BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23807_g2_i1 len=1050 path=[966:0-864 1831:865-922 1889:923-973
4688:974-978 3565:979-1007 2003:1008-1049]

Length=1050
                                                                      Score     E

ref|XP_011070596.1|  PREDICTED: lignin-forming anionic peroxidase...    426   1e-145   
ref|XP_011070600.1|  PREDICTED: lignin-forming anionic peroxidase...    425   2e-145   
ref|XP_011070595.1|  PREDICTED: lignin-forming anionic peroxidase...    424   1e-144   
ref|XP_011070599.1|  PREDICTED: lignin-forming anionic peroxidase...    421   2e-143   
ref|XP_009608056.1|  PREDICTED: lignin-forming anionic peroxidase       417   7e-142   
ref|NP_001289531.1|  lignin-forming anionic peroxidase precursor        416   2e-141   
ref|XP_011070598.1|  PREDICTED: lignin-forming anionic peroxidase...    413   3e-140   
ref|XP_011070597.1|  PREDICTED: lignin-forming anionic peroxidase...    412   4e-140   
ref|XP_009620122.1|  PREDICTED: lignin-forming anionic peroxidase...    407   5e-138   
ref|XP_009801852.1|  PREDICTED: lignin-forming anionic peroxidase...    407   9e-138   
emb|CDP16309.1|  unnamed protein product                                403   3e-136   
gb|AAY89058.1|  class III peroxidase                                    403   3e-136   Phelipanche ramosa
ref|XP_006351920.1|  PREDICTED: lignin-forming anionic peroxidase...    402   4e-136   
ref|XP_004250402.1|  PREDICTED: lignin-forming anionic peroxidase       402   5e-136   
emb|CDP08160.1|  unnamed protein product                                401   1e-135   
gb|EYU30095.1|  hypothetical protein MIMGU_mgv1a021792mg                399   9e-135   
gb|EYU30092.1|  hypothetical protein MIMGU_mgv1a010078mg                399   1e-134   
ref|XP_006361366.1|  PREDICTED: lignin-forming anionic peroxidase...    398   1e-134   
gb|ABF48527.1|  cell wall peroxidase                                    397   3e-134   Capsicum annuum
ref|XP_009781728.1|  PREDICTED: lignin-forming anionic peroxidase...    394   4e-133   
ref|XP_006351919.1|  PREDICTED: lignin-forming anionic peroxidase...    394   1e-132   
ref|XP_010270788.1|  PREDICTED: lignin-forming anionic peroxidase...    392   4e-132   
gb|EYU30094.1|  hypothetical protein MIMGU_mgv1a0094071mg               392   4e-132   
ref|XP_009603345.1|  PREDICTED: lignin-forming anionic peroxidase...    390   2e-131   
ref|XP_010030093.1|  PREDICTED: lignin-forming anionic peroxidase...    389   5e-131   
ref|XP_010270786.1|  PREDICTED: lignin-forming anionic peroxidase...    389   5e-131   
ref|XP_010270787.1|  PREDICTED: lignin-forming anionic peroxidase...    389   8e-131   
ref|XP_007045348.1|  Lignin-forming anionic peroxidase                  389   9e-131   
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g             387   3e-130   
ref|XP_004505714.1|  PREDICTED: lignin-forming anionic peroxidase...    387   3e-130   
ref|XP_007131640.1|  hypothetical protein PHAVU_011G030200g             387   3e-130   
dbj|BAA77388.1|  peroxidase 2                                           387   3e-130   Scutellaria baicalensis [Baikal skullcap]
gb|AAB97853.1|  ferriprotein porphyrin-containing peroxidase            387   3e-130   Striga asiatica [witchweed]
ref|XP_002521867.1|  Lignin-forming anionic peroxidase precursor,...    387   5e-130   Ricinus communis
ref|XP_011024237.1|  PREDICTED: lignin-forming anionic peroxidase...    386   6e-130   
ref|XP_004140450.1|  PREDICTED: lignin-forming anionic peroxidase...    386   7e-130   
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g             386   8e-130   
ref|XP_010270789.1|  PREDICTED: lignin-forming anionic peroxidase...    386   8e-130   
ref|XP_003556178.1|  PREDICTED: lignin-forming anionic peroxidase...    386   9e-130   
gb|KHN00767.1|  Lignin-forming anionic peroxidase                       386   1e-129   
ref|XP_008460239.1|  PREDICTED: lignin-forming anionic peroxidase...    386   1e-129   
ref|XP_004140410.1|  PREDICTED: lignin-forming anionic peroxidase...    385   2e-129   
emb|CDP07980.1|  unnamed protein product                                385   2e-129   
ref|XP_006589469.1|  PREDICTED: lignin-forming anionic peroxidase...    384   9e-129   
gb|AAB97854.1|  ferriprotein porphyrin-containing peroxidase            383   2e-128   Striga asiatica [witchweed]
ref|XP_003607863.1|  Peroxidase                                         381   6e-128   
gb|AES90060.2|  lignin-forming anionic peroxidase                       382   6e-128   
ref|XP_002311022.2|  hypothetical protein POPTR_0008s02340g             381   1e-127   Populus trichocarpa [western balsam poplar]
gb|AHL39158.1|  class III peroxidase                                    381   1e-127   
gb|AHL39166.1|  class III peroxidase                                    380   1e-127   
ref|XP_002269169.1|  PREDICTED: lignin-forming anionic peroxidase       381   2e-127   Vitis vinifera
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                       382   2e-127   
ref|XP_006378807.1|  hypothetical protein POPTR_0010s24330g             380   2e-127   
gb|EYU30097.1|  hypothetical protein MIMGU_mgv1a010056mg                380   2e-127   
gb|KDP38219.1|  hypothetical protein JCGZ_04862                         388   4e-127   
ref|XP_006470943.1|  PREDICTED: lignin-forming anionic peroxidase...    379   5e-127   
emb|CAN80097.1|  hypothetical protein VITISV_011206                     379   9e-127   Vitis vinifera
ref|XP_006379469.1|  hypothetical protein POPTR_0008s02330g             379   9e-127   
ref|XP_002269145.1|  PREDICTED: lignin-forming anionic peroxidase       379   9e-127   Vitis vinifera
ref|XP_007131639.1|  hypothetical protein PHAVU_011G030100g             378   2e-126   
ref|XP_003538964.1|  PREDICTED: lignin-forming anionic peroxidase...    378   2e-126   
ref|XP_006470944.1|  PREDICTED: lignin-forming anionic peroxidase...    377   4e-126   
ref|XP_004505715.1|  PREDICTED: lignin-forming anionic peroxidase...    377   4e-126   
ref|XP_007045349.1|  Lignin-forming anionic peroxidase                  376   1e-125   
ref|XP_011032836.1|  PREDICTED: lignin-forming anionic peroxidase...    375   1e-125   
ref|XP_002521852.1|  Lignin-forming anionic peroxidase precursor,...    375   3e-125   Ricinus communis
ref|XP_002521868.1|  Lignin-forming anionic peroxidase precursor,...    374   4e-125   Ricinus communis
ref|XP_004305595.1|  PREDICTED: lignin-forming anionic peroxidase...    374   6e-125   
emb|CBI27503.3|  unnamed protein product                                374   1e-124   
emb|CBI27505.3|  unnamed protein product                                372   2e-124   
ref|XP_002269058.1|  PREDICTED: lignin-forming anionic peroxidase...    372   3e-124   Vitis vinifera
ref|XP_002509730.1|  Lignin-forming anionic peroxidase precursor,...    372   4e-124   Ricinus communis
ref|XP_002269266.1|  PREDICTED: lignin-forming anionic peroxidase...    371   1e-123   Vitis vinifera
ref|XP_006470886.1|  PREDICTED: lignin-forming anionic peroxidase...    370   2e-123   
ref|XP_008350979.1|  PREDICTED: lignin-forming anionic peroxidase...    370   2e-123   
ref|XP_007045351.1|  Lignin-forming anionic peroxidase                  369   5e-123   
ref|XP_002521851.1|  Lignin-forming anionic peroxidase precursor,...    369   6e-123   Ricinus communis
ref|XP_004297785.1|  PREDICTED: lignin-forming anionic peroxidase...    369   7e-123   
ref|XP_002521866.1|  Lignin-forming anionic peroxidase precursor,...    368   1e-122   Ricinus communis
gb|KEH30580.1|  lignin-forming anionic peroxidase                       367   2e-122   
ref|XP_002509738.1|  Lignin-forming anionic peroxidase precursor,...    367   2e-122   Ricinus communis
emb|CDP16312.1|  unnamed protein product                                365   3e-122   
ref|XP_010527854.1|  PREDICTED: peroxidase 5-like                       366   5e-122   
ref|XP_010654887.1|  PREDICTED: lignin-forming anionic peroxidase...    367   6e-122   
gb|AAF43956.1|AC012188_33  Strong similarity to an Anionic Peroxi...    365   8e-122   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172907.1|  peroxidase 5                                          365   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006470885.1|  PREDICTED: lignin-forming anionic peroxidase...    365   1e-121   
ref|XP_008220986.1|  PREDICTED: lignin-forming anionic peroxidase...    365   3e-121   
ref|XP_007226601.1|  hypothetical protein PRUPE_ppa023604mg             363   4e-121   
ref|XP_002274693.1|  PREDICTED: lignin-forming anionic peroxidase...    364   5e-121   Vitis vinifera
ref|XP_004298191.1|  PREDICTED: lignin-forming anionic peroxidase...    363   8e-121   
ref|XP_002299006.2|  hypothetical protein POPTR_0001s46290g             363   8e-121   Populus trichocarpa [western balsam poplar]
gb|KDP25488.1|  hypothetical protein JCGZ_20644                         362   2e-120   
ref|XP_011013621.1|  PREDICTED: lignin-forming anionic peroxidase...    362   2e-120   
ref|XP_006370761.1|  Peroxidase 4 precursor family protein              362   2e-120   
ref|XP_006848018.1|  hypothetical protein AMTR_s00029p00173190          361   4e-120   
gb|KDP25492.1|  hypothetical protein JCGZ_20648                         361   7e-120   
ref|XP_010654860.1|  PREDICTED: lignin-forming anionic peroxidase...    360   1e-119   
emb|CDY66455.1|  BnaAnng22270D                                          360   2e-119   
ref|XP_010476510.1|  PREDICTED: peroxidase 5                            360   2e-119   
ref|XP_002890062.1|  hypothetical protein ARALYDRAFT_312453             359   3e-119   
ref|XP_010458957.1|  PREDICTED: peroxidase 5-like isoform X2            359   3e-119   
ref|XP_010088521.1|  Lignin-forming anionic peroxidase                  358   6e-119   
ref|XP_006848008.1|  hypothetical protein AMTR_s00029p00168370          358   8e-119   
emb|CDY65372.1|  BnaC05g49640D                                          357   2e-118   
ref|XP_006306491.1|  hypothetical protein CARUB_v10012474mg             356   4e-118   
ref|XP_010458955.1|  PREDICTED: peroxidase 4                            356   5e-118   
ref|XP_009148834.1|  PREDICTED: peroxidase 4                            356   6e-118   
emb|CBI27502.3|  unnamed protein product                                354   6e-118   
ref|XP_006305840.1|  hypothetical protein CARUB_v10010887mg             355   1e-117   
ref|XP_010496209.1|  PREDICTED: peroxidase 4-like                       354   3e-117   
ref|XP_003607245.1|  Peroxidase                                         353   3e-117   
gb|KHN32283.1|  Lignin-forming anionic peroxidase                       352   4e-117   
ref|XP_011038117.1|  PREDICTED: lignin-forming anionic peroxidase...    353   5e-117   
ref|XP_010496213.1|  PREDICTED: peroxidase 5-like                       353   1e-116   
ref|XP_010476509.1|  PREDICTED: peroxidase 4-like                       351   3e-116   
ref|XP_008465298.1|  PREDICTED: peroxidase 4-like                       352   3e-116   
ref|NP_172906.1|  peroxidase 4                                          351   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417000.1|  hypothetical protein EUTSA_v10008244mg             350   9e-116   
emb|CDX81650.1|  BnaC08g39510D                                          350   1e-115   
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       349   4e-115   
ref|XP_002892816.1|  hypothetical protein ARALYDRAFT_888837             348   4e-115   
ref|NP_196153.1|  peroxidase 52                                         349   4e-115   Arabidopsis thaliana [mouse-ear cress]
gb|AAF63165.1|AC010657_1  T5E21.5                                       348   6e-115   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    348   6e-115   
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       348   8e-115   
gb|KDO57833.1|  hypothetical protein CISIN_1g024722mg                   345   1e-114   
gb|KGN47222.1|  hypothetical protein Csa_6G216410                       347   1e-114   
ref|XP_004149366.1|  PREDICTED: peroxidase 4-like                       347   2e-114   
ref|XP_004172441.1|  PREDICTED: peroxidase 4-like                       347   2e-114   
gb|KDP45728.1|  hypothetical protein JCGZ_17335                         347   2e-114   
emb|CBI27501.3|  unnamed protein product                                345   3e-114   
gb|EMS66985.1|  Peroxidase 4                                            347   3e-114   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             347   3e-114   
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              346   4e-114   
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010          347   4e-114   Sorghum bicolor [broomcorn]
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              346   4e-114   
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              346   4e-114   
ref|XP_006391633.1|  hypothetical protein EUTSA_v10023814mg             346   4e-114   
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                       346   6e-114   
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                       345   9e-114   
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              345   1e-113   
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g             344   2e-113   
ref|XP_004150607.1|  PREDICTED: peroxidase 4-like                       344   4e-113   
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      343   4e-113   
ref|XP_008463814.1|  PREDICTED: peroxidase 4-like                       343   5e-113   
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       343   5e-113   
gb|KGN47223.1|  hypothetical protein Csa_6G216420                       343   5e-113   
gb|AAQ55233.1|  peroxidase                                              340   5e-113   Orobanche cernua var. cumana
ref|XP_002509733.1|  Lignin-forming anionic peroxidase precursor,...    343   6e-113   Ricinus communis
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      343   8e-113   
gb|KHG18057.1|  Peroxidase 52 -like protein                             343   9e-113   
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030          343   9e-113   Sorghum bicolor [broomcorn]
ref|XP_006848015.1|  hypothetical protein AMTR_s00029p00170340          343   1e-112   
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       343   1e-112   
emb|CBI27506.3|  unnamed protein product                                340   1e-112   
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like              343   1e-112   
gb|ABK21858.1|  unknown                                                 343   1e-112   Picea sitchensis
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           342   1e-112   
ref|XP_002509737.1|  Lignin-forming anionic peroxidase precursor,...    342   1e-112   Ricinus communis
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like              342   2e-112   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      342   2e-112   
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              341   3e-112   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          341   4e-112   
ref|XP_004977590.1|  PREDICTED: cationic peroxidase 1-like              341   5e-112   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      341   5e-112   
gb|ACN33662.1|  unknown                                                 340   7e-112   Zea mays [maize]
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                    341   7e-112   
ref|NP_001131000.1|  uncharacterized protein LOC100192105 precursor     340   9e-112   Zea mays [maize]
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000          340   9e-112   Sorghum bicolor [broomcorn]
ref|XP_004977588.1|  PREDICTED: peroxidase 4-like                       340   1e-111   
gb|AAP76387.1|  class III peroxidase                                    340   1e-111   Gossypium hirsutum [American cotton]
gb|KDP25489.1|  hypothetical protein JCGZ_20645                         339   2e-111   
ref|XP_010543687.1|  PREDICTED: peroxidase 52                           338   4e-111   
ref|NP_001065566.1|  Os11g0112200                                       338   4e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      338   4e-111   
ref|NP_001151940.1|  peroxidase 52 precursor                            339   5e-111   Zea mays [maize]
emb|CDP04065.1|  unnamed protein product                                338   6e-111   
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             338   6e-111   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         338   6e-111   
ref|XP_009117893.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 4...    338   6e-111   
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                       338   7e-111   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              338   7e-111   
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            338   7e-111   Vitis vinifera
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      338   8e-111   
ref|XP_009419701.1|  PREDICTED: cationic peroxidase 1-like              338   8e-111   
emb|CDY14118.1|  BnaC02g02350D                                          338   9e-111   
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       338   1e-110   
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like              337   1e-110   
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             337   1e-110   
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              337   1e-110   
emb|CAH10840.1|  peroxidase                                             337   1e-110   Picea abies
ref|XP_004492538.1|  PREDICTED: cationic peroxidase 1-like              337   1e-110   
emb|CAD67477.1|  peroxidase                                             337   1e-110   Asparagus officinalis
gb|AAB02554.1|  cationic peroxidase                                     337   1e-110   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           337   1e-110   
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like              337   1e-110   
emb|CDY04948.1|  BnaAnng01300D                                          337   2e-110   
tpe|CAH69378.1|  TPA: class III peroxidase 136 precursor                337   2e-110   
gb|AFR44628.1|  class III secretory peroxidase                          337   2e-110   
ref|XP_006848019.1|  hypothetical protein AMTR_s00029p00173440          337   2e-110   
dbj|BAJ97638.1|  predicted protein                                      337   2e-110   
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...    335   3e-110   Brassica rapa subsp. rapa
emb|CAL25300.1|  properoxidase                                          335   4e-110   Picea abies
ref|XP_007045344.1|  Peroxidase superfamily protein                     336   5e-110   
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            336   5e-110   Vitis vinifera
emb|CBI27504.3|  unnamed protein product                                337   5e-110   
gb|AHL39176.1|  class III peroxidase                                    335   5e-110   
gb|EMT02760.1|  Peroxidase 4                                            334   6e-110   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              335   6e-110   
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like              335   7e-110   
gb|KHN29529.1|  Cationic peroxidase 1                                   335   7e-110   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                  334   9e-110   
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              334   1e-109   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            335   1e-109   
ref|XP_004978554.1|  PREDICTED: peroxidase 4-like                       335   1e-109   
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      335   1e-109   
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                       335   2e-109   
emb|CAD67478.1|  peroxidase                                             333   2e-109   Asparagus officinalis
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       334   2e-109   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  334   2e-109   Ricinus communis
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like              334   2e-109   
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like              333   3e-109   
sp|P22195.2|PER1_ARAHY  RecName: Full=Cationic peroxidase 1; AltN...    333   3e-109   Arachis hypogaea [goober]
emb|CAD67479.1|  peroxidase                                             334   3e-109   Asparagus officinalis
ref|XP_002441703.1|  hypothetical protein SORBIDRAFT_08g000990          334   3e-109   Sorghum bicolor [broomcorn]
ref|XP_007033589.1|  Peroxidase superfamily protein                     333   3e-109   
ref|XP_002489046.1|  hypothetical protein SORBIDRAFT_0246s002010        333   4e-109   Sorghum bicolor [broomcorn]
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg             333   4e-109   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                334   4e-109   
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like              333   5e-109   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       333   5e-109   
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    333   6e-109   
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3        333   6e-109   
dbj|BAA82306.1|  peroxidase                                             333   6e-109   Nicotiana tabacum [American tobacco]
ref|XP_003551179.1|  PREDICTED: cationic peroxidase 1-like              333   6e-109   
gb|ABV24960.2|  putative secretory peroxidase                           333   8e-109   Catharanthus roseus [chatas]
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      333   8e-109   
ref|XP_003616748.1|  Peroxidase                                         333   9e-109   
ref|XP_006387287.1|  hypothetical protein POPTR_1332s00200g             330   9e-109   
ref|XP_010093550.1|  Cationic peroxidase 1                              332   1e-108   
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      332   1e-108   
ref|XP_008228933.1|  PREDICTED: peroxidase P7-like                      332   1e-108   
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              332   1e-108   
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                       332   1e-108   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              332   1e-108   
gb|AAZ42168.1|  lignin peroxidase-like                                  329   1e-108   Cucumis sativus [cucumbers]
gb|ACM47317.1|  peroxidase                                              332   1e-108   Capsicum annuum
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      332   2e-108   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      332   2e-108   
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like              333   2e-108   
ref|XP_002281731.1|  PREDICTED: peroxidase P7                           332   2e-108   Vitis vinifera
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                      332   2e-108   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      332   2e-108   
gb|KHN46100.1|  Cationic peroxidase 1                                   331   2e-108   
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              332   2e-108   
ref|XP_007011229.1|  Peroxidase superfamily protein                     332   2e-108   
gb|ACU17608.1|  unknown                                                 331   3e-108   Glycine max [soybeans]
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             332   3e-108   
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                       332   3e-108   
ref|NP_001106040.1|  peroxidase 70 precursor                            331   3e-108   Zea mays [maize]
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                      331   3e-108   
gb|AFK46186.1|  unknown                                                 331   3e-108   
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    331   3e-108   
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      331   3e-108   
gb|ABK23423.1|  unknown                                                 331   3e-108   Picea sitchensis
ref|XP_004502855.1|  PREDICTED: peroxidase 52-like                      331   3e-108   
ref|XP_002283995.1|  PREDICTED: cationic peroxidase 1-like              331   4e-108   Vitis vinifera
gb|ABK25962.1|  unknown                                                 331   4e-108   Picea sitchensis
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      331   4e-108   
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      331   4e-108   
ref|XP_009365290.1|  PREDICTED: peroxidase P7-like                      331   4e-108   
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       331   5e-108   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000          330   5e-108   
gb|KHN46282.1|  Peroxidase 4                                            331   5e-108   
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210          330   6e-108   
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       330   6e-108   
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   330   6e-108   
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              330   6e-108   
emb|CAH10839.1|  peroxidase                                             330   7e-108   
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      330   7e-108   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like              330   7e-108   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             330   7e-108   
ref|XP_003538328.1|  PREDICTED: peroxidase 4-like                       330   7e-108   
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           330   7e-108   
ref|XP_004951344.1|  PREDICTED: peroxidase 70-like                      330   8e-108   
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             330   9e-108   
ref|XP_002319407.1|  peroxidase family protein                          329   9e-108   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              330   9e-108   
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                   330   1e-107   
ref|XP_006664870.1|  PREDICTED: peroxidase 4-like                       330   1e-107   
ref|XP_008650762.1|  PREDICTED: peroxidase 70 isoform X1                330   1e-107   
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2        329   1e-107   
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     329   2e-107   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             329   2e-107   
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      329   2e-107   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              330   2e-107   
gb|KHN40655.1|  Cationic peroxidase 1                                   330   2e-107   
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1        329   2e-107   
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      329   2e-107   
emb|CAN81400.1|  hypothetical protein VITISV_038539                     329   2e-107   
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           329   2e-107   
ref|XP_004303193.1|  PREDICTED: peroxidase 52-like                      328   3e-107   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                       328   3e-107   
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              328   3e-107   
ref|XP_004492537.1|  PREDICTED: cationic peroxidase 1-like              328   4e-107   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       328   4e-107   
gb|EAY79693.1|  hypothetical protein OsI_34840                          328   4e-107   
ref|XP_009122142.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      328   4e-107   
ref|XP_002319968.2|  peroxidase family protein                          328   4e-107   
ref|XP_003602462.1|  Peroxidase                                         328   4e-107   
gb|ACT35473.1|  peroxidase 52                                           328   5e-107   
ref|XP_009404515.1|  PREDICTED: peroxidase P7-like                      328   5e-107   
emb|CDX98835.1|  BnaC09g50000D                                          328   5e-107   
ref|XP_008381199.1|  PREDICTED: peroxidase P7-like                      329   5e-107   
dbj|BAK03433.1|  predicted protein                                      328   5e-107   
ref|XP_010104414.1|  Peroxidase 52                                      328   5e-107   
gb|KEH29223.1|  class III peroxidase                                    329   5e-107   
emb|CDX70158.1|  BnaA10g25070D                                          328   6e-107   
emb|CAA62597.1|  korean-radish isoperoxidase                            328   6e-107   
ref|NP_001169614.1|  uncharacterized protein LOC100383495 precursor     328   7e-107   
ref|XP_010931330.1|  PREDICTED: peroxidase 4-like                       328   7e-107   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              327   7e-107   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              327   7e-107   
gb|ABR18139.1|  unknown                                                 328   8e-107   
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like              328   8e-107   
ref|XP_010689732.1|  PREDICTED: peroxidase P7-like                      327   9e-107   
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                      327   9e-107   
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      327   1e-106   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       327   1e-106   
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                      327   1e-106   
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg                327   1e-106   
ref|XP_006662662.1|  PREDICTED: peroxidase 4-like                       327   1e-106   
ref|XP_009395400.1|  PREDICTED: peroxidase P7-like                      327   1e-106   
ref|XP_002461207.1|  hypothetical protein SORBIDRAFT_02g042840          327   1e-106   
gb|KDP25490.1|  hypothetical protein JCGZ_20646                         327   2e-106   
gb|AAP42508.1|  anionic peroxidase swpb3                                326   2e-106   
emb|CAN80096.1|  hypothetical protein VITISV_011205                     325   2e-106   
gb|AAR31108.1|  peroxidase precursor                                    327   2e-106   
gb|KHN48395.1|  Peroxidase 4                                            327   2e-106   
ref|XP_007215699.1|  hypothetical protein PRUPE_ppa008808mg             326   3e-106   
ref|XP_010246463.1|  PREDICTED: peroxidase P7-like                      326   3e-106   
ref|XP_009404514.1|  PREDICTED: peroxidase P7-like                      326   3e-106   
gb|ACU23223.1|  unknown                                                 327   3e-106   
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      326   3e-106   
ref|XP_009130879.1|  PREDICTED: peroxidase 52-like                      326   3e-106   
ref|XP_007048724.1|  Peroxidase superfamily protein                     326   3e-106   
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            326   3e-106   
gb|AIE12239.1|  peroxide                                                326   3e-106   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              326   3e-106   
ref|NP_001065971.1|  Os12g0112000                                       326   4e-106   
gb|ACU24215.1|  unknown                                                 326   4e-106   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              326   4e-106   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like              327   5e-106   
ref|XP_003577842.1|  PREDICTED: peroxidase 4                            326   5e-106   
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              325   5e-106   
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg                325   6e-106   
ref|XP_003551174.1|  PREDICTED: peroxidase 4-like                       325   6e-106   
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       325   6e-106   
ref|XP_009381205.1|  PREDICTED: peroxidase P7-like                      325   7e-106   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            325   7e-106   
dbj|BAK06463.1|  predicted protein                                      325   8e-106   
gb|KDP22789.1|  hypothetical protein JCGZ_00376                         325   8e-106   
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      325   8e-106   
tpe|CAH69372.1|  TPA: class III peroxidase 130 precursor                325   8e-106   
gb|ACJ11762.1|  class III peroxidase                                    325   8e-106   
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    325   9e-106   
ref|XP_011095107.1|  PREDICTED: cationic peroxidase 1-like              325   9e-106   
ref|XP_002319967.2|  hypothetical protein POPTR_0013s15240g             325   9e-106   
gb|AAB48184.1|  peroxidase precursor                                    325   1e-105   
gb|KHN48387.1|  Peroxidase 52                                           323   1e-105   
dbj|BAJ92357.1|  predicted protein                                      325   1e-105   
dbj|BAM05634.1|  peroxidase 2                                           325   1e-105   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       325   1e-105   
emb|CDX80957.1|  BnaC03g02110D                                          325   1e-105   
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like              325   1e-105   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              324   2e-105   
ref|XP_003577141.1|  PREDICTED: peroxidase 4-like                       325   2e-105   
ref|XP_011080818.1|  PREDICTED: uncharacterized protein LOC105163979    336   2e-105   
ref|XP_007033588.1|  Peroxidase superfamily protein                     325   2e-105   
ref|XP_010067582.1|  PREDICTED: peroxidase P7-like                      324   2e-105   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           324   2e-105   
gb|AII99880.1|  peroxidase                                              323   2e-105   
gb|KHG09190.1|  Peroxidase 4                                            324   2e-105   
gb|KGN45822.1|  hypothetical protein Csa_6G013940                       322   3e-105   
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg                323   3e-105   
gb|KFK43699.1|  hypothetical protein AALP_AA1G161500                    322   3e-105   
gb|EMT19349.1|  Peroxidase 70                                           323   3e-105   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       323   3e-105   
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           323   3e-105   
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like              323   3e-105   
ref|XP_008457311.1|  PREDICTED: cationic peroxidase 1-like              323   4e-105   
emb|CBI22007.3|  unnamed protein product                                327   4e-105   
gb|AAW52720.1|  peroxidase 6                                            323   5e-105   
dbj|BAM05635.1|  peroxidase 2                                           323   5e-105   
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       323   6e-105   
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like              323   6e-105   
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like              323   6e-105   
ref|XP_007017044.1|  Peroxidase 68                                      332   7e-105   
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        322   7e-105   
ref|XP_003571919.1|  PREDICTED: peroxidase 70-like                      322   7e-105   
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              322   8e-105   
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg                322   8e-105   
ref|XP_002453592.1|  hypothetical protein SORBIDRAFT_04g008630          322   8e-105   
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       322   9e-105   
ref|XP_003602463.1|  Peroxidase                                         322   9e-105   
gb|AAR31106.1|  peroxidase precursor                                    323   1e-104   
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                       322   1e-104   
ref|XP_011019031.1|  PREDICTED: peroxidase 2-like                       322   1e-104   
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                322   1e-104   
gb|EMS50650.1|  Peroxidase 70                                           322   1e-104   
gb|ACU23245.1|  unknown                                                 322   1e-104   
gb|EPS59568.1|  hypothetical protein M569_15235                         322   1e-104   
ref|NP_001046400.2|  Os02g0240100                                       322   2e-104   
gb|KEH29224.1|  class III peroxidase                                    322   2e-104   
emb|CAH10841.1|  peroxidase                                             322   2e-104   
ref|XP_008792262.1|  PREDICTED: peroxidase 4-like                       330   2e-104   
gb|KDP22790.1|  hypothetical protein JCGZ_00377                         322   2e-104   
gb|KHN33941.1|  Peroxidase 52                                           320   2e-104   
ref|XP_004514553.1|  PREDICTED: cationic peroxidase 1-like              322   2e-104   
ref|XP_004253400.1|  PREDICTED: peroxidase 70-like                      321   2e-104   
gb|KHN44724.1|  Peroxidase 4                                            321   3e-104   
ref|NP_001130666.1|  uncharacterized protein LOC100191769 precursor     321   3e-104   
ref|XP_003623567.1|  Peroxidase                                         321   3e-104   
ref|XP_007132831.1|  hypothetical protein PHAVU_011G128200g             321   3e-104   
gb|AFK41406.1|  unknown                                                 320   4e-104   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like              321   5e-104   
gb|EMT19350.1|  Peroxidase 70                                           320   5e-104   
ref|XP_008350978.1|  PREDICTED: LOW QUALITY PROTEIN: lignin-formi...    318   5e-104   
gb|KEH34419.1|  anionic peroxidase swpb3 protein                        320   5e-104   
emb|CAH10842.1|  peroxidase                                             320   5e-104   
ref|XP_011003588.1|  PREDICTED: peroxidase 2-like                       320   6e-104   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      320   6e-104   
gb|KHN27952.1|  Cationic peroxidase 1                                   320   6e-104   
emb|CDP13933.1|  unnamed protein product                                320   6e-104   
ref|XP_009388702.1|  PREDICTED: peroxidase P7-like                      325   7e-104   
ref|XP_003540408.1|  PREDICTED: cationic peroxidase 1                   320   7e-104   
gb|ACZ51443.1|  peroxidase protein                                      320   7e-104   
ref|XP_008385017.1|  PREDICTED: cationic peroxidase 1-like              320   8e-104   
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like              320   8e-104   
ref|XP_009402215.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    320   9e-104   
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like              320   9e-104   
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       320   1e-103   
dbj|BAM05637.1|  peroxidase 2                                           320   1e-103   
gb|AAL93151.1|AF485265_1  class III peroxidase                          319   1e-103   
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             320   1e-103   
ref|XP_003615995.1|  Peroxidase                                         319   1e-103   
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       319   1e-103   
gb|KDP21683.1|  hypothetical protein JCGZ_03354                         319   2e-103   
ref|NP_001046402.1|  Os02g0240500                                       319   2e-103   
ref|XP_002531320.1|  Cationic peroxidase 1 precursor, putative          319   2e-103   
ref|XP_007140134.1|  hypothetical protein PHAVU_008G086800g             319   2e-103   
ref|XP_004150606.1|  PREDICTED: peroxidase 4-like                       319   2e-103   
gb|EEC82680.1|  hypothetical protein OsI_27324                          319   2e-103   
ref|XP_010227239.1|  PREDICTED: peroxidase P7-like                      319   2e-103   
gb|AHL39144.1|  class III peroxidase                                    318   3e-103   
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like              318   3e-103   
ref|XP_010032327.1|  PREDICTED: peroxidase P7-like                      318   3e-103   
ref|XP_011080738.1|  PREDICTED: peroxidase 4-like                       318   4e-103   
ref|XP_007134676.1|  hypothetical protein PHAVU_010G066600g             319   4e-103   
dbj|BAJ90940.1|  predicted protein                                      318   4e-103   
gb|KHG25850.1|  Peroxidase 4                                            318   4e-103   
ref|XP_010915490.1|  PREDICTED: peroxidase P7-like                      318   5e-103   
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      318   5e-103   
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    319   6e-103   
ref|XP_003596719.1|  Peroxidase                                         318   6e-103   
ref|XP_009775239.1|  PREDICTED: cationic peroxidase 1-like              318   6e-103   
dbj|BAJ91992.1|  predicted protein                                      318   6e-103   
ref|XP_010261059.1|  PREDICTED: cationic peroxidase 1-like isofor...    317   6e-103   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             318   7e-103   
emb|CDY02817.1|  BnaC02g10720D                                          317   7e-103   
gb|AHL39188.1|  class III peroxidase                                    317   7e-103   
ref|XP_004510041.1|  PREDICTED: peroxidase 52-like                      317   7e-103   
dbj|BAC83101.1|  putative peroxidase precursor                          317   7e-103   
ref|XP_006365360.1|  PREDICTED: peroxidase 70-like                      317   8e-103   
ref|XP_002308244.1|  peroxidase family protein                          317   8e-103   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      317   8e-103   
emb|CDY32701.1|  BnaA02g07630D                                          317   9e-103   
ref|XP_010915492.1|  PREDICTED: peroxidase P7-like                      317   9e-103   
emb|CDY02820.1|  BnaC02g10690D                                          317   9e-103   
gb|EMT13502.1|  Peroxidase 70                                           317   9e-103   
gb|EAY85151.1|  hypothetical protein OsI_06506                          317   1e-102   
ref|XP_010256954.1|  PREDICTED: cationic peroxidase 1-like              317   1e-102   
emb|CBI15847.3|  unnamed protein product                                315   1e-102   
ref|XP_004491048.1|  PREDICTED: peroxidase 4-like                       317   1e-102   
ref|XP_009126754.1|  PREDICTED: peroxidase 67                           317   2e-102   
emb|CBI19219.3|  unnamed protein product                                321   2e-102   
gb|ADC42135.1|  lignin biosynthetic peroxidase                          316   2e-102   
ref|NP_001060629.1|  Os07g0677300                                       316   2e-102   
ref|NP_001060626.1|  Os07g0676900                                       317   2e-102   
dbj|BAA77389.1|  peroxidase 3                                           316   3e-102   
ref|XP_009419858.1|  PREDICTED: cationic peroxidase 1-like              316   3e-102   
ref|XP_007149728.1|  hypothetical protein PHAVU_005G094200g             316   3e-102   
ref|XP_003623564.1|  Peroxidase                                         315   3e-102   
gb|KDO49649.1|  hypothetical protein CISIN_1g021171mg                   315   4e-102   
ref|XP_002323055.2|  peroxidase family protein                          315   4e-102   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              316   4e-102   
ref|XP_008369411.1|  PREDICTED: peroxidase P7-like                      315   5e-102   
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like              315   5e-102   
gb|KHG17773.1|  Peroxidase 52 -like protein                             315   5e-102   



>ref|XP_011070596.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   426 bits (1096),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 236/284 (83%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++RQAVSRERRMAASL+RLHFHDCFVQGCDASILLD TP I+ EK A PN  
Sbjct  40    NALSTIRTSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPTIQSEKTAFPNVN  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+V+EAAKRE+E+ CPGVVSCADILT+AARDA V+ GGPSW V LGRRDST A  A
Sbjct  100   SARGYEVVEAAKREVERICPGVVSCADILTLAARDASVAVGGPSWNVKLGRRDSTTASRA  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +DLP P S LD LI+ F  KGLS RD+VALSGAHT+GQ QCFLFR RIY N TD+D 
Sbjct  160   LANSDLPGPSSSLDALISGFGNKGLSARDMVALSGAHTIGQAQCFLFRDRIYSNGTDIDA  219

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP Q  GD NL+PLDLVTP  FDNNY+KNLMQ+KGLLQSDQ LF+GG TDS
Sbjct  220   GFASTRRRQCP-QNSGDGNLAPLDLVTPNSFDNNYFKNLMQRKGLLQSDQVLFSGGSTDS  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P+ F +DF +AMIK+ EI+ L   +GIIR+VCSA+N
Sbjct  279   IVSEYSRTPQTFASDFANAMIKMGEIELLTGQNGIIRRVCSAIN  322



