV+P
Sbjct  202   VDVCRKVDRPAS--RTIEWEPKKDRYLFAICLSGQMSNHLICLEKHMFFAALLDRALVLP  259

Query  1361  SSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDD  1182
             S + DY++ +VLD+DHIN+C GRKVV+ ++EF+E+ KN + ID+ ICY + P PC++D++
Sbjct  260   SPRFDYQYDQVLDIDHINECFGRKVVIKFDEFSETLKNKMKIDRFICYMASP-PCYLDEE  318

Query  1181  RIKKLKSSGVSMNKIETAWNEDVKKPKQKT--VQDIVSKFSSNDDVIAIGDVFFADVETG  1008
              IKKLK  G+S  KIE AW ED K   QK   V DI+ KF+SND+VIAIGDVF+ADVE  
Sbjct  319   HIKKLKDLGLSFGKIEAAWPEDAKLKMQKKRFVGDIMPKFTSNDEVIAIGDVFYADVEEE  378

Query  1007  WVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSC  828
             W+ QPGGP+AHKCKTLI+PSR I LTAQRFVQTFLG +FIALHFRRHGFLKFCN K  SC
Sbjct  379   WMKQPGGPLAHKCKTLIQPSRFIYLTAQRFVQTFLGSNFIALHFRRHGFLKFCNLKPESC  438

Query  827   FYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAE  648
             F+P+PQAA+CI R++E+A+ PVIYLSTDAAESET+LLQSLVVFNGK VPL KRP  ++AE
Sbjct  439   FFPIPQAAECILRIVEKADVPVIYLSTDAAESETNLLQSLVVFNGKQVPLFKRPDHDTAE  498

Query  647   KWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEY  468
             KWDALLYR+ L  D QVEAMLDKTICA+S+VFIGA GSTFTEDILRLRR WGSAS CDEY
Sbjct  499   KWDALLYRNKLGGDNQVEAMLDKTICAMSTVFIGASGSTFTEDILRLRRDWGSASRCDEY  558

Query  467   LCQGEVPNFIADDE  426
             LCQGE PN+IA+++
Sbjct  559   LCQGEQPNYIAEND  572



>gb|EMT33342.1| hypothetical protein F775_03160 [Aegilops tauschii]
Length=561

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/423 (65%), Positives = 346/423 (82%), Gaps = 7/423 (2%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGW  1509
             + V L DL+  LLSQI +N++IQ+ LLS+H  G   + +D+  D  + G G CR+ +  +
Sbjct  144   APVSLSDLQTALLSQIKINREIQEALLSTHHSGVG-NATDDALDLDLPGPG-CRRRELPY  201

Query  1508  SERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRV  1329
             + R+TIEW P+ N+YLFAIC+SGQMSNHLICLEKHMFFAA+L R LVVPS KVDY++ +V
Sbjct  202   N-RRTIEWNPKKNRYLFAICLSGQMSNHLICLEKHMFFAALLGRILVVPSQKVDYQYDKV  260

Query  1328  LDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVS  1149
             LD++HIN C+GRKVV+TYEEF + +K  V ID+ ICY + P PC+MD++ IKKLK+ G+S
Sbjct  261   LDINHINDCIGRKVVITYEEFVDKRKK-VSIDQFICYVASP-PCYMDEEHIKKLKAVGIS  318

Query  1148  MNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAH  975
             M KIE AW ED  +K PK++ V DI +KF+++ +V+A+G++F+AD E  W+MQPGGP+AH
Sbjct  319   MGKIEAAWPEDAKLKVPKKRYVADITAKFTTDAEVLAVGELFYADAEEEWIMQPGGPLAH  378

Query  974   KCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCI  795
             KCKTLI+PSRLIMLTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCF+P+PQAA CI
Sbjct  379   KCKTLIQPSRLIMLTAQRFVQTFLGGNYIALHFRRHGFLKFCNVKKESCFFPIPQAAGCI  438

Query  794   NRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGL  615
              R++E+AN+PVIYLSTDAA SET+LLQSLVVF+ + VPLV+RP    +EKWDALLYR  +
Sbjct  439   LRIIEKANAPVIYLSTDAAGSETNLLQSLVVFDDRQVPLVRRPEHEGSEKWDALLYRKHM  498

Query  614   EEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIA  435
               D QVEAMLDKTICALS+VFIG+ GSTFTEDI RLRRGWGS S CDEYLCQGE+PN+IA
Sbjct  499   GGDDQVEAMLDKTICALSNVFIGSSGSTFTEDIFRLRRGWGSMSYCDEYLCQGELPNYIA  558

Query  434   DDE  426
             + E
Sbjct  559   ELE  561



>ref|XP_004958098.1| PREDICTED: uncharacterized protein LOC101783584 [Setaria italica]
Length=564

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/424 (66%), Positives = 349/424 (82%), Gaps = 9/424 (2%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLG-RCRKVDQG  1512
             +AV L DL+A L SQI +N++IQ  LLS+H+ G   + +++  D  +   G R R++  G
Sbjct  147   AAVSLSDLQAALESQIKINREIQVALLSAHRSGAG-NATEDGLDLDLPATGCRRRELPAG  205

Query  1511  WSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQR  1332
                R+TIEW P+ +++LFAIC+SGQMSNHLICLEKHMF AA+L R LVVPS KVDY++ R
Sbjct  206   ---RRTIEWNPKKDRFLFAICLSGQMSNHLICLEKHMFMAAILGRILVVPSQKVDYQYDR  262

Query  1331  VLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGV  1152
             VLD+ HIN C+GRKVV+TYEEF + +K  V ID+ ICY + P PCF+D+D IKKLK  G+
Sbjct  263   VLDIHHINDCIGRKVVITYEEFVDKRKK-VSIDQFICYAASP-PCFLDEDHIKKLKGLGI  320

Query  1151  SMNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIA  978
             S+ KIE AW ED  +K+PK++ V DI  KFS++ +V+AIGD+F+AD+E  WV QPGGP+A
Sbjct  321   SLGKIEAAWPEDAKLKEPKKRYVGDITPKFSTDAEVLAIGDMFYADIEDEWVNQPGGPLA  380

Query  977   HKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADC  798
             HKCKTLI+PSRLIMLTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCF+P+PQAA+C
Sbjct  381   HKCKTLIQPSRLIMLTAQRFVQTFLGGNYIALHFRRHGFLKFCNVKKESCFFPIPQAAEC  440

Query  797   INRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHG  618
             I R++E+AN+PVIYLSTDAA+SET+LLQSLVVFN + VPLVKRP  +S+EKWDALLYR+ 
Sbjct  441   ILRIVEKANAPVIYLSTDAADSETNLLQSLVVFNDRQVPLVKRPEHHSSEKWDALLYRNH  500

Query  617   LEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFI  438
             +  D QVEAMLDKTICALS+VFIG+ GSTFTEDI+RLRRGWGSAS CDEYLC+GE+PN+I
Sbjct  501   MGGDNQVEAMLDKTICALSNVFIGSSGSTFTEDIIRLRRGWGSASHCDEYLCRGELPNYI  560

Query  437   ADDE  426
             A+ +
Sbjct  561   AEQD  564



>ref|XP_007139055.1| hypothetical protein PHAVU_009G261000g [Phaseolus vulgaris]
 gb|ESW11049.1| hypothetical protein PHAVU_009G261000g [Phaseolus vulgaris]
Length=529

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/419 (64%), Positives = 337/419 (80%), Gaps = 15/419 (4%)
 Frame = -3