>ref|XP_011070600.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=304

 Score =   425 bits (1093),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 235/284 (83%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++RQAVSRERRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK A PN  
Sbjct  22    NALSTIRTSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDDTSTIQSEKSAGPNAN  81

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VIEAAKRE+E+ CPGVVSCADILT+AARDA V+ GGPSW V LGRRDST A  A
Sbjct  82    SARGFEVIEAAKREVERICPGVVSCADILTLAARDASVAVGGPSWTVRLGRRDSTTANRA  141

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A +DLP P+S LD LI++F  KGL  R++VALSGAHTLGQ QCFLFR RIY N TD+DP
Sbjct  142   QANSDLPGPFSTLDGLISSFTNKGLIAREMVALSGAHTLGQAQCFLFRARIYSNGTDIDP  201

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP Q  GD NL+PLDLVTP  FDNNY+KNL Q+KGLLQSDQ LF+GG TDS
Sbjct  202   GFASTRRRQCP-QTGGDSNLAPLDLVTPNSFDNNYFKNLQQRKGLLQSDQVLFSGGSTDS  260

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY +SP+ F  DF +AMIK+ EIQPL    GIIR+VC+A+N
Sbjct  261   IVSEYIRSPQTFARDFANAMIKMGEIQPLTGQSGIIRRVCNAIN  304



>ref|XP_011070595.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   424 bits (1090),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 236/284 (83%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++RQAVSRERRMAASL+RLHFHDCFVQGCDASILLD TP I+ EK A PN  
Sbjct  40    NALSTIRTSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPTIQSEKTAFPNVN  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+V+EAAK E+E+ CPGVVSCADILT+AARDA V+ GGPSW+V LGRRDST A  +
Sbjct  100   SARGYEVVEAAKLEVERICPGVVSCADILTLAARDASVAVGGPSWSVKLGRRDSTTASRS  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +DLP P S LD LI+ F  KGLS RD+VALSGAHT+GQ QCFLFR RIY N TD+D 
Sbjct  160   LANSDLPGPSSSLDALISGFGNKGLSARDMVALSGAHTIGQAQCFLFRDRIYSNGTDIDA  219

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP Q  GD NL+PLDLVTP  FDNNY+KNLMQ+KGLLQSDQ LF+GG TDS
Sbjct  220   GFASTRRRQCP-QNSGDANLAPLDLVTPNSFDNNYFKNLMQRKGLLQSDQVLFSGGSTDS  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P+ F +DF +AMIK+ EI+ L   +GIIR+VCSA+N
Sbjct  279   IVSEYSRTPQTFASDFANAMIKMGEIELLTGQNGIIRRVCSAIN  322



>ref|XP_011070599.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=321

 Score =   421 bits (1082),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 238/284 (84%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA  IIRT++R+A+SRERRMAASL+RLHFHDCFVQGCDASILLD TP I+ EK A PN  
Sbjct  40    NATAIIRTSIRRAISRERRMAASLIRLHFHDCFVQGCDASILLDETPTIQSEKTAFPNIN  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VIEAAKRE+E+ CPGVVSCAD+LT+AARDA V+ GGPSW V LGRRDST A  +
Sbjct  100   SARGYEVIEAAKREVERVCPGVVSCADVLTLAARDASVAVGGPSWNVKLGRRDSTTASRS  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A TDLPSP++ LDTLI+AFA KGLS RD+VALSGAHT+GQ QCFLFR RIY N TD+D 
Sbjct  160   QANTDLPSPFAGLDTLISAFANKGLSARDMVALSGAHTIGQAQCFLFRGRIYSNGTDIDA  219

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP Q  GD NL+ LDLVTP  FDNNY+KNLMQ+KGLLQSDQ LF+GG TDS
Sbjct  220   GFASTRRRQCP-QNGGDGNLAALDLVTPNSFDNNYFKNLMQRKGLLQSDQVLFSGGSTDS  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P  F +DF +AMIK+ EI P    +GIIR+VCSA+N
Sbjct  279   IVSEYSRNPRIFASDFANAMIKMGEIPP-SQQNGIIRRVCSAIN  321



>ref|XP_009608056.1| PREDICTED: lignin-forming anionic peroxidase [Nicotiana tomentosiformis]
Length=319

 Score =   417 bits (1071),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 232/284 (82%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NALN IRT++RQA+S ERRMAASL+RLHFHDCFVQGCDASILLD TP IE EK ALPN  
Sbjct  37    NALNTIRTSIRQAISNERRMAASLIRLHFHDCFVQGCDASILLDETPSIESEKTALPNLG  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+ +IE AKRE+EK CP VVSCADILTVAARDA  + GGPSW V LGRRDST A   
Sbjct  97    SARGFGIIEDAKREVEKICPEVVSCADILTVAARDASAAVGGPSWTVKLGRRDSTTASKT  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A TDLP P+  L+ LI++FA KGLS RD+VALSGAHT+GQ QCFLFR RIY N TD+D 
Sbjct  157   LAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHTIGQAQCFLFRDRIYGNGTDIDA  216

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TRKRQCP Q+  + NL+PLDLVTP  FDNNY+KNL+QKKGLLQSDQ LFNGG TD+
Sbjct  217   GFASTRKRQCP-QEGENGNLAPLDLVTPNQFDNNYFKNLIQKKGLLQSDQVLFNGGSTDN  275

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+ SP AF++DF +AMIK+ +I PL   +GIIRKVC +VN
Sbjct  276   IVSEYSNSPRAFSSDFAAAMIKMGDISPLTGQNGIIRKVCGSVN  319



>ref|NP_001289531.1| lignin-forming anionic peroxidase precursor [Nicotiana sylvestris]
 sp|Q02200.1|PERX_NICSY RecName: Full=Lignin-forming anionic peroxidase; Flags: Precursor 
[Nicotiana sylvestris]
 gb|AAA34050.1| anionic peroxidase [Nicotiana sylvestris]
Length=322

 Score =   416 bits (1069),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 232/284 (82%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NALN IRT+VRQA+S ERRMAASL+RLHFHDCFVQGCDASILLD TP IE EK ALPN  
Sbjct  40    NALNTIRTSVRQAISSERRMAASLIRLHFHDCFVQGCDASILLDETPSIESEKTALPNLG  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+ +IE AKRE+EK CPGVVSCADILTVAARDA  + GGPSW V LGRRDST A   
Sbjct  100   SARGFGIIEDAKREVEKICPGVVSCADILTVAARDASAAVGGPSWTVKLGRRDSTTASKT  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A TDLP P+  L+ LI++FA KGLS RD+VALSGAHT+GQ QCFLFR RIY N TD+D 
Sbjct  160   LAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHTIGQAQCFLFRDRIYSNGTDIDA  219

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP Q+  + NL+PLDLVTP  FDNNY+KNL+QKKGLLQSDQ LFNGG TD+
Sbjct  220   GFASTRRRQCP-QEGENGNLAPLDLVTPNQFDNNYFKNLIQKKGLLQSDQVLFNGGSTDN  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+ S  AF++DF +AMIK+ +I PL   +GIIRKVC +VN
Sbjct  279   IVSEYSNSARAFSSDFAAAMIKMGDISPLSGQNGIIRKVCGSVN  322



>ref|XP_011070598.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   413 bits (1061),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 233/284 (82%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA  IIRT++++AVS ERRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK A PN  
Sbjct  40    NATAIIRTSIQRAVSLERRMAASLIRLHFHDCFVQGCDASILLDETSTIQSEKTAFPNVN  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY VIEAAKRE+E+ CPGVVSCADILT+AA DA V+ GGPSW V LGRRDST A  +
Sbjct  100   SVRGYQVIEAAKREVERVCPGVVSCADILTLAALDASVAVGGPSWNVRLGRRDSTTASRS  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRI-YNHTDVDP  513
             +A TDLPSP++ LD LI++FA KGLS RD+VALSGAHT+GQ QCFLFR RI  N TD+D 
Sbjct  160   QANTDLPSPFAGLDALISSFANKGLSARDMVALSGAHTIGQAQCFLFRSRINSNGTDIDA  219

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+ R+RQCP Q  GD NL+PLDLVTP  FDNNY+KNLMQ++GLLQSDQ LF+GG TDS
Sbjct  220   RFASIRRRQCP-QSGGDANLAPLDLVTPNSFDNNYFKNLMQRRGLLQSDQILFSGGSTDS  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P  F +DF +AMIK+ EIQPL+  +GIIR+ CSAVN
Sbjct  279   IVSEYSRNPRVFASDFGNAMIKMGEIQPLVGRNGIIRRTCSAVN  322



>ref|XP_011070597.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   412 bits (1060),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 233/284 (82%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA  IIR ++ +A+SRERRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK A PN  
Sbjct  40    NATAIIRASILRAISRERRMAASLIRLHFHDCFVQGCDASILLDETSTIQSEKTAFPNVN  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY VIEAAKRE+E+ CPGVVSCADILT+AARDA V+ GGPSW V LGRRDST A  +
Sbjct  100   SVRGYQVIEAAKREVERVCPGVVSCADILTLAARDASVAVGGPSWNVKLGRRDSTTASRS  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRI-YNHTDVDP  513
             +A TDLPSP++ +D LI++FA KGLS RD+VALSGAHT+GQ QCFLFR RI  N TD+D 
Sbjct  160   QANTDLPSPFAGVDALISSFANKGLSARDMVALSGAHTIGQAQCFLFRSRINSNGTDIDA  219

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+ R+RQCP Q  GD NL+PLDLVTP  FDNNY+KNLMQ+KGLLQSDQ LF+GG TDS
Sbjct  220   RFASIRRRQCP-QTGGDANLAPLDLVTPNSFDNNYFKNLMQRKGLLQSDQVLFSGGSTDS  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P  F +DF +AMIK+ EIQPL+  +GIIR+ CSA+N
Sbjct  279   IVSEYSRNPRVFASDFGNAMIKMGEIQPLVRRNGIIRRTCSAIN  322



>ref|XP_009620122.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
tomentosiformis]
Length=324

 Score =   407 bits (1047),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 229/284 (81%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NALN IRT+VRQAVSRERRMAASL+RLHFHDCFVQGCDASILLD TP I  EK ALPN  
Sbjct  42    NALNTIRTSVRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPTIVSEKTALPNLG  101

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY +IE AKRE+EK+CPG+VSCADIL VAARDA    GGP+WAV LGRRDST A H 
Sbjct  102   SARGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPTWAVKLGRRDSTTASHT  161

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A TDLP P+  L+ LI++FA KGLS RD+VALSGAH++GQ QCFLFR RIY N TD+D 
Sbjct  162   LAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHSIGQAQCFLFRDRIYGNGTDIDA  221

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP++   + NL+PLDLVTP   DNNY+KNL Q+KGLLQSDQ L +GG TDS
Sbjct  222   GFASTRRRQCPKED-QNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+ SP AF +DF +AMI++ +I P+   +GIIR VC ++N
Sbjct  281   IVSEYSNSPRAFASDFAAAMIRMGDISPITGQNGIIRTVCGSLN  324



>ref|XP_009801852.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
 ref|XP_009801853.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
Length=324

 Score =   407 bits (1045),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 228/284 (80%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NALN IRT+VRQAVSRERRMAASL+RLHFHDCFVQGCDASILLD TP I  EK ALPN  
Sbjct  42    NALNTIRTSVRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPTIVSEKTALPNLG  101

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY +IE AKRE+EK+CPG+VSCADIL VAARDA    GGP+WAV LGRRDST A H 
Sbjct  102   SARGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPTWAVKLGRRDSTTASHT  161

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A TDLP P+  L+ LI++FA KGLS RD+VALSGAH++GQ QCFLFR RIY N TD+D 
Sbjct  162   LAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHSIGQAQCFLFRDRIYGNGTDIDA  221

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP++   + NL+PLDLVTP   DNNY+KNL Q+KGLLQSDQ L +GG TD 
Sbjct  222   GFASTRRRQCPKED-QNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDD  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+ SP AF +DF +AMI++ +I PL   +GIIR VC ++N
Sbjct  281   IVSEYSNSPRAFASDFAAAMIRMGDISPLTGQNGIIRTVCGSLN  324



>emb|CDP16309.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/284 (68%), Positives = 231/284 (81%), Gaps = 2/284 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRT++R+AVSRERRMAASL+RLHFHDCFVQGCD S+LLD T  I+ EK AL NN S
Sbjct  39    ALDTIRTSIRRAVSRERRMAASLIRLHFHDCFVQGCDGSVLLDQTSTIQSEKTALANNNS  98

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARG++VIEAAK E+EK CPGVVSCADIL+VAARDA V+ GGP+W V LGRRDST A  + 
Sbjct  99    ARGFEVIEAAKLEVEKICPGVVSCADILSVAARDASVAVGGPTWQVKLGRRDSTTASRSA  158

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A ++LPSP+++L  LIT F  KGLS RD+VALSG+HT+GQ QCF+FR R+Y N TD+D  
Sbjct  159   ADSNLPSPFANLGDLITKFQNKGLSPRDMVALSGSHTIGQAQCFVFRNRVYSNGTDIDAG  218

Query  509   FANTRKRQCPEQ-QIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+RQCP     GD NL+PLDLVTP  FDNNY+KNLM+KKGLL SDQ LF+GG TDS
Sbjct  219   FASTRRRQCPSAIGNGDSNLAPLDLVTPNSFDNNYFKNLMRKKGLLISDQVLFSGGSTDS  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV+EY+++P  F  DF SAM+K+ +I+PL    GIIRKVCSAVN
Sbjct  279   IVAEYSRNPGTFLADFASAMVKMGDIEPLTGTSGIIRKVCSAVN  322



>gb|AAY89058.1| class III peroxidase [Orobanche ramosa]
Length=325

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 234/284 (82%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++R+AV+ ERRMAASL+RLHFHDCFVQGCDASILLD +P I+ EK A PN  
Sbjct  43    NALSTIRTSIRRAVAAERRMAASLIRLHFHDCFVQGCDASILLDDSPTIQSEKSAGPNVN  102

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGYDVIE AKRE+E  CP  VSCADI+ +AARDA V+ GGP+W V LGRRDST A   
Sbjct  103   SVRGYDVIETAKREVESICPRNVSCADIVALAARDASVAVGGPTWTVKLGRRDSTTANPN  162

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A TDLPSP++ L TLITAF  KGLS+ D+VALSG+HT+GQ++CFLFR RIY N TD+DP
Sbjct  163   EANTDLPSPFASLQTLITAFDDKGLSETDMVALSGSHTIGQSRCFLFRSRIYSNGTDIDP  222

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             +FA+TR+RQCP Q  GD NL+PLDLVTP  FDNNY++NL+Q+KGLL+SDQ LFNGG T++
Sbjct  223   NFASTRRRQCP-QTGGDNNLAPLDLVTPNSFDNNYFRNLIQRKGLLESDQVLFNGGSTNA  281

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +V+ Y+ +P  F TDF SAM+++SEIQPL+  +GIIR+VC+ +N
Sbjct  282   LVTSYSNNPRLFATDFASAMVRMSEIQPLLGSNGIIRRVCNVIN  325



>ref|XP_006351920.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=320

 Score =   402 bits (1033),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 224/283 (79%), Gaps = 2/283 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  IRT++RQAVS ERRMAASL+RLHFHDCFVQGCDASILLD TP I  EK ALPN  S
Sbjct  39    ALTTIRTSIRQAVSSERRMAASLIRLHFHDCFVQGCDASILLDETPTIVSEKTALPNLGS  98

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY +IE AKRE+EK+CPG+VSCADIL VAARDA    GGPSW V LGRRDST A H  
Sbjct  99    ARGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPSWTVKLGRRDSTTASHTL  158

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A TDLP P+  LD +I+ FA KGLS +D+VALSGAH++GQ QCFLFR RIY N TD+D  
Sbjct  159   AETDLPGPFDPLDRIISGFANKGLSTKDMVALSGAHSIGQAQCFLFRDRIYSNGTDIDAG  218

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TR+RQCP Q+  + NL+PLDLVTP   DNNYYKNL+Q+KGLLQSDQ L +GG TDSI
Sbjct  219   FASTRRRQCP-QEDQNGNLAPLDLVTPNQLDNNYYKNLIQRKGLLQSDQVLLSGGSTDSI  277

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+EY+ +P  F +DF +AMIK+ +I PL   +GIIR VC A+N
Sbjct  278   VTEYSNNPRTFASDFAAAMIKMGDISPLTGQNGIIRTVCGAIN  320



>ref|XP_004250402.1| PREDICTED: lignin-forming anionic peroxidase [Solanum lycopersicum]
Length=320

 Score =   402 bits (1033),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 222/284 (78%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
              AL  IRT++RQAVS ERRMAASL+RLHFHDCFVQGCDASILLD TP I  EK ALPN  
Sbjct  38    TALTTIRTSIRQAVSSERRMAASLIRLHFHDCFVQGCDASILLDETPTIVSEKTALPNLG  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY +IE AKRE+EK+CPG+VSCADIL VAARDA    GGPSW V LGRRDS  A H 
Sbjct  98    SARGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPSWTVKLGRRDSATASHT  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A TDLP P+  LD LI+ FA KGLS RD+VALSG+H++GQ QCFLFR RIY N TD+D 
Sbjct  158   LAETDLPGPFDPLDRLISGFANKGLSTRDMVALSGSHSIGQAQCFLFRDRIYSNGTDIDA  217

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP Q+  + NL+PLDLVTP   DNNYYKNL+Q+KGLLQSDQ L +GG TDS
Sbjct  218   GFASTRRRQCP-QEDQNGNLAPLDLVTPNQLDNNYYKNLIQRKGLLQSDQVLLSGGSTDS  276

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV+EY+ SP  F  DF +AMIK+ +I PL   +GIIR VC A+N
Sbjct  277   IVTEYSNSPRVFAADFAAAMIKMGDISPLTGQNGIIRTVCGAIN  320



>emb|CDP08160.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   401 bits (1030),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 231/284 (81%), Gaps = 2/284 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IR+++R+AVSRERRMAASL+RLHFHDCFVQGCD S+LLD+T   + EK A  N  S
Sbjct  40    ALSTIRSSIRRAVSRERRMAASLIRLHFHDCFVQGCDGSVLLDATSSFQSEKTAPANRNS  99

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VIEAAKRE+EK CPGVVSCADIL+VAARDA V+ GGP+W V LGRRDST A  + 
Sbjct  100   VRGFEVIEAAKREVEKICPGVVSCADILSVAARDASVAVGGPTWQVKLGRRDSTTASFSL  159

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A TDLPSP++ L  LI+ FA KGLS R++VALSG+HT+GQ QCF+FR RIY N TD+D  
Sbjct  160   AQTDLPSPFASLSDLISKFAAKGLSAREMVALSGSHTIGQAQCFVFRNRIYSNGTDIDAG  219

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+RQCP    +GD  L+PLDLVTP  FDNNY+KNLM+KKGLL SDQ LF+GG TDS
Sbjct  220   FASTRRRQCPAANGVGDSKLAPLDLVTPNSFDNNYFKNLMRKKGLLISDQVLFSGGSTDS  279

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+K+P  F +DF SAM+K+ +I+PL   +GIIRK+CSAVN
Sbjct  280   IVSEYSKNPRTFLSDFASAMVKMGDIEPLTGQNGIIRKICSAVN  323



>gb|EYU30095.1| hypothetical protein MIMGU_mgv1a021792mg [Erythranthe guttata]
Length=320

 Score =   399 bits (1025),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 231/284 (81%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA  IIR ++R+AVSRERRMAASL+RLHFHDCFVQGCDASILLD TP I+ EK A PN  
Sbjct  39    NAATIIRNSIRRAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPSIQSEKTAFPNIN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VIEAAK E+E++CPGVVSCAD+LT+AARDA V+ GGPSW+V LGRRDST A  +
Sbjct  99    SARGYEVIEAAKAEVERACPGVVSCADVLTLAARDASVAVGGPSWSVRLGRRDSTTASRS  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A  DLPSP+  LD LI+AF  KGL+ RD+VALSGAHTLGQ QCFLFR RIY N TD+D 
Sbjct  159   QANIDLPSPFVGLDALISAFDIKGLNARDMVALSGAHTLGQAQCFLFRGRIYSNGTDIDA  218

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             +FA  ++R+CP Q  GD NL+ LDLVTP  FDNNYY+N++Q+KGLLQ+DQ L +G  T +
Sbjct  219   NFAKEKRRRCP-QTGGDSNLAALDLVTPNSFDNNYYRNIVQRKGLLQTDQILLSGS-TSA  276

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV++Y+++P  F  DF  AMIK+SEIQPL+   GIIR+VCSA+N
Sbjct  277   IVTDYSRNPRTFAADFARAMIKMSEIQPLVGQAGIIRRVCSAIN  320



>gb|EYU30092.1| hypothetical protein MIMGU_mgv1a010078mg [Erythranthe guttata]
Length=323

 Score =   399 bits (1024),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/283 (66%), Positives = 233/283 (82%), Gaps = 3/283 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             A+ IIR ++RQAVSRERRMAASL+RLHFHDCFVQGCDASILLD TP I+ EK A+PN  S
Sbjct  43    AVTIIRNSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPTIQSEKTAIPNVNS  102

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY+VIEAAK  +E++CPGVVSCAD+LT+AAR+A V+  GPSW V LGRRDST A  A+
Sbjct  103   ARGYEVIEAAKLLVERACPGVVSCADVLTLAAREASVAVSGPSWTVRLGRRDSTTANRAQ  162

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A +DLPSP++ L+ LI++FA KGL+ R++VALSG+HTLGQ QCFLFR R+Y N TD+DP+
Sbjct  163   ANSDLPSPFAGLNGLISSFANKGLNTREMVALSGSHTLGQAQCFLFRARVYSNGTDIDPN  222

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+ R+R CP Q  G+ NL+PLDLVTP  FDNNY++N++ ++GLLQSDQ L  G  T SI
Sbjct  223   FASERRRGCP-QTGGNANLAPLDLVTPNSFDNNYFRNIVLRRGLLQSDQILLTGATT-SI  280

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+EY+ +P  F+TDF +AMIK+SEI PL+   GIIR+VCSA+N
Sbjct  281   VTEYSTNPRTFSTDFANAMIKMSEISPLLGSAGIIRRVCSAIN  323



>ref|XP_006361366.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=319

 Score =   398 bits (1023),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 222/284 (78%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRT++RQA+SRERRMAASL+RLHFHDCFVQGCDAS+LLD TP I  EK ALPN  
Sbjct  37    NALTTIRTSIRQAISRERRMAASLIRLHFHDCFVQGCDASLLLDETPTIVSEKTALPNLG  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+ +IE AKRE+EK+CPG+VSCADIL VAARDA    GGPSW V LGRRDST A H 
Sbjct  97    SVRGFGIIEDAKREVEKTCPGIVSCADILAVAARDASTLVGGPSWTVKLGRRDSTTASHT  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A TDLP P+  L  LI+ FA KGLS RD+VALSG+H++GQ QCFLFR RIY N TD+D 
Sbjct  157   LAETDLPGPFDPLSRLISGFANKGLSTRDMVALSGSHSIGQAQCFLFRDRIYGNGTDIDA  216

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP Q+  + NL+PLDLVTP   DNNY+KNL Q+KGLLQSDQ L +GG TD 
Sbjct  217   GFASTRRRQCP-QEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDD  275

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV EY+ SP AF +DF +AMIK+ +I PL   +GIIR VC A+N
Sbjct  276   IVLEYSNSPRAFASDFAAAMIKMGDISPLTGQNGIIRTVCGAIN  319



>gb|ABF48527.1| cell wall peroxidase [Capsicum annuum]
 gb|ABG73021.1| cell wall peroxidase [Capsicum annuum]
Length=322

 Score =   397 bits (1021),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/284 (68%), Positives = 222/284 (78%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NALN IR +VRQAVS ERRMAASL+RLHFHDCFVQGCDASILLD TP I  EK ALPN  
Sbjct  40    NALNTIRKSVRQAVSAERRMAASLIRLHFHDCFVQGCDASILLDETPTIVSEKTALPNLG  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY +IE AKRE+EK+CPG+VSCADIL VAARDA    GGPSW V LGRRDST A H 
Sbjct  100   SVRGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPSWTVKLGRRDSTTASHT  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A TDLP P+  L  LI+ FAKKGLS RD+VALSG+H++GQ QCFLFR RIY N TD+D 
Sbjct  160   LAETDLPGPFDPLTRLISGFAKKGLSTRDMVALSGSHSIGQAQCFLFRDRIYSNGTDIDA  219

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+R+CP Q+  + NL+PLDLVTP   DNNY+KNL Q+KGLLQSDQ L +GG TD 
Sbjct  220   GFASTRRRRCP-QEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDD  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV EY+ SP AF +DF +AMI++ +I PL   +GIIR VC A+N
Sbjct  279   IVLEYSNSPRAFASDFAAAMIRMGDISPLTGSNGIIRTVCGAIN  322



>ref|XP_009781728.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
Length=313

 Score =   394 bits (1013),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 225/282 (80%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ I+ AV QAVSRERRMAASL+RLHFHDCFVQGCDASILLD T  I  EK A+PN  S
Sbjct  33    ALSTIQKAVSQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETSNITSEKTAVPNQGS  92

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG+DV+EAAKRE+EK CPGVVSCADILTVAARDA V+  GPSW V LGRRDS  A    
Sbjct  93    VRGFDVVEAAKRELEKICPGVVSCADILTVAARDASVAVCGPSWKVKLGRRDSRTANRTL  152

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  D+PSP+ +LDTLI+ FAKKGLS +D+V LSGAHT+GQ+QC  FR RIYN +D+D  F
Sbjct  153   ANIDIPSPFDNLDTLISRFAKKGLSAKDMVVLSGAHTIGQSQCSSFRNRIYNASDIDASF  212

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A+  +RQCP+   G+  L+PLDLVT  +FDNNY+KNLMQKKGLLQSDQ LF+GG+TDSIV
Sbjct  213   ASITRRQCPKNG-GNGTLAPLDLVTDKIFDNNYFKNLMQKKGLLQSDQVLFSGGLTDSIV  271

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             S+Y+K+   F  DF  AMIK+++IQPL   +GIIR+VC+ VN
Sbjct  272   SKYSKNNSVFFVDFAKAMIKMADIQPLTGRNGIIRRVCNTVN  313



>ref|XP_006351919.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=319

 Score =   394 bits (1011),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 221/284 (78%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRT++RQA+S ERRMAASL+RLHFHDCFVQGCDAS+LLD TP I  EK ALPN  
Sbjct  37    NALTTIRTSIRQAISSERRMAASLIRLHFHDCFVQGCDASLLLDETPTIVSEKTALPNLG  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+ +IE AKRE+EK+CPGVVSCADIL VAARDA    GGPSW V LGRRDST A H 
Sbjct  97    SVRGFGIIEDAKREVEKTCPGVVSCADILAVAARDASSLVGGPSWTVKLGRRDSTTASHT  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A TDLP P+  L  LI+ FA KGLS RD+VALSG+H++GQ QCFLFR RIY N TD+D 
Sbjct  157   LAETDLPGPFDPLSRLISGFANKGLSTRDMVALSGSHSIGQAQCFLFRDRIYGNGTDIDA  216

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+R+CP Q+  + NL+PLDLVTP   DNNY+KNL Q+KGLLQSDQ L +GG TD 
Sbjct  217   GFASTRRRRCP-QEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDD  275

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV EY+ SP AF +DF +AMIK+ +I PL   +GIIR VC A+N
Sbjct  276   IVLEYSNSPRAFASDFAAAMIKMGDISPLTGQNGIIRTVCGAIN  319



>ref|XP_010270788.1| PREDICTED: lignin-forming anionic peroxidase-like [Nelumbo nucifera]
Length=325

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 221/284 (78%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +ALN IRT +R AVS ERRMAASL+RLHFHDCFVQGCDASILLD +  I  EK+ALPN  
Sbjct  42    SALNTIRTVIRSAVSTERRMAASLIRLHFHDCFVQGCDASILLDDSSSIRSEKNALPNQN  101

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY VI+ AK ++E  CPGVVSCADIL VAARDA ++ GGPSW V LGRRDST A   
Sbjct  102   SARGYQVIDRAKSQVESICPGVVSCADILAVAARDASIAVGGPSWTVKLGRRDSTTASPD  161

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +DLPS  + LDTLI  FAKKGLS RD+VALSG+HT+GQ  C  FR RIY N +D+D 
Sbjct  162   LANSDLPSFTASLDTLIGQFAKKGLSARDMVALSGSHTIGQASCLTFRGRIYDNSSDIDA  221

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TRKR+CP    GD NL+PLDLVTP  FDNNY+KNL+Q+KGLL SDQ LF+GG TDS
Sbjct  222   GFASTRKRRCPTDASGDGNLAPLDLVTPNSFDNNYFKNLIQRKGLLHSDQVLFSGGSTDS  281

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV+EY+KSP  F +DF SAMIK+ +I PL    G IR++CSAVN
Sbjct  282   IVTEYSKSPNTFKSDFASAMIKMGDINPLTGSLGEIRRLCSAVN  325



>gb|EYU30094.1| hypothetical protein MIMGU_mgv1a0094071mg, partial [Erythranthe 
guttata]
Length=326

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 186/281 (66%), Positives = 228/281 (81%), Gaps = 3/281 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA NIIR ++R+A+SRERRMAASL+RLHFHDCFVQGCDASILLD TP I+ EK A PN  
Sbjct  39    NAANIIRNSIRRAISRERRMAASLIRLHFHDCFVQGCDASILLDETPSIQSEKTAFPNIN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VIEAAK E+E++CPGVVSCAD+LT+AARDA V+ GGPSW+V LGRRDST A  +
Sbjct  99    SARGYEVIEAAKAEVERACPGVVSCADVLTLAARDASVAVGGPSWSVRLGRRDSTTASRS  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A  DLPSP+  LD LI+AF  KGL+ RD+VALSGAHTLGQ QCFLFR RIY N TD+D 
Sbjct  159   QANIDLPSPFVGLDALISAFDIKGLTARDMVALSGAHTLGQAQCFLFRGRIYSNGTDIDA  218

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             +FA  ++R+CP Q  GD NL+ LDLVTP  FDNNYY+N++Q+KGLLQ+DQ L +G  T +
Sbjct  219   NFAKEKRRRCP-QTGGDSNLAALDLVTPNSFDNNYYRNIVQRKGLLQTDQILLSGS-TSA  276

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCS  210
             IV++Y+++P  F  DF  AMIK+SEIQPL+   GIIR+V +
Sbjct  277   IVTDYSRNPRTFAADFARAMIKMSEIQPLVGQAGIIRRVAA  317



>ref|XP_009603345.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
tomentosiformis]
Length=322

 Score =   390 bits (1002),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/282 (66%), Positives = 223/282 (79%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ I+  V +AVSRERRMAASL+RLHFHDCFVQGCDASILLD    I  EK A+PN  S
Sbjct  42    ALSTIQKVVSRAVSRERRMAASLIRLHFHDCFVQGCDASILLDEASNITSEKTAIPNQGS  101

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG+DV+E AKRE+EK CPGVVSCADILTVAARDA ++  GPSW V LGRRDSTMA    
Sbjct  102   VRGFDVVETAKRELEKICPGVVSCADILTVAARDASIAVCGPSWKVKLGRRDSTMANRTL  161

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  D+P P+ +LDTLI+ FAKKGLS +++VALSGAHT+GQ+QC  FR RIYN +D+D  F
Sbjct  162   ANIDIPRPFDNLDTLISRFAKKGLSAKEMVALSGAHTIGQSQCSSFRNRIYNASDIDASF  221

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A+ R+RQCP    G+  L+PLDLVT   FDNNY+KNLMQKKGLLQSDQ LF+GG+ DSIV
Sbjct  222   ASIRRRQCPRNG-GNGTLAPLDLVTDKKFDNNYFKNLMQKKGLLQSDQVLFSGGLIDSIV  280

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             S+Y+K+  AF  DF  AM+K+++IQPL   +GIIR+VC+ VN
Sbjct  281   SKYSKTNSAFLADFAKAMVKMADIQPLTGRNGIIRRVCNNVN  322



>ref|XP_010030093.1| PREDICTED: lignin-forming anionic peroxidase-like [Eucalyptus 
grandis]
Length=306

 Score =   389 bits (999),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 187/284 (66%), Positives = 224/284 (79%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRT++R AVSRERRMAASL+RLHFHDCFVQGCDASILL+++P I  E+DA PN  
Sbjct  24    NALAAIRTSIRTAVSRERRMAASLIRLHFHDCFVQGCDASILLENSPTISSERDAGPNRG  83

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY+VI+ AK E+EK CPGVVSCADI+ VAARDA V+ G PSW V LGRRDST A  +
Sbjct  84    SVRGYEVIDDAKSEVEKICPGVVSCADIVAVAARDASVAVGSPSWTVKLGRRDSTTASPS  143

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +DLPS    L+ L++ FA KGLS RD+VALSGAHTLGQ QCF FR RIY N +++D 
Sbjct  144   LASSDLPSFQDGLERLVSRFAGKGLSARDMVALSGAHTLGQAQCFTFRDRIYSNGSNIDT  203

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TRKR+CP    GD  L+PLDLVTP  FDNNY+KNLMQKKGLL+SDQ LF+GG TDS
Sbjct  204   GFASTRKRRCPASG-GDATLAPLDLVTPNSFDNNYFKNLMQKKGLLESDQVLFSGGSTDS  262

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVS+Y+K P +F +DF +AMIK+ +I PL    G IR++CSA+N
Sbjct  263   IVSDYSKKPASFKSDFAAAMIKMGDISPLTGSSGQIRRICSALN  306



>ref|XP_010270786.1| PREDICTED: lignin-forming anionic peroxidase-like isoform X1 
[Nelumbo nucifera]
Length=315

 Score =   389 bits (999),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 221/283 (78%), Gaps = 1/283 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             ALN IRT +R AVS ERRMAASL+RLHFHDCFVQGCDASILLD +  I  EK+ALPN  S
Sbjct  33    ALNTIRTVIRSAVSAERRMAASLIRLHFHDCFVQGCDASILLDDSSSIRSEKNALPNQNS  92

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY VI+ AK ++E  CPGVVSCADIL VAARDA V+ GGPSW V LGR+DST A    
Sbjct  93    ARGYQVIDRAKAQVESICPGVVSCADILAVAARDASVAVGGPSWTVKLGRKDSTTASPDL  152

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A +DLPS  + LDTLI  FAKKGLS RD+VALSG+HT+GQ +C  FR RIY N +D+D  
Sbjct  153   ANSDLPSFTASLDTLIDRFAKKGLSARDMVALSGSHTIGQARCLAFRGRIYDNSSDIDAG  212

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TR+R+CP    GD NL+PLDLVTP  FDNNY+KNL+Q+KGLL SDQ LF+GG TDSI
Sbjct  213   FASTRRRRCPTDASGDGNLAPLDLVTPNSFDNNYFKNLIQRKGLLHSDQVLFSGGSTDSI  272

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+EY+K+P  F +DF SAMIK+ +I PL    G IR++CSAVN
Sbjct  273   VTEYSKNPNTFKSDFASAMIKMGDINPLTGSLGEIRRLCSAVN  315



>ref|XP_010270787.1| PREDICTED: lignin-forming anionic peroxidase-like isoform X2 
[Nelumbo nucifera]
Length=312

 Score =   389 bits (998),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 221/283 (78%), Gaps = 1/283 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             ALN IRT +R AVS ERRMAASL+RLHFHDCFVQGCDASILLD +  I  EK+ALPN  S
Sbjct  30    ALNTIRTVIRSAVSAERRMAASLIRLHFHDCFVQGCDASILLDDSSSIRSEKNALPNQNS  89

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY VI+ AK ++E  CPGVVSCADIL VAARDA V+ GGPSW V LGR+DST A    
Sbjct  90    ARGYQVIDRAKAQVESICPGVVSCADILAVAARDASVAVGGPSWTVKLGRKDSTTASPDL  149

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A +DLPS  + LDTLI  FAKKGLS RD+VALSG+HT+GQ +C  FR RIY N +D+D  
Sbjct  150   ANSDLPSFTASLDTLIDRFAKKGLSARDMVALSGSHTIGQARCLAFRGRIYDNSSDIDAG  209

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TR+R+CP    GD NL+PLDLVTP  FDNNY+KNL+Q+KGLL SDQ LF+GG TDSI
Sbjct  210   FASTRRRRCPTDASGDGNLAPLDLVTPNSFDNNYFKNLIQRKGLLHSDQVLFSGGSTDSI  269

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+EY+K+P  F +DF SAMIK+ +I PL    G IR++CSAVN
Sbjct  270   VTEYSKNPNTFKSDFASAMIKMGDINPLTGSLGEIRRLCSAVN  312



>ref|XP_007045348.1| Lignin-forming anionic peroxidase [Theobroma cacao]
 gb|EOY01180.1| Lignin-forming anionic peroxidase [Theobroma cacao]
Length=327

 Score =   389 bits (999),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 184/284 (65%), Positives = 221/284 (78%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRTA+R A++RERRMAASL+RLHFHDCFVQGCDASILLD++P I  EK  + NN 
Sbjct  44    NALRTIRTAIRSAIARERRMAASLIRLHFHDCFVQGCDASILLDNSPSITSEKFVIQNNN  103

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK  +E  CPGVVSCADIL VAARDA    GGPSW V LGRRDST A  +
Sbjct  104   SARGYEVIDQAKSAVENVCPGVVSCADILAVAARDASEYVGGPSWTVKLGRRDSTTASPS  163

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A  DLP     L++L++ F  KGLS RD+VALSG+HT+GQ QC  FR RIY N +D+D 
Sbjct  164   LASRDLPRFTDSLESLLSLFGTKGLSARDMVALSGSHTIGQAQCVTFRDRIYSNGSDIDA  223

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+R CP    G+ NL+PLDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG TDS
Sbjct  224   GFASTRRRNCPTTANGNGNLAPLDLVTPNSFDNNYFKNLLQKKGLLQSDQVLFSGGSTDS  283

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P  F++DF SAMIK+ +I+PL    GIIR++CSAVN
Sbjct  284   IVSEYSRTPSTFSSDFASAMIKMGDIEPLTGSSGIIRRICSAVN  327



>ref|XP_006378808.1| hypothetical protein POPTR_0010s24340g [Populus trichocarpa]
 ref|XP_006387937.1| Peroxidase 5 precursor family protein [Populus trichocarpa]
 gb|ERP46851.1| Peroxidase 5 precursor family protein [Populus trichocarpa]
 gb|ERP56605.1| hypothetical protein POPTR_0010s24340g [Populus trichocarpa]
 gb|AHL39167.1| class III peroxidase [Populus trichocarpa]
Length=317

 Score =   387 bits (995),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/278 (67%), Positives = 221/278 (79%), Gaps = 1/278 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             IRTA+R A++RERRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK A  NN S RGY
Sbjct  41    IRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSIQSEKTAGGNNNSVRGY  100

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+ AK ++EK CPGVVSCADI+ VAARDA    GGPSWAV LGRRDST A  A A T+
Sbjct  101   EVIDKAKSKVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASPALAITE  160

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             LP+ + DL  LI+ F +KGL+ RD+VALSG+HTLGQ QCF FR RIYN +++D  FA+TR
Sbjct  161   LPAFFDDLGRLISRFQQKGLTARDMVALSGSHTLGQAQCFTFRDRIYNASNIDAGFASTR  220

Query  494   KRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYA  315
             KR+CP    G  NL+PLDLVTP  FDNNY+KNLM+ KGLLQSDQ LFNGG TDSIVSEY+
Sbjct  221   KRRCPRAG-GQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDSIVSEYS  279

Query  314   KSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             ++P  F++DF SAMIK+ +I+PL    G IR++CSAVN
Sbjct  280   RNPAKFSSDFASAMIKMGDIRPLTGSAGQIRRICSAVN  317



>ref|XP_004505714.1| PREDICTED: lignin-forming anionic peroxidase-like [Cicer arietinum]
Length=311

 Score =   387 bits (994),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 221/286 (77%), Gaps = 3/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++R AVS+ERRMAASL+RLHFHDCFVQGCDASILLD +  IE EK ALPN  
Sbjct  26    NALSTIRTSIRNAVSKERRMAASLIRLHFHDCFVQGCDASILLDESTTIESEKSALPNVN  85

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+++I+ AK  +EK CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST A  +
Sbjct  86    SVRGFEIIDKAKAAVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKS  145

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A TDLP    DL TLI+ F  KGL+ RD+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  146   SANTDLPLFTDDLQTLISRFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDA  205

Query  512   DFANTRKRQCP--EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVT  339
              F++TR+R CP       D+ L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG T
Sbjct  206   GFSSTRQRGCPLSSSTTNDQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGST  265

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+K+P  F +DF +AM+K+ +IQPL    GIIR +CSAVN
Sbjct  266   DSIVSEYSKNPTTFKSDFAAAMVKMGDIQPLTASAGIIRSICSAVN  311



>ref|XP_007131640.1| hypothetical protein PHAVU_011G030200g [Phaseolus vulgaris]
 gb|ESW03634.1| hypothetical protein PHAVU_011G030200g [Phaseolus vulgaris]
Length=324

 Score =   387 bits (995),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/286 (65%), Positives = 222/286 (78%), Gaps = 3/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRT +R AVS+ERRMAASL+RLHFHDCFVQGCDASILLD +  IE EK AL N  
Sbjct  39    NALTTIRTVIRSAVSKERRMAASLIRLHFHDCFVQGCDASILLDDSSSIESEKTALQNIN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGYDVI+ AK E+EK CPGVVSCADI+ VA+RDA  + GGPSW V LGRRDST A  +
Sbjct  99    SVRGYDVIDQAKTEVEKVCPGVVSCADIVAVASRDASFAVGGPSWTVKLGRRDSTTASKS  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
             +A +DLP    DL+TLI+ F+KKGL+ RD+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  159   EATSDLPLFIDDLETLISRFSKKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDA  218

Query  512   DFANTRKRQCPE--QQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVT  339
              FA+TR+R CP       DK L+ LDLVTP  FDNNY+KNL+QKKGLL SDQ LF+GG  
Sbjct  219   GFASTRQRGCPSLNSDDNDKKLAALDLVTPNSFDNNYFKNLIQKKGLLHSDQVLFSGGSA  278

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+K+P  F +DF +AMIK+ +IQPL    GIIRK+CS++N
Sbjct  279   DSIVSEYSKNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRKICSSIN  324



>dbj|BAA77388.1| peroxidase 2 [Scutellaria baicalensis]
Length=325

 Score =   387 bits (995),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/285 (65%), Positives = 225/285 (79%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA++ IRT++RQAVS ERRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK A PN  
Sbjct  41    NAVSTIRTSIRQAVSAERRMAASLIRLHFHDCFVQGCDASILLDETSTIQSEKTAGPNAG  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+ VI+AAK  +E+ CPGVVSCADILT+AARDA V+ GGPSW V LGRRDST A  A
Sbjct  101   SVRGFQVIDAAKTAVERLCPGVVSCADILTLAARDASVAVGGPSWTVRLGRRDSTTANRA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A TDLP P S L  LIT F  KGL+ R++VALSGAHTLGQ+QC  FR RIY N +D++ 
Sbjct  161   QANTDLPGPTSTLTQLITRFDAKGLNAREMVALSGAHTLGQSQCGNFRARIYSNGSDIEA  220

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             +FA+TR+RQCP+   GD NL+PLDLVTP  FDNNYY+NL+ ++GLLQSDQ L +GG TD+
Sbjct  221   NFASTRRRQCPQDGSGDSNLAPLDLVTPNSFDNNYYRNLVARRGLLQSDQVLLSGGETDA  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDG-HGIIRKVCSAVN  201
             IV+ Y+ +P  F +DF +AMIK+ EIQPL  G +GIIR+ C AVN
Sbjct  281   IVTSYSSNPATFASDFANAMIKMGEIQPLQLGQNGIIRRTCGAVN  325



>gb|AAB97853.1| ferriprotein porphyrin-containing peroxidase [Striga asiatica]
Length=322

 Score =   387 bits (994),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 223/284 (79%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA  IIR ++R A++RERRMAAS++RLHFHDCFVQGCDASILLD TP I+ EK A PN  
Sbjct  40    NATTIIRNSIRGAIARERRMAASIIRLHFHDCFVQGCDASILLDETPSIQSEKTAFPNVN  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGYDVIEAAKRE+E+ CPGVVSCADILT+AARDA    GGPSW V LGRRDST A   
Sbjct  100   SLRGYDVIEAAKREVERVCPGVVSCADILTLAARDASAYVGGPSWNVRLGRRDSTTANRD  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A TDLPSP++ L+ LI+AF  KGL+ RD+VALSGAHT+GQ QCFLFR RIY N TD+D 
Sbjct  160   QANTDLPSPFATLNNLISAFDTKGLNTRDMVALSGAHTIGQAQCFLFRARIYSNGTDIDA  219

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR R+CP Q   D NL+PLDLVTP  FDNNY+KN +Q+KGL+QSDQ LFNGG T +
Sbjct  220   GFASTRTRRCP-QTGRDANLAPLDLVTPNSFDNNYFKNFVQRKGLVQSDQVLFNGGSTAT  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVS+Y+ +P  F +DF SAMIK+ EI      +GI + VCSA+N
Sbjct  279   IVSQYSNNPRLFASDFASAMIKIGEIAMHGRPNGIYKVVCSAIN  322



>ref|XP_002521867.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40503.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=326

 Score =   387 bits (994),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 186/284 (65%), Positives = 220/284 (77%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++R +++ ERRMAASL+RLHFHDCF+QGCDAS+LLD T  IE EK ALPN  
Sbjct  44    NALSTIRTSIRNSIAAERRMAASLIRLHFHDCFIQGCDASVLLDETSTIESEKTALPNKD  103

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK E+EK CPGVVSCADIL+VAARD+    GGPSW V LGRRDST A   
Sbjct  104   SARGYEVIDKAKTEVEKICPGVVSCADILSVAARDSSAYVGGPSWTVMLGRRDSTTASRT  163

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A ++LPS    LD LI+ F  KGLS RD+VALSGAHTLGQ QCF FR RIY N T++D 
Sbjct  164   LANSELPSFKDGLDRLISRFQSKGLSARDMVALSGAHTLGQAQCFTFRDRIYSNGTEIDA  223

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TRKR CP    GD NL+PLDLVTP  FDNNY+KNLMQ+KGLL+SDQ L +GG TDS
Sbjct  224   GFASTRKRSCPAVG-GDANLAPLDLVTPNSFDNNYFKNLMQRKGLLESDQILLSGGSTDS  282

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVS Y++SP  F++DF SAMIK+  I PL    G IR++CSA+N
Sbjct  283   IVSGYSRSPSTFSSDFASAMIKMGNIDPLTGTAGQIRRICSAIN  326



>ref|XP_011024237.1| PREDICTED: lignin-forming anionic peroxidase-like [Populus euphratica]
Length=316

 Score =   386 bits (992),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 187/283 (66%), Positives = 222/283 (78%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +A + IR A+R A++RERRMAASL+RLHFHDCFVQGCDASILL+ T  IE EK A  N  
Sbjct  35    HAESAIRAAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLNETSSIESEKTAGGNRN  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK E+EK CPGVVSCADI+ VAARDA    GGPSWAV LGRRDST A  A
Sbjct  95    SARGYEVIDKAKSEVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASPA  154

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A T+LP+   DL TLI+ F +KGL+ RD+VALSG+HTLGQ QCF FR RIYN +++D  
Sbjct  155   LAITELPAFSDDLGTLISRFQQKGLTARDMVALSGSHTLGQAQCFTFRDRIYNASNIDAG  214

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TRKR+CP    G  NL+PLDLVTP  FDNNY+KNLM+ KGLLQSDQ LFNGG TDSI
Sbjct  215   FASTRKRRCPRTG-GQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDSI  273

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             VSEY+++P  F++DF SAMIK+ +I PL    G IR++CSAVN
Sbjct  274   VSEYSRNPAKFSSDFASAMIKMGDISPLTGSAGQIRRICSAVN  316



>ref|XP_004140450.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 ref|XP_004170186.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 gb|KGN50790.1| hypothetical protein Csa_5G262770 [Cucumis sativus]
Length=320

 Score =   386 bits (992),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 183/282 (65%), Positives = 218/282 (77%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  IRT +RQAVS+ERRMAASL+RLHFHDCFVQGCDASILLD TP + GE++A PN  S
Sbjct  40    ALTTIRTVIRQAVSQERRMAASLIRLHFHDCFVQGCDASILLDDTPSMIGEQNAAPNINS  99

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY VI  AK E+EK CPG VSCADIL VAARDA  S GGPSW V LGRRDST A    
Sbjct  100   ARGYGVIHKAKTEVEKRCPGTVSCADILAVAARDASFSVGGPSWTVKLGRRDSTSASKTL  159

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A ++LP     LD LI+ FA KGLS RD+VALSG+HT+GQ+QCFLFR RIYN +++D  F
Sbjct  160   AESELPHFQESLDRLISIFANKGLSTRDMVALSGSHTIGQSQCFLFRNRIYNQSNIDAGF  219

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A TR+R CP    G+ NL+PLDLVTP  FDNNY+KNL+Q KGLL++DQ LF+GG TD+IV
Sbjct  220   ARTRQRNCPSSG-GNGNLAPLDLVTPNSFDNNYFKNLIQMKGLLETDQVLFSGGSTDNIV  278

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +EY+++P  F +DF +AMIK+ +IQPL    G IR +C AVN
Sbjct  279   TEYSRNPSTFKSDFAAAMIKMGDIQPLTGLEGEIRNICGAVN  320



>ref|XP_006387938.1| hypothetical protein POPTR_0466s00210g [Populus trichocarpa]
 gb|ERP46852.1| hypothetical protein POPTR_0466s00210g [Populus trichocarpa]
Length=316

 Score =   386 bits (992),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 183/278 (66%), Positives = 218/278 (78%), Gaps = 1/278 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             IRTA+R A++RERRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK A  NN S RGY
Sbjct  40    IRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSIQSEKTAGGNNNSVRGY  99

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+ AK ++EK CPGVVSCADI+ VAARDA    GGPSWAV  GRRDST A    A  +
Sbjct  100   EVIDKAKSKVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKFGRRDSTTASRTLANAE  159

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             LP+ +  LD LI+ F KKGL+ RD+VALSG+HTLGQ QCF FR RIYN +++D  FA+TR
Sbjct  160   LPAFFDRLDRLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRDRIYNASNIDAGFASTR  219

Query  494   KRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYA  315
             KR+CP    G  NL+PLDLVTP  FDNNY+KNLM+ KGLLQSDQ LFNGG TDSIVSEY+
Sbjct  220   KRRCPRAG-GQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDSIVSEYS  278

Query  314   KSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             ++P  F++DF SAMIK+ +I+PL    G IR++CSAVN
Sbjct  279   RNPAKFSSDFASAMIKMGDIRPLTGSAGQIRRICSAVN  316



>ref|XP_010270789.1| PREDICTED: lignin-forming anionic peroxidase-like [Nelumbo nucifera]
Length=325

 Score =   386 bits (992),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 219/283 (77%), Gaps = 1/283 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             ALN IRT +R AVS ERRMAASL+RLHFHDCFVQGCDASILLD +  I  EK+A  N  S
Sbjct  43    ALNTIRTVIRSAVSAERRMAASLIRLHFHDCFVQGCDASILLDDSSSITSEKNAPANKNS  102

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY+VI+ AK ++E  CPGVVSCADI+ VAARDA V+ GGPSW V LGRRDST A    
Sbjct  103   ARGYEVIDKAKAQVENICPGVVSCADIVAVAARDASVAVGGPSWTVKLGRRDSTTASPDL  162

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A +DLPS  + LDTLI  FAKKGLS RD+VALSG+HT+GQ  C  FR RIY N +D+D  
Sbjct  163   ANSDLPSFTASLDTLIGQFAKKGLSARDMVALSGSHTIGQASCLTFRGRIYDNSSDIDAG  222

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TRKR+CP    GD NL+PLDLVTP  FDNNY+KNL+Q+KGLL SDQ LF+GG TDSI
Sbjct  223   FASTRKRRCPTDASGDGNLAPLDLVTPNSFDNNYFKNLIQRKGLLHSDQVLFSGGSTDSI  282

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+EY+KSP  F +DF SAMIK+ +I PL    G IR++CSAVN
Sbjct  283   VTEYSKSPNTFKSDFASAMIKMGDINPLTGSLGEIRRLCSAVN  325



>ref|XP_003556178.1| PREDICTED: lignin-forming anionic peroxidase-like [Glycine max]
Length=323

 Score =   386 bits (992),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 185/286 (65%), Positives = 221/286 (77%), Gaps = 3/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+ +R AVS ERRMAASL+RLHFHDCFVQGCDASILLD +  IE EK AL N  
Sbjct  38    NALSTIRSVIRSAVSAERRMAASLIRLHFHDCFVQGCDASILLDDSSTIESEKSALQNAN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY++I+ AK E+EK CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST A  +
Sbjct  98    SIRGYNIIDQAKSEVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A +DLP    DLDTLI+ F  KGL+ RD+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  158   SATSDLPRFTDDLDTLISKFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDA  217

Query  512   DFANTRKRQCP--EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVT  339
              FA+TR+R CP       DK L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG T
Sbjct  218   GFASTRQRGCPSVSNDDNDKKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGST  277

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+K+P  F +DF +AMIK+ +I+PL    G+IRK+CS+VN
Sbjct  278   DSIVSEYSKNPTTFKSDFAAAMIKMGDIEPLTGSAGMIRKICSSVN  323



>gb|KHN00767.1| Lignin-forming anionic peroxidase [Glycine soja]
Length=326

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/286 (65%), Positives = 221/286 (77%), Gaps = 3/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+ +R AVS ERRMAASL+RLHFHDCFVQGCDASILLD +  IE EK AL N  
Sbjct  41    NALSTIRSVIRSAVSAERRMAASLIRLHFHDCFVQGCDASILLDDSSTIESEKSALQNAN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY++I+ AK E+EK CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST A  +
Sbjct  101   SIRGYNIIDQAKSEVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKS  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A +DLP    DLDTLI+ F  KGL+ RD+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  161   SATSDLPRFTDDLDTLISKFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDA  220

Query  512   DFANTRKRQCP--EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVT  339
              FA+TR+R CP       DK L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG T
Sbjct  221   GFASTRQRGCPSVSNDDNDKKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGST  280

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+K+P  F +DF +AMIK+ +I+PL    G+IRK+CS+VN
Sbjct  281   DSIVSEYSKNPTTFKSDFAAAMIKMGDIEPLTGSAGMIRKICSSVN  326



>ref|XP_008460239.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis melo]
Length=316

 Score =   386 bits (991),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/282 (65%), Positives = 217/282 (77%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  IRT +RQA+S+ERRMAASL+RLHFHDCFVQGCDASILLD TP + GE++A PN  S
Sbjct  36    ALTTIRTVIRQAISQERRMAASLIRLHFHDCFVQGCDASILLDDTPSMIGEQNAAPNRNS  95

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY VI  AK E+EK CPGVVSCADIL VAARDA  + GGPSW V LGRRDST A    
Sbjct  96    ARGYGVIHKAKTEVEKICPGVVSCADILAVAARDASFAVGGPSWTVKLGRRDSTTASKTL  155

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  +LP   + LD LI+ F+ KGLS RD+VALSG+HT+GQ QCFLFR RIYN T++D  F
Sbjct  156   AENELPHFQAGLDRLISIFSNKGLSTRDMVALSGSHTIGQAQCFLFRNRIYNQTNIDAGF  215

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A+TR+R CP    G+ NL+PLDLVTP  FDNNY+KNL+Q+KGLL++DQ LFNGG TDSIV
Sbjct  216   ASTRRRNCPTSS-GNGNLAPLDLVTPNSFDNNYFKNLVQRKGLLETDQVLFNGGSTDSIV  274

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +EY++ P  F +DF +AMIK+  IQPL    G IR +C  VN
Sbjct  275   TEYSRDPTMFKSDFAAAMIKMGNIQPLTGLEGEIRNICGIVN  316



>ref|XP_004140410.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 ref|XP_004140411.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 ref|XP_004170185.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
Length=316

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/282 (65%), Positives = 217/282 (77%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  IRT +RQA+S+ERRMAASL+RLHFHDCFVQGCDASILLD TP + GE++A PN  S
Sbjct  36    ALTTIRTVIRQAISQERRMAASLIRLHFHDCFVQGCDASILLDDTPSMIGEQNAAPNRDS  95

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY VI  AK  +EK CPGVVSCADIL VAARDA  + GGPSW V LGRRDST A  A 
Sbjct  96    ARGYGVIHNAKTAVEKICPGVVSCADILAVAARDASFAVGGPSWTVRLGRRDSTTASKAL  155

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  +LP   + LD LI+ F+ KGLS RD+VALSG+HT+GQ QCFLFR RIYN T++D  F
Sbjct  156   AENELPHFQAGLDRLISIFSNKGLSTRDMVALSGSHTIGQAQCFLFRNRIYNQTNIDAGF  215

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A+TR+R CP    G+ NL+PLDLVTP  FDNNY+KNL+Q+KGLL++DQ LFNGG TDSIV
Sbjct  216   ASTRRRNCPTSS-GNGNLAPLDLVTPNSFDNNYFKNLVQRKGLLETDQVLFNGGSTDSIV  274

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +EY+K P  F +DF +AMIK+  IQPL    G IR +C  VN
Sbjct  275   TEYSKDPTMFKSDFAAAMIKMGNIQPLTGLEGEIRNICGIVN  316



>emb|CDP07980.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/284 (63%), Positives = 221/284 (78%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRT +R A+SRERRMAASL+RLHFHDCFVQGCD S+LLD TP I+ EK +L N  
Sbjct  39    NALTTIRTTIRSAISRERRMAASLIRLHFHDCFVQGCDGSVLLDETPTIQSEKTSLANRQ  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VIE AK  +EK CPGVVSCADIL VAARD+  + GGPSW V LGRRDST A  +
Sbjct  99    SARGFNVIEDAKTAVEKICPGVVSCADILAVAARDSSAAVGGPSWTVKLGRRDSTTASRS  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +DLP+P+  L TLI+ F+ KG + R++VALSGAHT+GQ QC  FR RIY N  D+D 
Sbjct  159   LADSDLPAPFHQLSTLISLFSNKGFTPREMVALSGAHTVGQAQCRTFRGRIYSNGADIDT  218

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP    GD NL+PLDLVTP  FDNNYYKNL+QKKGLL SDQ LFNG  TD+
Sbjct  219   GFASTRQRQCPSTG-GDSNLAPLDLVTPNQFDNNYYKNLVQKKGLLISDQTLFNGSSTDT  277

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              V+EY+++P+ F++DF +AM+K+ ++ PL    GIIR+VCSA+N
Sbjct  278   FVTEYSQNPQTFSSDFGAAMVKMGDLSPLTGQDGIIRRVCSAIN  321



>ref|XP_006589469.1| PREDICTED: lignin-forming anionic peroxidase-like [Glycine max]
 gb|KHN17056.1| Lignin-forming anionic peroxidase [Glycine soja]
Length=323

 Score =   384 bits (985),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 185/285 (65%), Positives = 218/285 (76%), Gaps = 3/285 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRT +R AVS ERRMAASL+RLHFHDCFVQGCDASILLD +  IE EK AL N  S
Sbjct  39    ALSTIRTVIRSAVSAERRMAASLIRLHFHDCFVQGCDASILLDDSSSIESEKSALQNANS  98

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RGY++I+ AK E+EK CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST A  + 
Sbjct  99    IRGYNIIDQAKSEVEKLCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKSS  158

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDPD  510
             A +DLP    DLDTLI+ F  KGL+ RD+V LSGAHT+GQ QCF FR RIYN+ +D+D  
Sbjct  159   ATSDLPRFTDDLDTLISRFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAG  218

Query  509   FANTRKRQCP--EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
             FA+TR+R CP       DK L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG TD
Sbjct  219   FASTRQRGCPSVSNDDNDKKLASLDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTD  278

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIVSEY+  P  F +DF +AMIK+ +IQPL    GIIRK+CS++N
Sbjct  279   SIVSEYSNKPTTFKSDFAAAMIKMGDIQPLTASAGIIRKICSSIN  323



>gb|AAB97854.1| ferriprotein porphyrin-containing peroxidase [Striga asiatica]
Length=321

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 223/284 (79%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IR ++ +AV+RERRMAAS++RLHFHDCFVQGCD S+LLD  P I+ EK A PN  
Sbjct  39    NALRTIRASIWRAVARERRMAASIIRLHFHDCFVQGCDGSVLLDDAPTIQSEKSAFPNLN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+DVIEAAKR++E+ CPGVVSCADIL VAARDA V+  GPSW V LGRRDST A   
Sbjct  99    SARGFDVIEAAKRDVERLCPGVVSCADILAVAARDASVAVRGPSWNVRLGRRDSTTANRD  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A  +LP P+S LD LIT+F  KGLS+RD+VALSG+HT+GQ QCFLFR RIY N TD+DP
Sbjct  159   AANRELPGPFSTLDGLITSFKNKGLSERDMVALSGSHTIGQAQCFLFRSRIYSNGTDIDP  218

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
               A  R++ CP Q +G  NLSPLDLVTP   DNNY+KNL Q++GLL+SDQ LF+GG TDS
Sbjct  219   FKARLRRQSCP-QTVGIGNLSPLDLVTPNRLDNNYFKNLRQRRGLLESDQVLFSGGSTDS  277

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +V  Y+ +P  F +DF +AM+K+SEIQPL+  +GIIR+VC+A N
Sbjct  278   LVFSYSINPHLFASDFANAMLKMSEIQPLLGSNGIIRRVCNATN  321



>ref|XP_003607863.1| Peroxidase [Medicago truncatula]
Length=321

 Score =   381 bits (979),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 220/287 (77%), Gaps = 4/287 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT +R AVS+ERRMAASL+RLHFHDCFVQGCDASILLD T  IE EK ALPN  
Sbjct  35    NALSTIRTVIRTAVSKERRMAASLIRLHFHDCFVQGCDASILLDDTSTIESEKSALPNIN  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK  +EK CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST+A  +
Sbjct  95    SVRGFEVIDKAKANVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTVASKS  154

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
             +A +DLP    DL TLI  F  KGL+ +D+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  155   QANSDLPKFTDDLTTLIAHFTNKGLTLKDMVTLSGAHTIGQAQCFTFRDRIYNNASDIDA  214

Query  512   DFANTRKRQCP--EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGV  342
              FA+TR+R CP       ++ L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF  GG 
Sbjct  215   GFASTRRRGCPSLSSTTNNQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFGGGGS  274

Query  341   TDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             TDSIVSEY+K+P  F +DF +AMIK+ +IQPL    GIIR +CSA+N
Sbjct  275   TDSIVSEYSKNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRSICSAIN  321



>gb|AES90060.2| lignin-forming anionic peroxidase [Medicago truncatula]
Length=324

 Score =   382 bits (980),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 220/287 (77%), Gaps = 4/287 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT +R AVS+ERRMAASL+RLHFHDCFVQGCDASILLD T  IE EK ALPN  
Sbjct  38    NALSTIRTVIRTAVSKERRMAASLIRLHFHDCFVQGCDASILLDDTSTIESEKSALPNIN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK  +EK CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST+A  +
Sbjct  98    SVRGFEVIDKAKANVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTVASKS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
             +A +DLP    DL TLI  F  KGL+ +D+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  158   QANSDLPKFTDDLTTLIAHFTNKGLTLKDMVTLSGAHTIGQAQCFTFRDRIYNNASDIDA  217

Query  512   DFANTRKRQCP--EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGV  342
              FA+TR+R CP       ++ L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF  GG 
Sbjct  218   GFASTRRRGCPSLSSTTNNQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFGGGGS  277

Query  341   TDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             TDSIVSEY+K+P  F +DF +AMIK+ +IQPL    GIIR +CSA+N
Sbjct  278   TDSIVSEYSKNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRSICSAIN  324



>ref|XP_002311022.2| hypothetical protein POPTR_0008s02340g [Populus trichocarpa]
 gb|EEE88389.2| hypothetical protein POPTR_0008s02340g [Populus trichocarpa]
Length=319

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 224/284 (79%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA++ IRTA+R A++ +RRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK AL N  
Sbjct  37    NAISAIRTAIRSAIASDRRMAASLIRLHFHDCFVQGCDASILLDETLSIQSEKTALGNLN  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK E+EK CPGVVSCADI+ VAARDA    GGPS+AV LGRRDST A   
Sbjct  97    SARGYNVIDKAKTEVEKICPGVVSCADIIAVAARDASAYVGGPSYAVKLGRRDSTTASRT  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  +LP+ +  L++LI+ F KKGL+ RD+VALSG+HTLGQ QCF FR RIYNH+++D  
Sbjct  157   LANAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRERIYNHSNIDAG  216

Query  509   FANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP  ++G +  L+PLDLVTP  FDNNY+KNLMQ KGLLQSDQ LFNGG TDS
Sbjct  217   FASTRRRRCP--RVGSNSTLAPLDLVTPNSFDNNYFKNLMQNKGLLQSDQVLFNGGSTDS  274

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P  F +DF SAMIK+ +I  L    G IR++CSAVN
Sbjct  275   IVSEYSRNPARFKSDFGSAMIKMGDIGLLTGSAGQIRRICSAVN  318



>gb|AHL39158.1| class III peroxidase [Populus trichocarpa]
Length=319

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/284 (65%), Positives = 222/284 (78%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTA+R A++R+RRMAASL+RLHFHDCFVQGCDASILL  T  I+ EK AL N  
Sbjct  37    NALSAIRTAIRSAIARDRRMAASLIRLHFHDCFVQGCDASILLHETSSIQSEKTALGNLN  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK E+EK CPGVVSCADI+ VAARDA    GGPS+AV LGRRDST A   
Sbjct  97    SARGYNVIDKAKNEVEKICPGVVSCADIIAVAARDASAYVGGPSYAVKLGRRDSTTASRT  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  +LP+ +  L++LI+ F KKGL+ RD+VALSG+HTLGQ QCF FR RIYNH+++D  
Sbjct  157   LANAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRERIYNHSNIDAG  216

Query  509   FANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP  ++G D  L+PLDLVTP  FDNNY+KNLMQ KGLLQSDQ LFNGG TDS
Sbjct  217   FASTRRRRCP--RVGSDATLAPLDLVTPNSFDNNYFKNLMQNKGLLQSDQVLFNGGSTDS  274

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY++    F +DF SAMIK+ +I  L    G IR++CSAVN
Sbjct  275   IVSEYSRDRARFKSDFGSAMIKMGDIGLLTGSSGQIRRICSAVN  318



>gb|AHL39166.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 222/284 (78%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA + IRTA+R A++RERRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK A  N  
Sbjct  35    NAESAIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSIKSEKTAGANKN  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK E+EK CPGVVSCADI+ VAARDA    GGPSWAV LGRRDST A   
Sbjct  95    SARGYEVIDKAKAEVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASPT  154

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A T+LP+   DL  LI+ F +KGL+ RD+VALSG+H+LGQ QCF FR RI++  ++D  
Sbjct  155   LAITELPAFSDDLGRLISRFQQKGLTARDMVALSGSHSLGQAQCFTFRDRIHSDNNIDAG  214

Query  509   FANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TRKR+CP   +G D  L+PLDLVTP  FDNNY+KNLMQKKGLLQSDQ LF+GG TDS
Sbjct  215   FASTRKRRCP--LVGSDSTLAPLDLVTPNSFDNNYFKNLMQKKGLLQSDQELFSGGSTDS  272

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P  F++DF SAMIK+ +I PL    G IR++CSAVN
Sbjct  273   IVSEYSRNPAKFSSDFASAMIKMGDISPLTGSAGQIRRICSAVN  316



>ref|XP_002269169.1| PREDICTED: lignin-forming anionic peroxidase [Vitis vinifera]
Length=331

 Score =   381 bits (978),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/285 (63%), Positives = 227/285 (80%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL+ IRTA+R AVSRERRMAASL+RLHFHDCFVQGCDASILLD +P I+ EK+A  NN 
Sbjct  47    SALSTIRTAIRTAVSRERRMAASLIRLHFHDCFVQGCDASILLDDSPTIQSEKNAPNNNN  106

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+  K ++E  CPGVVSCADIL VAARDA V+ GGP+W + LGRRDST +  +
Sbjct  107   SVRGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLS  166

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A T+LP+    LD L + F+ KGLS RD+VALSG+HT+GQ +C  FR RIY N T++D 
Sbjct  167   QAATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDA  226

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R+CP +   GD NL+PLDLVTP  FDNNY+KNL+Q+KGLLQSDQ LFNGG TD
Sbjct  227   GFASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTD  286

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+KSP  F++DF SAM+K+ +I+PLI   G+IRK C+ +N
Sbjct  287   SIVTEYSKSPSTFSSDFSSAMVKMGDIEPLIGSAGVIRKFCNVIN  331



>ref|XP_011024238.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=365

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/283 (65%), Positives = 218/283 (77%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +A + IR A+R A++RERRMAASL+RLHFHDCFVQGCDASILL+ T  IE EK A  N  
Sbjct  84    HAESAIREAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLNETSSIESEKTAGGNRN  143

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK E+EK CPGVVSCADI+ VAARDA    GGPSWAV LGRRDST A   
Sbjct  144   SARGYEVIDKAKSEVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASRT  203

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  +LP+ +  LD L++ F KKGL+ RD+VALSG+HTLGQ QCF FR RIYN +++D  
Sbjct  204   LANAELPAFFDSLDRLVSRFQKKGLTARDMVALSGSHTLGQAQCFTFRDRIYNASNIDAG  263

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TRKR+CP    G  NL+PLDLVTP  FDNNY+KNLM+ KGLLQSDQ LFNGG TDSI
Sbjct  264   FASTRKRRCPRTG-GQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDSI  322

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             VSEY+++P  F +DF SAMIK+  I PL    G IR++CSA+N
Sbjct  323   VSEYSRNPAKFRSDFASAMIKMGNIGPLTGSAGQIRRICSALN  365



>ref|XP_006378807.1| hypothetical protein POPTR_0010s24330g [Populus trichocarpa]
 gb|ERP56604.1| hypothetical protein POPTR_0010s24330g [Populus trichocarpa]
Length=316

 Score =   380 bits (975),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 222/284 (78%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NA + IRTA+R A++RERRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK A  N  
Sbjct  35    NAESAIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSIKSEKTAGANKN  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK E+EK CPGVVSCADI+ VAARDA    GGPSWAV LGRRDST A   
Sbjct  95    SARGYEVIDKAKAEVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASPT  154

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A T+LP+   DL  LI+ F +KGL+ RD+VALSG+H+LGQ QCF FR RI++  ++D  
Sbjct  155   LAITELPAFSDDLGRLISRFQQKGLTARDMVALSGSHSLGQAQCFTFRDRIHSDNNIDAG  214

Query  509   FANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TRKR+CP   +G D  L+PLDLVTP  FDNNY+KNLMQKKGLLQSDQ LF+GG TDS
Sbjct  215   FASTRKRRCP--LVGSDSTLAPLDLVTPNSFDNNYFKNLMQKKGLLQSDQELFSGGSTDS  272

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P  F++DF SAMIK+ +I PL    G IR++CSAVN
Sbjct  273   IVSEYSRNPAKFSSDFASAMIKMGDISPLTGTAGQIRRICSAVN  316



>gb|EYU30097.1| hypothetical protein MIMGU_mgv1a010056mg [Erythranthe guttata]
Length=324

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/285 (65%), Positives = 219/285 (77%), Gaps = 3/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRT++RQAVSRERRMA SL+RLHFHDCFVQGCDASILLD T  I  EK A PN  
Sbjct  41    NALATIRTSIRQAVSRERRMAGSLIRLHFHDCFVQGCDASILLDETATIRSEKTAFPNVN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY+VIEAAK  +E+ CPGVVSCADILT+AARDA V+ GGP+W V LGRRDST A   
Sbjct  101   SVRGYEVIEAAKTLVERLCPGVVSCADILTLAARDASVAVGGPTWNVRLGRRDSTTANRD  160

Query  689   KAGTDLPSPYSDLDTLITAFA-KKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
             +A  DLP P S L  LI +F  K  L+ RD+VALSGAHTLG  QC  FR RIY N T++D
Sbjct  161   QANRDLPGPDSTLQRLIDSFGIKNNLTPRDMVALSGAHTLGLAQCSSFRTRIYSNGTNID  220

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
             P FA TR+R CP Q  GD NL+PLDLVTP  FDNNY++NL+Q++GLLQSDQ L +GG TD
Sbjct  221   PGFATTRRRTCP-QTGGDGNLAPLDLVTPNSFDNNYFRNLVQRRGLLQSDQVLLSGGSTD  279

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+ +P  F  DF +AMIK+SEI+P+    GIIR++C+A+N
Sbjct  280   SIVTEYSTTPRTFAADFATAMIKMSEIEPVTGQSGIIRRICTAIN  324



>gb|KDP38219.1| hypothetical protein JCGZ_04862 [Jatropha curcas]
Length=566

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 185/283 (65%), Positives = 221/283 (78%), Gaps = 2/283 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++R +++RERRMAASL+RLHFHDCFVQGCDAS+LLD T  IE EK ALPN  
Sbjct  36    NALSTIRTSIRNSIARERRMAASLIRLHFHDCFVQGCDASVLLDETSTIESEKTALPNFQ  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGYD+IE AK E+EK+CPGVVSCADIL VAA++A    GGPSW V LGRRDST A   
Sbjct  96    SARGYDIIEKAKAEVEKTCPGVVSCADILAVAAKEASSYVGGPSWTVLLGRRDSTTASRT  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A T+LPS    LD+LI+ F  KGL  RD+VALSG+HT+GQ QCF FR RIYN+ TD+D 
Sbjct  156   LANTELPSFKEGLDSLISRFQSKGLGARDMVALSGSHTIGQAQCFTFRDRIYNNGTDIDA  215