Query  1667  LKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSERKTIE  1488
             LK+ L +QISLN QIQ +LLS +    SL   +            C  VDQ   ER+T+E
Sbjct  121   LKSLLSNQISLNSQIQHLLLSPYTTATSLHFRN----------AACGTVDQKLLERRTME  170

Query  1487  WKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHIN  1308
             WKP++NK+L A+CVSGQMSNHL+CL+KHMFFAA+LNR LV+PSSKVDYE++RVLDV+H+N
Sbjct  171   WKPKANKFLVAVCVSGQMSNHLMCLQKHMFFAALLNRVLVIPSSKVDYEYERVLDVEHMN  230

Query  1307  KCLGRKV--VLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGV-SMNKI  1137
             +C G KV  V++++EF+  +KN +H  K +CYFS P+PC++DD+ ++KLKS G+ S NK 
Sbjct  231   RCAGGKVKAVISFQEFSSMKKNGMHEGKFLCYFSLPRPCYLDDEHLRKLKSLGLLSTNKP  290

Query  1136  ETAWNEDVKKPKQKTVQDIVSKFS--SNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKT  963
               AW+ED +KP++++V+++VS+FS    +DV+ IGDV +ADVE  WV Q GGP+AH+CKT
Sbjct  291   AAAWDEDARKPRKRSVEEVVSRFSREEKEDVLVIGDVLYADVEEEWVTQAGGPLAHRCKT  350

Query  962   LIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVL  783
             LI+P+RLI LTAQRF+QTFLG +F+ALHFRRH FL FCN KKPSCFYP+PQAA CI RV+
Sbjct  351   LIQPNRLIFLTAQRFIQTFLGRNFLALHFRRHDFLNFCNGKKPSCFYPIPQAAACILRVV  410

Query  782   ERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDT  603
             ERAN+P+IYLSTDAAESE  LLQSL+V  G+ VPLVKRP RNSAEKWDALLYRH +E D 
Sbjct  411   ERANAPLIYLSTDAAESEIRLLQSLLVLEGRHVPLVKRPPRNSAEKWDALLYRHHIEGDP  470

Query  602   QVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
             QVEAMLDKTICA+SSVFIGA GSTFT+DI RLR+ WGSAS+CDEYLCQGE PN +A+ E
Sbjct  471   QVEAMLDKTICAMSSVFIGASGSTFTQDIRRLRKDWGSASLCDEYLCQGEEPNVVAEIE  529



>ref|XP_002460894.1| hypothetical protein SORBIDRAFT_02g037060 [Sorghum bicolor]
 gb|EER97415.1| hypothetical protein SORBIDRAFT_02g037060 [Sorghum bicolor]
Length=562

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/422 (66%), Positives = 343/422 (81%), Gaps = 9/422 (2%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN-NTDPSISGLGRCRKVDQG  1512
             + + L DL++ L SQI +N++IQ  LLSSH+ G      D  + D   SG   CRK +  
Sbjct  145   APISLSDLQSALESQIKINREIQAALLSSHRSGTGNATEDGLDLDLPFSG---CRKRELP  201

Query  1511  WSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQR  1332
              + R+TIEW P+ +++L AIC+SGQMSNHLICLEKHMF AA+L R LVVPS KVDY++ R
Sbjct  202   -ANRRTIEWNPKKDRFLLAICISGQMSNHLICLEKHMFMAALLGRTLVVPSQKVDYQYDR  260

Query  1331  VLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGV  1152
             VLD++HIN C+GRKVV+TYEEF E +K  V ID+ ICY + P PCF+D+D IKKLK  G+
Sbjct  261   VLDINHINDCIGRKVVITYEEFVEKRKKVV-IDQFICYAASP-PCFLDEDHIKKLKGLGI  318

Query  1151  SMNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIA  978
             S+ KIE AW ED  +K+PK++ V DI  KFS+  +V+AIGD+F+AD+E  W+ QPGGP+A
Sbjct  319   SLGKIEAAWPEDAKLKEPKKRFVGDITPKFSTEAEVLAIGDMFYADMEDEWLNQPGGPLA  378

Query  977   HKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADC  798
             HKCKTLI+PSRLIMLTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCF+P+PQAA+C
Sbjct  379   HKCKTLIQPSRLIMLTAQRFVQTFLGGNYIALHFRRHGFLKFCNVKKESCFFPIPQAAEC  438

Query  797   INRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHG  618
             I R++E+AN+PVIYLSTDAAESET+LLQSLVVFN + VPLVKRP  +S+EKWDALL+R+ 
Sbjct  439   ILRIVEKANAPVIYLSTDAAESETNLLQSLVVFNDRQVPLVKRPEHDSSEKWDALLHRNH  498

Query  617   LEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFI  438
             +  D QV+AMLDKTICALS+VFIG+ GSTFTEDI RLRRGWGSAS CDEYLCQGE+PN+I
Sbjct  499   IGGDVQVDAMLDKTICALSNVFIGSSGSTFTEDIFRLRRGWGSASHCDEYLCQGELPNYI  558

Query  437   AD  432
             A+
Sbjct  559   AE  560



>ref|XP_006842718.1| hypothetical protein AMTR_s00147p00102480 [Amborella trichopoda]
 gb|ERN04393.1| hypothetical protein AMTR_s00147p00102480 [Amborella trichopoda]
Length=577

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/558 (57%), Positives = 409/558 (73%), Gaps = 16/558 (3%)
 Frame = -3

Query  2072  RSSFQIDGNKDRFIDPARFNFICRKRYCLAIILPLFVILLYATTDIKNIFR-TGVSKITF  1896
             RSSF+ID    +      F F+ R RY LA +LPLF++LLY +TD    F+ +   +   
Sbjct  27    RSSFEIDEPVTKTF--KSFPFLHR-RYLLAFLLPLFLVLLYFSTDFSRFFQVSSCFQSPI  83

Query  1895  DSPANRMRESelralyllrqqqleLFKQWNHTFVN-KTRLAAVnntgnstssnagsgssn  1719
             DS  + MRE+ELRAL LLR Q+  LF+ +N +F N  + +++ +     T+S++ S  S 
Sbjct  84    DSQISLMREAELRALNLLRTQKSGLFRLFNQSFSNPSSEISSNSTASVPTNSSSNSTFSV  143

Query  1718  sslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGL  1539
                     S   + L + K +L+ QI L+ +++Q LLSSHQ GN       N+D   +G 
Sbjct  144   PDNLNEKKSSPMISLGEFKKELIKQIKLSNEVEQALLSSHQFGNGS--GSVNSDEYFNGF  201

Query  1538  G---RCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLV  1368
             G   +C K + G  ERKTIEWKP+ N YLFAICVSGQMSNHLICL+KHMFFAAVL R L+
Sbjct  202   GSYSKCGKWNYG-KERKTIEWKPKPNTYLFAICVSGQMSNHLICLQKHMFFAAVLGRALI  260

Query  1367  VPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMD  1188
             +P+ K DY++ RV+D++HINKCLG K VLT+EEF++ +K+ V ID++ICY +   PC++D
Sbjct  261   LPNPKFDYQYDRVIDIEHINKCLGVKAVLTFEEFSQLKKDKVRIDRLICYMAS-TPCYLD  319

Query  1187  DDRIKKLKSSGVSMNKIETAWNEDVKK----PKQKTVQDIVSKFSSNDDVIAIGDVFFAD  1020
             ++ IKKLK  G+ + K+E AW EDVK     P    V +I  KFS  D+V+A+GD+F+A+
Sbjct  320   EEHIKKLKGLGIQIGKLEVAWKEDVKLKNEIPSHPHVSEITEKFSCKDEVLAVGDLFYAN  379