Query  512   DFANTRKRQCPEQQI-GDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R CP   + GD NL+ LDLVTP  FDNNY+KNLMQKKGLL+SDQ LF+GG TD
Sbjct  216   GFASTRRRSCPAAGLGGDANLAALDLVTPNSFDNNYFKNLMQKKGLLESDQVLFSGGSTD  275

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSA  207
             SIVSEY++SP  F+ DF SAM+K+  I PL    G IR++C+A
Sbjct  276   SIVSEYSRSPATFSADFASAMVKMGNIDPLTGTAGQIRRICTA  318


 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 187/249 (75%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSCPGVVSCADILTVAARD  765
            GCDASILL  T  I+ E+ ALPN  SARGY+VI+ AK E EK CPGVVSCADIL VAARD
Sbjct  319  GCDASILLKETSSIQRERTALPNFESARGYEVIDKAKSEAEKICPGVVSCADILAVAARD  378

Query  764  AVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSG  585
            A    GGPSW V LGRRDST A  + A ++LPS    LD+LI+ F  KGLS RD+VALSG
Sbjct  379  ASAYVGGPSWTVLLGRRDSTTASRSLANSELPSFKDGLDSLISRFQGKGLSVRDMVALSG  438

Query  584  AHTLGQTQCFLFRYRIYNH-TDVDPDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNY  408
            +HT+GQ QCF FR RIYN+ T++D  FA+TR+R CP    GD  L+PLDLVTP  FDNNY
Sbjct  439  SHTIGQAQCFTFRDRIYNNGTNIDAGFASTRRRTCPTIG-GDARLAPLDLVTPNSFDNNY  497

Query  407  YKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGI  228
            +KNL+Q+KGLL+SDQ LF+GG TDSIVSEY+++   F++DF SAMIK+  I PL    G 
Sbjct  498  FKNLIQRKGLLESDQVLFSGGSTDSIVSEYSRNRATFSSDFASAMIKMGNIDPLTGNAGQ  557

Query  227  IRKVCSAVN  201
            IR++C AVN
Sbjct  558  IRRICGAVN  566



>ref|XP_006470943.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=323

 Score =   379 bits (974),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 222/284 (78%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +ALN IRT +R AVSRERRM+ASL+RLHFHDCFVQGCDASILLD +  I+ EK+ALPN  
Sbjct  42    SALNTIRTGIRNAVSRERRMSASLIRLHFHDCFVQGCDASILLDDSSSIDSEKNALPNFK  101

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI++ K ++E+ CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST A  +
Sbjct  102   SARGFEVIDSVKSQLERVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASRS  161

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A  +LPS    LD LI+ FA KGL+ RDLVALSGAHTLGQ QC  FR RIY N +++D 
Sbjct  162   LA-ENLPSFTDGLDKLISTFATKGLNARDLVALSGAHTLGQAQCAFFRDRIYSNQSNIDA  220

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP    GD NLSPLDLVTP  FDNNY+KNL+QKKGLL SDQ LF+GG TDS
Sbjct  221   GFASTRRRQCPANG-GDSNLSPLDLVTPNSFDNNYFKNLIQKKGLLASDQVLFSGGSTDS  279

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV EY+K+P  F +DF +AMIK+++I PL    G IR+VC+ VN
Sbjct  280   IVDEYSKNPSKFKSDFAAAMIKMADISPLTGSAGEIRRVCNLVN  323



>emb|CAN80097.1| hypothetical protein VITISV_011206 [Vitis vinifera]
Length=331

 Score =   379 bits (973),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 180/285 (63%), Positives = 226/285 (79%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL+ IRTA+R AVSRERRMAASL+RLHFHDCFVQGCDASILLD +P I+ EK+A  NN 
Sbjct  47    SALSTIRTAIRTAVSRERRMAASLIRLHFHDCFVQGCDASILLDDSPTIQSEKNAPNNNN  106

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+  K ++E  CPGVVSCADIL VAARDA V+ GGP+W + LGRRDST +  +
Sbjct  107   SVRGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLS  166

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A T+LP+    LD L + F+ KGLS RD+VALSG+HT+GQ +C  FR RIY N T++D 
Sbjct  167   QAATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDA  226

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R+CP +   GD NL+PLDLVTP  FDNNY+KNL+Q+KGLLQSDQ LFNGG TD
Sbjct  227   GFASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTD  286

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+KSP  F++DF SAM+K+ +I+PLI   G IRK C+ +N
Sbjct  287   SIVTEYSKSPSTFSSDFSSAMVKMGDIEPLIGSAGXIRKFCNVIN  331



>ref|XP_006379469.1| hypothetical protein POPTR_0008s02330g [Populus trichocarpa]
 gb|ERP57266.1| hypothetical protein POPTR_0008s02330g [Populus trichocarpa]
 gb|AHL39157.1| class III peroxidase [Populus trichocarpa]
Length=319

 Score =   379 bits (972),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 223/284 (79%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I TA+R A++ +RRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK AL N  
Sbjct  37    NALSAIGTAIRSAIASDRRMAASLIRLHFHDCFVQGCDASILLDETTSIQSEKTALGNLN  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK E+EK CPGVVSCADI+ VAARDA    GGPS+AV LGRRDST A   
Sbjct  97    SARGYNVIDKAKTEVEKICPGVVSCADIIAVAARDASAYVGGPSYAVKLGRRDSTTASRT  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  +LP+ +  L++LI+ F KKGL+ RD+VALSG+HTLGQ QCF FR RIYNH+++D  
Sbjct  157   LANAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRERIYNHSNIDAG  216

Query  509   FANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP  ++G +  L+PLDLVTP  FDNNY+KNLMQ KGLLQSDQ LFNGG TDS
Sbjct  217   FASTRRRRCP--RVGSNSTLAPLDLVTPNSFDNNYFKNLMQNKGLLQSDQVLFNGGSTDS  274

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P  F +DF SAMIK+ +I  L    G IR++CSAVN
Sbjct  275   IVSEYSRNPARFRSDFGSAMIKMGDIGLLTGSAGQIRRICSAVN  318



>ref|XP_002269145.1| PREDICTED: lignin-forming anionic peroxidase [Vitis vinifera]
Length=331

 Score =   379 bits (973),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 180/285 (63%), Positives = 226/285 (79%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL+ IRTA+R AVSRERRMAASL+RLHFHDCFVQGCDASILLD +P I+ EK+A  NN 
Sbjct  47    SALSTIRTAIRTAVSRERRMAASLIRLHFHDCFVQGCDASILLDDSPTIQSEKNAPNNNN  106

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+  K ++E  CPGVVSCADIL VAARDA V+ GGP+W + LGRRDST +  +
Sbjct  107   SVRGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLS  166

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A T+LP+    LD L + F+ KGLS RD+VALSG+HT+GQ +C  FR RIY N T++D 
Sbjct  167   QAATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDA  226

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R+CP +   GD NL+PLDLVTP  FDNNY+KNL+Q+KGLLQSDQ LFNGG TD
Sbjct  227   GFASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTD  286

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+KSP  F++DF SAM+K+ +I+PLI   G IRK C+ +N
Sbjct  287   SIVTEYSKSPSTFSSDFSSAMVKMGDIEPLIGSAGEIRKFCNVIN  331



>ref|XP_007131639.1| hypothetical protein PHAVU_011G030100g [Phaseolus vulgaris]
 gb|ESW03633.1| hypothetical protein PHAVU_011G030100g [Phaseolus vulgaris]
Length=323

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 217/286 (76%), Gaps = 3/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRT  R AVS+ERRMAASL+RLHFHDCFVQGCDASILLD +  IE EK A  N  
Sbjct  38    NALTTIRTVTRSAVSKERRMAASLIRLHFHDCFVQGCDASILLDDSSSIESEKTAPQNFN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGYDVI+ AK E+EK CPGVVSCADI+ VAARDA  + GGPSW V +GRRDST A  +
Sbjct  98    SVRGYDVIDQAKTEVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKVGRRDSTTASKS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
             +A +DLP    D+D LI+ F KKGL+ RD+V LSGAHT+GQ QC  FR RIYN+ +D+D 
Sbjct  158   EATSDLPRFTDDVDILISRFDKKGLTARDMVTLSGAHTIGQAQCSTFRGRIYNNASDIDA  217

Query  512   DFANTRKRQCPE--QQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVT  339
              FA+TR+R CP       DK L+ LDLVTP  FDNNY+KNL+QKKGLL SDQ LF+GG T
Sbjct  218   GFASTRQRGCPSLNSDENDKKLAALDLVTPNSFDNNYFKNLIQKKGLLHSDQVLFSGGST  277

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+ +P  F +DF +AMIK+ +IQPL    GIIRK+CS+VN
Sbjct  278   DSIVSEYSNNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRKICSSVN  323



>ref|XP_003538964.1| PREDICTED: lignin-forming anionic peroxidase-like [Glycine max]
Length=323

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 222/286 (78%), Gaps = 3/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL+ IRT +R+AVS+ERRMAASL+RLHFHDCFVQGCDASILLD +  IE EK AL N  
Sbjct  38    DALSTIRTVIRRAVSKERRMAASLIRLHFHDCFVQGCDASILLDDSTSIESEKTALQNVN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK C GVVSCADI+ VAARDA  + GGPSW V LGRRDST A  +
Sbjct  98    SVRGFNVIDQAKTEVEKVCSGVVSCADIMAVAARDASFAVGGPSWTVKLGRRDSTTASKS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A +DLP    DLDTLI+ F  KGL+ RD+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  158   LASSDLPLFTDDLDTLISRFNSKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDA  217

Query  512   DFANTRKRQCPE--QQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVT  339
              FA+TR+R CP       +K L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ L++GG T
Sbjct  218   GFASTRRRGCPSLNNNDNNKKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLYSGGST  277

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+K+P  F +DF +AMIK+ +I+PL    G+IRK+CS++N
Sbjct  278   DSIVSEYSKNPTTFKSDFAAAMIKMGDIEPLTGSAGMIRKICSSIN  323



>ref|XP_006470944.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=323

 Score =   377 bits (968),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/284 (65%), Positives = 222/284 (78%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +ALN IRT +R A SRERRMAASL+RLHFHDCFVQGCDASILLD +  I+ EK+ALPN  
Sbjct  42    SALNTIRTGIRNAASRERRMAASLIRLHFHDCFVQGCDASILLDDSSSIDSEKNALPNFK  101

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI++ K ++E+ CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST A  +
Sbjct  102   SARGFEVIDSVKSQLERVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASRS  161

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A  +LPS    LD LI+ FA KGL+ RDLVALSGAHT+GQ QC  FR RIYN+ +++D 
Sbjct  162   LA-ENLPSFTDGLDKLISTFATKGLNARDLVALSGAHTIGQAQCAFFRDRIYNNQSNIDA  220

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+RQCP    GD NLSPLDLVTP  FDNNY+KNL+QKKGLL SDQ LF+GG TDS
Sbjct  221   GFASTRRRQCPANG-GDSNLSPLDLVTPNSFDNNYFKNLIQKKGLLASDQVLFSGGSTDS  279

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV EY+K+P  F +DF +AMIK+++I PL    G IR+VC+ VN
Sbjct  280   IVDEYSKNPSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNIVN  323



>ref|XP_004505715.1| PREDICTED: lignin-forming anionic peroxidase-like [Cicer arietinum]
Length=316

 Score =   377 bits (967),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/286 (64%), Positives = 217/286 (76%), Gaps = 7/286 (2%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTA+R A    RRMAASL+RLHFHDCFVQGCDASILLD +  IE EK ALPN  
Sbjct  35    NALSTIRTAIRTA----RRMAASLIRLHFHDCFVQGCDASILLDESTTIESEKSALPNVN  90

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+++I+ AK  +EK CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST A  +
Sbjct  91    SVRGFEIIDKAKAAVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKS  150

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A TDLP    DL TLI+ F  KGL+ RD+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  151   SANTDLPLFTDDLQTLISRFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDA  210

Query  512   DFANTRKRQCP--EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVT  339
              F++TR+R CP       D+ L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG T
Sbjct  211   GFSSTRQRGCPLSSSTTNDQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGST  270

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+K+P  F +DF +AMIK+ +IQPL    G+IR +CSAVN
Sbjct  271   DSIVSEYSKNPTTFKSDFAAAMIKMGDIQPLTASAGVIRSICSAVN  316



>ref|XP_007045349.1| Lignin-forming anionic peroxidase [Theobroma cacao]
 gb|EOY01181.1| Lignin-forming anionic peroxidase [Theobroma cacao]
Length=330

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/285 (64%), Positives = 221/285 (78%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRTA+R A++RERRMAASL+RLHFHDCFVQGCDASILLD  P I  EK+AL N  
Sbjct  46    NALGTIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDDAPSITSEKNALQNKD  105

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK ++E  CPGVVSCADIL VAARDA    GGPSW V LGRRDST A  +
Sbjct  106   SARGYEVIDKAKSDVENICPGVVSCADILAVAARDASEYVGGPSWTVKLGRRDSTTASVS  165

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A ++LP   + L++LI  F  KGLS RD+VALSG+HT+GQ QC  FR RIYN+ +D+D 
Sbjct  166   LATSELPRFTASLESLIDLFRSKGLSARDMVALSGSHTIGQAQCVTFRNRIYNNASDIDA  225

Query  512   DFANTRKRQCPEQ-QIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R+CP     GD NL+ LDLVTP  FDNNY+KNLMQKKGLL+SDQ LF+GG TD
Sbjct  226   GFASTRRRRCPATLGNGDGNLAALDLVTPNSFDNNYFKNLMQKKGLLESDQVLFSGGSTD  285

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +IVSEY+++P  F +DF +AMIK+ +I+PL    GIIR++CS V+
Sbjct  286   NIVSEYSRNPSTFKSDFAAAMIKMGDIEPLTGSAGIIRRICSRVD  330



>ref|XP_011032836.1| PREDICTED: lignin-forming anionic peroxidase-like [Populus euphratica]
Length=318

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 221/284 (78%), Gaps = 3/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTA+R A++ +RRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK AL N  
Sbjct  37    NALSAIRTAIRSAIAGDRRMAASLIRLHFHDCFVQGCDASILLDETSSIQSEKTALGNLN  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VIE AK E+EK CPGVVSCADI+ VAARDA    GGPS+AV LGRRDST A   
Sbjct  97    SARGYNVIEKAKTEVEKICPGVVSCADIIAVAARDASSYVGGPSYAVKLGRRDSTTASRT  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  +LP+ +  L++LI+ F KKGL+ RD+VALSG+HTLGQ QCF FR RIYN +++D  
Sbjct  157   LANAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRERIYNDSNIDAG  216

Query  509   FANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP  ++G D  L+PLDLVTP  FDNNY+KNLM+ KGLLQSDQ LFNGG TDS
Sbjct  217   FASTRRRRCP--RVGSDATLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDS  274

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+++P  F +DF SAMIK+ +I  L    G IR+ CS VN
Sbjct  275   IVSEYSRNPARFKSDFGSAMIKMGDIGLLTGSAGQIRRTCSVVN  318



>ref|XP_002521852.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40488.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=325

 Score =   375 bits (962),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 188/285 (66%), Positives = 219/285 (77%), Gaps = 6/285 (2%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++R +++ ERRMAASL+RLHFHDCFVQGCDASILLD TP IE EK ALPN  
Sbjct  45    NALSTIRTSIRNSIAAERRMAASLIRLHFHDCFVQGCDASILLDETPTIESEKTALPNKD  104

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY VI+ AK  +EK CPG+VSCADIL VAARDA    GGPSW V LGR+DST A   
Sbjct  105   SARGYGVIDKAKSAVEKICPGIVSCADILAVAARDASAYVGGPSWTVMLGRKDSTTASRT  164

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A ++LPS    LD LI  F  KGLS RD+VALSG+HTLGQ QCF FR RIY N T +D 
Sbjct  165   LANSELPSFKDGLDRLIYRFQSKGLSARDMVALSGSHTLGQAQCFTFRDRIYTNSTSIDA  224

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              FA+TR+R CP    GD  L+ LDLVTP  FDNNY+KNL+QKKGLL+SDQ LF+GG TDS
Sbjct  225   GFASTRRRGCPAVG-GDAKLAALDLVTPNSFDNNYFKNLIQKKGLLESDQVLFSGGSTDS  283

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGH-GIIRKVCSAVN  201
             IVSEY++SP AF++DF SAMIK+  I   I+G+ G IRK+CSAVN
Sbjct  284   IVSEYSRSPAAFSSDFASAMIKMGNI---INGNAGQIRKICSAVN  325



>ref|XP_002521868.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40504.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=323

 Score =   374 bits (961),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 219/285 (77%), Gaps = 6/285 (2%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++R +++ +RRMAASL+RLHFHDCFVQGCDASILLD TP I+ EK+ALPN  
Sbjct  43    NALSTIRTSIRNSIAADRRMAASLIRLHFHDCFVQGCDASILLDETPTIDSEKNALPNKD  102

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY VI  AK E+EK CPGVVSCADIL VAARDA    GGPSW V LGR+DST A   
Sbjct  103   SARGYGVIGKAKSEVEKICPGVVSCADILAVAARDASAYVGGPSWTVMLGRKDSTTASRT  162

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A T+LPS    LD LI++F  KGLS RD+VALSGAHTLGQ QCF FR RIY N  D+D 
Sbjct  163   LANTELPSFKDGLDRLISSFQIKGLSARDMVALSGAHTLGQAQCFTFRDRIYSNGPDIDA  222

Query  512   DFANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R CP   IG D NL+ LDLVTP  FDNNY+KNL+QKKGLL+SDQ LF+GG TD
Sbjct  223   GFASTRRRGCPA--IGDDANLAALDLVTPNSFDNNYFKNLIQKKGLLESDQILFSGGSTD  280

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV EY++SP  FN+DF SAMIK+  I  L    G IRK+CSAVN
Sbjct  281   SIVLEYSRSPATFNSDFASAMIKMGNI--LNANAGQIRKICSAVN  323



>ref|XP_004305595.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=326

 Score =   374 bits (960),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 185/285 (65%), Positives = 216/285 (76%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IR ++R AVS ERRMAASLVRLHFHDCFVQGCDASILLD T  I GEK+ALPN  
Sbjct  41    NALATIRKSIRTAVSAERRMAASLVRLHFHDCFVQGCDASILLDDTATIIGEKNALPNLN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY+VI+ AK  +EK CPGVVSCADI+ VAARDA V+ GGPSWAV LGRRDST A   
Sbjct  101   SVRGYEVIDDAKAAVEKLCPGVVSCADIVAVAARDASVAVGGPSWAVKLGRRDSTTASKT  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHT-DVDP  513
              A + LPS   +L++L   FA  GL+ RDLVALSGAH++GQ QCF FR RIYN T D+D 
Sbjct  161   LAESSLPSFLDNLESLTNRFAGLGLNVRDLVALSGAHSIGQAQCFTFRDRIYNKTSDIDA  220

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
             +FA+TRK  CP E  +G+ NL+ LDLVTP   DNNYYKNL+QKKGLL SDQ L++GG TD
Sbjct  221   NFASTRKSSCPAEANVGNANLAALDLVTPNQLDNNYYKNLIQKKGLLASDQVLYSGGSTD  280

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIVSEY+  P  F  DF +AMIK+  I PL   +G IR++CSA+N
Sbjct  281   SIVSEYSSKPAKFIADFATAMIKMGNINPLTGSNGQIRRICSALN  325



>emb|CBI27503.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   374 bits (961),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 230/296 (78%), Gaps = 3/296 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL+ IRTA+R AVSRERRMAASL+RLHFHDCFVQGCDASILLD +P I+ EK+A  NN 
Sbjct  47    SALSTIRTAIRTAVSRERRMAASLIRLHFHDCFVQGCDASILLDDSPTIQSEKNAPNNNN  106

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+  K ++E  CPGVVSCADIL VAARDA V+ GGP+W + LGRRDST +  +
Sbjct  107   SVRGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLS  166

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A T+LP+    LD L + F+ KGLS RD+VALSG+HT+GQ +C  FR RIY N T++D 
Sbjct  167   QAATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDA  226

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R+CP +   GD NL+PLDLVTP  FDNNY+KNL+Q+KGLLQSDQ LFNGG TD
Sbjct  227   GFASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTD  286

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN*LHFFKLVFPL  168
             SIV+EY+KSP  F++DF SAM+K+ +I+PLI   G IRK C+    ++ F  +FP 
Sbjct  287   SIVTEYSKSPSTFSSDFSSAMVKMGDIEPLIGSAGEIRKFCNPAYFINSFP-IFPF  341



>emb|CBI27505.3| unnamed protein product [Vitis vinifera]
Length=302

 Score =   372 bits (955),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/284 (64%), Positives = 221/284 (78%), Gaps = 2/284 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRTAVR AVSRERRMAASL+RLHFHDCFVQGCDASILL+ +  I+ EK+A  N  S
Sbjct  19    ALSTIRTAVRTAVSRERRMAASLIRLHFHDCFVQGCDASILLNDSSSIQSEKNAPNNLNS  78

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RGYDVI+  K E+E  CPG+VSCADIL VAARDA V+  GP+W VNLGRRDST +  ++
Sbjct  79    VRGYDVIDDVKSEVESICPGIVSCADILAVAARDASVAVSGPTWTVNLGRRDSTTSGLSQ  138

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A T+LP+    LD LI+ F  KGLS+RD+VALSG+HT+GQ +C  FR RIY N TD+D  
Sbjct  139   AATNLPNFSDGLDRLISLFGSKGLSERDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAG  198

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP     GD N++ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG TDS
Sbjct  199   FASTRRRRCPATSGDGDDNIAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  258

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV+ Y+KSP  F++DF SAM+K+  I+PL    G IRK+CSA+N
Sbjct  259   IVTGYSKSPSTFSSDFASAMVKMGNIEPLTGSAGEIRKLCSAIN  302



>ref|XP_002269058.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=319

 Score =   372 bits (955),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/284 (64%), Positives = 221/284 (78%), Gaps = 2/284 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRTAVR AVSRERRMAASL+RLHFHDCFVQGCDASILL+ +  I+ EK+A  N  S
Sbjct  36    ALSTIRTAVRTAVSRERRMAASLIRLHFHDCFVQGCDASILLNDSSSIQSEKNAPNNLNS  95

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RGYDVI+  K E+E  CPG+VSCADIL VAARDA V+  GP+W VNLGRRDST +  ++
Sbjct  96    VRGYDVIDDVKSEVESICPGIVSCADILAVAARDASVAVSGPTWTVNLGRRDSTTSGLSQ  155

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A T+LP+    LD LI+ F  KGLS+RD+VALSG+HT+GQ +C  FR RIY N TD+D  
Sbjct  156   AATNLPNFSDGLDRLISLFGSKGLSERDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAG  215

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP     GD N++ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG TDS
Sbjct  216   FASTRRRRCPATSGDGDDNIAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  275

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV+ Y+KSP  F++DF SAM+K+  I+PL    G IRK+CSA+N
Sbjct  276   IVTGYSKSPSTFSSDFASAMVKMGNIEPLTGSAGEIRKLCSAIN  319



>ref|XP_002509730.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51117.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=323

 Score =   372 bits (955),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/285 (62%), Positives = 220/285 (77%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTA+R AVSRERRM+ASLVRLHFHDCFVQGCD SILLD T  + GEK A  NN 
Sbjct  39    NALSTIRTAIRSAVSRERRMSASLVRLHFHDCFVQGCDGSILLDDTSSMTGEKFARNNNN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+ VI+ AK ++E  CPG+VSCADI+ VAARDA V+ GGPSW V LGRRDST A   
Sbjct  99    SVRGFQVIDNAKAQVESICPGIVSCADIVAVAARDASVAVGGPSWTVKLGRRDSTSASQR  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A  +LP     L++LI+ F +KGLS RD+VALSGAHT+GQ +C  FR RIYN+ +D+D 
Sbjct  159   LADANLPGFTDSLESLISLFERKGLSARDMVALSGAHTIGQARCLTFRGRIYNNASDIDA  218

Query  512   DFANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+RQCP     GD NL+ LDLVTP  FDNNY++NL+QKKGLLQSDQ LF+GG TD
Sbjct  219   GFASTRRRQCPANNGNGDGNLAALDLVTPNSFDNNYFRNLIQKKGLLQSDQVLFSGGSTD  278

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +IV+EY++SP  F++DF SAM+K+ +I+PL    G IR++C+ VN
Sbjct  279   NIVNEYSRSPSTFSSDFASAMVKMGDIEPLTGSQGEIRRLCNVVN  323



>ref|XP_002269266.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=326

 Score =   371 bits (952),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/283 (62%), Positives = 220/283 (78%), Gaps = 1/283 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  IRTAVR AVSRERRMAASL+RLHFHDCFVQGCDASILLD +  I+ EK+A  N  S
Sbjct  44    ALTTIRTAVRTAVSRERRMAASLIRLHFHDCFVQGCDASILLDDSSSIQSEKNAPNNLNS  103

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RGY+VI+  K ++E  CPGVVSCADI+ VAARDA V+  GP+W V LGRRDST +  + 
Sbjct  104   VRGYEVIDNIKSKVESICPGVVSCADIVAVAARDASVAVSGPTWTVKLGRRDSTTSGLSL  163

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A T+LPS    LD L++ F  KGLS RD+VALSG+HT+GQ +C  FR R+YN TD+D  F
Sbjct  164   AATNLPSFRDSLDKLVSLFGSKGLSARDMVALSGSHTIGQARCVTFRDRVYNGTDIDAGF  223

Query  506   ANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             A+TR+R+CP +   GD NL+PL+LVTP  FDNNY+KNL+Q+KGLLQSDQ LF+GG TD+I
Sbjct  224   ASTRRRRCPADNGNGDANLAPLELVTPNSFDNNYFKNLIQRKGLLQSDQVLFSGGSTDTI  283

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+EY+KSP+ F +DF SAM+K+ +I+PL    G+IRK C+ +N
Sbjct  284   VNEYSKSPKTFRSDFASAMVKMGDIEPLTGSAGVIRKFCNVIN  326



>ref|XP_006470886.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=317

 Score =   370 bits (950),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/283 (64%), Positives = 217/283 (77%), Gaps = 3/283 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  IRT +R AVSRERRMAASL+RLHFHDCFVQGCDASILLD +  I+ EK+ALPN  S
Sbjct  37    ALKTIRTGIRNAVSRERRMAASLLRLHFHDCFVQGCDASILLDDSSSIDSEKNALPNFKS  96

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI++ K ++E  CPGVVSCADI+ VAARDA  + GGPSWAV LGRRDST A  + 
Sbjct  97    VRGFEVIDSVKSQLESVCPGVVSCADIVAVAARDASFAVGGPSWAVKLGRRDSTTASRSL  156

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A  +LPS    LD LI+ FA KG + RDLVALSGAHT+GQ QC  FR RIY N +D+D  
Sbjct  157   A-ENLPSFTDGLDKLISTFATKGFTARDLVALSGAHTIGQAQCAFFRDRIYSNQSDIDAG  215

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA++R+RQCP    GD NLSPLDLVTP  FDNNY+KNL+QKKGLL SDQ LF+GG TDSI
Sbjct  216   FASSRRRQCPASG-GDSNLSPLDLVTPDSFDNNYFKNLVQKKGLLASDQVLFSGGSTDSI  274

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V EY+K+   F +DF +AMIK+++I PL    G IR+VC+ VN
Sbjct  275   VDEYSKNRSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNLVN  317



>ref|XP_008350979.1| PREDICTED: lignin-forming anionic peroxidase-like [Malus domestica]
Length=328

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/285 (63%), Positives = 212/285 (74%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  I+ A+R AVS ERRMAASL+RLHFHDCFVQGCDASILLD  P I  EK A  NN 
Sbjct  44    NALTTIKNAIRTAVSSERRMAASLIRLHFHDCFVQGCDASILLDDAPSITSEKGAFQNNG  103

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK CPGVVSCADIL VAARDA V+  GPSW V LGRRDST A   
Sbjct  104   SVRGFEVIDKAKAEVEKVCPGVVSCADILAVAARDASVAVSGPSWTVKLGRRDSTTASQX  163

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A + LP     LD L   F   GL+ RDLVALSGAHT+GQ +C  FR RIYN+ +D+D 
Sbjct  164   LAESSLPLFTDSLDXLRERFGDLGLNARDLVALSGAHTIGQARCVTFRGRIYNNASDIDS  223

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
             +FA TRKR+CP +   GD NL+PL+LVTP  FDNNYYKNL+QKKGLL+SDQ LF+GG TD
Sbjct  224   NFATTRKRRCPADANNGDANLAPLELVTPNSFDNNYYKNLIQKKGLLESDQVLFSGGSTD  283

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIVSEY+  P  F  DF++AMIK+ +I PL    G +R++CSA+N
Sbjct  284   SIVSEYSSKPATFKADFITAMIKMGDINPLTGSAGEVRRICSALN  328



>ref|XP_007045351.1| Lignin-forming anionic peroxidase [Theobroma cacao]
 gb|EOY01183.1| Lignin-forming anionic peroxidase [Theobroma cacao]
Length=330

 Score =   369 bits (948),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/285 (63%), Positives = 218/285 (76%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRTA+R A++RERRMAASL+RLHFHDCFVQGCDASIL D    I  EK+AL N  
Sbjct  46    NALRTIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILPDDASSITSEKNALQNKD  105

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK ++E  CPGVVSCADIL VAARDA    GGPSW V LGRRDST A  +
Sbjct  106   SARGYEVIDKAKSDVEHICPGVVSCADILAVAARDASEYVGGPSWRVKLGRRDSTTASVS  165

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A + LP   + L++LI  F  KGLS RD+VALSG+HT+GQ QC  FR RIYN+ +D+D 
Sbjct  166   LATSQLPRFTASLESLIDLFRSKGLSARDMVALSGSHTIGQAQCVTFRNRIYNNASDIDA  225

Query  512   DFANTRKRQCPEQ-QIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R+CP     GD NL+ LDLVTP  FDNNY+KNLMQKKGLL+SDQ LF+GG TD
Sbjct  226   GFASTRRRRCPATLGNGDGNLAALDLVTPNSFDNNYFKNLMQKKGLLESDQVLFSGGFTD  285

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +IVSEY+++P  F +DF +AMIK+ +I+PL    GI R++CSA+N
Sbjct  286   NIVSEYSRNPSTFKSDFATAMIKMGDIEPLTGSAGIARRICSAIN  330



>ref|XP_002521851.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40487.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=325

 Score =   369 bits (947),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/284 (65%), Positives = 215/284 (76%), Gaps = 6/284 (2%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRT++R A++RERRMAASL+RLHFHDCFVQGCDASILLD T  ++ EK ALPN  S
Sbjct  45    ALSTIRTSIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSMQSEKSALPNKDS  104

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY+VI+ AK  +EK CPGVVSCADIL VAARDA    GGPSW V LGRRDS  A    
Sbjct  105   ARGYEVIDKAKSAVEKICPGVVSCADILAVAARDASAYVGGPSWTVRLGRRDSKTASRTL  164

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A  DLPS    LD LI+ F  KGLS RD+VALSG+HTLGQ QCF FR RIY N T ++  
Sbjct  165   ANRDLPSFRDGLDRLISRFRSKGLSARDMVALSGSHTLGQAQCFTFRERIYSNGTKIEGG  224

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TR+R+CP    GD NL+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG TDSI
Sbjct  225   FASTRRRRCPAVG-GDANLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDSI  283

Query  329   VSEYAKSPEAFNTDFVSAMIKLSE-IQPLIDGHGIIRKVCSAVN  201
             V EY+K+ E FN+DF +AM+K+   I P     G IR++CSAVN
Sbjct  284   VLEYSKNRETFNSDFATAMVKMGNLINP---SRGEIRRICSAVN  324



>ref|XP_004297785.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=327

 Score =   369 bits (947),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/285 (64%), Positives = 213/285 (75%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IR ++R AVS ERRMAASL+RLHFHDCFVQGCDASILLD T  I GEK A PN  
Sbjct  43    NALATIRKSIRSAVSAERRMAASLIRLHFHDCFVQGCDASILLDDTSSITGEKTAPPNLN  102

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY VI+ AK E+EK CPGVVSCADI+ VAARDA V+ GGP W+V LGRRDST A  +
Sbjct  103   SVRGYGVIDNAKSEVEKLCPGVVSCADIVAVAARDASVAVGGPDWSVKLGRRDSTTASKS  162

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHT-DVDP  513
              AG+ LPS    L++L   FA  GL+ RDLVALSGAH++GQ QCF FR RIY++T D+D 
Sbjct  163   LAGSSLPSFLDSLESLTNRFAGLGLNARDLVALSGAHSIGQAQCFTFRGRIYSNTSDIDA  222

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
             +FA TR R CP     GD NL+ LDLVTP   DNNY+KNL+QKKGLL SDQ LF+GG TD
Sbjct  223   NFARTRGRTCPAAANDGDANLAALDLVTPNQLDNNYFKNLIQKKGLLASDQVLFSGGSTD  282

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIVSEY+  P  F  DF +AMIK+ +I PL   +G IR++CSA+N
Sbjct  283   SIVSEYSSKPANFKADFAAAMIKMGDINPLTGSNGQIRRICSALN  327



>ref|XP_002521866.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40502.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=325

 Score =   368 bits (945),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/284 (65%), Positives = 214/284 (75%), Gaps = 6/284 (2%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  IRT+++ A++RERRMAASL+RLHFHDCFVQGCDASILLD T  I+ EK ALPN  S
Sbjct  45    ALTTIRTSIKTAIARERRMAASLIRLHFHDCFVQGCDASILLDETSSIQSEKSALPNKDS  104

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY+VI+ AK  +EK CPGVVSCADIL VAARDA    GGPSW V LGRRDS  A    
Sbjct  105   ARGYEVIDTAKSAVEKICPGVVSCADILAVAARDASAYVGGPSWTVRLGRRDSKTASRTL  164

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A  DLPS    LD LI+ F  KGLS RD+VALSG+HTLGQ QCF FR RIY N T ++  
Sbjct  165   ANRDLPSFRDGLDRLISRFRSKGLSARDMVALSGSHTLGQAQCFTFRERIYSNGTKIEAG  224

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TR+R+CP    GD NL+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG TDSI
Sbjct  225   FASTRRRRCPAIG-GDANLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDSI  283

Query  329   VSEYAKSPEAFNTDFVSAMIKLSE-IQPLIDGHGIIRKVCSAVN  201
             V EY+K+ E FN+DF +AM+K+   I P     G IR++CSAVN
Sbjct  284   VLEYSKNRETFNSDFATAMVKMGNLINP---SRGEIRRICSAVN  324



>gb|KEH30580.1| lignin-forming anionic peroxidase [Medicago truncatula]
Length=308

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/287 (63%), Positives = 215/287 (75%), Gaps = 17/287 (6%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTA+R AVS+ERRMAASL+RLHFHDCFVQGCDASILLD T  IE EK ALPN  
Sbjct  35    NALSTIRTAIRTAVSKERRMAASLIRLHFHDCFVQGCDASILLDDTSTIESEKSALPNLN  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+ VI+ AK ++EK CPGVVSCADI+ +AARDA  + GGPSW V LGRRDST+A   
Sbjct  95    SVRGFQVIDKAKADVEKVCPGVVSCADIVAIAARDASFAVGGPSWTVKLGRRDSTIA---  151

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
                       +DL TLI+ F  KGL+ +D+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  152   ----------NDLTTLISHFTNKGLTLKDMVTLSGAHTIGQAQCFTFRDRIYNNASDIDV  201

Query  512   DFANTRKRQCPEQQIGDKN--LSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGV  342
              FA+TR+R CP       N  L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF  GG 
Sbjct  202   GFASTRQRGCPSSSTTTNNQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFGGGGS  261

Query  341   TDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             TDSIVSEY+K+P  F +DF +AMIK+ +IQPL    GIIR +CSA+N
Sbjct  262   TDSIVSEYSKNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRSICSAIN  308



>ref|XP_002509738.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51125.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=320

 Score =   367 bits (943),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/285 (61%), Positives = 217/285 (76%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL+ I+ A+  AVSRE+RMAASL+RLHFHDCFVQGCD SILLD TP + GEK A  N  
Sbjct  36    SALSTIKGAISTAVSREQRMAASLIRLHFHDCFVQGCDGSILLDDTPTMTGEKTARNNAN  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E  CPG+VSCADI+ VAARDA V+A GPSW+VNLGRRDST A  +
Sbjct  96    SVRGFDVIDNIKSQLESRCPGIVSCADIVAVAARDASVAASGPSWSVNLGRRDSTTASRS  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A ++LP+    LD L + F  KGLS+RD+VALSGAHT+GQ QC  FR RIYN+ +D+D 
Sbjct  156   LADSNLPAFTDSLDRLTSLFGSKGLSQRDMVALSGAHTIGQAQCVTFRGRIYNNASDIDA  215