Query  1019  VETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAK  840
             VE  WVMQPGGP+AHKCKT+I+P+RLI+LTAQRF+QTFLGE+F+ALHFRRHGFLKFCNAK
Sbjct  380   VEEEWVMQPGGPVAHKCKTIIQPNRLIILTAQRFIQTFLGENFMALHFRRHGFLKFCNAK  439

Query  839   KPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPAR  660
             + SCF+P+PQAADCI R ++RA++PVIYLSTDAAESET+LLQ L V NGKTVPLVKRP+ 
Sbjct  440   QESCFFPIPQAADCILRKVQRADTPVIYLSTDAAESETNLLQLLTVVNGKTVPLVKRPSH  499

Query  659   NSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASM  480
             NS EKWDALL RH L  D QV+AMLDKTICALS VFIGA GSTFT+DILRLR+ W  AS 
Sbjct  500   NSVEKWDALLVRHHLNSDDQVDAMLDKTICALSKVFIGASGSTFTDDILRLRKDWQLASD  559

Query  479   CDEYLCQGEVPNFIADDE  426
             CDEYLCQGE PNFIA+ E
Sbjct  560   CDEYLCQGEQPNFIAEME  577



>ref|XP_003562860.1| PREDICTED: uncharacterized protein LOC100825796 [Brachypodium 
distachyon]
Length=560

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/425 (64%), Positives = 343/425 (81%), Gaps = 8/425 (2%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGW  1509
             + + L DL+A LLSQI +N++IQ  LLS+H  G      ++  D  + G G CR+ +  +
Sbjct  140   TPISLSDLQAALLSQIKINREIQAALLSTHHSGAGNATEEDPLDLDLPGPG-CRRKELPY  198

Query  1508  SERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSS--KVDYEFQ  1335
             + R+TI+W P+ +++LFAICVSGQMSNHLICLEKH+FFAA+L R LV+PSS  KVDY++ 
Sbjct  199   N-RRTIQWNPKKDRFLFAICVSGQMSNHLICLEKHIFFAALLGRILVLPSSIDKVDYQYD  257

Query  1334  RVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSG  1155
             RVLD+ +IN C+GRKVV+TY EF E +K  V ID+ ICY + P PCFMD+D +KKLK  G
Sbjct  258   RVLDISNINDCIGRKVVITYREFLEKRKK-VSIDQFICYAASP-PCFMDEDYVKKLKGLG  315

Query  1154  VSMNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPI  981
             +SM KIE AW ED  +K+PK++ V DI  KF++  +V+AIGD+F+AD E  W+MQPGGP+
Sbjct  316   ISMGKIEAAWPEDAKLKEPKKRFVGDITPKFTTEAEVLAIGDMFYADAEEEWLMQPGGPL  375

Query  980   AHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAAD  801
             AHKCKTLI+PSRLIMLTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCF+P+PQAA+
Sbjct  376   AHKCKTLIQPSRLIMLTAQRFVQTFLGGNYIALHFRRHGFLKFCNVKKESCFFPIPQAAE  435

Query  800   CINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRH  621
             CI R++E+AN+PVIYLSTDA ESET+LLQSLVVFN + VPLVKRP   ++EKWDALLYR+
Sbjct  436   CILRIVEKANAPVIYLSTDALESETNLLQSLVVFNDRQVPLVKRPVHQNSEKWDALLYRN  495

Query  620   GLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNF  441
              +  D QVEAMLDKTICALS+VFIG+ GSTFTEDI RLRR WGS S CDEYLCQG++PN+
Sbjct  496   HMGGDAQVEAMLDKTICALSNVFIGSSGSTFTEDIFRLRRSWGSMSYCDEYLCQGQLPNY  555

Query  440   IADDE  426
             IA+ +
Sbjct  556   IAEQD  560



>tpg|DAA41170.1| TPA: hypothetical protein ZEAMMB73_622134 [Zea mays]
Length=453

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/422 (65%), Positives = 342/422 (81%), Gaps = 9/422 (2%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN-NTDPSISGLGRCRKVDQG  1512
             + + L DL++ L SQI +N++IQ  LLSSH+ G+     D  + D   SG   CRK +  
Sbjct  36    APISLSDLQSALESQIKINREIQAALLSSHRSGSGNATEDGLDLDLPFSG---CRKRELP  92

Query  1511  WSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQR  1332
              S R+TIEW P+ +++L  IC+SGQMSNHLICLEKHMF AA+L R LVVPS K DY++ R
Sbjct  93    AS-RRTIEWNPKKDRFLLVICISGQMSNHLICLEKHMFMAALLGRTLVVPSQKADYQYDR  151

Query  1331  VLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGV  1152
             VLD++HIN C+GRKVV+TYEEF E +K  V ID+ ICY + P PCF+D++ IKKLK  G+
Sbjct  152   VLDINHINDCIGRKVVITYEEFVEKRKK-VAIDQFICYAASP-PCFLDEEHIKKLKGLGI  209

Query  1151  SMNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIA  978
             S++KIE AW ED  +K+PK+++V DI  KFS+  +V+AIGD+F+AD+E  W+ QPGGP+A
Sbjct  210   SLSKIEAAWPEDAKLKEPKKRSVGDIAPKFSTEAEVLAIGDMFYADMEDEWLNQPGGPLA  269

Query  977   HKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADC  798
             HKCK LI+PSRLI+LTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCF+P+PQAA+C
Sbjct  270   HKCKALIQPSRLIVLTAQRFVQTFLGGNYIALHFRRHGFLKFCNVKKESCFFPIPQAAEC  329

Query  797   INRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHG  618
             I R++E+AN+PVIYLSTDAAESET+LLQSLVVFN + VPLVKRP  +S+EKWDALL R+ 
Sbjct  330   ILRIVEKANAPVIYLSTDAAESETNLLQSLVVFNDRQVPLVKRPEHHSSEKWDALLNRNR  389

Query  617   LEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFI  438
             +  D QV+AMLDKTICALS+VFIG+ GSTFTEDI RLRRGWGSAS CDEYLCQGE+PNFI
Sbjct  390   MGGDGQVDAMLDKTICALSNVFIGSSGSTFTEDIFRLRRGWGSASHCDEYLCQGELPNFI  449

Query  437   AD  432
             A+
Sbjct  450   AE  451



>ref|XP_008670499.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100384812 
[Zea mays]
Length=562

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/422 (65%), Positives = 342/422 (81%), Gaps = 9/422 (2%)
 Frame = -3

Query  1688  SAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN-NTDPSISGLGRCRKVDQG  1512
             + + L DL++ L SQI +N++IQ  LLSSH+ G+     D  + D   SG   CRK +  
Sbjct  145   APISLSDLQSALESQIKINREIQAALLSSHRSGSGNATEDGLDLDLPFSG---CRKRELP  201

Query  1511  WSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQR  1332
              S R+TIEW P+ +++L  IC+SGQMSNHLICLEKHMF AA+L R LVVPS K DY++ R
Sbjct  202   AS-RRTIEWNPKKDRFLLVICISGQMSNHLICLEKHMFMAALLGRTLVVPSQKADYQYDR  260

Query  1331  VLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGV  1152
             VLD++HIN C+GRKVV+TYEEF E +K  V ID+ ICY + P PCF+D++ IKKLK  G+
Sbjct  261   VLDINHINDCIGRKVVITYEEFVEKRKK-VAIDQFICYAASP-PCFLDEEHIKKLKGLGI  318

Query  1151  SMNKIETAWNED--VKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIA  978
             S++KIE AW ED  +K+PK+++V DI  KFS+  +V+AIGD+F+AD+E  W+ QPGGP+A
Sbjct  319   SLSKIEAAWPEDAKLKEPKKRSVGDIAPKFSTEAEVLAIGDMFYADMEDEWLNQPGGPLA  378

Query  977   HKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADC  798
             HKCK LI+PSRLI+LTAQRFVQTFLG ++IALHFRRHGFLKFCN KK SCF+P+PQAA+C
Sbjct  379   HKCKALIQPSRLIVLTAQRFVQTFLGGNYIALHFRRHGFLKFCNVKKESCFFPIPQAAEC  438

Query  797   INRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHG  618
             I R++E+AN+PVIYLSTDAAESET+LLQSLVVFN + VPLVKRP  +S+EKWDALL R+ 
Sbjct  439   ILRIVEKANAPVIYLSTDAAESETNLLQSLVVFNDRQVPLVKRPEHHSSEKWDALLNRNR  498

Query  617   LEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFI  438
             +  D QV+AMLDKTICALS+VFIG+ GSTFTEDI RLRRGWGSAS CDEYLCQGE+PNFI
Sbjct  499   MGGDGQVDAMLDKTICALSNVFIGSSGSTFTEDIFRLRRGWGSASHCDEYLCQGELPNFI  558

Query  437   AD  432
             A+
Sbjct  559   AE  560



>gb|KEH18522.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=489

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/363 (68%), Positives = 310/363 (85%), Gaps = 3/363 (1%)
 Frame = -3

Query  1679  FLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDN--NTDPSISGLGRCRKVDQGWS  1506
              +EDLK+ L  QIS+N +IQQ+LL+ H+ GN +D   N  N++ ++    RCR VDQ  S
Sbjct  122   LIEDLKSALFKQISINNEIQQILLNPHRTGNVIDPEFNFGNSNFNVGNYDRCRTVDQSLS  181

Query  1505  ERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVL  1326
             +RKTIEW P+ +K+L AICVSGQMSNHLICLEKHMFFAA+LNR LV+PSSKVDY++ RV+
Sbjct  182   KRKTIEWNPKKDKFLVAICVSGQMSNHLICLEKHMFFAAILNRVLVIPSSKVDYQYDRVV  241

Query  1325  DVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSM  1146
             D+DHINKCLG+KVV++++EF+  +K H+HIDK +CYF+ PQPC++DD+R+KKL   G+ M
Sbjct  242   DIDHINKCLGKKVVMSFDEFSNVKKGHLHIDKFLCYFALPQPCYLDDERLKKLDGLGLGM  301

Query  1145  NKIETAW-NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKC  969
             +K +  W +ED + PK+KTVQD++ KFS +DDV+AIGDVF+A VE  WVMQPGGPIAH+C
Sbjct  302   SKPKAVWEDEDTRNPKKKTVQDVMDKFSYDDDVMAIGDVFYAKVEHEWVMQPGGPIAHQC  361

Query  968   KTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINR  789
             KTLIEP+RLI+LTAQRF+QTFLG +FIALHFRRHGFLKFCNAKKPSCF+P+PQAADCI R
Sbjct  362   KTLIEPNRLILLTAQRFIQTFLGRNFIALHFRRHGFLKFCNAKKPSCFFPIPQAADCILR  421

Query  788   VLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEE  609
             V+ERA++P+IYLSTDAAESET LLQSL+V NGK+VPLV RPARNSAEKWDALLYRH +E 
Sbjct  422   VIERADAPIIYLSTDAAESETGLLQSLIVLNGKSVPLVIRPARNSAEKWDALLYRHHIEG  481

Query  608   DTQ  600
             D+Q
Sbjct  482   DSQ  484



>ref|XP_010459302.1| PREDICTED: uncharacterized protein LOC104740418 [Camelina sativa]
Length=549

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/512 (57%), Positives = 379/512 (74%), Gaps = 39/512 (8%)
 Frame = -3

Query  2090  GARSPGRSSFQIDGNKDRFIDPAR--FNFICRKRYCL-AIILPLFVILLYATTDIKNIFR  1920
             G RSP RS+FQID        PAR  +     KRY + A+ L LF+ +L+  TD +  F 
Sbjct  42    GGRSP-RSAFQID----EIASPARNRWKISLNKRYVVGAVSLTLFLGVLFLFTDTRRFFS  96

Query  1919  TGVSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssn  1740
               +S    D   +R++ESEL+ALYLLRQQQL L    N T V+++               
Sbjct  97    VDLSSFKLDPLTSRVKESELQALYLLRQQQLALVSLLNRTLVDQS---------------  141

Query  1739  agsgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNT  1560
                    ++   + +  S+V ++++KA L+ QIS+NK+I++VLLS H+ GN   ++ +  
Sbjct  142   -------ANFNSSNAIGSSVVIDNVKAALVKQISVNKEIEEVLLSPHRNGN-YSITGSGL  193

Query  1559  DPSISGL----GRCRKVDQG-WSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFF  1395
             D SISG      RCRKVDQ    +RKTIEW P S+++LFAIC+SGQMSNHLICLEKHMFF
Sbjct  194   D-SISGSYYDDARCRKVDQKKLLDRKTIEWNPRSDRFLFAICLSGQMSNHLICLEKHMFF  252

Query  1394  AAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICY  1218
             AA+L+R LV+PS K DY++ RV+D+D IN CLGR VV+++++F E  +KN+ HID+ ICY
Sbjct  253   AALLDRVLVIPSPKFDYQYDRVIDIDRINTCLGRTVVISFDQFKEIDKKNNAHIDRFICY  312

Query  1217  FSQPQPCFMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAI  1041
             FS PQPC++D++ IKKLK  G+S+  K+E  W+ED+K+P ++T Q++V KF S+D VIAI
Sbjct  313   FSSPQPCYVDEEHIKKLKGLGISIGGKLEAPWSEDIKQPTKRTSQEVVEKFKSDDGVIAI  372

Query  1040  GDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGF  861
             GDVF+AD+E   VMQPGGPI HKCKTLIEPS+LI++TAQRF+QTFLG++FI+LH RRHGF
Sbjct  373   GDVFYADMEQDLVMQPGGPIKHKCKTLIEPSKLILVTAQRFIQTFLGKNFISLHLRRHGF  432

Query  860   LKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVP  681
             LKFCNAK PSCFYP+PQAADCI+R++ERAN+PVIYLSTDAAESET LLQSLVV +GK +P
Sbjct  433   LKFCNAKSPSCFYPIPQAADCISRMVERANAPVIYLSTDAAESETGLLQSLVVVDGKVIP  492

Query  680   LVKRPARNSAEKWDALLYRHGLEEDTQVEAML  585
             LVKRP RNSAEKWD+LLYRHG+E+DTQV  +L
Sbjct  493   LVKRPPRNSAEKWDSLLYRHGIEDDTQVTKLL  524



>gb|KFK35696.1| hypothetical protein AALP_AA4G025100 [Arabis alpina]
Length=474

 Score =   532 bits (1370),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 248/376 (66%), Positives = 317/376 (84%), Gaps = 2/376 (1%)
 Frame = -3

Query  1550  ISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFL  1371
             +S + RCRK+DQ  + RKT++WKP+ +KYL AIC+SGQMSNHLICLEKHMF AA+LNR L
Sbjct  100   LSPVIRCRKLDQKITGRKTVQWKPKPDKYLLAICLSGQMSNHLICLEKHMFIAALLNRIL  159