Query  512   DFANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA TR+ QCP     GD NL+PLDLVTP +FDNNY++NL+QKKGLLQSDQ LF+GG TD
Sbjct  216   GFAATRRSQCPAASGSGDSNLAPLDLVTPNIFDNNYFRNLIQKKGLLQSDQVLFSGGATD  275

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV++Y++    F++DF SAM+K+  I PL    G IR+VC+ VN
Sbjct  276   SIVNQYSRDSSVFSSDFASAMVKMGNISPLTGSQGQIRRVCNVVN  320



>emb|CDP16312.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   365 bits (936),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 211/266 (79%), Gaps = 7/266 (3%)
 Frame = -2

Query  992  MAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSC  813
            MAASL+RLHFHDCFVQGCD SILLD TP I+ EK A PNN S RG++VIEAAKRE+EK C
Sbjct  1    MAASLIRLHFHDCFVQGCDGSILLDETPTIQSEKTARPNNNSTRGFEVIEAAKREVEKIC  60

Query  812  PGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITA  633
            PGVVSCADIL+VAARDA V+ GGP+W V LGRRDS  A  + A ++LPSP+++L  LI+ 
Sbjct  61   PGVVSCADILSVAARDASVAVGGPTWQVKLGRRDSITASRSAAESNLPSPFANLRDLISN  120

Query  632  FAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPDFANTRKRQCPEQ-QIGDK  459
            F  KGLS RD+VALS     GQ QCF+FR R+Y N TD+D  FA+TR+RQCP+    GD 
Sbjct  121  FKNKGLSARDMVALS-----GQAQCFVFRNRVYSNGTDIDAGFASTRRRQCPQAVGNGDS  175

Query  458  NLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVS  279
            NL+PLDLVTP  FDNNY+KNLM+KKGLL SDQ LF+GG TDSIVSEY+++P  F +DF S
Sbjct  176  NLAPLDLVTPNSFDNNYFKNLMRKKGLLISDQALFSGGSTDSIVSEYSRNPRTFLSDFAS  235

Query  278  AMIKLSEIQPLIDGHGIIRKVCSAVN  201
            AM+K+ +++PL    GIIRKVCSAV+
Sbjct  236  AMVKMGDLEPLTGASGIIRKVCSAVS  261



>ref|XP_010527854.1| PREDICTED: peroxidase 5-like [Tarenaya hassleriana]
Length=321

 Score =   366 bits (940),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/286 (62%), Positives = 221/286 (77%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A++RERRMAASL+RLHFHDCFV GCDASILL++TP +E E++A+PN+ 
Sbjct  37    NALSTIRSSIRTAIARERRMAASLIRLHFHDCFVNGCDASILLEATPKMESEREAVPNSR  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY+VIE AK +++K CPGVVSCADILTVAARDA    GGP W V LGRRDST A+ A
Sbjct  97    SVRGYEVIEKAKSQVDKICPGVVSCADILTVAARDASEYVGGPKWTVKLGRRDSTRAFKA  156

Query  689   KA-GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A G +LPS    LD L   F++KGL  RD VALSGAHT+G+ QCFLFR R+Y N +D+D
Sbjct  157   LADGGELPSFKDSLDQLTRLFSRKGLDTRDFVALSGAHTIGKAQCFLFRERLYDNSSDID  216

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFN-GGVT  339
               FA TRK +CP    GD+N+  LD+VTP  FDNNYY+NLMQKKGLL +DQ LF  G  T
Sbjct  217   RGFAATRKTRCPAAG-GDRNMEDLDMVTPDSFDNNYYRNLMQKKGLLATDQVLFGRGAAT  275

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DS+VSEY+++P  F +DF +AM+K+++I PL    G IR++CSAVN
Sbjct  276   DSVVSEYSRNPSKFASDFAAAMVKMADIDPLTGSAGQIRRICSAVN  321



>ref|XP_010654887.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=331

 Score =   367 bits (941),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 174/284 (61%), Positives = 224/284 (79%), Gaps = 2/284 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRTA+R AVSRERRMAASL+RLHFHDCFVQGCDASILLD +  I+ EK+A  NN S
Sbjct  48    ALSTIRTAIRTAVSRERRMAASLIRLHFHDCFVQGCDASILLDDSATIQSEKNAPNNNNS  107

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+  K ++E  CPGVVSCADIL VAARD+ V+ GGP+W V LGRRDST +  ++
Sbjct  108   VRGFEVIDNVKSQVESICPGVVSCADILAVAARDSSVAVGGPTWTVKLGRRDSTTSGLSQ  167

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A  +LPS    LD L++ F+ KGL+ R++VALSG+HT+GQ +C  FR RI+ N T++D  
Sbjct  168   AAANLPSFRDGLDKLVSLFSSKGLNTREMVALSGSHTIGQARCVTFRDRIHDNGTNIDAG  227

Query  509   FANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP +   GD NL+PLDLVTP  FDNNY+KNL+Q+KGLLQSDQ LFNGG TDS
Sbjct  228   FASTRRRRCPVDNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDS  287

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV+EY+KS   F++DF +AM+K+ +I PL   +G IRK+C+A+N
Sbjct  288   IVTEYSKSRSTFSSDFAAAMVKMGDIDPLTGSNGEIRKLCNAIN  331



>gb|AAF43956.1|AC012188_33 Strong similarity to an Anionic Peroxidase Precursor from Nicotiana 
sylvestris gi|1076611 and contains a Peroxidase PF|00141 
domain [Arabidopsis thaliana]
Length=310

 Score =   365 bits (938),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 218/286 (76%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR++VR A++RERRMAASL+R+HFHDCFV GCDASILL+ T  IE E+DALPN  
Sbjct  26    NALSKIRSSVRTAIARERRMAASLIRMHFHDCFVHGCDASILLEGTSTIESERDALPNFK  85

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK CPG+VSCADI+ VAARDA    GGP WAV +GRRDST A+ A
Sbjct  86    SVRGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKA  145

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + +LP     LD L   F+KKGL+ RDLVALSGAHT+GQ+QCFLFR R+Y N +D+D
Sbjct  146   LANSGELPGFKDTLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDID  205

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-T  339
               FA+TRKR+CP    GD NL+ LDLVTP  FDNNYYKNLMQKKGLL +DQ LF  G  T
Sbjct  206   AGFASTRKRRCPTVG-GDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGAST  264

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             D IVSEY+K+   F  DF +AMIK+  I+PL   +G IRK+CS VN
Sbjct  265   DGIVSEYSKNRSKFAADFATAMIKMGNIEPLTGSNGEIRKICSFVN  310



>ref|NP_172907.1| peroxidase 5 [Arabidopsis thaliana]
 sp|Q9M9Q9.2|PER5_ARATH RecName: Full=Peroxidase 5; Short=Atperox P5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE29180.1| peroxidase 5 [Arabidopsis thaliana]
Length=321

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 218/286 (76%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR++VR A++RERRMAASL+R+HFHDCFV GCDASILL+ T  IE E+DALPN  
Sbjct  37    NALSKIRSSVRTAIARERRMAASLIRMHFHDCFVHGCDASILLEGTSTIESERDALPNFK  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK CPG+VSCADI+ VAARDA    GGP WAV +GRRDST A+ A
Sbjct  97    SVRGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKA  156

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + +LP     LD L   F+KKGL+ RDLVALSGAHT+GQ+QCFLFR R+Y N +D+D
Sbjct  157   LANSGELPGFKDTLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDID  216

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-T  339
               FA+TRKR+CP    GD NL+ LDLVTP  FDNNYYKNLMQKKGLL +DQ LF  G  T
Sbjct  217   AGFASTRKRRCPTVG-GDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGAST  275

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             D IVSEY+K+   F  DF +AMIK+  I+PL   +G IRK+CS VN
Sbjct  276   DGIVSEYSKNRSKFAADFATAMIKMGNIEPLTGSNGEIRKICSFVN  321



>ref|XP_006470885.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=317

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/283 (64%), Positives = 215/283 (76%), Gaps = 3/283 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  IRT +R AVS ERRMAASL+RLHFHDCFVQGCDASILLD +  I+ EK+ALPN  S
Sbjct  37    ALKTIRTGIRNAVSGERRMAASLLRLHFHDCFVQGCDASILLDDSSSIDSEKNALPNFKS  96

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI++ K ++E  CPGVVSCADI+ VAARDA  + GGPSW V LGRRDST A  + 
Sbjct  97    VRGFEVIDSVKSQLESVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASRSL  156

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A  +LPS    LD LI+ FA KG S RDLVALSGAHT+GQ QC  FR RIY N +D+D  
Sbjct  157   A-ENLPSFTDGLDRLISTFATKGFSARDLVALSGAHTIGQAQCAFFRDRIYSNQSDIDAG  215

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TR+R+CP    GD NLSPLDLVTP  FDNNY+KNL+QKKGLL SDQ LF+GG TDSI
Sbjct  216   FASTRRRECPASG-GDSNLSPLDLVTPDSFDNNYFKNLVQKKGLLASDQVLFSGGSTDSI  274

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V EY+K+   F +DF +AMIK+++I PL    G IR+VC+ VN
Sbjct  275   VDEYSKNRSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNLVN  317



>ref|XP_008220986.1| PREDICTED: lignin-forming anionic peroxidase-like [Prunus mume]
Length=327

 Score =   365 bits (936),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/285 (62%), Positives = 218/285 (76%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  I++++ +AVSRERRMAASLVRLHFHDCFVQGCDAS+LL+ +  I  EK+A  N  
Sbjct  43    NALATIKSSISRAVSRERRMAASLVRLHFHDCFVQGCDASLLLNDSASIVSEKNAFQNRG  102

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK ++EK CPGVVSCADIL VAARDA V+  GPSW V LGRRD+T A  A
Sbjct  103   SARGFEVIDDAKAQVEKICPGVVSCADILAVAARDASVAVSGPSWTVKLGRRDATRASQA  162

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A +DLP     LD LI+ F  +GLS RDLVALSGAHT+GQ QCF FR RIY N +D+D 
Sbjct  163   QAESDLPLFTDSLDRLISRFGDRGLSPRDLVALSGAHTIGQAQCFTFRDRIYSNGSDIDS  222

Query  512   DFANTRKRQCPEQQI-GDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
             +FA TR+R+CP     G+ NL+PLDLVTP  FD NY+KNL+QKKGLL+SDQ LF+GG TD
Sbjct  223   NFATTRRRRCPAAAPNGNANLAPLDLVTPNSFDYNYFKNLIQKKGLLESDQVLFSGGSTD  282

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIVSEY+  P  F +DF  AMIK+ ++ PL    G IR++C+A+N
Sbjct  283   SIVSEYSSKPATFRSDFGIAMIKMGDVSPLTGSAGEIRRICTALN  327



>ref|XP_007226601.1| hypothetical protein PRUPE_ppa023604mg [Prunus persica]
 gb|EMJ27800.1| hypothetical protein PRUPE_ppa023604mg [Prunus persica]
Length=304

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/285 (62%), Positives = 219/285 (77%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  I++++ +AVS+ERRMAASL+RLHFHDCFVQGCDAS+LL+ +  I  EK+A  N  
Sbjct  20    NALATIKSSISRAVSQERRMAASLMRLHFHDCFVQGCDASLLLNDSASIVSEKNAFQNRG  79

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK ++EK CPGVVSCADIL VAARDA V+  GPSW V LGRRD+T A  A
Sbjct  80    SARGFEVIDDAKAQVEKICPGVVSCADILAVAARDASVAVSGPSWTVKLGRRDATRASQA  139

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
             +A +DLP     LD LI+ F  +GLS RDLVALSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  140   QAESDLPLFTDSLDRLISRFGDRGLSPRDLVALSGAHTIGQAQCFTFRDRIYNNGSDIDS  199

Query  512   DFANTRKRQCPEQQI-GDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
             +FA TR+R+CP     G+ NL+PLDLVTP  FD NY+KNL+QKKGLL+SDQ LF+GG TD
Sbjct  200   NFATTRRRRCPAAAPNGNTNLAPLDLVTPNSFDYNYFKNLIQKKGLLESDQVLFSGGSTD  259

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIVSEY+  P  F +DF  AMIK+ ++ PL    G IR++C+AVN
Sbjct  260   SIVSEYSSKPATFRSDFGIAMIKMGDVSPLTGSAGEIRRICTAVN  304



>ref|XP_002274693.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=324

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/284 (62%), Positives = 220/284 (77%), Gaps = 2/284 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRTA R+AVSRERRMAASL+RLHFHDCFVQGCDASILLD +  I+ EK+A  N  S
Sbjct  41    ALSTIRTATRKAVSRERRMAASLIRLHFHDCFVQGCDASILLDDSSSIQSEKNAPNNLNS  100

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY+VI   K ++E  CPG+VSCADIL VAARDA V+ GGP+W V LGRRDST +  ++
Sbjct  101   ARGYEVIHDVKSQVESICPGIVSCADILAVAARDASVAVGGPTWTVKLGRRDSTTSGLSQ  160

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
               ++LPS    LD LI+ F  KGLS RD+VALSG+HT+GQ +C  FR RIY N TD+D  
Sbjct  161   VSSNLPSFRDSLDRLISLFGSKGLSTRDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAG  220

Query  509   FANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP +   GD NL+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG TDS
Sbjct  221   FASTRRRRCPADNGDGDDNLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IVSEY+K+ + F++DF  AM+K+ +I+PL    G IR+ C+A+N
Sbjct  281   IVSEYSKNRKTFSSDFALAMVKMGDIEPLTGAAGEIREFCNAIN  324



>ref|XP_004298191.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=325

 Score =   363 bits (933),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 182/285 (64%), Positives = 209/285 (73%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IR +VR AVS ERRMAASLVRLHFHDCFVQGCDASILLD T  I GEK A PN  
Sbjct  41    NALATIRKSVRTAVSAERRMAASLVRLHFHDCFVQGCDASILLDDTASITGEKTARPNLN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY VI+ AK  +EK CPGVVSCADI+ VAARDA V+ GGP WAV LGRRDST A   
Sbjct  101   SVRGYGVIDNAKAAVEKLCPGVVSCADIVAVAARDASVAVGGPDWAVKLGRRDSTTASKT  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHT-DVDP  513
              A + LPS    L++L    A  GL+ RDLVALSGAH++GQ QCF FR RIYN T D+D 
Sbjct  161   LAESSLPSFLDSLESLTNRLAGLGLNVRDLVALSGAHSIGQAQCFTFRDRIYNETSDIDA  220

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
             +FA TR R+CP     G+ NL+PLDLVTP   DNNY+KNL+QKKGLL SDQ LF+GG TD
Sbjct  221   NFARTRGRRCPAAANDGNANLAPLDLVTPNQLDNNYFKNLIQKKGLLASDQVLFSGGSTD  280

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             S+VSEY+  P  F  DF +AMIK+  I PL   +G IR++CSA+N
Sbjct  281   SVVSEYSSKPAKFKADFATAMIKMGNINPLTGSNGQIRRICSALN  325



>ref|XP_002299006.2| hypothetical protein POPTR_0001s46290g [Populus trichocarpa]
 gb|EEE83811.2| hypothetical protein POPTR_0001s46290g [Populus trichocarpa]
 gb|AHL39117.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   363 bits (932),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 171/285 (60%), Positives = 220/285 (77%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRTA+R+AVS ERRMAASL+RLHFHDCFVQGCDASI+LD++P I+ EK +  NN 
Sbjct  38    NALTTIRTAIRRAVSSERRMAASLIRLHFHDCFVQGCDASIMLDNSPSIDSEKFSFSNNN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++V++ AK ++E  CPGVVSCADI  VAARDA V+ GGPSW V LGRRDST A  +
Sbjct  98    SIRGFEVVDDAKAQVESICPGVVSCADIAAVAARDASVAVGGPSWTVRLGRRDSTTASRS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +D+P   + L  LI  F  KGLS+RD+VALSG+HT+GQ +C  FR RIY N +D+D 
Sbjct  158   LADSDIPRATTSLVNLIGMFNGKGLSERDMVALSGSHTIGQARCVTFRGRIYDNSSDIDA  217

Query  512   DFANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R CP     G+ NL+PLDLVTP  FDNNY++NL+Q++GLLQSDQ LF+G  TD
Sbjct  218   GFASTRRRNCPSASGNGNNNLAPLDLVTPNSFDNNYFRNLIQRRGLLQSDQVLFSGQSTD  277

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+++P  F++DF +AM+++ +I+PL    G IR+VCS VN
Sbjct  278   SIVTEYSRNPSLFSSDFAAAMLRMGDIEPLTGSQGEIRRVCSVVN  322



>gb|KDP25488.1| hypothetical protein JCGZ_20644 [Jatropha curcas]
Length=320

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/284 (62%), Positives = 212/284 (75%), Gaps = 2/284 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ I+ AV +AVS ERRMAASLVRLHFHDCFVQGCD S+LLD T  + GEK A  N  S
Sbjct  37    ALSTIKEAVAKAVSSERRMAASLVRLHFHDCFVQGCDGSVLLDDTSSMTGEKTARNNANS  96

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+  K ++E  CPG+VSCADI+ VAARDA V+AGGPSW VNLGRRDST A    
Sbjct  97    IRGFNVIDNIKSQVESRCPGIVSCADIVAVAARDASVAAGGPSWTVNLGRRDSTTASKTL  156

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A  +LP+    LD L + F+ KGLS+RD+VALSGAHT+GQ +C  FR RIY N +D+D  
Sbjct  157   ADNNLPAFTDTLDKLTSLFSSKGLSQRDMVALSGAHTIGQARCLTFRSRIYSNGSDIDAG  216

Query  509   FANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FANTRKR CP +   GD NL+PLDLVTP  FDNNYY+NL+ KKGLLQSDQ LF+GG TDS
Sbjct  217   FANTRKRNCPSDSGNGDGNLAPLDLVTPNNFDNNYYRNLISKKGLLQSDQVLFSGGATDS  276

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV++Y+K    F +DF SAM+K+  I PL    G IR+VC+ VN
Sbjct  277   IVNQYSKDGSIFRSDFASAMVKMGNISPLTGSQGEIRRVCNVVN  320



>ref|XP_011013621.1| PREDICTED: lignin-forming anionic peroxidase-like [Populus euphratica]
Length=322

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/285 (60%), Positives = 219/285 (77%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRTA+R+AVS +RRMAASL+RLHFHDCFVQGCDASI+LD++P I+ EK +  NN 
Sbjct  38    NALTTIRTAIRRAVSSDRRMAASLIRLHFHDCFVQGCDASIMLDNSPSIDSEKFSFSNNN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK  +E  CPGVVSCADI  VAARDA V+ GGPSW V LGRRDST A  +
Sbjct  98    SIRGFEVIDEAKARVESICPGVVSCADIAAVAARDASVAVGGPSWTVRLGRRDSTTASQS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +D+P   + L  LI  F  KGLS+RD+VALSG+HT+GQ +C  FR RIY N +D+D 
Sbjct  158   LADSDIPRTTTSLVNLIDMFNGKGLSERDMVALSGSHTIGQARCVTFRGRIYDNSSDIDA  217

Query  512   DFANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R CP     G+ NL+PLDLVTP  FDNNY++NL+Q++GLLQSDQ LF+G  TD
Sbjct  218   GFASTRRRNCPSASGDGNNNLAPLDLVTPNSFDNNYFRNLIQRRGLLQSDQVLFSGQSTD  277

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+++P  F++DF +AM+++ +I+PL    G IR+VCS VN
Sbjct  278   SIVTEYSRNPSLFSSDFAAAMLRMGDIEPLTGSQGEIRRVCSVVN  322



>ref|XP_006370761.1| Peroxidase 4 precursor family protein [Populus trichocarpa]
 gb|ERP67330.1| Peroxidase 4 precursor family protein [Populus trichocarpa]
 gb|AHL39118.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/285 (60%), Positives = 219/285 (77%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRTA+R+AVS ERRMAASL+RLHFHDCFVQGCDASI+LD++P I+ EK +  NN 
Sbjct  38    NALTTIRTAIRRAVSSERRMAASLIRLHFHDCFVQGCDASIMLDNSPSIDSEKFSFSNNN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK ++E  CPGVVSCADI  VAARDA V+ GGPSW V LGRRDST A  +
Sbjct  98    SIRGFEVIDDAKAQVESICPGVVSCADIAAVAARDASVAVGGPSWTVRLGRRDSTTASRS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +D+P   + L  LI  F  KGLS+RD+VALSG+HT+GQ +C  FR RIY N +D+D 
Sbjct  158   LADSDIPRATTSLVNLIGMFNGKGLSERDMVALSGSHTIGQARCVTFRGRIYDNSSDIDA  217

Query  512   DFANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R CP     G+ NL+PLDLVTP  FDNNY++NL+Q++GLLQSDQ LF+G  TD
Sbjct  218   GFASTRRRNCPSASGNGNNNLAPLDLVTPNSFDNNYFRNLIQRRGLLQSDQELFSGQSTD  277

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+++   F++DF +AM+++ +I+PL    G IR+VCS VN
Sbjct  278   SIVTEYSRNASLFSSDFAAAMLRMGDIEPLTGSQGEIRRVCSVVN  322



>ref|XP_006848018.1| hypothetical protein AMTR_s00029p00173190 [Amborella trichopoda]
 gb|ERN09599.1| hypothetical protein AMTR_s00029p00173190 [Amborella trichopoda]
Length=321

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/283 (62%), Positives = 208/283 (73%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTA+  A+S ERRM ASL+RLHFHDCFV GCDAS+LLDST   E E++A+ N  
Sbjct  40    NALSTIRTAIHAAISAERRMGASLIRLHFHDCFVNGCDASLLLDSTSSFESEQNAIQNIE  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+ VIE AK  +E  CPGVVSCADIL VAARD+ V  GGPSW V LGRRDS  A  +
Sbjct  100   SARGFQVIEKAKSRVESICPGVVSCADILAVAARDSSVKLGGPSWTVKLGRRDSATASKS  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
             +A  +LP   + LD+LI+ F +KGLS +DLVALSGAHT+GQ QCF FR RIYNHT++D  
Sbjct  160   EAERELPLFTTPLDSLISRFRRKGLSAKDLVALSGAHTIGQAQCFTFRDRIYNHTNIDSG  219

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA  R+ +CP    GD  L+PLDLVTP  FDNNY+K LMQKKGLL+SDQ LFNGG TD I
Sbjct  220   FARKRRNRCPSNG-GDSKLAPLDLVTPTSFDNNYFKILMQKKGLLESDQVLFNGGSTDEI  278

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+KS  AF +DF  AM+K+ +I+PL    G IR  CS  N
Sbjct  279   VRSYSKSRSAFYSDFAEAMVKMGDIEPLTGSAGQIRARCSVPN  321



>gb|KDP25492.1| hypothetical protein JCGZ_20648 [Jatropha curcas]
Length=320

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 178/285 (62%), Positives = 219/285 (77%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL  IRTA+R+AV RERRMAASL+RLHFHDCFVQGCD SILLD T  I GEK A  NN 
Sbjct  36    DALTTIRTAIRRAVYRERRMAASLIRLHFHDCFVQGCDGSILLDDTASITGEKTAGGNNN  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+ AK ++E  CPG+VSCADIL VAARDA V+ GGPSW V LGRRDST A   
Sbjct  96    SARGYEVIDDAKAQVESVCPGIVSCADILAVAARDASVAVGGPSWTVKLGRRDSTTASRT  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A  +LPS  + L++LI+ F  KGLS+RD+VALSGAHT+GQ QC  FR RIY N +D+D 
Sbjct  156   LANANLPSFTASLESLISQFRNKGLSERDMVALSGAHTIGQAQCLTFRNRIYSNGSDIDA  215

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA  R+R+CP +   G+ NL+PLDLVTP  FDNNY++NL+Q+KGLL SDQ LF+GG TD
Sbjct  216   GFATIRRRRCPADPNTGNGNLAPLDLVTPNSFDNNYFRNLLQRKGLLHSDQVLFSGGSTD  275

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+ SP  F++DF SAM+++ +I+PL    G IR++C  VN
Sbjct  276   SIVNEYSSSPSTFSSDFASAMVRMGDIEPLTGSQGQIRRLCRVVN  320



>ref|XP_010654860.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=331

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/284 (61%), Positives = 219/284 (77%), Gaps = 2/284 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  I+TAVR AVSRERRMAASL+RLHFHDCFVQGCDASILLD +  I+ EK+A  N  S
Sbjct  48    ALTTIQTAVRTAVSRERRMAASLIRLHFHDCFVQGCDASILLDDSSSIQSEKNAPNNLNS  107

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RGY+VI+  K ++E  CPGVVSCADI+ VAARDA V+  GP+W V LGRRDST +  ++
Sbjct  108   VRGYEVIDNIKSKVESLCPGVVSCADIVAVAARDASVAVSGPTWTVRLGRRDSTTSGLSQ  167

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
             A T+LPS    LD L++ F  KGLS RD+VALSG+HT+GQ +C  FR RIY N TD+D  
Sbjct  168   AATNLPSFRDSLDKLVSLFGSKGLSARDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAG  227

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP     GD NL+PL+LVTP  FDNNY+KNL+++KGLLQSDQ LF+GG TD+
Sbjct  228   FASTRRRRCPANNGNGDDNLAPLELVTPNSFDNNYFKNLIRRKGLLQSDQVLFSGGSTDT  287

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV+EY+KSP+ F +DF SAM+K+ +I+ L    G+IRK C+ +N
Sbjct  288   IVNEYSKSPKTFRSDFASAMVKMGDIEALTGSAGVIRKFCNVIN  331



>emb|CDY66455.1| BnaAnng22270D [Brassica napus]
Length=317

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/286 (62%), Positives = 221/286 (77%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERR+AASL+RLHFHDCFV GCDAS++L +TP +E E+DA+PN  
Sbjct  33    NALSTIRSSIRTAISRERRIAASLIRLHFHDCFVNGCDASVMLVATPTMESERDAVPNFQ  92

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VIE AK  +E+ CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  93    SARGFEVIEQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPKYAVKVGRRDSTAAFRA  152

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLPS  + LD L   F +KGL+ RDLVALSGAHTLGQ QC  F+ R+Y N +D+D
Sbjct  153   IADSGDLPSFRASLDELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKERLYDNSSDID  212

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-T  339
               F++TRKR+CP    GD NL+PLDLVTP  FDNNYY+NLMQKKGLL SDQ LF  G  T
Sbjct  213   AGFSSTRKRRCPVNG-GDTNLAPLDLVTPNSFDNNYYRNLMQKKGLLASDQVLFGAGAST  271

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+++P  F +DF +AMIK+ +IQ L    G IR++C+AVN
Sbjct  272   DSIVSEYSRNPSRFASDFGAAMIKMGDIQTLTGSAGQIRRICTAVN  317



>ref|XP_010476510.1| PREDICTED: peroxidase 5 [Camelina sativa]
Length=321

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/287 (62%), Positives = 219/287 (76%), Gaps = 6/287 (2%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IR+++R A++RERRMAASL+R+HFHDCFV GCDASILL+ T  IE E+DALPN  
Sbjct  37    NALPKIRSSIRTAIARERRMAASLIRMHFHDCFVHGCDASILLEGTSTIESERDALPNFK  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK CPG+VSCADI+ VAARDA    GGP WAV +GRRDST A+ A
Sbjct  97    SVRGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKA  156

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + +LP    +LD L   F+KKGL+ RDLVALSGAHT+GQ+QCFLFR R+Y N +D+D
Sbjct  157   LANSGELPGFKDNLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDID  216

Query  515   PDFANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-  342
               FA+TRKR+CP   +G D NL+ LDLVTP  FDNNYYKNLMQKKGLL +DQ LF  G  
Sbjct  217   AGFASTRKRRCP--TVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGAS  274

Query  341   TDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             TD IVSEY+++   F  DF +AMIK+ +I+PL    G IRK+CS VN
Sbjct  275   TDGIVSEYSRNRSKFAADFATAMIKMGDIEPLTGSTGEIRKLCSFVN  321



>ref|XP_002890062.1| hypothetical protein ARALYDRAFT_312453 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66321.1| hypothetical protein ARALYDRAFT_312453 [Arabidopsis lyrata subsp. 
lyrata]
Length=321

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/287 (62%), Positives = 220/287 (77%), Gaps = 6/287 (2%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL+ IR+++R A++RERRMAASL+R+HFHDCFV GCDASILL+ T  IE E+DALPN  
Sbjct  37    SALSKIRSSIRTAITRERRMAASLIRMHFHDCFVHGCDASILLEGTSKIESERDALPNFK  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK CPG+VSCADI+ VAARDA    GGP WAV +GRRDST A+ A
Sbjct  97    SVRGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTTAFKA  156

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + +LP    +LD L   F+KKGL+ RDLVALSGAHT+GQ+QCFLFR R+Y N +D+D
Sbjct  157   LANSGELPGFKDNLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDID  216

Query  515   PDFANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-  342
               FA+TRKR+CP   +G D NL+ LDLVTP  FDNNYYKNLMQKKGLL +DQ LF  G  
Sbjct  217   AGFASTRKRRCP--TVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGAS  274

Query  341   TDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             TD IVSEY+++   F  DF +AMIK+ +I+PL    G IRK+CS VN
Sbjct  275   TDGIVSEYSRNRSKFAADFATAMIKMGDIEPLTGSTGEIRKICSFVN  321



>ref|XP_010458957.1| PREDICTED: peroxidase 5-like isoform X2 [Camelina sativa]
Length=321

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/287 (62%), Positives = 220/287 (77%), Gaps = 6/287 (2%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A++RERRMA SL+R+HFHDCFVQGCDASILL+ T  IE E+DALPN  
Sbjct  37    NALSKIRSSIRTAIARERRMAPSLIRMHFHDCFVQGCDASILLEGTSTIESERDALPNFK  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK CPG+VSCADI+ VAARDA    GGP WAV +GRRDST A+ A
Sbjct  97    SVRGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTTAFKA  156

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + ++P    +LD L   F+KKGL+ RDLVALSGAHT+GQ+QCFLFR R+Y N +D+D
Sbjct  157   LANSGEVPGFKDNLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDID  216

Query  515   PDFANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-  342
               FA+TRKR+CP   +G D NL+ LDLVTP  FDNNYYKNLMQKKGLL +DQ LF  G  
Sbjct  217   AGFASTRKRRCP--TVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGAS  274

Query  341   TDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             TD IVSEY+++   F  DF +AMIK+ +I+PL    G IR++CS VN
Sbjct  275   TDGIVSEYSRNRSKFAADFATAMIKMGDIEPLTASTGEIRRICSFVN  321



>ref|XP_010088521.1| Lignin-forming anionic peroxidase [Morus notabilis]
 gb|EXB36438.1| Lignin-forming anionic peroxidase [Morus notabilis]
Length=323

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/285 (61%), Positives = 215/285 (75%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++R A+S ERRMAASL+RLHFHDCFVQGCDASILL+ +  I  E+ A  N  
Sbjct  39    NALSTIRTSIRSAISAERRMAASLIRLHFHDCFVQGCDASILLEDSASIVSEQSAGQNRN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+V+E AK  +E  CPGVVSCADIL VAARDA V  GGPSW V LGRRDST A  +
Sbjct  99    SARGYEVVEEAKSAVESICPGVVSCADILAVAARDASVVVGGPSWTVKLGRRDSTTASLS  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRI-YNHTDVDP  513
             +A +DLP+   DL TLI  F +KGLS RD+VALSG+HT+GQ +C  FR R+  N +D+D 
Sbjct  159   QAQSDLPNFTDDLQTLINLFNRKGLSTRDMVALSGSHTIGQARCLTFRGRVNSNTSDIDA  218

Query  512   DFANTRKRQCPEQQIGDKN-LSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R+CP     + + L+PLDLVTP   DNNY+KNL+QKKGLLQSDQ L++G  T 
Sbjct  219   GFASTRRRRCPADVTKENSTLAPLDLVTPNQLDNNYFKNLIQKKGLLQSDQILYSGAPTK  278

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              IV+EY+KSP  F++DF SAMIK+ +I+PL    G IRK+C AVN
Sbjct  279   DIVTEYSKSPSIFSSDFASAMIKMGDIEPLTGSAGEIRKICKAVN  323



>ref|XP_006848008.1| hypothetical protein AMTR_s00029p00168370 [Amborella trichopoda]
 gb|ERN09589.1| hypothetical protein AMTR_s00029p00168370 [Amborella trichopoda]
Length=324

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 174/283 (61%), Positives = 208/283 (73%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTA+R A+S ERRM ASL+RLHFHDCFV GCDAS+LLDST   E E++A+ N  
Sbjct  43    NALSTIRTAIRTAISAERRMGASLIRLHFHDCFVNGCDASLLLDSTSSFESEQNAIQNIN  102

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+ VIE AK  +E  CPGVVSC+DIL VAARD+ V+ GGPSW VNLGRRDS  A   
Sbjct  103   SARGFHVIENAKSRVESICPGVVSCSDILAVAARDSSVAMGGPSWTVNLGRRDSATASKD  162

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
             +A  +LP   + LD LI+ F +KGLS +D+VALSGAHT+GQ QCF FR RIYNHT++D  
Sbjct  163   EAERELPLFTAPLDDLISLFGRKGLSAKDMVALSGAHTIGQAQCFTFRDRIYNHTNIDAG  222

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA  R+  CP    GD NL+ LDLVTP  FDNNY+K LMQKKGLL+SDQ LFNGG TD I
Sbjct  223   FARKRRGNCPSTG-GDSNLAALDLVTPTSFDNNYFKILMQKKGLLESDQVLFNGGSTDDI  281

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+ S  AF +DF +AM+K+ +I+PL    G IR  CS  N
Sbjct  282   VRSYSNSRSAFYSDFAAAMVKMGDIEPLTGSAGQIRARCSVPN  324



>emb|CDY65372.1| BnaC05g49640D [Brassica napus]
Length=317

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/286 (61%), Positives = 219/286 (77%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDAS++L +TP +E E+DA+PN  
Sbjct  33    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASVMLVATPTMESERDAVPNFQ  92

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E+ CPGVVSCADI+ VAARDA    GGP + V +GRRDST A+ A
Sbjct  93    SARGFEVIDQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPRYEVKVGRRDSTAAFRA  152

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLPS  + LD L   F +KGL+ RDLVALSGAHTLGQ QC  F+ R+Y N +D+D
Sbjct  153   IADSGDLPSFRASLDELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKERLYDNSSDID  212

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-T  339
               F++TRKR+CP    GD NL+PLD VTP  FDNNYY+NLMQKKGLL SDQ LF  G  T
Sbjct  213   AGFSSTRKRRCPVNG-GDTNLAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGAGAST  271

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+++P  F +DF +AMIK+ +IQ L    G IR++C+AVN
Sbjct  272   DSIVSEYSRNPSRFASDFAAAMIKMGDIQTLTGSAGQIRRICTAVN  317



>ref|XP_006306491.1| hypothetical protein CARUB_v10012474mg [Capsella rubella]
 gb|EOA39389.1| hypothetical protein CARUB_v10012474mg [Capsella rubella]
Length=321

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/287 (62%), Positives = 215/287 (75%), Gaps = 6/287 (2%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IR+++R A++RERRMAASL+R+HFHDCFV GCDASILL+ T  IE E+DALPN  
Sbjct  37    NALTKIRSSIRTAIARERRMAASLIRMHFHDCFVHGCDASILLEGTSTIESERDALPNFK  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK CPG+VSCADIL VAARDA    GGP W V LGRRDST A+ A
Sbjct  97    SVRGFEVIDKAKSEVEKVCPGIVSCADILAVAARDASEYVGGPRWTVRLGRRDSTDAFKA  156

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + +LP     LD L   F+KKGL+ RDLVALSGAHT+GQ+QCFLFR R+Y N +D+D
Sbjct  157   LANSGELPGFKDSLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDID  216

Query  515   PDFANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-  342
               FA TRKR CP   +G D NL+ LDLVTP  FDNNYYKNLMQKKGLL +DQ LF  G  
Sbjct  217   AGFARTRKRGCP--TVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGAS  274

Query  341   TDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             TD IVSEY+++   F  DF +AMIK+ +I+PL    G IR++CS VN
Sbjct  275   TDGIVSEYSRNRLKFAADFATAMIKMGDIEPLTGSTGEIRRICSFVN  321



>ref|XP_010458955.1| PREDICTED: peroxidase 4 [Camelina sativa]
Length=316

 Score =   356 bits (913),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/286 (62%), Positives = 218/286 (76%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDASI+L +TP +E E+D+L N  
Sbjct  32    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASIMLVATPTMESERDSLANFQ  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E  CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  92    SARGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRA  151

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLPS  + LDTL   F +KGL+ RDLVALSGAHTLGQ QC  FR R+Y N +D+D
Sbjct  152   IADSGDLPSFSASLDTLSDLFLRKGLNTRDLVALSGAHTLGQAQCSTFRDRLYDNSSDID  211

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGVT  339
               F++TRKR+CP    GD  L+PLD VTP  FDNNYY+NLMQKKGLL SDQ LF  G  T
Sbjct  212   VGFSSTRKRRCPANG-GDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLTSDQVLFGTGAST  270

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIV+EY+++P  F +DF +AMIK+ +IQ L    G IR++CSAVN
Sbjct  271   DSIVTEYSRNPSRFASDFAAAMIKMGDIQTLTGSDGQIRRICSAVN  316



>ref|XP_009148834.1| PREDICTED: peroxidase 4 [Brassica rapa]
Length=317

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/286 (61%), Positives = 220/286 (77%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDAS++L +TP +E E+DA+PN  
Sbjct  33    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASVMLVATPTMESERDAVPNFQ  92

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E+ CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  93    SARGFEVIDQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPKYAVKVGRRDSTAAFRA  152

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLPS  + LD L   F +KGL+ RDLVALSGAHTLGQ QC  F+ R+Y N +D+D
Sbjct  153   IADSGDLPSFRASLDELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKERLYDNSSDID  212

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-T  339
               F++TRKR+CP    GD NL+PLD VTP  FDNNYY++LMQKKGLL SDQ LF  G  T
Sbjct  213   AGFSSTRKRRCPVNG-GDTNLAPLDQVTPNSFDNNYYRSLMQKKGLLASDQVLFGAGAST  271

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+++P  F +DF +AMIK+ +IQ L    G IR++C+AVN
Sbjct  272   DSIVSEYSRNPSRFASDFGAAMIKMGDIQTLTGSAGQIRRICTAVN  317



>emb|CBI27502.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   354 bits (908),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/266 (62%), Positives = 210/266 (79%), Gaps = 2/266 (1%)
 Frame = -2

Query  992  MAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSC  813
            MAASL+RLHFHDCFVQGCDASILLD +P I+ EK+A  NN S RG++VI+  K ++E  C
Sbjct  1    MAASLIRLHFHDCFVQGCDASILLDDSPTIQSEKNAPNNNNSVRGFEVIDNVKSQVENIC  60

Query  812  PGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITA  633
            PGVVSCADIL VAARDA V+ GGP+W + LGRRDST +  ++A T+LP+    LD L + 
Sbjct  61   PGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLSQAATNLPTFRDGLDRLTSL  120

Query  632  FAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPDFANTRKRQCP-EQQIGDK  459
            F+ KGLS RD+VALSG+HT+GQ +C  FR RIY N T++D  FA+TR+R+CP +   GD 
Sbjct  121  FSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDAGFASTRRRRCPADNGNGDD  180

Query  458  NLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVS  279
            NL+PLDLVTP  FDNNY+KNL+Q+KGLLQSDQ LFNGG TDSIV+EY+KSP  F++DF S
Sbjct  181  NLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSIVTEYSKSPSTFSSDFSS  240

Query  278  AMIKLSEIQPLIDGHGIIRKVCSAVN  201
            AM+K+ +I+PLI   G+IRK C+ +N
Sbjct  241  AMVKMGDIEPLIGSAGVIRKFCNVIN  266



>ref|XP_006305840.1| hypothetical protein CARUB_v10010887mg [Capsella rubella]
 gb|EOA38738.1| hypothetical protein CARUB_v10010887mg [Capsella rubella]
Length=316

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/286 (62%), Positives = 218/286 (76%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDASI+L +TP +E E+D+L N  
Sbjct  32    NALSTIRSSIRSAISRERRMAASLIRLHFHDCFVNGCDASIMLVATPNMESERDSLANFQ  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E  CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  92    SARGFEVIDQAKSTVESICPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRA  151

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLPS  + LDTL   F +KGL+ RDLVALSGAHTLGQ QCF FR R+Y N +D+D
Sbjct  152   IADSGDLPSFSASLDTLSELFLRKGLNTRDLVALSGAHTLGQAQCFTFRDRLYDNSSDID  211

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGVT  339
               F++TRKR+CP    GD   +PLD VTP  FDNNYY+NLMQKKGLL SDQ LF  G  T
Sbjct  212   AGFSSTRKRRCPVNG-GDTTGAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGTGAST  270

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIV+EY+++P  F +DF +AMIK+ +IQ L    G IR++CSAVN
Sbjct  271   DSIVTEYSRNPSRFASDFAAAMIKMGDIQTLTGSDGQIRRICSAVN  316



>ref|XP_010496209.1| PREDICTED: peroxidase 4-like [Camelina sativa]
Length=317

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/286 (61%), Positives = 218/286 (76%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDAS++L +TP +E E+D+L N  
Sbjct  33    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVSGCDASVMLVATPTMESERDSLANFQ  92

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E  CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  93    SARGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRA  152

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLPS  + LDTL   F +KGL+ RDLVALSGAHTLGQ QC  FR R+Y N +D+D
Sbjct  153   IADSGDLPSFSASLDTLSDLFLRKGLNTRDLVALSGAHTLGQAQCSTFRDRLYDNSSDID  212

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGVT  339
               F++TRKR+CP    GD  L+PLD VTP  FDNNYY+NLMQKKGLL SDQ LF  G  T
Sbjct  213   VGFSSTRKRRCPANG-GDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLTSDQVLFGTGAST  271

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +SIV+EY+++P  F +DF +AMIK+ +IQ L    G IR++CSAVN
Sbjct  272   ESIVTEYSRNPSRFTSDFAAAMIKMGDIQALTGSDGQIRRICSAVN  317



>ref|XP_003607245.1| Peroxidase [Medicago truncatula]
 gb|AES89442.1| lignin-forming anionic peroxidase [Medicago truncatula]
Length=305

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/286 (61%), Positives = 210/286 (73%), Gaps = 18/286 (6%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT++R AVS+E RMAAS++RLHFHDCFVQGCDASILLD +P IE EK+ALPN  
Sbjct  35    NALSTIRTSIRTAVSKECRMAASVIRLHFHDCFVQGCDASILLDDSPTIESEKNALPNIN  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+++I+ AK E+EK CPGVVSCADIL VAARDA  + GGPSW V LGRRDST A  +
Sbjct  95    SVRGFEIIDKAKSEVEKICPGVVSCADILAVAARDASFAVGGPSWTVKLGRRDSTTASKS  154

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
              A TDLP    DL TLI+ F KK L+ RD+V LSGAHT+GQ QCF FR RIYN+ +D+D 
Sbjct  155   LANTDLPLFTDDLTTLISHFNKKNLTPRDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDA  214

Query  512   DFANTRKRQCPEQQI--GDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVT  339
              FANTR+R CP  +    D+ L+ LDLVTP  FDNNY+KNL+QKK               
Sbjct  215   GFANTRQRGCPSSRTTSNDQKLAALDLVTPNSFDNNYFKNLIQKK---------------  259

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+ +P  F +DF +AMIK+ +I+PL    GIIR +CSAVN
Sbjct  260   DSIVSEYSNNPTTFKSDFAAAMIKMGDIEPLTGSAGIIRSICSAVN  305



>gb|KHN32283.1| Lignin-forming anionic peroxidase [Glycine soja]
Length=267

 Score =   352 bits (903),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  992  MAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSC  813
            MAASL+RLHFHDCFVQGCDASILLD +  IE EK AL N  S RG++VI+ AK E+EK C
Sbjct  1    MAASLIRLHFHDCFVQGCDASILLDDSTSIESEKTALQNVNSVRGFNVIDQAKTEVEKVC  60

Query  812  PGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITA  633
             GVVSCADI+ VAARDA  + GGPSW V LGRRDST A  + A +DLP    DLDTLI+ 
Sbjct  61   SGVVSCADIMAVAARDASFAVGGPSWTVKLGRRDSTTASKSLASSDLPLFTDDLDTLISR  120

Query  632  FAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDPDFANTRKRQCPE--QQIGD  462
            F  KGL+ RD+V LSGAHT+GQ QCF FR RIYN+ +D+D  FA+TR+R CP       +
Sbjct  121  FNSKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGFASTRRRGCPSLNNNDNN  180

Query  461  KNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFV  282
            K L+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ L++GG TDSIVSEY+K+P  F +DF 
Sbjct  181  KKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLYSGGSTDSIVSEYSKNPTTFKSDFA  240

Query  281  SAMIKLSEIQPLIDGHGIIRKVCSAVN  201
            +AMIK+ +I+PL    G+IRK+CS++N
Sbjct  241  AAMIKMGDIEPLTGSAGMIRKICSSIN  267



>ref|XP_011038117.1| PREDICTED: lignin-forming anionic peroxidase-like [Populus euphratica]
Length=323

 Score =   353 bits (907),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/286 (60%), Positives = 217/286 (76%), Gaps = 3/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IRTA+R+AVS ERRMAASL+RLHFHDCFVQGCDASI+LD++P I+ EK +  NN 
Sbjct  38    NALTTIRTAIRRAVSSERRMAASLIRLHFHDCFVQGCDASIMLDNSPSIDSEKFSFSNNN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK  +E  CPGVVSCADI  VAARDA V+ GGPSW V LGRRDST A  +
Sbjct  98    SIRGFEVIDEAKARVESICPGVVSCADIAAVAARDASVAVGGPSWTVRLGRRDSTTASRS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +D+P   + L  LI  F  KGLS+RD+VALSG+HT+GQ +C  FR RIY N +D+D 
Sbjct  158   LADSDIPRATTGLVNLIDMFNGKGLSERDMVALSGSHTIGQARCVTFRGRIYDNSSDIDA  217

Query  512   DFANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+TR+R CP     G+ NL+PLDLVTP  FDNNY++NL+Q++GLLQSDQ LF+G  TD
Sbjct  218   GFASTRRRNCPSASGDGNNNLAPLDLVTPNSFDNNYFRNLIQRRGLLQSDQVLFSGQSTD  277

Query  335   SIVSEYAKSPEAFNTDFVSAMIKL-SEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+++P  F++DF +AM++   +I+PL      IR+VCS VN
Sbjct  278   SIVTEYSRNPSLFSSDFAAAMLRTQGDIEPLTGSQVEIRRVCSVVN  323



>ref|XP_010496213.1| PREDICTED: peroxidase 5-like [Camelina sativa]
Length=321

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/287 (61%), Positives = 218/287 (76%), Gaps = 6/287 (2%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A++RERRMAASL+R+HFHDCFV G DASILL+ T  IE E+DALPN  
Sbjct  37    NALSKIRSSIRTAIARERRMAASLIRMHFHDCFVHGYDASILLEGTSTIESERDALPNFK  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK CPG+VSCADI+ VAARDA    GGP WAV +GRRDST A+ A
Sbjct  97    SVRGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKA  156

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + +LP    +LD L   F+KKGL+ RDLVALSGAHT+GQ+QCFLFR R+Y N +D+D
Sbjct  157   LANSGELPGFKDNLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDID  216

Query  515   PDFANTRKRQCPEQQIG-DKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-  342
               FA+TRKR+CP   +G D NL+ LDLVTP  FDNNYYKNLMQKKG L +DQ L   G  
Sbjct  217   ARFASTRKRRCP--TVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGFLVTDQVLVGSGAS  274

Query  341   TDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             TD+IVSEY+++   F  DF +AMIK+ +I+PL    G IR++CS VN
Sbjct  275   TDAIVSEYSRNRSKFAADFATAMIKMGDIEPLTGSTGEIRRICSFVN  321



>ref|XP_010476509.1| PREDICTED: peroxidase 4-like [Camelina sativa]
Length=316

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/286 (62%), Positives = 217/286 (76%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDASI+L +TP +E E+D+L N  
Sbjct  32    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASIMLVATPTMESERDSLANFQ  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG +VI+ AK  +E  CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  92    SARGLEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRA  151

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLPS  + LDTL   F +KGL+ RDLVALSGAHTLGQ +C  FR R+Y N +D+D
Sbjct  152   IADSGDLPSFSASLDTLTDLFLRKGLNTRDLVALSGAHTLGQAKCSTFRDRLYDNSSDID  211

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-T  339
               F++TRKR+CP    GD  L+PLD VTP  FDNNYY+NLMQKKGLL SDQ LF  G  T
Sbjct  212   VGFSSTRKRRCPANG-GDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLTSDQVLFGTGAPT  270

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIV+EY+++P  F +DF +AMIK+ +IQ L    G IR++CSAVN
Sbjct  271   DSIVTEYSRNPSRFASDFGAAMIKMGDIQTLTGSDGQIRRICSAVN  316



>ref|XP_008465298.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=324

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/281 (60%), Positives = 202/281 (72%), Gaps = 1/281 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
             LN +R  +  AV++E RM ASL+RLHFHDCFV GCD SILL+ TP   GE+ A PNN S 
Sbjct  45    LNTVRAGIHAAVAKEARMGASLLRLHFHDCFVNGCDGSILLEDTPTFTGEQTAAPNNRSV  104

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG+DVIE+ K+ +EK CPGVVSCADILT++ARDAVV  GGPSW V LGRRDS  A  +  
Sbjct  105   RGFDVIESIKKNVEKICPGVVSCADILTLSARDAVVVLGGPSWKVKLGRRDSKTASFSDV  164

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
                +P P S LDTLI  F  KGLS RDLVALSGAHT+GQ +C  F+ RIYN T++D  FA
Sbjct  165   TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARCLFFKNRIYNETNIDESFA  224

Query  503   NTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVS  324
               R+R CP    GD N +PLDL TP +FDN YYKNL++KK LL+SDQ L NGG TDS+V 
Sbjct  225   EERQRICPTNG-GDDNRAPLDLRTPKLFDNYYYKNLLEKKALLRSDQVLHNGGSTDSLVE  283

Query  323   EYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              Y+   +AF  DFV+AMIK+ +IQPL    G IRK+CS  N
Sbjct  284   LYSDDSDAFEHDFVTAMIKMGDIQPLTGSQGEIRKICSRPN  324



>ref|NP_172906.1| peroxidase 4 [Arabidopsis thaliana]
 sp|Q9LE15.1|PER4_ARATH RecName: Full=Peroxidase 4; Short=Atperox P4; AltName: Full=ATP46; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43954.1|AC012188_31 Strong similarity to an Anionic Peroxidase Precursor from Nicotiana 
sylvestris gi|1076611 and contains a Peroxidase PF|00141 
domain. EST gb|AI996783 comes from this gene [Arabidopsis 
thaliana]
 gb|AAF63178.1|AC010657_14 T5E21.4 [Arabidopsis thaliana]
 gb|AEE29178.1| peroxidase 4 [Arabidopsis thaliana]
Length=315

 Score =   351 bits (900),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/285 (60%), Positives = 216/285 (76%), Gaps = 3/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDAS++L +TP +E E+D+L N  
Sbjct  32    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASVMLVATPTMESERDSLANFQ  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E  CPGVVSCADI+ VAARDA    GGP + V +GRRDST A+ A
Sbjct  92    SARGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYDVKVGRRDSTNAFRA  151

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A  DLP+  + L+ L   F +KGL+ RDLVALSGAHTLGQ QC  F+ R+Y N +D+D 
Sbjct  152   IADRDLPNFRASLNDLSELFLRKGLNTRDLVALSGAHTLGQAQCLTFKGRLYDNSSDIDA  211

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGVTD  336
              F++TRKR+CP    GD  L+PLD VTP  FDNNYY+NLMQKKGLL+SDQ LF  G  TD
Sbjct  212   GFSSTRKRRCPVNG-GDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLESDQVLFGTGASTD  270

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+++P  F +DF +AMIK+ +IQ L    G IR++CSAVN
Sbjct  271   SIVTEYSRNPSRFASDFSAAMIKMGDIQTLTGSDGQIRRICSAVN  315



>ref|XP_006417000.1| hypothetical protein EUTSA_v10008244mg [Eutrema salsugineum]
 gb|ESQ35353.1| hypothetical protein EUTSA_v10008244mg [Eutrema salsugineum]
Length=316

 Score =   350 bits (899),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 171/286 (60%), Positives = 219/286 (77%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDAS++L +TP +E E+DAL N  
Sbjct  32    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASVMLVATPTMESERDALANFQ  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E+ CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  92    SARGFEVIDQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRA  151

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLP+  + LD L   F +KGL+ RDLVALSGAHTLGQ QC  F+ R+Y N +D+D
Sbjct  152   IADSGDLPNFTASLDELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKQRLYDNSSDID  211

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGVT  339
               F++TRKR+CP +  GD  L+PLD VTP  FDNNYY+NLMQKKGLL +DQ LF  G  T
Sbjct  212   AGFSSTRKRRCPVEG-GDMTLAPLDQVTPNSFDNNYYRNLMQKKGLLATDQVLFGTGAST  270

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             D+IVSEY+++P  F +D+ +AMIK+ +IQ L    G IR++C+AVN
Sbjct  271   DNIVSEYSRNPARFASDYAAAMIKMGDIQTLTGSAGQIRRICTAVN  316



>emb|CDX81650.1| BnaC08g39510D [Brassica napus]
Length=316

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 217/286 (76%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDAS++L +TP +E E+D++ N  
Sbjct  32    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASVMLVATPTMESERDSVANFQ  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E  CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  92    SARGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTTAFRA  151

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLPS  + LD L   F +KGL+ RDLVALSGAHTLGQ  C  F+ R+Y N +D+D
Sbjct  152   IADSGDLPSFRASLDDLSDLFLRKGLNTRDLVALSGAHTLGQATCVTFKERLYDNSSDID  211

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-T  339
               F++TRKR+CP    GD NL+PLD VTP  FDNNYY+NLMQKKGLL SDQ LF  G  T
Sbjct  212   AGFSSTRKRRCPVNG-GDTNLAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGSGAST  270

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+++P  F +D+ +AMIK+ +IQ L    G IR++C+AVN
Sbjct  271   DSIVSEYSRNPSRFASDYAAAMIKMGDIQTLTGSAGQIRRICTAVN  316



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   349 bits (895),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/285 (58%), Positives = 208/285 (73%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++ VR AVS+ERRM ASL+RL FHDCFV GCD SILLD T   +GEK A PNN 
Sbjct  39    NVLSTVKSVVRSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDTSSFQGEKTAGPNNK  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY+VI+  K ++E +CPGVVSCADI+ +AARD+VV  GGPSW V LGRRD+  A  +
Sbjct  99    SLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEVKLGRRDARTASFS  158

Query  689   KAGTD-LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDP  513
              A +  LP P S L  L + F  +GLS RD+VALSG+HT+GQ +C  FR RIYN +++D 
Sbjct  159   LANSGALPPPTSTLSNLTSLFQAQGLSTRDMVALSGSHTIGQARCISFRSRIYNDSNIDS  218

Query  512   DFANTRKRQCPEQ-QIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              F+ TR+R+CP     GD+NL+PLDL +P  FDN Y+KNL+  KGLL SDQ LFNGG TD
Sbjct  219   SFSKTRQRKCPSTVGSGDQNLAPLDLQSPTAFDNAYFKNLLSNKGLLHSDQELFNGGSTD  278

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             S+V  Y+ +P+ FN+DF SAMIK+ +I+PL    G IRK+CS VN
Sbjct  279   SLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICSKVN  323



>ref|XP_002892816.1| hypothetical protein ARALYDRAFT_888837 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69075.1| hypothetical protein ARALYDRAFT_888837 [Arabidopsis lyrata subsp. 
lyrata]
Length=316

 Score =   348 bits (894),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 219/286 (77%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDAS++L +TP +E E+D+L N  
Sbjct  32    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASVMLVATPTMESERDSLANFQ  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E  CPGVVSCADI+ VAARDA    GGP + V +GRRDST A+ A
Sbjct  92    SARGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYNVKVGRRDSTNAFRA  151

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLP+  + L+ L   F KKGL+ RDLVALSGAHTLGQ+QC  F+ R+Y N +D+D
Sbjct  152   IADSGDLPNFRASLNDLSELFLKKGLNTRDLVALSGAHTLGQSQCLTFKGRLYDNSSDID  211

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGVT  339
               F++TRKR+CP    GD  L+PLD VTP  FDNNYY+NLMQKKGLL++DQ LF  G  T
Sbjct  212   AGFSSTRKRRCPVNG-GDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLETDQVLFGTGAST  270

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIV+EY+++P  F +DF +AMIK+ +IQ LI   G IR++CSAVN
Sbjct  271   DSIVTEYSRNPSRFASDFGAAMIKMGDIQTLIGSDGQIRRICSAVN  316



>ref|NP_196153.1| peroxidase 52 [Arabidopsis thaliana]
 sp|Q9FLC0.1|PER52_ARATH RecName: Full=Peroxidase 52; Short=Atperox P52; AltName: Full=ATP49; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09977.1| peroxidase [Arabidopsis thaliana]
 gb|AAL38746.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED90861.1| peroxidase 52 [Arabidopsis thaliana]
Length=324

 Score =   349 bits (895),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/284 (57%), Positives = 209/284 (74%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ ++TAV+ AV+ E RM AS++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAAPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K  +EK+CPGVVSCADIL +AARD+VV+ GGP+W V +GRRD+  A  A
Sbjct  101   SARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P S L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR RIYN T+++  
Sbjct  161   AANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRARIYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+R CP     GD NL+PLD+ T   FDNNY+KNLM ++GLL SDQ LFNGG TDS
Sbjct  221   FATTRQRTCPRASGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLHSDQVLFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ +P +FN+DF +AMIK+ +I PL    G IRKVC   N
Sbjct  281   IVRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>gb|AAF63165.1|AC010657_1 T5E21.5 [Arabidopsis thaliana]
Length=315

 Score =   348 bits (893),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 175/286 (61%), Positives = 214/286 (75%), Gaps = 10/286 (3%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR++VR A++RERRMAASL+R+HFHDCFV GCDASILL+ T  IE E+DALPN  
Sbjct  37    NALSKIRSSVRTAIARERRMAASLIRMHFHDCFVHGCDASILLEGTSTIESERDALPNFK  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK E+EK CPG+VSCADI+ VAARDA        + + +GRRDST A+ A
Sbjct  97    SVRGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDA------SEYVLKVGRRDSTAAFKA  150

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + +LP     LD L   F+KKGL+ RDLVALSGAHT+GQ+QCFLFR R+Y N +D+D
Sbjct  151   LANSGELPGFKDTLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDID  210

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-T  339
               FA+TRKR+CP    GD NL+ LDLVTP  FDNNYYKNLMQKKGLL +DQ LF  G  T
Sbjct  211   AGFASTRKRRCPTVG-GDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGAST  269

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             D IVSEY+K+   F  DF +AMIK+  I+PL   +G IRK+CS VN
Sbjct  270   DGIVSEYSKNRSKFAADFATAMIKMGNIEPLTGSNGEIRKICSFVN  315



>gb|KFK24955.1| hypothetical protein AALP_AA8G047500 [Arabis alpina]
Length=324

 Score =   348 bits (894),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 208/284 (73%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ ++TAV+ AV  E RM AS++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVQTAVKSAVKSEARMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAAPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K  +EK+CPGVVSCAD+L +AARD+VV+ GGP+W V +GRRD+  A  A
Sbjct  101   SARGFNVIDNIKAAVEKACPGVVSCADVLAIAARDSVVALGGPNWNVKVGRRDARTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P S L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR RIYN T+++  
Sbjct  161   AANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRTRIYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+R CP     GD NL+PLD+ TP  FDNNY+KNL+ +KGLL SDQ LFNGG TDS
Sbjct  221   FATTRQRTCPRATGSGDGNLAPLDVATPASFDNNYFKNLLTQKGLLHSDQELFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y  +  +FN+DF +AMIK+ +I PL    G IRKVC + N
Sbjct  281   IVRGYNNNARSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGSTN  324



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score =   348 bits (893),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/284 (57%), Positives = 204/284 (72%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N    +++AVR A+S+E RM ASL+RL FHDCFV GCD SILLD T    GEK+A PN  
Sbjct  38    NVFTTVKSAVRSAISKESRMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+DV++  K ++EK CPGVVSCADIL +AARD+VV  GG SW V LGRRDS  A  +
Sbjct  98    SARGFDVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGTSWNVKLGRRDSKTASQS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  ++P P S+L+ LI++F  KGLS +D+VALSG HT+GQ +C  FR RIYN ++++  
Sbjct  158   AANNNIPPPTSNLNNLISSFQSKGLSTKDMVALSGGHTIGQARCTNFRARIYNESNIESS  217

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+ +CP     GD NL+PLDL TP  FDNNY+KNL+ +KGLL SDQ LFNGG TDS
Sbjct  218   FAKTRQGRCPSSSGSGDNNLAPLDLQTPTAFDNNYFKNLINQKGLLHSDQQLFNGGSTDS  277

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              V  Y+ +P  FN+DF +AMIK+ +I PL   +G IRK C  VN
Sbjct  278   QVRTYSNNPSTFNSDFAAAMIKMGDISPLTGSNGEIRKNCRRVN  321



>gb|KDO57833.1| hypothetical protein CISIN_1g024722mg [Citrus sinensis]
Length=263

 Score =   345 bits (886),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 206/265 (78%), Gaps = 3/265 (1%)
 Frame = -2

Query  992  MAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSC  813
            MAASL+RLHFHDCFVQGCDASILLD +  I+ EK+ALPN  SARG++VI++ K ++E+ C
Sbjct  1    MAASLIRLHFHDCFVQGCDASILLDDSSSIDSEKNALPNFKSARGFEVIDSVKSQLERVC  60

Query  812  PGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITA  633
            PGVVSCADI+ VAARDA  + GGPSW V LGR+DST A  + A  +LPS    LD LI+ 
Sbjct  61   PGVVSCADIVAVAARDASFAVGGPSWTVKLGRKDSTTASRSLA-ENLPSFTDGLDKLIST  119

Query  632  FAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDPDFANTRKRQCPEQQIGDKN  456
            FA KGL+ RDLVALSGAHT+GQ QC  FR RIYN+ +++D  FA+TR+RQCP    GD N
Sbjct  120  FATKGLNARDLVALSGAHTIGQAQCAFFRDRIYNNQSNIDAGFASTRRRQCPANG-GDSN  178

Query  455  LSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVSA  276
            LSPLDLVTP  FDNNY+KNL+QKKGLL SDQ LF+GG TD IV EY+K+P  F +DF +A
Sbjct  179  LSPLDLVTPNSFDNNYFKNLIQKKGLLASDQVLFSGGSTDYIVDEYSKNPSKFKSDFAAA  238

Query  275  MIKLSEIQPLIDGHGIIRKVCSAVN  201
            MIK+++I PL    G IR+VC+ VN
Sbjct  239  MIKMADISPLTGTAGQIRRVCNIVN  263



>gb|KGN47222.1| hypothetical protein Csa_6G216410 [Cucumis sativus]
Length=302

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/281 (59%), Positives = 200/281 (71%), Gaps = 1/281 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
             LN +R  +  AV++E RM ASL+RLHFHDCFV GCD SILL+ TP   GE+ A PNN S 
Sbjct  23    LNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSILLEDTPTFTGEQTAAPNNRSV  82

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG+DVIE+ K+ +EK CPGVVSCADILT++ARD+VV  GGPSW V LGRRDS  A  +  
Sbjct  83    RGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPSWKVKLGRRDSKTASFSDV  142

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
                +P P S LDTLI  F  KGLS RDLVALSGAHT+GQ +C  F+ RIYN T++D  FA
Sbjct  143   TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARCLFFKNRIYNETNIDESFA  202

Query  503   NTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVS  324
               R+R CP    GD N +PLD  TP +FDN YYKNL++KK LL+SDQ L +GG TDS+V 
Sbjct  203   EERQRTCPTNG-GDDNRAPLDFRTPKLFDNYYYKNLLEKKALLRSDQVLHDGGSTDSLVE  261

Query  323   EYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              Y+   + F  DFV+AMIK+ +IQPL    G IRK+CS  N
Sbjct  262   LYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIRKICSRPN  302



>ref|XP_004149366.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/281 (59%), Positives = 200/281 (71%), Gaps = 1/281 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
             LN +R  +  AV++E RM ASL+RLHFHDCFV GCD SILL+ TP   GE+ A PNN S 
Sbjct  34    LNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSILLEDTPTFTGEQTAAPNNRSV  93

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG+DVIE+ K+ +EK CPGVVSCADILT++ARD+VV  GGPSW V LGRRDS  A  +  
Sbjct  94    RGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPSWKVKLGRRDSKTASFSDV  153

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
                +P P S LDTLI  F  KGLS RDLVALSGAHT+GQ +C  F+ RIYN T++D  FA
Sbjct  154   TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARCLFFKNRIYNETNIDESFA  213

Query  503   NTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVS  324
               R+R CP    GD N +PLD  TP +FDN YYKNL++KK LL+SDQ L +GG TDS+V 
Sbjct  214   EERQRTCPTNG-GDDNRAPLDFRTPKLFDNYYYKNLLEKKALLRSDQVLHDGGSTDSLVE  272

Query  323   EYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              Y+   + F  DFV+AMIK+ +IQPL    G IRK+CS  N
Sbjct  273   LYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIRKICSRPN  313



>ref|XP_004172441.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/281 (59%), Positives = 200/281 (71%), Gaps = 1/281 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
             LN +R  +  AV++E RM ASL+RLHFHDCFV GCD SILL+ TP   GE+ A PNN S 
Sbjct  34    LNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSILLEDTPTFTGEQTAAPNNRSV  93

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG+DVIE+ K+ +EK CPGVVSCADILT++ARD+VV  GGPSW V LGRRDS  A  +  
Sbjct  94    RGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPSWKVKLGRRDSKTASFSDV  153

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
                +P P S LDTLI  F  KGLS RDLVALSGAHT+GQ +C  F+ RIYN T++D  FA
Sbjct  154   TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARCLFFKNRIYNETNIDESFA  213

Query  503   NTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVS  324
               R+R CP    GD N +PLD  TP +FDN YYKNL++KK LL+SDQ L +GG TDS+V 
Sbjct  214   EERQRTCPTNG-GDDNRAPLDFKTPKLFDNYYYKNLLEKKALLRSDQVLHDGGSTDSLVE  272

Query  323   EYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              Y+   + F  DFV+AMIK+ +IQPL    G IRK+CS  N
Sbjct  273   LYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIRKICSRPN  313



>gb|KDP45728.1| hypothetical protein JCGZ_17335 [Jatropha curcas]
Length=328

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/280 (59%), Positives = 204/280 (73%), Gaps = 2/280 (1%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             ++  V  A+S+ERRM ASLVRL FHDCFV+GCD SILL+ T    GE+ A PNN S RG+
Sbjct  49    VKPVVADAISKERRMGASLVRLFFHDCFVKGCDGSILLEDTASFTGEQTAGPNNNSVRGF  108

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI   K ++EK CPGVVSCADIL +AARD+ V+ GGP+WAV LGRRDS  A  + A + 
Sbjct  109   NVINNIKAKVEKVCPGVVSCADILAIAARDSTVTLGGPNWAVKLGRRDSKTASFSAANSG  168

Query  674   -LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANT  498
              +P P S L  LI  F  KGLS RD+VALSGAHT+GQ +C +FR RIYN T++D  FA+T
Sbjct  169   VIPPPTSTLSNLINRFKAKGLSARDMVALSGAHTIGQARCVIFRNRIYNETNIDSSFAST  228

Query  497   RKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSE  321
             R+R CP     GD NL+PLD+ TP  FDNNY+KNL+ +KGLL SDQ LFNGG TDS+V  
Sbjct  229   RQRNCPRATGSGDNNLAPLDVQTPNAFDNNYFKNLLNQKGLLHSDQVLFNGGSTDSLVRT  288

Query  320   YAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             Y+ +P+ FN+DFVSAMIK+ +I PL    G IRK C+ VN
Sbjct  289   YSNNPKTFNSDFVSAMIKMGDIDPLTGSSGEIRKKCNRVN  328



>emb|CBI27501.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   345 bits (884),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 205/265 (77%), Gaps = 1/265 (0%)
 Frame = -2

Query  992  MAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSC  813
            MAASL+RLHFHDCFVQGCDASILLD +  I+ EK+A  N  S RGY+VI+  K ++E  C
Sbjct  1    MAASLIRLHFHDCFVQGCDASILLDDSSSIQSEKNAPNNLNSVRGYEVIDNIKSKVESIC  60

Query  812  PGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITA  633
            PGVVSCADI+ VAARDA V+  GP+W V LGRRDST +  + A T+LPS    LD L++ 
Sbjct  61   PGVVSCADIVAVAARDASVAVSGPTWTVKLGRRDSTTSGLSLAATNLPSFRDSLDKLVSL  120

Query  632  FAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTRKRQCP-EQQIGDKN  456
            F  KGLS RD+VALSG+HT+GQ +C  FR R+YN TD+D  FA+TR+R+CP +   GD N
Sbjct  121  FGSKGLSARDMVALSGSHTIGQARCVTFRDRVYNGTDIDAGFASTRRRRCPADNGNGDAN  180

Query  455  LSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVSA  276
            L+PL+LVTP  FDNNY+KNL+Q+KGLLQSDQ LF+GG TD+IV+EY+KSP+ F +DF SA
Sbjct  181  LAPLELVTPNSFDNNYFKNLIQRKGLLQSDQVLFSGGSTDTIVNEYSKSPKTFRSDFASA  240

Query  275  MIKLSEIQPLIDGHGIIRKVCSAVN  201
            M+K+ +I+PL    G+IRK C+ +N
Sbjct  241  MVKMGDIEPLTGSAGVIRKFCNVIN  265



>gb|EMS66985.1| Peroxidase 4 [Triticum urartu]
Length=321

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/283 (58%), Positives = 204/283 (72%), Gaps = 1/283 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  + + V+ AV++E RM AS++RL FHDCFVQGCD S+LLD TP  +GEK A+PNN S
Sbjct  39    ALGAVASVVQSAVAKEPRMGASILRLFFHDCFVQGCDGSLLLDDTPSFQGEKTAMPNNGS  98

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+A K  +E  CPGVVSCAD+L +AARD+VV+ GGP+WAV +GRRDST A  + 
Sbjct  99    VRGFEVIDAIKVAVENICPGVVSCADVLAIAARDSVVALGGPNWAVKVGRRDSTTASFSG  158

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  ++P P S L  L + FA +GLS++D+VALSG+HT+GQ +C  FR  IYN TD+D  F
Sbjct  159   ANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQARCTNFRAHIYNETDIDSGF  218

Query  506   ANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             A TR+  CP     GD NL+PLDL TP  F+NNYYKNL+ KKGLL SDQ LFNGG TD +
Sbjct  219   AGTRQSGCPPNSGSGDNNLAPLDLQTPIAFENNYYKNLVAKKGLLHSDQELFNGGATDPL  278

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  YA S  AF  DFV+ MIK+ +I PLI  +G IRK C   N
Sbjct  279   VQYYASSQSAFFADFVAGMIKMGDISPLIGNNGEIRKNCRKSN  321



>ref|XP_002873207.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49466.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 208/284 (73%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++AV+ AV+ E RM AS++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVQSAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAAPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K  +EK+CPGVVSCADIL +AARD+VV  GGP+W V +GRRD+  A  A
Sbjct  101   SARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNVKVGRRDARTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P S L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR RIYN T+++  
Sbjct  161   AANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRARIYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+R CP     GD NL+PLD+ T   FDNNY+KNLM ++GLL SDQ LFNGG TDS
Sbjct  221   FATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLHSDQVLFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ +P +FN+DF +AMIK+ +I PL    G IRKVC   N
Sbjct  281   IVRGYSNNPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_006664869.1| PREDICTED: cationic peroxidase 1-like [Oryza brachyantha]
Length=317

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/283 (59%), Positives = 201/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTAVR A+++E RM ASL+RLHFHDCFV+GCD S+LLD TP   GEK A PNN 
Sbjct  36    NALSTIRTAVRSAITKENRMGASLLRLHFHDCFVKGCDGSVLLDDTPTFTGEKTAAPNNN  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K +IE  CP VVSCADIL VAARD+VV+ GGP+W V LGRRDST A   
Sbjct  96    SLRGFDVIDNIKAQIEGICPQVVSCADILAVAARDSVVALGGPTWVVQLGRRDSTTASLD  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  D+P+P  DL  L  +F+ KGLS  D++ALSGAHT+GQ +C  FR RIY+ T++D  
Sbjct  156   AANNDIPAPTLDLGDLNKSFSNKGLSATDMIALSGAHTIGQARCVNFRNRIYSETNIDSS  215

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
              A + K  CP    GD N+SPLD  TPYVFDN YYKNL++KKG+L SDQ LFNGG  DS 
Sbjct  216   LATSLKSNCPN-TTGDNNISPLDASTPYVFDNFYYKNLLKKKGVLHSDQQLFNGGSADSQ  274

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              + Y+ +   F TDF +AM+K+S I PL    G IRK C  VN
Sbjct  275   TTTYSSNMATFFTDFSAAMVKMSNITPLTGSSGQIRKNCRKVN  317



>ref|XP_002450133.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
 gb|EES09121.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
Length=328

 Score =   347 bits (889),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 202/279 (72%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++ ++ A++ E+RM AS+VRL FHDCFVQGCDAS+LLD T   +GEK A PNN S RG+
Sbjct  50    VKSVMKSAIANEKRMGASIVRLFFHDCFVQGCDASLLLDDTATFQGEKMATPNNGSVRGF  109

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  +EK CPGVVSCADIL +AARD+VV  GGPSW V +GRRDST A  + A  +
Sbjct  110   EVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPSWDVKVGRRDSTTASFSGANNN  169