Query  1370  VVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFM  1191
             V+PS K DY + +++D+D IN CLG  VV+++++F + +K++ H+ + ICYFS+P+ C++
Sbjct  160   VIPSHKFDYHYNQIIDIDRINTCLGSNVVVSFDKFKKKKKHNHHV-RFICYFSKPELCYV  218

Query  1190  DDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVE  1014
             D + + KLKS G+S+N K+++ W ED+ KP  KTV+++ S+F S+DDVIA+GDVF+A+VE
Sbjct  219   DKEHLTKLKSLGISINGKLDSPWEEDIGKPSNKTVEEVESRFGSDDDVIAVGDVFYANVE  278

Query  1013  TGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKP  834
                VMQPGGP+AHKC++LIEP+RLI+LTAQRF+QTFLG+++IALHFRRHGFLKFCNAK P
Sbjct  279   KEMVMQPGGPVAHKCRSLIEPNRLILLTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKNP  338

Query  833   SCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNS  654
             SCFYP+PQAA CI R++E+ ++PVIYLSTDAAESE  LLQ L+  NGK VPLVKRP R+S
Sbjct  339   SCFYPIPQAAACITRLIEKVDAPVIYLSTDAAESEIGLLQLLLNLNGKNVPLVKRPPRDS  398

Query  653   AEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCD  474
             AEKWDALLYRHGLE D+QVEAMLDKTI A+SSVFIGA GSTFTEDILRLR+ W +AS CD
Sbjct  399   AEKWDALLYRHGLEGDSQVEAMLDKTISAMSSVFIGASGSTFTEDILRLRKDWRTASYCD  458

Query  473   EYLCQGEVPNFIADDE  426
             EYLC  E PNF+AD E
Sbjct  459   EYLCANEPPNFVADHE  474



>ref|XP_008353304.1| PREDICTED: uncharacterized protein LOC103416869 [Malus domestica]
Length=451

 Score =   446 bits (1146),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 239/390 (61%), Positives = 291/390 (75%), Gaps = 30/390 (8%)
 Frame = -3

Query  2003  RKRYCLAIILPLFVILLYATTDIKNI-FRTG-VSKITFDSPANRMRESelralyllrqqq  1830
             R    LAI +P F+++L+  TD+K++ F TG  S   +DS + ++ ESELRALYLL+QQQ
Sbjct  74    RSFVLLAIFVPTFLVILFFVTDMKSLLFTTGNFSSSPYDSASGKLLESELRALYLLKQQQ  133

Query  1829  leLFKQWNHTFVNKTRLAAVnntgnstssnagsgssnsslertgsSFSAVFLEDLKADLL  1650
             + LF  WN T  N T   + ++                             L+D K+ +L
Sbjct  134   VSLFNLWNRTLPNPTNSTSNHSDPAQIP----------------------LLDDFKSAVL  171

Query  1649  SQISLNKQIQQVLLSSHQLGNSL--DLSD--NNTDPSISGLGRCRKVDQGWSERKTIEWK  1482
              QISLN+ IQQVLLS H+ GNS   D  D  +  +PS+    RCR VDQ +S+R+TIEWK
Sbjct  172   RQISLNRDIQQVLLSPHRTGNSTEPDFRDFGDFENPSLGD--RCRAVDQQFSQRRTIEWK  229

Query  1481  PESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKC  1302
             P SNKYLFAICVSGQMSNHLICLEKHMFFAA+LNR LV+PS KVDY+F RVLD++HINKC
Sbjct  230   PNSNKYLFAICVSGQMSNHLICLEKHMFFAALLNRVLVIPSPKVDYQFSRVLDIEHINKC  289

Query  1301  LGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWN  1122
             LGR VV+T+EE  E +KNHVHIDK ICYFS P PC++DD+ +KKLK +GVSMNK+E+AW 
Sbjct  290   LGRTVVVTFEELDEKKKNHVHIDKFICYFSHPTPCYVDDEHVKKLKGAGVSMNKLESAWV  349

Query  1121  EDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRL  942
             EDVKKP ++TVQD+ SKFSSNDDVIAIGDVFFAD+E  WVMQ  GP+AHKCKTLIEPSRL
Sbjct  350   EDVKKPTKRTVQDVQSKFSSNDDVIAIGDVFFADLEQEWVMQARGPLAHKCKTLIEPSRL  409

Query  941   IMLTAQRFVQTFLGEDFIALHFRRHGFLKF  852
             IMLTAQRF+QTFLG++F+ALHFRRHGFLKF
Sbjct  410   IMLTAQRFIQTFLGKNFVALHFRRHGFLKF  439



>ref|XP_002970687.1| protein-O-fucosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ28013.1| protein-O-fucosyltransferase-like protein [Selaginella moellendorffii]
Length=464

 Score =   435 bits (1118),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 219/420 (52%), Positives = 287/420 (68%), Gaps = 31/420 (7%)
 Frame = -3

Query  1664  KADLL-SQISLNKQIQQVLLSSHQLGNSLDLSDNNTDPSISGLGRCRKVDQGWSER---K  1497
             +AD L SQI LN QIQQ++  +           +  DP   G+G C+   Q +S R   K
Sbjct  69    QADALRSQIELNHQIQQLVSGAR----------HGYDP---GMGGCQ--GQNFSSRRHGK  113

Query  1496  TIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVD  1317
               +W+P  +++L  IC SGQ+SNHLICLEKHMFFAA+L+R LV+P   VDY +++ LD+ 
Sbjct  114   LFQWQPREDRFLLVICTSGQISNHLICLEKHMFFAALLDRTLVLPDPSVDYSYEKTLDIA  173

Query  1316  HINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKI  1137
             HI  CLG K +LT+ EF    K  +   +++CY S    C++D D  KK+K+ G+S +  
Sbjct  174   HIRSCLGEKTLLTFHEFLAKNKTDI---RLLCYMSG---CYLDKDHEKKIKALGLSWSSK  227

Query  1136  ETAWNEDVK---KPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCK  966
               AW E+      P      + V+KFS  D+V+ IGDVF++DVE+  V Q GGP+ H CK
Sbjct  228   TDAWPEEASLKGYPSHPRASEFVAKFSCEDEVLGIGDVFYSDVESELVAQIGGPLQHSCK  287

Query  965   TLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRV  786
             T+I P+RLI+LTAQRFVQTFLG +F+ALHFRRHGFLKFCN K  SCF+P+PQAA CI R 
Sbjct  288   TIIRPNRLILLTAQRFVQTFLGSNFMALHFRRHGFLKFCNVKNESCFFPIPQAASCILRK  347

Query  785   LERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEED  606
             +E A   VIY+STDAAESE +LLQ L+   G  VP+++RP  +S EKWDA+L R GL  D
Sbjct  348   IEEAKPRVIYISTDAAESEITLLQQLL---GPDVPMIQRPQHDSREKWDAILQRKGLLAD  404

Query  605   TQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
              +V AMLDKTICA++  FIG PGSTFT+DI+RLR+ WGS++ CD  LCQG+ PNFIAD +
Sbjct  405   NEVVAMLDKTICAMAESFIGTPGSTFTDDIVRLRKEWGSSNSCDGVLCQGQHPNFIADTD  464



>gb|ACJ85563.1| unknown [Medicago truncatula]
Length=242

 Score =   410 bits (1053),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/242 (78%), Positives = 219/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  1148  MNKIETAWNE-DVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHK  972
             M+K +  W + D + PK+KTVQD++ KFS +DDV+AIGDVF+A VE  WVMQPGGPIAH+
Sbjct  1     MSKPKAVWEDGDTRNPKKKTVQDVMDKFSYDDDVMAIGDVFYAKVEHEWVMQPGGPIAHQ  60

Query  971   CKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCIN  792
             CKTLIEP+RLI+LTAQRF+QTFLG +FIALHFRRHGFLKFCNAKKPSCF+P+PQAADCI 
Sbjct  61    CKTLIEPNRLILLTAQRFIQTFLGRNFIALHFRRHGFLKFCNAKKPSCFFPIPQAADCIL  120

Query  791   RVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLE  612
             RV+ERA++P+IYLSTDAAESET LLQSL+V NGK+VPLV RPARNSAEKWDALLYRH +E
Sbjct  121   RVIERADAPIIYLSTDAAESETGLLQSLIVLNGKSVPLVIRPARNSAEKWDALLYRHHIE  180

Query  611   EDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIAD  432
              D+QVEAMLDKTICA+SSVFIGAPGSTFTEDILRLR+ WGSAS+CDEYLC GE PN +A+
Sbjct  181   GDSQVEAMLDKTICAMSSVFIGAPGSTFTEDILRLRKDWGSASLCDEYLCHGEEPNIVAE  240

Query  431   DE  426
             +E
Sbjct  241   NE  242



>ref|XP_010442531.1| PREDICTED: uncharacterized protein LOC104725559 isoform X2 [Camelina 
sativa]
Length=481

 Score =   410 bits (1053),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 225/416 (54%), Positives = 292/416 (70%), Gaps = 25/416 (6%)
 Frame = -3

Query  2090  GARSPGRSSFQIDGNKDRFIDPARFNFICRKRYCL-AIILPLFVILLYATTDIKNIFRTG  1914
              A SP  S+FQI+    R +   R+     KRY + A+ L + + LL+  TD + +F   
Sbjct  34    AATSPRSSTFQIEDIMQR-VQQHRWKISLNKRYVIVAVSLIVSIGLLFLLTDPRELFSAN  92

Query  1913  VSKITFDSPANRMRESelralyllrqqqleLFKQWNHTFVNKTRLAAVnntgnstssnag  1734
             +S    D  ANR++ESELRALYLLRQQQLEL   WN T VN +   + N +         
Sbjct  93    LSSFKLDPLANRVKESELRALYLLRQQQLELLSLWNGTLVNPSLNQSANASSLG------  146

Query  1733  sgssnsslertgsSFSAVFLEDLKADLLSQISLNKQIQQVLLSSHQLGNSLDLSDNNTDP  1554
                            S+V  ED+K+ +  QISLNK+IQ+VLLS H+  N         D 
Sbjct  147   ---------------SSVLFEDVKSAVSKQISLNKEIQEVLLSPHRTANYSGGGGTGVDS  191

Query  1553  SISGLGRCRKVDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEKHMFFAAVLNRF  1374
                   RCRKVDQ  S+R+T+EWKP S+K+LFAIC+SGQMSNHLICLEKHMFFAA+L+R 
Sbjct  192   VNFLYDRCRKVDQNLSDRRTVEWKPRSDKFLFAICLSGQMSNHLICLEKHMFFAALLDRV  251

Query  1373  LVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAE-SQKNHVHIDKVICYFSQPQPC  1197
             LV+PS K DY++ RV+D+D IN CLGR VV+++++F E ++KNH  ID+ ICYFS PQ C
Sbjct  252   LVIPSPKFDYQYDRVIDIDRINTCLGRNVVVSFDQFKEKAKKNHFRIDRFICYFSSPQLC  311

Query  1196  FMDDDRIKKLKSSGVSMN-KIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFAD  1020
             ++D++ IKKLK  G+S++ K+E  W+ED+KKP ++TVQD+ +KF S+DDVIAIGDVF+AD
Sbjct  312   YVDEEHIKKLKGLGISIDGKLEAPWSEDIKKPSKRTVQDVQTKFKSDDDVIAIGDVFYAD  371

Query  1019  VETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKF  852
             +E  WVMQPGGPI HKCKTLIEPS+LI+LTAQRF+QTFLG++FIALHFRRHGFLKF
Sbjct  372   MEQDWVMQPGGPINHKCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKF  427



>emb|CAE30294.1| GDP-fucose protein-O-fucosyltransferase 2 [Helianthus annuus]
Length=190

 Score =   349 bits (896),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  995  PGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPV  816
            PGGPIAHKC+TLIEPSR+I+LTAQRF+QTFLGE F+ALHFRRHGFLKFCNAK PSCF+P+
Sbjct  1    PGGPIAHKCQTLIEPSRVILLTAQRFIQTFLGERFVALHFRRHGFLKFCNAKNPSCFFPI  60

Query  815  PQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDA  636
            PQAA+CI+R++ERAN PVIYLSTDAAESET LLQSLV   GKTVPLV RPARNSAEKWDA
Sbjct  61   PQAAECISRLVERANVPVIYLSTDAAESETGLLQSLVTLYGKTVPLVTRPARNSAEKWDA  120

Query  635  LLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQG  456
            LLYR  L+ D QVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWG+AS+CDEYLC+G
Sbjct  121  LLYRKKLDGDPQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGTASVCDEYLCEG  180

Query  455  EVPNFIADDE  426
            EVPNFIA DE
Sbjct  181  EVPNFIAGDE  190



>emb|CBI35787.3| unnamed protein product [Vitis vinifera]
Length=171

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  938  MLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVI  759
            MLTAQRFVQTFLG+ F ALHFRRHGFLKFCNAK+PSCF+P+PQAADCI+RV+ERA++PVI
Sbjct  1    MLTAQRFVQTFLGKSFTALHFRRHGFLKFCNAKEPSCFFPIPQAADCISRVVERADTPVI  60

Query  758  YLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDK  579
            YLSTDAAESET LLQSLVV NGK VPL+KRP RNSAEKWDALLYRHGL+ D+QVEAMLDK
Sbjct  61   YLSTDAAESETGLLQSLVVLNGKLVPLIKRPTRNSAEKWDALLYRHGLDGDSQVEAMLDK  120

Query  578  TICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
            TICA++SVFIGAPGSTFTEDILRLRRGWGSAS CDEYLCQGE PNFIAD+E
Sbjct  121  TICAMASVFIGAPGSTFTEDILRLRRGWGSASHCDEYLCQGEQPNFIADNE  171



>ref|XP_001772368.1| predicted protein [Physcomitrella patens]
 gb|EDQ62839.1| predicted protein [Physcomitrella patens]
Length=335

 Score =   319 bits (817),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 160/343 (47%), Positives = 229/343 (67%), Gaps = 15/343 (4%)
 Frame = -3

Query  1454  ICVSGQMSNHLICLEKHMFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTY  1275
             IC +GQ++NHLIC  KHM+FAA+LNR LV+P  K+DY+++ +LD+ H+ KCLG   V+T+
Sbjct  2     ICQTGQVTNHLICFRKHMWFAALLNRTLVLPHGKLDYKYEHLLDMAHLKKCLGNSSVITF  61

Query  1274  EEFAESQKNHVHIDKVICYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQK  1095
             EEFAE +   +H+D++ICY      C  D D  +  ++ G +  + + AW+     P   
Sbjct  62    EEFAELRNETLHVDRLICYM---HSCHFDKDHPRAWEALGYTFGERQDAWSSSSNPPAAH  118

Query  1094  TVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCK-TLIEPSRLIMLTAQRF  918
                DI+S+F+ N  V+A+GD+F+A VE       G  +AH C  + + P+R I++TA+RF
Sbjct  119   K-DDILSRFACNAKVLAVGDLFYAAVED----SHGFAVAHDCTVSPVLPNRNIVVTAERF  173