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+GQ +C  FR  IYN TD++  FA TR
Sbjct  170   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRAHIYNDTDINSAFAKTR  229

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP VF+NNYYKNL+ KKGLL SDQ LFNGG TD++V  Y
Sbjct  230   QSGCPSTSGAGDNNLAPLDLQTPTVFENNYYKNLLSKKGLLHSDQELFNGGATDTLVQSY  289

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               S   F TDFV+ MIK+ +I PL   +G IRK C  VN
Sbjct  290   VGSQSTFFTDFVTGMIKMGDITPLTGSNGQIRKNCRRVN  328



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 208/284 (73%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++AV+ AV+ E RM AS+VRL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVQSAVKSAVNSEARMGASIVRLFFHDCFVNGCDGSILLDDTSSFTGEQNANPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K  +EK+CPGVVSCADIL +AARD+VV  GGP+W V +GRRD+  A  A
Sbjct  101   SARGFNVIDNIKAAVEKACPGVVSCADILAIAARDSVVVLGGPNWTVKVGRRDARTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P S L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR RIYN T+++  
Sbjct  161   AANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFRTRIYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+R CP     GD NL+PLD+ T   FDNNY+KNLM ++GLL SDQ LFNGG TDS
Sbjct  221   FATTRQRTCPRTSGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLHSDQELFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ +P +F++DF +AMIK+ +I PL    G IRKVC   N
Sbjct  281   IVRGYSNNPSSFSSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score =   346 bits (887),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/283 (58%), Positives = 203/283 (72%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L++I+TAV  AVS E RM ASL+RLHFHDCFV GCDAS+LLD T    GEK A PN+ 
Sbjct  35    NVLSVIKTAVNSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTSNFTGEKTAGPNSG  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E SC G+VSCADIL VAARD+VV  GGPSW V LGRRDST A  +
Sbjct  95    SIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGPSWTVLLGRRDSTTASLS  154

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A ++LP P S L  LI++F+ KGL+ R++VALSG+HT+GQ +C  FR R+YN  +++  
Sbjct  155   AANSNLPGPTSSLSALISSFSNKGLTAREMVALSGSHTIGQARCTTFRTRLYNEANINAS  214

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA T K  CP Q  GD NLSPLD+ +P  FDN YYKNL  +KGLL SDQ LFNGG TDSI
Sbjct  215   FATTVKANCP-QSGGDNNLSPLDITSPTSFDNAYYKNLQIQKGLLHSDQVLFNGGSTDSI  273

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ +   F+TDF +AM+K+  + PL   +G IRK C   N
Sbjct  274   VNTYSSNSATFSTDFANAMVKMGNLSPLTGTNGQIRKNCRKTN  316



>ref|XP_006391633.1| hypothetical protein EUTSA_v10023814mg [Eutrema salsugineum]
 gb|ESQ28919.1| hypothetical protein EUTSA_v10023814mg [Eutrema salsugineum]
Length=316

 Score =   346 bits (887),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 218/286 (76%), Gaps = 4/286 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDAS++L +TP +E E+DAL N  
Sbjct  32    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASVMLVATPTMESERDALANFQ  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E+ CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  92    SARGFEVIDQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRA  151

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLP+  + L+ L   F +KGL+ RDLVALSGAHTLGQ QC  F+ R+Y N +D+D
Sbjct  152   IADSGDLPNFTASLNELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKQRLYDNSSDID  211

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF-NGGVT  339
               F++TRKR+CP +  GD  L+PLD VTP  FDNNYY+NLMQKKGLL +DQ LF  G  T
Sbjct  212   AGFSSTRKRRCPVEG-GDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLATDQVLFGTGAST  270

Query  338   DSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             D+IVSEY+++   F +D+ +AMIK+ +IQ L    G IR++C+AVN
Sbjct  271   DNIVSEYSRNTARFASDYAAAMIKMGDIQTLTGSAGQIRRICTAVN  316



>ref|XP_010922691.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   346 bits (887),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/279 (58%), Positives = 198/279 (71%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             ++  V+ A+++E+RM ASL+RL FHDCFVQGCD SILLD TP   GEK A+PNN S RG+
Sbjct  42    VKPVVQAAIAKEQRMGASLLRLFFHDCFVQGCDGSILLDDTPTFMGEKTAVPNNNSVRGF  101

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             DV++  K  +EK CPGVVSCADIL + +RD+VV  GGP+W V LGRRDST A  + A  +
Sbjct  102   DVVDNIKAAVEKVCPGVVSCADILAITSRDSVVILGGPNWDVKLGRRDSTTASFSGANNN  161

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  LI+ FA +GLS +D+VALSG HT+GQ +C  FR  IYN TD+D  FA TR
Sbjct  162   IPPPNSSLSNLISKFAAQGLSTKDMVALSGGHTIGQARCLNFRAHIYNDTDIDSSFAKTR  221

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP  FDN+YYKNL+ KKGLL SDQ LFNGG TDS V  Y
Sbjct  222   QMNCPSTSGSGDNNLAPLDLQTPTCFDNDYYKNLINKKGLLHSDQELFNGGSTDSQVMTY  281

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + +P  FN+DFV+ MI + +I PL    G IRK C  VN
Sbjct  282   SNNPSTFNSDFVTGMINMGDITPLTGSSGQIRKNCRKVN  320



>ref|XP_008810563.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=319

 Score =   345 bits (886),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 199/279 (71%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             ++  V+ A+++E+RM ASL+RL FHDCFVQGCD SILLD T   +GEK A PNN S RG+
Sbjct  41    VKPVVQSAIAKEKRMGASLLRLFFHDCFVQGCDGSILLDDTSSFQGEKTATPNNNSVRGF  100

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             DV+++ K  +EK CPGVVSCADIL + ARD+VV  GGP+W V LGRRDST A  + A  +
Sbjct  101   DVVDSIKAAVEKVCPGVVSCADILAITARDSVVILGGPNWNVKLGRRDSTTASFSGANNN  160

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  LI+ F+ +GLS +D+VALSG HT+GQ +C  FR  +YN TD+D  FA TR
Sbjct  161   IPPPNSSLSNLISKFSAQGLSTKDMVALSGGHTIGQARCTNFRAHVYNDTDIDSSFAKTR  220

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP  FDNNYYKNL+ KKGLL SDQ LFNGG TDS V+ Y
Sbjct  221   QMNCPSTAGSGDNNLAPLDLQTPTCFDNNYYKNLINKKGLLHSDQELFNGGSTDSQVTTY  280

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + +P  FN+DFV+ MI + +I PL    G IRK C  VN
Sbjct  281   SNNPSTFNSDFVTGMINMGDINPLTGTRGEIRKNCRRVN  319



>ref|XP_010931328.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=316

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/282 (59%), Positives = 201/282 (71%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  I+ AVR AV +ERRM ASL+RLHFHDCFV GCD SILLD TP   GEK A PNN S
Sbjct  36    ALYTIQNAVRAAVFKERRMGASLLRLHFHDCFVNGCDGSILLDDTPTFTGEKTAGPNNNS  95

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG+DVI+  K ++E  C  VVSCADIL VAARD+VV+ GGPSWAV LGRRD+T A  + 
Sbjct  96    VRGFDVIDTIKSQVEAICTQVVSCADILAVAARDSVVALGGPSWAVQLGRRDATTASFSG  155

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A +D+PSP SDL  LI+AF+KKGLS  D+VALSGAHT+GQ +C +FR R+YN T++D   
Sbjct  156   ANSDIPSPTSDLSALISAFSKKGLSTTDMVALSGAHTIGQARCTVFRTRLYNETNIDASL  215

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + K  CP    GD NLSPLD +TP + DN YYK+L+ KKGLL SDQ L+NGG TDS V
Sbjct  216   ATSLKSNCPSSG-GDDNLSPLDAITPTIVDNFYYKDLVNKKGLLHSDQQLYNGGSTDSQV  274

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + YA +   F +DF +AM+ +  I PL    G IR  C  +N
Sbjct  275   TTYANNFAKFYSDFAAAMVNMGNISPLTGTSGEIRTNCRKIN  316



>ref|XP_007146853.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
 gb|ESW18847.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
Length=318

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/283 (58%), Positives = 201/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL+ I++ V+ AVS+ERRM ASL+RLHFHDCFV GCDAS+LLD T    GEK A  N  
Sbjct  37    SALSTIKSKVKSAVSKERRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKSAAANVD  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E  CPG+VSCADIL VAARD+VVS GG SW V LGRRDST A   
Sbjct  97    SLRGFDVIDDIKSQLETDCPGIVSCADILAVAARDSVVSLGGSSWTVGLGRRDSTTASKD  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A TD+PSP  DL  LITAF+ KG + +++V LSGAHT GQ +C  FR RIYN T++D D
Sbjct  157   AATTDIPSPQLDLSDLITAFSNKGFTTKEMVVLSGAHTTGQAKCQFFRGRIYNETNIDSD  216

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + +  CP    GD NLSPLD+ T  +FDN+Y+KNL+ KKGLL SDQ LF+GG TDS 
Sbjct  217   FATSTQSNCPSTD-GDSNLSPLDVTTNVLFDNSYFKNLVNKKGLLHSDQQLFSGGSTDSQ  275

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ S  +F  DF SAM+K+  + PL    G IR  C AVN
Sbjct  276   VTAYSTSSSSFYADFSSAMVKMGNLSPLTGSSGQIRTNCRAVN  318



>ref|XP_004150607.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=326

 Score =   344 bits (882),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/283 (58%), Positives = 202/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+++R  VR AV++E RM ASL+RLHFHDCFV GCD SILLD TP   GE+ A PNN 
Sbjct  45    NLLSLVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSILLDDTPTFLGEQTAAPNNR  104

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI   K +IEK CPGVVSCADILT++ARD+VV+ GGPSW V LGRRDS  A  +
Sbjct  105   SVRGFNVIANIKEKIEKICPGVVSCADILTLSARDSVVALGGPSWKVKLGRRDSKTASFS  164

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
                  +P P S L TLI  F  KGLS +DLVALSGAHT+G+ +C  F+ RIYN T++D  
Sbjct  165   DVTGAIPPPTSTLATLINRFNTKGLSPKDLVALSGAHTIGKARCLFFKNRIYNETNIDKS  224

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA  R++ CP    GD N +P D  TP +FDNNYYKNL++KK LL+SDQ L NGG TDS+
Sbjct  225   FAKKRQKNCPRNG-GDDNRTPFDFRTPNLFDNNYYKNLLEKKALLRSDQVLHNGGSTDSL  283

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+    AF +DFV+AMIK+ +I+PL    G IRKVCS  N
Sbjct  284   VELYSHDSAAFESDFVAAMIKMGDIEPLTGLQGEIRKVCSRPN  326



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   343 bits (881),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 200/282 (71%), Gaps = 1/282 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
              + +++ V+ A+ +E RM ASL+RLHFHDCFV GCD S+LLD T    GEK+A PN  SA
Sbjct  38    FSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSLLLDDTSSFTGEKNAAPNRNSA  97

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG+DV++  K  +E  CPGVVSCADIL +AARD+VV+ GGPSW V LGRRD+  A  A A
Sbjct  98    RGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVVTLGGPSWNVKLGRRDARTASQAAA  157

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
               ++P P  +L+ LI+ F+  GLS RDLVALSG+HT+GQ +C  FR RIYN T++D   A
Sbjct  158   NNNIPPPTRNLNQLISTFSAVGLSTRDLVALSGSHTIGQARCTSFRPRIYNETNLDSSLA  217

Query  503   NTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
              TR+  CP     GD NL+PLDL TP  FDNNY+KNL+Q KGLL SDQ LFNGG TDSIV
Sbjct  218   QTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQNKGLLHSDQQLFNGGSTDSIV  277

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y+ S  AF++DF SAMIK+ +I+PL    G IRK C   N
Sbjct  278   RAYSNSYNAFSSDFASAMIKMGDIKPLTGSSGEIRKNCRKTN  319



>ref|XP_008463814.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=325

 Score =   343 bits (881),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/281 (59%), Positives = 204/281 (73%), Gaps = 1/281 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
             L+++R  VR AV++E RM ASL+RLHFHDCFV GCD SILLD TP   GE+ A PNN S 
Sbjct  46    LSVVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSILLDDTPTFLGEQTAAPNNRSV  105

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG++VI + K +IEK CP VVSCADILT++ARD+VV+ GGPSW V LGRRDS  A  +  
Sbjct  106   RGFNVIASIKEKIEKICPDVVSCADILTLSARDSVVALGGPSWKVKLGRRDSKTASFSDV  165

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
                +P P S L TLI  F+ KGLS +DLVALSGAHT+G+ +C  F+ RIYN T++D  FA
Sbjct  166   SGAIPPPTSTLPTLINRFSTKGLSPKDLVALSGAHTIGKPRCLFFKNRIYNETNIDKSFA  225

Query  503   NTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVS  324
               R+R CP    GD+N SP D  TP +FDNNYYKNL++KK LL+SDQ L +GG TDS+V 
Sbjct  226   KERQRNCPRNG-GDENRSPFDFRTPNLFDNNYYKNLVEKKALLRSDQVLHDGGSTDSLVE  284

Query  323   EYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              Y+    AF +DFV+AMIK+ +I+PLI   G IRKVCS  N
Sbjct  285   LYSHDSAAFESDFVAAMIKMGDIEPLIGLQGEIRKVCSRPN  325



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score =   343 bits (881),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 200/284 (70%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N    +++AV  A+S+ERRM ASL+RL FHDCFV GCD SIL+D T    GEK+A PN  
Sbjct  37    NVFTTVKSAVGSAISKERRMGASLLRLFFHDCFVNGCDGSILVDDTSNFTGEKNAAPNRN  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++V++  K ++EK CPGVVSCADIL +AARD+VV  GGPSW V LGRRD+  A  A
Sbjct  97    SVRGFNVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGPSWKVKLGRRDARTASQA  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A T +P P S L  LI++F  KGLS +D+VALSG+HT+GQ +C  FR RIYN +++D  
Sbjct  157   AANTSIPPPTSSLSNLISSFQSKGLSTKDMVALSGSHTIGQARCTSFRTRIYNESNIDGS  216

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA  R+R+CP     GD NL+PLDL TP  FDNNY+KNL+  KGLL SDQ LFNGG TDS
Sbjct  217   FAKARQRKCPATSGSGDNNLAPLDLQTPTAFDNNYFKNLINNKGLLHSDQQLFNGGSTDS  276

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +V  Y+  P  F +DF +AMIK+ +I PL   +G IR  C  VN
Sbjct  277   LVRSYSSKPSTFISDFSAAMIKMGDITPLTGSNGEIRNNCRRVN  320



>gb|KGN47223.1| hypothetical protein Csa_6G216420 [Cucumis sativus]
Length=311

 Score =   343 bits (880),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/283 (58%), Positives = 202/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+++R  VR AV++E RM ASL+RLHFHDCFV GCD SILLD TP   GE+ A PNN 
Sbjct  30    NLLSLVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSILLDDTPTFLGEQTAAPNNR  89

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI   K +IEK CPGVVSCADILT++ARD+VV+ GGPSW V LGRRDS  A  +
Sbjct  90    SVRGFNVIANIKEKIEKICPGVVSCADILTLSARDSVVALGGPSWKVKLGRRDSKTASFS  149

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
                  +P P S L TLI  F  KGLS +DLVALSGAHT+G+ +C  F+ RIYN T++D  
Sbjct  150   DVTGAIPPPTSTLATLINRFNTKGLSPKDLVALSGAHTIGKARCLFFKNRIYNETNIDKS  209

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA  R++ CP    GD N +P D  TP +FDNNYYKNL++KK LL+SDQ L NGG TDS+
Sbjct  210   FAKKRQKNCPRNG-GDDNRTPFDFRTPNLFDNNYYKNLLEKKALLRSDQVLHNGGSTDSL  268

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+    AF +DFV+AMIK+ +I+PL    G IRKVCS  N
Sbjct  269   VELYSHDSAAFESDFVAAMIKMGDIEPLTGLQGEIRKVCSRPN  311



>gb|AAQ55233.1| peroxidase, partial [Orobanche cernua var. cumana]
Length=248

 Score =   340 bits (873),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 193/249 (78%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSCPGVVSCADILTVAARD  765
            GCDASILLD  P IE EK A PN  S RG+DVIEAAK  +E  CPGVVSCADIL +AARD
Sbjct  1    GCDASILLDDGPTIESEKSAGPNVDSVRGFDVIEAAKSAVEGICPGVVSCADILALAARD  60

Query  764  AVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSG  585
            A V+ GGP+W V LGRRDST A   +A TDLPSP+++L TL++AFA KGLS+ D+ ALSG
Sbjct  61   ASVAVGGPTWTVKLGRRDSTTANRTQANTDLPSPFANLQTLVSAFANKGLSQTDMAALSG  120

Query  584  AHTLGQTQCFLFRYRIY-NHTDVDPDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNY  408
            +HTLGQ QCFLFR RIY N TD+DP FA+    QCP Q  GD NL+PLDLVTP  FDNNY
Sbjct  121  SHTLGQAQCFLFRARIYSNGTDIDPTFASNLTSQCP-QSGGDSNLAPLDLVTPNFFDNNY  179

Query  407  YKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGI  228
            +KNL+Q++GLLQSDQ LF+GG T++ VS Y+ +P  F  DF SAMI++SEIQPL+   GI
Sbjct  180  FKNLIQRRGLLQSDQVLFSGGSTNTTVSRYSANPRMFAADFASAMIRMSEIQPLLGSSGI  239

Query  227  IRKVCSAVN  201
            IR++CSA N
Sbjct  240  IRRICSATN  248



>ref|XP_002509733.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51120.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=321

 Score =   343 bits (880),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 174/284 (61%), Positives = 214/284 (75%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  I++A+  A+  E+RMAASL+RLHFHDCFVQGCD S+LL  TP   GEK A  N  
Sbjct  39    NALTTIKSAIDAAIESEQRMAASLIRLHFHDCFVQGCDGSVLLVDTPTFTGEKSARNNAN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG +VI+ AK ++E  CPG+VSCADIL VAARDA V+AGGPSW VNLGRRDST A  A
Sbjct  99    SIRGENVIDDAKAQVESICPGIVSCADILAVAARDASVAAGGPSWTVNLGRRDSTTASLA  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
             +A +DLP     L+ LI+ F+ KGL++RD+VALSGAHT+GQ QC  FR RIYN+ +D+DP
Sbjct  159   QANSDLPGFSDPLNRLISLFSDKGLNERDMVALSGAHTIGQAQCVTFRDRIYNNASDIDP  218

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             DFA TR+  CP Q  G+ NL+PLDLVTP  FDNNYY NLM K+GLL SDQ LF+GG TDS
Sbjct  219   DFAATRRGNCP-QTGGNGNLAPLDLVTPNNFDNNYYSNLMAKRGLLASDQILFSGGSTDS  277

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV+EY+    +F++DF +AM+K+  I PL    G IR++CSAVN
Sbjct  278   IVNEYSTDSSSFDSDFAAAMVKMGNISPLTGTQGEIRRLCSAVN  321



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score =   343 bits (879),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 201/279 (72%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +R+ V+ A+  E R+ ASL+RLHFHDCFV GCD S+LLD T    GEK+A+PN  SARG+
Sbjct  41    VRSTVQSAIRNEARIGASLLRLHFHDCFVNGCDGSLLLDDTSSFTGEKNAVPNRNSARGF  100

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             DV++  K  +E  CPGVVSCADIL +AARD+V   GGPSW V LGRRD+  A  A A  +
Sbjct  101   DVVDNIKSAVENVCPGVVSCADILAIAARDSVAILGGPSWNVKLGRRDARTASQAAANNN  160

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S+L+ LI+ F   GLS RDLVALSG+HT+GQ++C  FR RIYN T++D  FA TR
Sbjct  161   IPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQSRCIQFRPRIYNETNLDSSFAQTR  220

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP  FDNNY+KNL+QKKGLL SDQ LFNGG TDSIV  Y
Sbjct  221   RSNCPRASGSGDNNLAPLDLQTPTAFDNNYFKNLIQKKGLLHSDQQLFNGGSTDSIVRTY  280

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + S   F++DFVSA+IK+ +I+PL   +G IRK C   N
Sbjct  281   SNSYNTFSSDFVSAIIKMGDIKPLTGSNGEIRKNCRKPN  319



>gb|KHG18057.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=322

 Score =   343 bits (879),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 160/282 (57%), Positives = 200/282 (71%), Gaps = 1/282 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
             L+ +++ V  A+++E RM ASL+RL FHDCFV GCD S+LLD T    GEK+A+PN  SA
Sbjct  41    LSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLDDTSSFTGEKNAIPNRNSA  100

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG+DV++  K  +E  CPGVVSCADIL + ARD+V   GGP WAV LGRRD+  A  + A
Sbjct  101   RGFDVVDNIKSAVENVCPGVVSCADILAITARDSVEILGGPKWAVKLGRRDARSASQSAA  160

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
                +P+P S+L+ L + F   GLS RDLVALSGAHT+GQ +C  FR RIYN +++D  FA
Sbjct  161   NNGIPAPTSNLNQLTSRFNALGLSTRDLVALSGAHTIGQARCTSFRARIYNESNIDASFA  220

Query  503   NTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
              TR+R CP     GD NL+PLD+ TP  FDNNY+KNL+ ++GLL SDQ LFNGG TDSIV
Sbjct  221   QTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLVSRRGLLHSDQQLFNGGSTDSIV  280

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y  SP +FN+DFVSAMIK+ +I PL    G IRK C  VN
Sbjct  281   RGYGNSPSSFNSDFVSAMIKMGDISPLTGSRGEIRKNCRRVN  322



>ref|XP_002450134.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
 gb|EES09122.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
Length=317

 Score =   343 bits (879),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/283 (58%), Positives = 201/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  I+TAVR AV+RE RM ASL+RLHFHDCFV GCD S+LLD TP   GEK A+PNN 
Sbjct  36    NALYTIQTAVRSAVARENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTFTGEKTAVPNNN  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI++ K ++E+ CP VVSCADI+ VAARD+VV+ GGP+WAVNLGRRDS  A   
Sbjct  96    SLRGFDVIDSIKAQLERICPQVVSCADIVAVAARDSVVALGGPTWAVNLGRRDSLTASLD  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  D+P+P  DL  L  +F+ KGLS  D++ALSG HT+GQ +C  FR RIY+  ++D  
Sbjct  156   AANNDIPAPTLDLTDLTKSFSNKGLSASDMIALSGGHTIGQARCVNFRDRIYSEANIDTS  215

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
              A + K  CP  + GD N+SPLD  TPYVFDN YYKNL+ KKG+L SDQ LFNGG  DS 
Sbjct  216   LATSLKTNCPN-KTGDNNISPLDASTPYVFDNFYYKNLLNKKGVLHSDQQLFNGGSADSQ  274

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              + Y+ +   F TDF +AM+K+S I PL    G IRK C  VN
Sbjct  275   TTTYSSNMAKFFTDFSTAMLKMSNISPLTGSSGQIRKNCRRVN  317



>ref|XP_006848015.1| hypothetical protein AMTR_s00029p00170340 [Amborella trichopoda]
 gb|ERN09596.1| hypothetical protein AMTR_s00029p00170340 [Amborella trichopoda]
Length=346

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 206/308 (67%), Gaps = 26/308 (8%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTA+R A+S ERRM ASL+RLHFHDCFV GCDAS+LLDST   E E++A+ N  
Sbjct  40    NALSTIRTAIRTAISAERRMGASLIRLHFHDCFVNGCDASLLLDSTSSFESEQNAIQNIG  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVV----------------------  756
             SARG+ VIE AK  +E  CPGVVSCADIL VAARD+ V                      
Sbjct  100   SARGFQVIEKAKSRVESICPGVVSCADILAVAARDSSVKDFSLVFLDKKSNREIKTDVEI  159

Query  755   ---SAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSG  585
                  GGPSW V LGRRDS  A  ++A  +LP   + LD+LI+ F +KGLS +DLVALSG
Sbjct  160   NSAQLGGPSWTVKLGRRDSATASKSEAERELPLFTAPLDSLISLFRRKGLSAKDLVALSG  219

Query  584   AHTLGQTQCFLFRYRIYNHTDVDPDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYY  405
             AHT+GQ QCF FR RIYNHT++D  FA  R+  CP    GD  L+PLDLVTP  FDNNY+
Sbjct  220   AHTIGQAQCFTFRDRIYNHTNIDSGFARKRRNHCPSNG-GDSKLAPLDLVTPNSFDNNYF  278

Query  404   KNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGII  225
             K LM+KKGLL+SDQ LFNGG TD IV  Y+KS  AF  DF  AM+K+ +I+PL      I
Sbjct  279   KILMEKKGLLESDQVLFNGGSTDEIVRSYSKSRSAFYLDFAEAMVKMGDIEPLTGSARQI  338

Query  224   RKVCSAVN  201
             R  CS  N
Sbjct  339   RARCSVPN  346



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/285 (56%), Positives = 206/285 (72%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+  ++ V+ AVS+ERRM ASL+RL FHDCFV GCD SILLD T   +GEK A PN  
Sbjct  39    NVLSTAKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDTSSFQGEKTAGPNQN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY+VI+  K ++E +CPGVVSCADI+ +AARD+VV  GGPSW V LGRRD+  A  +
Sbjct  99    SVRGYNVIDQIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEVKLGRRDARTASLS  158

Query  689   KAGTD-LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDP  513
             +A +  +P P S L  LI+ F  +GLS RD+VALSG+HT+GQ +C  FR RIYN +++D 
Sbjct  159   RANSGVIPPPTSTLSNLISRFKAQGLSTRDMVALSGSHTIGQARCISFRPRIYNDSNIDS  218

Query  512   DFANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              F+ TR+ +CP     GD NLSPLDL +P  FDN Y+KNL+  KGLL SDQ LFNGG TD
Sbjct  219   SFSKTRQGKCPRTAGSGDNNLSPLDLQSPTAFDNAYFKNLLSNKGLLHSDQELFNGGTTD  278

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             S+V  Y+ +P+ FN+DF SAMIK+ +I+PL    G IRK+CS +N
Sbjct  279   SLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICSKIN  323



>emb|CBI27506.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 208/266 (78%), Gaps = 2/266 (1%)
 Frame = -2

Query  992  MAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSC  813
            MAASL+RLHFHDCFVQGCDASILLD +  I+ EK+A  NN S RG++VI+  K ++E  C
Sbjct  1    MAASLIRLHFHDCFVQGCDASILLDDSATIQSEKNAPNNNNSVRGFEVIDNVKSQVESIC  60

Query  812  PGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITA  633
            PGVVSCADIL VAARD+ V+ GGP+W V LGRRDST +  ++A  +LPS    LD L++ 
Sbjct  61   PGVVSCADILAVAARDSSVAVGGPTWTVKLGRRDSTTSGLSQAAANLPSFRDGLDKLVSL  120

Query  632  FAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPDFANTRKRQCP-EQQIGDK  459
            F+ KGL+ R++VALSG+HT+GQ +C  FR RI+ N T++D  FA+TR+R+CP +   GD 
Sbjct  121  FSSKGLNTREMVALSGSHTIGQARCVTFRDRIHDNGTNIDAGFASTRRRRCPVDNGNGDD  180

Query  458  NLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVS  279
            NL+PLDLVTP  FDNNY+KNL+Q+KGLLQSDQ LFNGG TDSIV+EY+KS   F++DF +
Sbjct  181  NLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSIVTEYSKSRSTFSSDFAA  240

Query  278  AMIKLSEIQPLIDGHGIIRKVCSAVN  201
            AM+K+ +I PL   +G IRK+C+A+N
Sbjct  241  AMVKMGDIDPLTGSNGEIRKLCNAIN  266



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/283 (58%), Positives = 199/283 (70%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I++ V  AV+ ERRM ASL+RLHFHDCFVQGCDAS+LLD T    GEK A PN  
Sbjct  61    NALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTSSFTGEKTAGPNAG  120

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E  CPGVVSCADIL VAARD+VV+ GG +W V LGRRDST A  +
Sbjct  121   SIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTVQLGRRDSTTASLS  180

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +DLP P S L  LI++F+ KG S ++LVALSG+HT+GQ QC  FR RIYN T++D  
Sbjct  181   SANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIYNDTNIDSS  240

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + +  CP    GD NL+PLD  +P  FDN Y+KNL  KKGLL SDQ LFNGG TDS 
Sbjct  241   FAKSLQGNCPSTG-GDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQ  299

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ +P +F TDF +AMIK+  + PL    G IR  C   N
Sbjct  300   VNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  342



>gb|ABK21858.1| unknown [Picea sitchensis]
Length=326

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 208/283 (73%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +A +I+ + V QAV++E+RM ASL+RLHFHDCFV GCD SILLD T   +GEK A+PN  
Sbjct  45    SAFSIVNSVVTQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTSTFQGEKTAVPNKN  104

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+A K ++E +CPGVVSCADI+ +AARDAVV  GGP+W V LGRRDST A  +
Sbjct  105   SVRGFEVIDAIKTQVEAACPGVVSCADIVAIAARDAVVQLGGPTWLVLLGRRDSTTASLS  164

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A ++LP P S+L  LI++F   GLS RDLVALSG+HT+GQ +C  FR RI++ +++D  
Sbjct  165   AANSNLPPPASNLSALISSFQSHGLSIRDLVALSGSHTIGQARCTNFRNRIHSESNIDLS  224

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA  R+  CP    GD NL+PLDL+TP  FDNNYYKNL +++GLL SDQ LFNGG TD++
Sbjct  225   FARARQANCPSTG-GDDNLAPLDLLTPTTFDNNYYKNLERRRGLLHSDQQLFNGGSTDNL  283

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             VS Y   P AF+ DF  AM+K+  I+PL   +G IRK C  +N
Sbjct  284   VSFYTTYPIAFSIDFAVAMVKMGSIEPLTGNNGEIRKNCRKIN  326



>ref|XP_010423480.1| PREDICTED: peroxidase 52 [Camelina sativa]
Length=324

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/284 (56%), Positives = 207/284 (73%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ ++TAV+ AV  E RM  S++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTSSFTGEQNANPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K  +EK+CPGVVSCADIL +AARD+VV+ GGP+W V +GRRD+  A  A
Sbjct  101   SARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P S L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR RIYN T+++  
Sbjct  161   AANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFRARIYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+R CP     GD NL+PLD+ T   FDNNY+KNL+ +KGLL SDQ LFNGG TDS
Sbjct  221   FATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLHSDQVLFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ +P +F++DF +AMIK+ +I PL    G IRK+C   N
Sbjct  281   IVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|XP_002509737.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51124.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=322

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/284 (61%), Positives = 214/284 (75%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  I++A+  A+  E+RMAASL+RLHFHDCFVQGCD S+LL  TP   GEK A  N  
Sbjct  40    NALTTIKSAIDAAIESEQRMAASLIRLHFHDCFVQGCDGSVLLVDTPTFTGEKSARNNAN  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG +VI+ AK ++E  CPG+VSCADIL VAARDA V+AGGPSW VNLGRRDST A  A
Sbjct  100   SIRGENVIDDAKAQVESICPGIVSCADILAVAARDASVAAGGPSWTVNLGRRDSTTASLA  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNH-TDVDP  513
             +A +DLP     L+ LI+ F+ KGL++RD+VALSGAHT+GQ QC  FR RIYN+ +D+DP
Sbjct  160   QANSDLPGFSDPLNRLISLFSDKGLNERDMVALSGAHTIGQAQCVTFRDRIYNNASDIDP  219

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             DFA TR+  CP Q  G+ NL+PLDLVTP  FDNNYY NL+ K+GLL SDQ LF+GG TDS
Sbjct  220   DFAATRRGNCP-QTGGNGNLAPLDLVTPNNFDNNYYSNLIAKRGLLASDQILFSGGSTDS  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV+EY+    +F++DF +AM+K+  I PL    G IR++CSAVN
Sbjct  279   IVNEYSTDSSSFDSDFAAAMVKMGNISPLTGTQGEIRRICSAVN  322



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 200/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I++ V  AV+ ERRM ASL+RLHFHDCFVQGCDAS+LLD T   +GEK A PN  
Sbjct  35    NALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTSSFKGEKTAGPNAG  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+  K ++E  CPGVVSCADIL VAARD+VV+ GGP+W V LGRRDST A  +
Sbjct  95    SIRGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGPTWTVQLGRRDSTTASLS  154

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +DLP+P S L  LI++F+ KG S ++LVALSG+HT+GQ QC  FR RIYN T++D  
Sbjct  155   SANSDLPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIYNDTNIDSS  214

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + +  CP    G   L+PLD  +P  FDN Y+KNL  KKGLL SDQ LFNGG TDS 
Sbjct  215   FAKSLQGNCPSTG-GGSTLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQ  273

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ +P +F TDF +AMIK+  + PL    G IR  C   N
Sbjct  274   VNSYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  316



>ref|XP_010452439.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/284 (56%), Positives = 206/284 (73%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ ++TAV+ AV  E RM  S++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTSSFTGEQNANPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K  +EK+CPGVVSCADIL +AARD+VV+ GGP+W V +GRRD+  A  A
Sbjct  101   SARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P P S L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR RIYN T+++  
Sbjct  161   AANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFRARIYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+R CP     GD NL+PLD+ T   FDNNY+KNL+ +KGLL SDQ LFNGG TDS
Sbjct  221   FATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLHSDQVLFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ +P +F++DF +AMIK+ +I PL    G IRK+C   N
Sbjct  281   IVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|XP_008782619.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=320

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/283 (58%), Positives = 201/283 (71%), Gaps = 2/283 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ I++AV+ AV++ERRM ASL+RLHFHDCFVQGCD S+LLD T    GEK A PNN S
Sbjct  39    ALSTIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDDTSTFTGEKTAGPNNNS  98

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG+DVI+  K  +E  C   VSCADIL VAARD+VV+ GGPSW V LGRRDST A  + 
Sbjct  99    IRGFDVIDTIKSRVEAVCKQTVSCADILAVAARDSVVALGGPSWTVQLGRRDSTTASLSL  158

Query  686   AGTDLPSPY-SDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
             A +D+PSP  SDL  LI+AF+KKGL+  D+VALSGAHT+GQ +C  FR RIYN T++D  
Sbjct  159   ANSDIPSPITSDLSALISAFSKKGLATSDMVALSGAHTIGQARCTSFRNRIYNETNIDSS  218

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + +  CP    GD NL+PLD+ TP +FDN YY+NL+ KKGLL SDQ LFNGG TDS 
Sbjct  219   FATSLQSNCPVSG-GDSNLAPLDVSTPTIFDNFYYRNLLNKKGLLHSDQQLFNGGSTDSQ  277

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             VS Y+ +   F +DF SAM+ +  I PL    G IR  C   N
Sbjct  278   VSSYSTNSAKFFSDFASAMVNMGNISPLTGTSGEIRISCRKTN  320



>ref|XP_006842420.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
 gb|ERN04095.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
Length=315

 Score =   341 bits (874),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 197/283 (70%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I+TAVR AV+ E RM ASL+RLHFHDCFV GCD S+LLD      GEK A PNN 
Sbjct  34    NALSTIQTAVRSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDNATFTGEKTARPNNN  93

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++V++  K ++E  CPGVVSCADIL VAARD+VV  GGP+W V LGRRDST A  +
Sbjct  94    SVRGFEVVDNIKSQLESLCPGVVSCADILAVAARDSVVVLGGPTWTVLLGRRDSTTASLS  153

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +D+P+P   L  LIT+F+ KGLS  ++VALSG+HT+GQ +C  FR  IYN T++D  
Sbjct  154   TANSDIPAPSLSLSGLITSFSNKGLSSSEMVALSGSHTIGQARCTTFRTHIYNETNIDST  213

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             +A + K  CP    GD NLSPLD+ +P VFDN YYKNL+ KKGLL SDQ LFNGG TDS 
Sbjct  214   YATSLKSNCPFSG-GDNNLSPLDVTSPTVFDNAYYKNLVNKKGLLHSDQELFNGGSTDSQ  272

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y  S   F TDF  AM+K+  I PL    G +R  C  VN
Sbjct  273   VTGYTSSSSTFPTDFAKAMVKMGNISPLTGSSGQVRTNCRKVN  315



>ref|XP_004977590.1| PREDICTED: cationic peroxidase 1-like [Setaria italica]
Length=317

 Score =   341 bits (874),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 198/283 (70%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  I+TAV+ AV++E RM ASL+RLHFHDCFV GCD S+LLD TP   GEK A+PNN 
Sbjct  36    NALYTIQTAVKSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTFTGEKTAVPNNN  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI++ K +IE  CP VVSCADIL VAARD+VV+ GGP+W VNLGRRDST A   
Sbjct  96    SIRGFDVIDSIKAQIEGICPQVVSCADILAVAARDSVVTLGGPTWVVNLGRRDSTTASLD  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  D+P P  DL  L  +F+ KGL+  D++ALSG HT+GQ +C  FR RIY+  ++D  
Sbjct  156   AANNDIPKPTFDLSDLTKSFSNKGLTATDMIALSGGHTIGQARCVNFRNRIYSEANIDTS  215