Query  917   VQTFLGEDFIALHFRRHGFLKFCNAKK-PSCFYPVPQAADCINRVLERANSPVIYLSTDA  741
             VQT+LG +F++LHFRRHGFL FCN +K PSCFYP+PQAA CI R +  A + V+YLSTDA
Sbjct  174   VQTYLGPNFLSLHFRRHGFLVFCNKQKSPSCFYPIPQAARCIRRKVWEARADVVYLSTDA  233

Query  740   AESETSLLQSLVVFNGKTVPLVKRPARNSAE-KWDALLYRHGLEEDTQVEAMLDKTICAL  564
               SE  +L+  +      V +V+R   + AE KWD+LL+R+GLE +  V AM+DKTIC L
Sbjct  234   PASEVDILKQELA----GVTVVRRTKVHEAEAKWDSLLWRNGLESELAVMAMVDKTICVL  289

Query  563   SSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIA  435
                F+G   STF+ DILR+R    +AS CD ++C GE P+F+A
Sbjct  290   GVGFMGTRESTFSYDILRMRNEMRTASSCDGFICDGETPSFLA  332



>emb|CAH41978.1| protein-O-fucosyltransferase 2 [Glycine max]
Length=164

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  917  VQTFLGEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAA  738
            VQTFL  +F+ALHFRRHGFLKFCNAKKPSCFY + QAADCI RV+ERA++P+IYLSTDAA
Sbjct  1    VQTFLESNFVALHFRRHGFLKFCNAKKPSCFYSITQAADCILRVVERADAPIIYLSTDAA  60

Query  737  ESETSLLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSS  558
            ESET LLQSLVV NG+ VPLV RPARNSAEKWDALLYRH ++ D+QVEAMLDK+ICA+SS
Sbjct  61   ESETGLLQSLVVLNGRPVPLVIRPARNSAEKWDALLYRHRMDGDSQVEAMLDKSICAMSS  120

Query  557  VFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIADDE  426
            VFIGAPGSTFTEDILRLR+ WGSASMCDEYLCQGE PN +A++E
Sbjct  121  VFIGAPGSTFTEDILRLRKDWGSASMCDEYLCQGEEPNIVAENE  164



>gb|AAG51963.1|AC024260_1 hypothetical protein, 5' partial; 217-725 [Arabidopsis thaliana]
Length=141

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -3

Query  848  NAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKR  669
            NAK PSCF+P+PQAA CI R++E+  +PV+YLSTDAAESET LLQSL++ NGKTVPLVKR
Sbjct  1    NAKNPSCFFPIPQAASCITRLIEKVEAPVLYLSTDAAESETGLLQSLLILNGKTVPLVKR  60

Query  668  PARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGS  489
            PAR+SAEKWDALLYRHGLE D+QVEAMLDKTICALSSVFIGA GSTFTEDILRLR+ WG+
Sbjct  61   PARDSAEKWDALLYRHGLEGDSQVEAMLDKTICALSSVFIGASGSTFTEDILRLRKDWGT  120

Query  488  ASMCDEYLCQGEVPNFIADDE  426
            AS CDEYLC  E PNFIAD E
Sbjct  121  ASECDEYLCANEQPNFIADHE  141



>ref|XP_002969585.1| hypothetical protein SELMODRAFT_410382 [Selaginella moellendorffii]
 gb|EFJ29673.1| hypothetical protein SELMODRAFT_410382 [Selaginella moellendorffii]
Length=399

 Score =   203 bits (517),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 145/259 (56%), Gaps = 59/259 (23%)
 Frame = -3

Query  1199  CFMDDDRIKKLKSSGVSMNKIETAWNEDVK---KPKQKTVQDIVSKFSSNDDVIAIGDVF  1029
             C++D+D  KK+K+ G+S +    AW E+      P      + V+KFS  D+V+ IGDVF
Sbjct  4     CYLDEDHEKKIKALGLSWSSKNDAWPEEASLKGYPSHPRASEFVAKFSCEDEVLGIGDVF  63

Query  1028  FADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFC  849
             ++DVE+  V Q GGP+ H CKT+I  +RLI+LT Q                         
Sbjct  64    YSDVESELVAQIGGPLQHSCKTIIRLNRLILLTVQS------------------------  99

Query  848   NAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKR  669
             N K  SCF+P+PQAA CI+R ++ A   VIY+STDAAESE +LLQ L+            
Sbjct  100   NVKNESCFFPIPQAASCISRKIQEAKPRVIYISTDAAESEITLLQQLL------------  147

Query  668   PARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGS  489
                                    V AMLDKTICA++  FIG PGSTFT+DI+RLR+ WGS
Sbjct  148   --------------------GPDVVAMLDKTICAMAESFIGTPGSTFTDDIVRLRKEWGS  187

Query  488   ASMCDEYLCQGEVPNFIAD  432
             ++ CD  LCQG+ PNFIAD
Sbjct  188   SNSCDGVLCQGQYPNFIAD  206



>ref|XP_002969374.1| protein-O-fucosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ29462.1| protein-O-fucosyltransferase-like protein [Selaginella moellendorffii]
Length=245

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/290 (38%), Positives = 151/290 (52%), Gaps = 61/290 (21%)
 Frame = -3

Query  1403  MFFAAVLNRFLVVPSSKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVI  1224
             MFFAA+L+R LV P   VDY +++ LD+ HI  CLG K +LT  EF    K  +   +++
Sbjct  1     MFFAALLDRTLVFPDPCVDYSYEKTLDIAHICSCLGEKTLLTLHEFLGKNKTDI---RLL  57

Query  1223  CYFSQPQPCFMDDDRIKKLKSSGVSMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIA  1044
             CY S    CF+D+D  KK+K+ G+            +KK   K +  ++++ +S      
Sbjct  58    CYMSG---CFLDEDHEKKIKALGLPRPM------PGLKKLLSKAIHLVLARANSWRR---  105

Query  1043  IGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHG  864
               DVF++DVE+  V Q GGP  H CKT+I P+R I+LTAQ  +   L ED          
Sbjct  106   --DVFYSDVESELVAQIGGPFQHSCKTIIRPNRPILLTAQSNLH--LEED----------  151

Query  863   FLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTV  684
                           P  QA   ++                A ESE +LLQ L+   G  V
Sbjct  152   --------------PGGQALSDLHL---------------AVESEITLLQQLL---GPDV  179

Query  683   PLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGS  534
             P+++RP  +S EKWDA+L R GL  D QV AMLDKTICA++  FIG  GS
Sbjct  180   PMIQRPQHDSREKWDAILQRKGLLADNQVVAMLDKTICAMAQSFIGTRGS  229



>gb|AFP49325.1| GDP-fucose protein-O-fucosyltransferase 2, partial [Olea europaea]
Length=87

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -3

Query  686  VPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRL  507
            VPLV+RPARNSAEKWDALLYRHGLE D QVEAMLDK+ICALS+VFIG+ GSTFT+DILRL
Sbjct  1    VPLVQRPARNSAEKWDALLYRHGLEGDAQVEAMLDKSICALSTVFIGSGGSTFTDDILRL  60

Query  506  RRGWGSASMCDEYLCQGEVPNFIADDE  426
            R+ WGSAS CDEYLCQGE+PNF+A+DE
Sbjct  61   RKDWGSASACDEYLCQGELPNFVAEDE  87



>ref|XP_002970857.1| hypothetical protein SELMODRAFT_411497 [Selaginella moellendorffii]
 gb|EFJ28183.1| hypothetical protein SELMODRAFT_411497 [Selaginella moellendorffii]
Length=952

 Score =   131 bits (329),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 140/317 (44%), Gaps = 87/317 (27%)
 Frame = -3

Query  1358  SKVDYEFQRVLDVDHINKCLGRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDDR  1179
             S VDY +++ LD+  I  CLG K +LT+ EF    K  +   +++CY S    C++D+D 
Sbjct  496   SSVDYSYEKTLDI--ICSCLGEKTLLTFHEFLGKNKTDI---RLLCYMSG---CYLDEDH  547

Query  1178  IKKLKSSGVSMNKIETAWNEDVK---KPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETG  1008
              KK+K+ G+S +    AW E+      P      + V+ FS   +V+ IGDVF++DVE+ 
Sbjct  548   EKKIKALGLSWSSKTDAWPEEASLKGYPSHPRASEFVATFSCEVEVLGIGDVFYSDVESE  607

Query  1007  WVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFLGEDFIALHFRRHGFLKFCNAKKPSC  828
              V Q                  I +   R +Q                        KP  
Sbjct  608   LVAQ------------------IAICISRKIQE----------------------AKPRV  627

Query  827   FYPVPQAADCINRVLERANSPVIYLSTDAAESETSLLQSLVVFNGKTVPLVKRPARNSAE  648
              Y    AA                      ESE +LLQ L+   G  VP+++RP  +S E
Sbjct  628   IYISTDAA----------------------ESEITLLQQLL---GPDVPMIQRPQHDSRE  662

Query  647   KWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCD--  474
             KWDA+L R GL  D +V A  D       +   G PGSTFT+DILRLR+ WG  S     
Sbjct  663   KWDAILQRKGLLADNEVVAGSD-------AAQNGTPGSTFTDDILRLRKEWGKYSFQGLS  715

Query  473   --EYLCQGEVPNFIADD  429
                 LC+G    F+  +
Sbjct  716   LVHELCRGGAQYFVGKN  732



>gb|ACR34624.1| unknown [Zea mays]
Length=64

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -3

Query  608  DTQVEAMLDKTICALSSVFIGAPGSTFTEDILRLRRGWGSASMCDEYLCQGEVPNFIAD  432
            D QV+AMLDKTICALS+VFIG+ GSTFTEDI RLRRGWGSAS CDEYLCQGE+PNFIA+
Sbjct  4    DGQVDAMLDKTICALSNVFIGSSGSTFTEDIFRLRRGWGSASHCDEYLCQGELPNFIAE  62



>gb|AES63265.2| PPR containing plant-like protein [Medicago truncatula]
Length=614

 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 81/115 (70%), Gaps = 5/115 (4%)
 Frame = -3

Query  1298  GRKVVLTYEEFAESQKNHVHIDKVICYFSQPQPCFMDDD-RIKKLKSSGVSMNKIETAW-  1125
             G+K++     F   ++ ++HIDK +CYF+ PQPC++DDD R+KKL   G+ M+K +  W 
Sbjct  502   GKKLLFLLMNFRMLRRVYLHIDKFLCYFALPQPCYLDDDERLKKLGGLGLGMSKPKAVWE  561

Query  1124  NEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTL  960
             +ED + PK+  V D   KFS +DDV+AIGDVF+ +VE  WVMQ GGPIAH+CKT 
Sbjct  562   DEDARNPKKTVVMD---KFSYDDDVMAIGDVFYVEVEHDWVMQSGGPIAHQCKTF  613



>ref|XP_003593013.1| GDP-fucose protein-O-fucosyltransferase [Medicago truncatula]
Length=182

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 84/127 (66%), Gaps = 21/127 (17%)
 Frame = -3

Query  1256  QKNHVHIDKVICYFSQPQPCFMDDD-RIKKLKSSGVSMNKIETAW-NEDVKKPKQKTVQD  1083
             ++ ++HIDK +CYF+ PQPC++DDD R+KKL   G+ M+K +  W +ED + PK+  V D
Sbjct  3     RRVYLHIDKFLCYFALPQPCYLDDDERLKKLGGLGLGMSKPKAVWEDEDARNPKKTVVMD  62

Query  1082  IVSKFSSNDDVIAIGDVFFADVETGWVMQPGGPIAHKCKTLIEPSRLIMLTAQRFVQTFL  903
                KFS +DDV+AIGDVF+ +VE                 LIEP+ LI+LTAQRF+QTFL
Sbjct  63    ---KFSYDDDVMAIGDVFYVEVE----------------LLIEPNHLILLTAQRFIQTFL  103

Query  902   GEDFIAL  882
               +FIA 
Sbjct  104   ERNFIAF  110



>ref|XP_003593014.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=628

 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = -3

Query  1577  LSDNNTDPSISGLGRCRK---VDQGWSERKTIEWKPESNKYLFAICVSGQMSNHLICLEK  1407
             L DN  + + + L   R    ++Q  S+RKTIEW P+++K+L AICVSGQMSNHLIC E 
Sbjct  543   LKDNRINATTARLNPHRTLNVIEQSLSKRKTIEWNPKNDKFLVAICVSGQMSNHLICFEN  602

Query  1406  HMFFAAVLNRFLVVPSSKVDYEFQRV  1329
             HMFF  +LNR LV+P+ KV Y++  +
Sbjct  603   HMFFPEILNRVLVIPNFKVSYQYDMI  628



>ref|XP_010535238.1| PREDICTED: uncharacterized protein LOC104810589 [Tarenaya hassleriana]
Length=129

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 63/119 (53%), Gaps = 32/119 (27%)
 Frame = -3

Query  1331  VLDVDHINKCLGRKVVLTYEEFAE----------SQKNHVHIDKVICYFSQPQPCFMDDD  1182
             V+D+D IN CLGR V +T+EEF E             +H HID  IC FS+P+P +    
Sbjct  10    VVDIDRINTCLGRNVAVTFEEFVEKKKNKYKKGHHHHHHGHIDGFICCFSKPRPTY----  65

Query  1181  RIKKLKSSGV-SMNKIETAWNEDVKKPKQKTVQDIVSKFSSNDDVIAIGDVFFADVETG  1008
                  ++SGV  ++K    W +            + + F S+ DVIAIGDVF+A+VE G
Sbjct  66    -----QASGVLVVSKSTRQWRK------------MEANFRSDYDVIAIGDVFYANVEGG  107



>gb|EJW77671.1| O-fucosyltransferase 2 [Wuchereria bancrofti]
Length=220

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 62/129 (48%), Gaps = 21/129 (16%)
 Frame = -3

Query  902  GEDFIALHFRRHGFLKFCNAKKPSCFYPVPQAADCINRVLERANSPVIYLSTDAAESETS  723
            G D+I +H+RR  F++  +A  PS    +   A+ I  +L + N   +YL TDA+ +E +
Sbjct  70   GGDYICVHWRRRDFVRSHSADIPS----INGTAEQIVVILRKENLTTLYLCTDASTAEVA  125

Query  722  LLQSLVVFNGKTVPLVKRPARNSAEKWDALLYRHGLEEDTQVEAMLDKTICALSSVFIGA  543
             L SL+ ++ +    +   + N  E                  +++D+ ICA +  FIG 
Sbjct  126  TLTSLLPYDVQVERFLNDSSLNDGEV-----------------SIVDQWICAHARYFIGT  168

Query  542  PGSTFTEDI  516
              STF+  I
Sbjct  169  HTSTFSYRI  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7041065150936