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
              A + K  CP +  GD N+SPLD  TPYVFDN YYKNL+ KKG+L SDQ LFNGG  DS 
Sbjct  216   LATSLKSNCPNKT-GDNNISPLDASTPYVFDNFYYKNLLNKKGVLHSDQQLFNGGSADSQ  274

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              + Y+ +   F TDF +AM+K+  I PL    G IRK C  VN
Sbjct  275   TTTYSSNMAKFFTDFSAAMVKMGNISPLTGSSGQIRKNCRKVN  317



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   341 bits (874),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 202/285 (71%), Gaps = 3/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ ++++VR AVS E RM AS++RL FHDCFV GCD SILLD T    GEK+A PN  
Sbjct  39    NLLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+DVI+  K  +EK+CPGVVSCADIL +AARD+VV  GGPSW V LGRRDST A  +
Sbjct  99    SARGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWNVKLGRRDSTTASQS  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A  D+P P S L  L + F+  GLS  DLVALSG HT+GQ +C  FR RIY N ++++ 
Sbjct  159   QANNDIPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCTTFRSRIYSNSSNIES  218

Query  512   DFANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA TR+  CP     GD NL+PLD  TP  FDNNYYKNL+Q KGLLQSDQ LFNGG TD
Sbjct  219   SFARTRQSNCPNTSGTGDNNLAPLDF-TPTSFDNNYYKNLVQNKGLLQSDQVLFNGGSTD  277

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             S+V  YA +P  F +DF +AM+K+ +I PL   +G IRK C  VN
Sbjct  278   SVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRMVN  322



>gb|ACN33662.1| unknown [Zea mays]
Length=320

 Score =   340 bits (873),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/281 (58%), Positives = 204/281 (73%), Gaps = 3/281 (1%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++ ++ A++RE+RM AS++RL FHDCFVQGCDAS+LLD TP  +GEK A PNN S RG+
Sbjct  40    VKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLLLDDTPSFQGEKMANPNNGSVRGF  99

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  +EK CPGVVSCADIL +AARD+VV  GGP+W V +GRRDST A  + A  +
Sbjct  100   EVIDAVKSAVEKLCPGVVSCADILAIAARDSVVILGGPTWDVKVGRRDSTTASFSGANNN  159

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+GQ +C  FR  IYN TD+D  FA TR
Sbjct  160   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRAHIYNDTDIDAAFARTR  219

Query  494   KRQCPEQQ--IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSE  321
             +  CP      GD NL+PLDL TP VF+NNYY+NL+ KKGLL SDQ LFNGG TD++V  
Sbjct  220   QSGCPSTSGAGGDSNLAPLDLQTPTVFENNYYRNLLAKKGLLHSDQELFNGGATDALVQS  279

Query  320   YAKSPEAFNTDFVSAMIKLSEIQPLI-DGHGIIRKVCSAVN  201
             Y  S  AF  DFV+ MIK+ +I PL    +G IRK C  VN
Sbjct  280   YVGSQSAFFADFVAGMIKMGDITPLTGSNNGQIRKNCRRVN  320



>gb|AFW64595.1| hypothetical protein ZEAMMB73_885092 [Zea mays]
Length=333

 Score =   341 bits (874),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/280 (58%), Positives = 202/280 (72%), Gaps = 2/280 (1%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++ V+ AV+ E+RM AS+VRL FHDCFVQGCDAS+LLD TP  +GEK A PNN S RG+
Sbjct  54    VKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLLLDDTPSFQGEKMANPNNGSVRGF  113

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  +EK CPGVVSCADIL +AARD+VV  GGP+W V +GRRDST A  + A  +
Sbjct  114   EVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPTWDVKVGRRDSTTASFSGANNN  173

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+GQ +C  FR  +YN T++D  FA TR
Sbjct  174   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRAHVYNDTNIDGSFARTR  233

Query  494   KRQCPEQ--QIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSE  321
             +  CP      GD NL+PLDL TP VF+NNYYKNL+ KKGLL SDQ LFNGG TD++V  
Sbjct  234   QSGCPRSSGSSGDNNLAPLDLQTPTVFENNYYKNLVCKKGLLHSDQELFNGGATDALVQS  293

Query  320   YAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             YA     F +DFV+ M+K+ +I PL    G IRK C  VN
Sbjct  294   YASGQSEFFSDFVTGMVKMGDITPLTGSGGQIRKNCRRVN  333



>ref|NP_001131000.1| uncharacterized protein LOC100192105 precursor [Zea mays]
 gb|ACF79421.1| unknown [Zea mays]
 gb|ACL53914.1| unknown [Zea mays]
Length=320

 Score =   340 bits (872),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 162/281 (58%), Positives = 204/281 (73%), Gaps = 3/281 (1%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++ ++ A++RE+RM AS++RL FHDCFVQGCDAS+LLD TP  +GEK A PNN S RG+
Sbjct  40    VKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLLLDDTPSFQGEKMANPNNGSVRGF  99

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  +EK CPGVVSCADIL +AARD+VV  GGP+W V +GRRDST A  + A  +
Sbjct  100   EVIDAVKSAVEKLCPGVVSCADILAIAARDSVVILGGPTWDVKVGRRDSTTASFSGANNN  159

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+GQ +C  FR  IYN TD+D  FA TR
Sbjct  160   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRAHIYNDTDIDAAFARTR  219

Query  494   KRQCPEQQ--IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSE  321
             +  CP      GD NL+PLDL TP VF+NNYY+NL+ KKGLL SDQ LFNGG TD++V  
Sbjct  220   QSGCPSTSGAGGDNNLAPLDLQTPTVFENNYYRNLLAKKGLLHSDQELFNGGATDALVQS  279

Query  320   YAKSPEAFNTDFVSAMIKLSEIQPLI-DGHGIIRKVCSAVN  201
             Y  S  AF  DFV+ MIK+ +I PL    +G IRK C  VN
Sbjct  280   YVGSQSAFFADFVAGMIKMGDITPLTGSNNGQIRKNCRRVN  320



>ref|XP_002450132.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
 gb|EES09120.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
Length=331

 Score =   340 bits (873),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 202/279 (72%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++A++ A++ E+RM AS+VRL FHDCFVQGCDAS+LLD T   +GEK A PNN S RG+
Sbjct  53    VKSAIQSAIATEQRMGASIVRLFFHDCFVQGCDASLLLDDTASFQGEKMATPNNGSVRGF  112

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  +EK CPGVVSCADIL +AARD+VV  GGPSW V +GRRDST A  + A  +
Sbjct  113   EVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPSWDVKVGRRDSTTASFSGANNN  172

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+GQ +C  FR  +YN T++D  FA TR
Sbjct  173   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRAHVYNDTNIDGTFARTR  232

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP VF+NNYYKNL+ KKGLL SDQ LFNGG TD+ V  Y
Sbjct  233   QSGCPRTSGSGDNNLAPLDLQTPTVFENNYYKNLVCKKGLLHSDQELFNGGATDAQVQSY  292

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               S   F +DFV+ MIK+ +I PL   +G IRK C  +N
Sbjct  293   ISSQSTFFSDFVTGMIKMGDITPLTGSNGQIRKNCRMIN  331



>ref|XP_004977588.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=321

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 201/279 (72%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++ V+ A+ +E+RM AS+VRL FHDCFVQGCDAS+LLD TP  +GEK A PNN S RG+
Sbjct  43    VKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDASLLLDDTPSFQGEKMATPNNGSVRGF  102

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  +EK CPGVVSCADIL +AARD+VV  GGP+W V +GRRDST A  + A  +
Sbjct  103   EVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPNWNVKVGRRDSTTASFSGANNN  162

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+G  +C  FR  +YN T++D  FA TR
Sbjct  163   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLARCTNFRAHVYNETNIDGAFARTR  222

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP VF+NNYY+NL+ KKGLL SDQ LFNGG TD+ V  Y
Sbjct  223   QSGCPSTSGTGDNNLAPLDLQTPTVFENNYYRNLVSKKGLLHSDQELFNGGATDAQVQSY  282

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               S  AF  DFV+ MIK+ +I PL   +G IRK C  +N
Sbjct  283   VSSQSAFFADFVTGMIKMGDITPLTGSNGEIRKNCRRMN  321



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 200/284 (70%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++ V  A+++E RM ASL+RL FHDCFV GCD S+LLD T    GEK+A PN  
Sbjct  47    NLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLDDTSSFTGEKNANPNRN  106

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S+RG+DV++  K  +E  CPGVVSCADIL +AARD+V   GGP WAV LGRRD+  A  +
Sbjct  107   SSRGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVEILGGPKWAVKLGRRDARSASQS  166

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A   +P P S+L+ L + F   GLS RDLVALSGAHT+GQ +C  FR RIYN +++D  
Sbjct  167   AANNGIPPPTSNLNRLTSRFNALGLSTRDLVALSGAHTIGQARCTSFRARIYNESNIDAS  226

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+R CP     GD NL+PLD+ TP  FDNNY+KNL+ ++GLL SDQ LFNGG TDS
Sbjct  227   FAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLISQRGLLHSDQQLFNGGSTDS  286

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y  SP +FN+DFV+AMIK+ +I PL    G IRK C  VN
Sbjct  287   IVRGYGNSPSSFNSDFVAAMIKMGDISPLTGSRGEIRKNCRRVN  330



>gb|KDP25489.1| hypothetical protein JCGZ_20645 [Jatropha curcas]
Length=309

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 210/285 (74%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRT V  AV  + RMAASL+RLHFHDCFVQGCD S+LL+ T    GE+ A  N A
Sbjct  25    NALSTIRTVVDSAVDSDPRMAASLIRLHFHDCFVQGCDGSVLLEDTATFTGERTARNNAA  84

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+ VI+ AK +IE  CPGV SCADI+ VAARDA V+A GPSW VNLGRRDST A  +
Sbjct  85    SLRGFSVIDDAKSQIESICPGVFSCADIVAVAARDASVAASGPSWTVNLGRRDSTTASLS  144

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A +DLP     L  LI+ F +KGLS+RD+VALSGAHTLGQ +C  FR RIY N +D+DP
Sbjct  145   EANSDLPGFTDSLTRLISLFGEKGLSERDMVALSGAHTLGQARCLTFRARIYSNGSDIDP  204

Query  512   DFANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
             DFA TR+  CP +   G  NL+PLDLVTP  FDNNYY N++ ++GLLQSDQ LF+GG TD
Sbjct  205   DFATTRQGNCPSDTNSGSGNLAPLDLVTPNTFDNNYYSNIIARRGLLQSDQVLFSGGSTD  264

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             SIV+EY+    +F++DF +AM+++  I PL    G IR++C+A+N
Sbjct  265   SIVNEYSSDGSSFSSDFAAAMVRMGNIDPLTGTQGEIRRICTAIN  309



>ref|XP_010543687.1| PREDICTED: peroxidase 52 [Tarenaya hassleriana]
Length=324

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/284 (56%), Positives = 205/284 (72%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +R+A++ AV+RE R  AS++RL FHDCFV GCD SILLD T    GEK+A PN  
Sbjct  41    NLLSTVRSAMQSAVNREARAGASILRLFFHDCFVNGCDGSILLDDTSNFTGEKNANPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+DVI+  K  +E++CPGVVSCADIL VAARD VV  GGP+W V LGRRD+  A  +
Sbjct  101   SARGFDVIDNIKTAVERACPGVVSCADILAVAARDGVVLLGGPNWNVKLGRRDARTASQS  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P S L  LI++F   GLS RD+VALSG HT+GQ +C  FR RIYN T+++  
Sbjct  161   GANSNIPAPTSSLSQLISSFGNVGLSTRDMVALSGGHTIGQARCTSFRTRIYNETNINSA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR++ CP     GD NL+PLD+ TP  F+N+Y+KNLM ++GLL SDQ LFNGG TDS
Sbjct  221   FATTRQQTCPRTAGSGDGNLAPLDIQTPANFNNDYFKNLMAQRGLLHSDQELFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ +P  FN+DFV+AMIK+ +I PL    G IR+ C  +N
Sbjct  281   IVRTYSSNPATFNSDFVAAMIKMGDISPLTGNSGEIRRNCRRLN  324



>ref|NP_001065566.1| Os11g0112200 [Oryza sativa Japonica Group]
 tpe|CAH69373.1| TPA: class III peroxidase 131 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27411.1| Os11g0112200 [Oryza sativa Japonica Group]
Length=317

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 196/283 (69%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IRTAVR AV++E RM ASL+RLHFHDCFV GCD S+LLD TP   GEK A PNN 
Sbjct  36    NALSTIRTAVRSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTFTGEKTAAPNNN  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E  CP VVSCADIL VAARD+V + GGP+W V LGRRDST A   
Sbjct  96    SLRGFDVIDNIKAQVEGICPQVVSCADILAVAARDSVFALGGPTWVVQLGRRDSTTASLD  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  D+P+P  DL  L  +F+ KGLS  D++ALSGAHT+GQ +C  FR RIY+ T++D  
Sbjct  156   TANNDIPAPTLDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNFRNRIYSETNIDTS  215

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
              A + K  CP    GD N+SPLD  TPY FDN YYKNL+ KKG+L SDQ LFNGG  DS 
Sbjct  216   LATSLKSNCPN-TTGDNNISPLDASTPYTFDNFYYKNLLNKKGVLHSDQQLFNGGSADSQ  274

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              + Y+ +   F TDF +A++K+  I PL    G IRK C  VN
Sbjct  275   TTTYSSNMATFFTDFSAAIVKMGNIDPLTGSSGQIRKNCRKVN  317



>ref|XP_008456761.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Cucumis melo]
Length=323

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/285 (58%), Positives = 201/285 (71%), Gaps = 2/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ ++++VR AVS E RM AS++RL FHDCFV GCD SILLD T    GEK A PN  
Sbjct  39    NLLSTVKSSVRSAVSSEARMGASILRLXFHDCFVNGCDGSILLDDTSSFTGEKSANPNRN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+DVI+  K  +E +CPGVVSCADIL +AARD+VV  GGPSW V LGRRDST A  +
Sbjct  99    SARGFDVIDNIKTAVENACPGVVSCADILAIAARDSVVFLGGPSWNVKLGRRDSTTASQS  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
             +A  D+P P S L  L + F+  GLS  DLVALSG HT+GQ +C  FR RIY N ++++ 
Sbjct  159   QANNDIPGPNSSLSQLSSRFSALGLSNTDLVALSGGHTIGQARCTTFRSRIYSNSSNIES  218

Query  512   DFANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA TR+  CP     GD NL+PLDL TP  FDNNY+KNL+Q KGLLQSDQ LFNGG TD
Sbjct  219   LFARTRQSNCPNTSGSGDNNLAPLDLQTPNSFDNNYFKNLVQNKGLLQSDQVLFNGGSTD  278

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             S+V  YA +P  F +DF +AM+K+ +I PL   +G IRK C  VN
Sbjct  279   SVVRNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRRVN  323



>ref|NP_001151940.1| peroxidase 52 precursor [Zea mays]
 gb|ACG45093.1| peroxidase 52 precursor [Zea mays]
Length=334

 Score =   339 bits (869),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/281 (58%), Positives = 202/281 (72%), Gaps = 3/281 (1%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++ V+ AV+ E+RM AS+VRL FHDCFVQGCDAS+LLD TP  +GEK A PNN S RG+
Sbjct  54    VKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLLLDDTPSFQGEKMANPNNGSVRGF  113

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  +EK CPGVVSCADIL +AARD+VV  GGP+W V +GRRDST A  + A  +
Sbjct  114   EVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPTWDVKVGRRDSTTASFSGANNN  173

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+GQ +C  FR  +YN T++D  FA TR
Sbjct  174   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRAHVYNDTNIDGSFARTR  233

Query  494   KRQCPE---QQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVS  324
             +  CP       GD NL+PLDL TP VFDNNYYKNL+ KKGLL SDQ LFNGG TD++V 
Sbjct  234   QSGCPRSSSGSSGDNNLAPLDLQTPTVFDNNYYKNLVCKKGLLHSDQELFNGGATDALVQ  293

Query  323   EYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              YA     F +DFV+ M+K+ +I PL    G IRK C  VN
Sbjct  294   SYASGQSEFFSDFVTGMVKMGDITPLTGSGGQIRKNCRRVN  334



>emb|CDP04065.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   338 bits (867),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/283 (59%), Positives = 200/283 (71%), Gaps = 2/283 (1%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
             L  IR+ V+ AVS+ERRM ASLVRL FHDCFVQGCDASILLD T   +GEK A PN  S 
Sbjct  34    LGTIRSEVQSAVSKERRMGASLVRLFFHDCFVQGCDASILLDDTSSFKGEKTAFPNINSV  93

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG+ VI+  K ++EK CPGVVSCADI+ +AARD++V  GGPSW V LGRRDS  A  ++A
Sbjct  94    RGFGVIDNIKEKVEKVCPGVVSCADIVAIAARDSIVILGGPSWDVKLGRRDSKTASLSQA  153

Query  683   GTD-LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
              +  LP P S L  LI  F   GLS +D+VALSGAHT+GQ +C  FR RIYN T +D  F
Sbjct  154   NSGRLPGPASTLANLINRFQAVGLSAKDMVALSGAHTIGQARCTNFRTRIYNETKIDTSF  213

Query  506   ANTRKRQCPEQ-QIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             A TR+ QCP     GD NL+PLDL TP  FD  Y++NL+ KKGLL SDQ L+NGG TDS+
Sbjct  214   AKTRRSQCPATVGRGDNNLAPLDLQTPTGFDTKYFQNLINKKGLLHSDQVLYNGGSTDSL  273

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V +Y+K  + FN+DFV AMIK+ +I PL    G IRK C  +N
Sbjct  274   VEKYSKDSKTFNSDFVKAMIKMGDINPLTRSQGEIRKKCRKLN  316



>ref|XP_006398996.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
 gb|ESQ40449.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
Length=324

 Score =   338 bits (867),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 207/284 (73%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ ++TAV+ AVS + RM AS++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVQTAVKSAVSSQNRMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNANPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K  +EK+CPGVVSCADIL +AARD+VV  GGP+W V LGRRD+  A  A
Sbjct  101   SARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVILGGPNWNVKLGRRDARTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P S L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR R+YN T+++  
Sbjct  161   AANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRARVYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA  R+R CP     GD NL+PLD+ +   FDN+Y+KNLM ++GLL SDQ LFNGG TDS
Sbjct  221   FATLRQRSCPRTAGSGDGNLAPLDVNSAASFDNSYFKNLMAQRGLLHSDQELFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ +P +F++DF +AMIK+ +I PL    G IRK+C   N
Sbjct  281   IVRGYSNTPSSFSSDFAAAMIKMGDISPLTGTSGEIRKLCGRTN  324



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   338 bits (867),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 199/284 (70%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N  + I+  V+ A+++E+RM ASLVRL FHDCFV GCD S+LLD T    GEK ALPN  
Sbjct  42    NLFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVLLDDTSSFTGEKTALPNRN  101

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI++ K  +EK+CPGVVSCADIL VAARD+ V  GGP+W V LGRRD+  A  +
Sbjct  102   SARGFEVIDSIKSAVEKACPGVVSCADILAVAARDSTVILGGPTWNVKLGRRDARTASLS  161

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A   +P P S+L+ LI+ F   GLS RDLVAL+G+HT+GQ +C  FR RIYN T++D  
Sbjct  162   AANNGIPPPTSNLNQLISRFNALGLSTRDLVALTGSHTIGQARCTSFRARIYNETNIDNS  221

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+  CP     GD NL+PLDL TP  FDNNY+KNL+ +KGLL SDQ LFNGG TDS
Sbjct  222   FAQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFKNLLNQKGLLHSDQQLFNGGSTDS  281

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+     F +DFV+ MIK+ +I PL    G IRK C  +N
Sbjct  282   IVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCRRMN  325



>ref|XP_009117893.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 4-like [Brassica rapa]
Length=326

 Score =   338 bits (867),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 215/296 (73%), Gaps = 14/296 (5%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR+++R A+SRERRMAASL+RLHFHDCFV GCDAS++L +TP +E E+D++ N  
Sbjct  32    NALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASVMLVATPTMESERDSVANFQ  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+ AK  +E  CPGVVSCADI+ VAARDA    GGP +AV +GRRDST A+ A
Sbjct  92    SARGFEVIDEAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTTAFRA  151

Query  689   KAGT-DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVD  516
              A + DLPS  + LD L   F +KGL+ RDLVALSGAHTLGQ  C  F+ R+Y N +D+D
Sbjct  152   IADSGDLPSFRASLDDLSDLFLRKGLNTRDLVALSGAHTLGQATCVTFKERLYDNSSDID  211

Query  515   PDFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGV-T  339
               F++TRKR+CP    GD NL+PLD VTP  FDNNYY+NLMQKKGLL SDQ LF  G  T
Sbjct  212   AGFSSTRKRRCPANG-GDTNLAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGSGAST  270

Query  338   DSIVSEYAKSPEAFNTDF----------VSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             DSIVSEY+++P  F              ++AMIK+ +IQ L    G IR++C+AVN
Sbjct  271   DSIVSEYSRNPSRFGHGISQSQHXIRVXLTAMIKMGDIQTLTGSAGQIRRICTAVN  326



>ref|XP_010045401.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=321

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/284 (57%), Positives = 205/284 (72%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++ V+ AVS+ERRM ASL+RL FHDCFV GCD SILLD T   +GEK A PNN 
Sbjct  39    NGLSTVKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDTSSFQGEKTARPNNK  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RGY+VI+  K ++E +CPGVVSCADI+ +AARD+VV  GGPSW V LGRRD+  A  +
Sbjct  99    SLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEVKLGRRDARTASFS  158

Query  689   KAGTD-LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDP  513
              A +  LP P S L  LI+ F  +GLS RD+VALSG+HT+GQ +C  FR  IYN +++D 
Sbjct  159   LANSGALPPPTSTLSNLISLFQAQGLSTRDMVALSGSHTIGQARCTSFRPHIYNDSNIDS  218

Query  512   DFANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              F  TR+ QCP    GD N +PLDL +P  FDN Y+KNL+  KGLL+SDQ LFNGG TDS
Sbjct  219   AFRKTRQGQCPFGS-GDNNPAPLDLRSPTAFDNAYFKNLLSNKGLLRSDQELFNGGSTDS  277

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +V  Y+ +P+ FN+DF SAMIK+ +I+PL    G IRK+CS VN
Sbjct  278   LVKTYSNNPKTFNSDFASAMIKMGDIKPLKGSQGEIRKICSKVN  321



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   338 bits (866),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/283 (56%), Positives = 202/283 (71%), Gaps = 2/283 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L++I+TAV  A+S+E RM ASL+RLHFHDCFV GCDAS+LLD T    GEK A PN+ 
Sbjct  34    NVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKTANPNSG  93

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E +C GVVSCADIL VAARD+VV  GGPSW V LGRRDST A  +
Sbjct  94    SLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSWNVLLGRRDSTTASLS  153

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  D+P+P  +L +LI++F+ KG + R++VALSG+HT+GQ +C  FR R+YN T+++  
Sbjct  154   AANNDIPAPTLNLSSLISSFSNKGFNSREMVALSGSHTIGQARCTTFRDRLYNETNINSS  213

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             F  T K  CP Q  GD NLSPLD  +P  FDN YYKNL  +KG+L SDQ LFNGG TDSI
Sbjct  214   FGTTIKANCP-QNGGDNNLSPLD-TSPTSFDNVYYKNLQSQKGILHSDQQLFNGGSTDSI  271

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ +   F TDF  AM+K+  + PL   +G IRK C  +N
Sbjct  272   VNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRKIN  314



>ref|XP_002278996.1| PREDICTED: peroxidase 4 [Vitis vinifera]
Length=321

 Score =   338 bits (866),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 200/279 (72%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++AV+ AV++E RM ASL+RL FHDCFV GCD S+LLD T    GEK+A PN  S RG+
Sbjct  43    VKSAVKSAVAKEARMGASLLRLFFHDCFVNGCDGSVLLDDTSSFIGEKNAAPNANSVRGF  102

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             DV++  K ++E +CPGVVSCAD+L +AARD+VV  GGPSW V LGRRD+  A  A A   
Sbjct  103   DVVDDIKSKVETACPGVVSCADVLAIAARDSVVILGGPSWNVKLGRRDARTASQAAANNS  162

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S+L+ LI+ F   GLS RDLVAL+G+HT+GQ +C  FR RIYN T++D  FA TR
Sbjct  163   IPPPTSNLNQLISRFQALGLSTRDLVALAGSHTIGQARCTSFRARIYNETNIDNSFAKTR  222

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP  F+NNYYKNL++KKGLL SDQ LFNGG TDSIV +Y
Sbjct  223   QSNCPRASGSGDNNLAPLDLQTPTAFENNYYKNLIKKKGLLHSDQQLFNGGSTDSIVRKY  282

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + S   FN  FV+ MIK+ +I PL   +G IRK C  VN
Sbjct  283   SNSRSNFNAHFVAGMIKMGDISPLTGSNGEIRKNCRRVN  321



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   338 bits (866),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 152/284 (54%), Positives = 202/284 (71%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++ V+ AV+ E RM ASL+RL FHDCFV GCD S+LLD T    GEK+A PN  
Sbjct  40    NLLSTVKSVVQSAVNNEARMGASLLRLFFHDCFVNGCDGSVLLDDTSSFTGEKNAFPNAG  99

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DV++  K  +EK+CPGVVSCADIL ++ARD+VV  GGP+W V LGRRD+T A  +
Sbjct  100   SLRGFDVVDQIKTAVEKACPGVVSCADILAISARDSVVILGGPTWNVKLGRRDATTASQS  159

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A T++P+P + L  LI +F+ +GLS  D+VALSGAHT+GQ +C  FR RIYN +++D  
Sbjct  160   AANTNIPAPTASLSALIKSFSDQGLSTTDMVALSGAHTIGQARCTTFRTRIYNESNIDAS  219

Query  509   FANTRKRQCPEQQI-GDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+  CP     G  NL+PLD+ TP  FDN YY NL+ +KGLL SDQ LF+GG T++
Sbjct  220   FAKTRQANCPSASTSGSNNLAPLDIQTPNTFDNKYYNNLVNQKGLLHSDQQLFSGGSTNA  279

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +V  Y+ +P  FNTDFV+AMI + +++PL   +G IRK C   N
Sbjct  280   LVQTYSSNPSRFNTDFVAAMINMGDVKPLTGSNGQIRKNCRKTN  323



>ref|XP_009419701.1| PREDICTED: cationic peroxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=324

 Score =   338 bits (866),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/285 (59%), Positives = 208/285 (73%), Gaps = 3/285 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+IIRTAVR AV+R+RRM ASL+RLHFHDCFVQGCDAS+LLD T    GEK A PNN 
Sbjct  41    NALSIIRTAVRAAVARDRRMGASLLRLHFHDCFVQGCDASLLLDDTSTFTGEKTANPNNN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+A K ++E +C  VVSCADI+ VAARD+VV+ GGP+W V LGRRDST A  +
Sbjct  101   SLRGFEVIDAIKSKLESACKQVVSCADIVAVAARDSVVALGGPTWTVELGRRDSTTASLS  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A TD+P P +DL TLI++F+ KGLS  D+ ALSGAHT+GQ +CFLFR RIYN T++DP 
Sbjct  161   SANTDIPGPTADLRTLISSFSGKGLSASDMAALSGAHTIGQARCFLFRARIYNDTNIDPS  220

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLF--NGGVTD  336
             FA++ +  C     GD  LSPLD  TP VFDN+YY NL++++GLL SDQ LF   GG  +
Sbjct  221   FASSLQSNCSSSG-GDNELSPLDSTTPTVFDNDYYANLVRERGLLHSDQQLFMNGGGSVE  279

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             S V  YA +   F +DF SAM+K++ I PL    G IR  C  +N
Sbjct  280   SQVGSYATNSAKFFSDFASAMVKMASISPLTGSSGEIRINCRKIN  324



>emb|CDY14118.1| BnaC02g02350D [Brassica napus]
Length=324

 Score =   338 bits (866),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 204/284 (72%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++ V+ AVS + RM AS++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAGPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+ VI+  K  +EK+CPGVVSCADIL +AARD+VV  GGP+W V +GRRD+  A  A
Sbjct  101   SARGFTVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P   L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR R+YN T+++  
Sbjct  161   AANSNIPAPNMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA  R+R CP     GD NL+PLD+ +   FDN+Y+KNLM ++GLL SDQ LFNGG TDS
Sbjct  221   FATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHSDQVLFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ SP +FN+DF SAMIK+ +I PL    G IRKVC   N
Sbjct  281   IVRGYSNSPSSFNSDFASAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 196/284 (69%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N    +++ V+ A+++E RM ASL+RL FHDCFV GCD SILLD T    GEK+A PN  
Sbjct  48    NVFTTVKSQVQAAINKEARMGASLLRLFFHDCFVNGCDGSILLDDTSTFTGEKNAAPNKN  107

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+DV++  K  +EK CPGVVSCAD+L + ARD+ V  GGPSW V +GRRD+  A  A
Sbjct  108   SARGFDVVDNIKSAVEKVCPGVVSCADLLAITARDSTVILGGPSWNVKVGRRDARTASQA  167

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A   +P P S+L+ LI+ F   GLS RD+VALSG+HT+GQ +C  FR RIYN T++D  
Sbjct  168   AANNSIPPPTSNLNNLISFFQNVGLSTRDMVALSGSHTIGQARCTNFRTRIYNETNLDSS  227

Query  509   FANTRKRQCPEQ-QIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
              A TR+  CP     GD NL+PLDL TP  FDNNYYKNL+Q KGLL SDQ LFNGG TDS
Sbjct  228   LAKTRQSNCPRTVGSGDNNLAPLDLQTPTKFDNNYYKNLLQNKGLLHSDQQLFNGGSTDS  287

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +V  Y  +P  F +DFV+ MIK+ +I+PL    G IRK C  +N
Sbjct  288   LVRTYGSNPSTFTSDFVAGMIKMGDIKPLTGSSGEIRKNCRKIN  331



>ref|XP_008229747.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=319

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 200/282 (71%), Gaps = 0/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+++++AV  AV +E RM ASL+RLHFHDCFV GCDASILLD T    GEK ALPN  S
Sbjct  38    ALSVVKSAVINAVVKEHRMGASLLRLHFHDCFVNGCDASILLDDTSNFTGEKTALPNVGS  97

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+  K ++E  CPGVVSCADIL +AARD+V+S GGPSW V LGRRDST A  + 
Sbjct  98    LRGFEVIDTIKSQLESICPGVVSCADILAIAARDSVLSFGGPSWTVQLGRRDSTTASLSD  157

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A T+LPSP  DL  LI++F+ KG S  +LVALSG+HT+GQ +C +FR RIYN T+++ +F
Sbjct  158   ANTELPSPSLDLKDLISSFSTKGFSAEELVALSGSHTMGQARCRMFRNRIYNETNINSEF  217

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A   K  C +    D NLSPLD+ +P  FDN Y+KNL+  KGLL SDQ LF+GG TDS+V
Sbjct  218   ATFLKSNCTQSSGTDDNLSPLDITSPVFFDNTYFKNLVDSKGLLHSDQQLFSGGSTDSLV  277

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + Y+ S   F TDF +AM+K+  + PL    G IR  C   N
Sbjct  278   TTYSTSSGTFYTDFANAMVKMGNLSPLTGTSGQIRTNCRKTN  319



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/282 (56%), Positives = 206/282 (73%), Gaps = 1/282 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
             L+ ++++++ A+S+E R+ ASL+RL FHDCFV GCD SILLD T    GEK+A PN  SA
Sbjct  39    LSTVKSSMQSAISKETRIGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRNSA  98

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RGY+VI++ K  +EK CPGVVSCADIL +AARD+V   GGP+W V LGRRD+  A  + A
Sbjct  99    RGYEVIDSIKSAVEKVCPGVVSCADILAIAARDSVGILGGPTWDVKLGRRDARTASQSAA  158

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
              + +P P S+L+ LI+ F+  GLS +D+VALSG HT+GQ++C  FR RIYN +++D  FA
Sbjct  159   NSAIPPPTSNLNQLISKFSAVGLSTKDMVALSGGHTIGQSRCTSFRARIYNESNIDTSFA  218

Query  503   NTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
              TR+  CP     GD NL+PLDL TP  FDN Y+KNL+QKKGLL SDQ LFNGG TDSIV
Sbjct  219   RTRQSSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSIV  278

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y+ +P +F++DFV+AMIK+ +I PL    G +RK C  +N
Sbjct  279   RGYSTNPSSFSSDFVTAMIKMGDITPLTGSKGEVRKNCRRIN  320



>ref|XP_006596457.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=301

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/282 (57%), Positives = 201/282 (71%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+IIRT V  AV+++ RM ASL+RLHFHDCFV GCDAS+LLD+T    GEK A  N  S
Sbjct  21    ALSIIRTVVIGAVAKDHRMGASLLRLHFHDCFVNGCDASVLLDNTSTFTGEKSAGANVNS  80

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+  K ++E +CPGVVSCADIL +AARD+VV+ GGPSW V LGRRDST A    
Sbjct  81    LRGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVALGGPSWNVGLGRRDSTTASKDS  140

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A TD+PSP  DL  LI++F+KKG + +++VALSGAHT GQ +C LFR R+YN + ++ +F
Sbjct  141   ATTDIPSPLMDLSALISSFSKKGFNTKEMVALSGAHTTGQARCQLFRGRVYNESSIESNF  200

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + K  CP    GD NLSPLD+ T  +FD  Y+KNL+ KKGLL SDQ LF+GG TDS V
Sbjct  201   ATSLKSNCPSTG-GDSNLSPLDVTTSVLFDTAYFKNLINKKGLLHSDQQLFSGGSTDSQV  259

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + Y+  P AF  DF SAM+K+  + PL    G IR  C  VN
Sbjct  260   TAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTNCRKVN  301



>emb|CAH10840.1| peroxidase [Picea abies]
Length=320

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 197/279 (71%), Gaps = 1/279 (0%)
 Frame = -2

Query  1037  IIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARG  858
             I++T V+QAV++E+RM ASLVRLHFHDCFV GCD SILLD      GEK A PN  SARG
Sbjct  43    IVKTVVKQAVAKEKRMGASLVRLHFHDCFVNGCDGSILLDDNATFTGEKTAGPNANSARG  102

Query  857   YDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGT  678
             +DVI+  K ++E +C GVVSCADILT+AARD++V   GP+W V LGRRDS  A  + A  
Sbjct  103   FDVIDTIKTQVEAACSGVVSCADILTIAARDSIVELQGPTWTVMLGRRDSPTASLSAANN  162

Query  677   DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANT  498
             ++PSP S L TLIT+F   GLS +DLVALSGAHT+GQ++C  FR RIYN ++++  FA +
Sbjct  163   NIPSPASSLSTLITSFQNHGLSTKDLVALSGAHTIGQSRCAFFRTRIYNESNINAAFATS  222

Query  497   RKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
              K  CP    GD  LSPLD+VTP  FDN YY NL  +KGLL SDQ LFNGG TDS V+ Y
Sbjct  223   VKPNCPSAG-GDNTLSPLDVVTPTTFDNKYYSNLKVQKGLLHSDQQLFNGGSTDSQVTTY  281

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + +  +F TDF +AM+K+  I PL    G IRK C   N
Sbjct  282   STNQNSFFTDFAAAMVKMGNISPLTGTSGQIRKNCRKAN  320



>ref|XP_004492538.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=317

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 194/283 (69%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             + L+ I+T +  AV+ E RM ASL+RLHFHDCFVQGCD S+LLD T    GEK A PN  
Sbjct  36    DVLSTIKTQIDLAVNDEPRMGASLLRLHFHDCFVQGCDGSVLLDDTSSFTGEKSAGPNAN  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K E+E  CP VVSCADIL+VAARD+VV+ GGPSW V LGRRDST A   
Sbjct  96    SLRGFDVIDTIKSEVESLCPNVVSCADILSVAARDSVVALGGPSWTVQLGRRDSTTASLD  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A T+LP P SDL  LITAF KKG + +++VALSG+HT+GQ  C  FR RIYN  ++DP 
Sbjct  156   SANTNLPGPTSDLTNLITAFDKKGFTTQEMVALSGSHTIGQASCRFFRSRIYNEDNIDPT  215

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + +  CP    GD NLSPLD  TP  FDN+YY NL  + GL  SDQ LFN G TDSI
Sbjct  216   FAASLQANCPTSG-GDNNLSPLDTTTPDTFDNSYYTNLQSQMGLFHSDQELFNQGSTDSI  274

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+  P +F TDF +AM+K+  + PL    G IR  C A+N
Sbjct  275   VDGYSSDPSSFETDFANAMLKMGNLSPLTGSSGQIRTTCGAIN  317



>emb|CAD67477.1| peroxidase [Asparagus officinalis]
Length=315

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/284 (56%), Positives = 198/284 (70%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N    I+  ++ A+ +E+RM AS++RL FHDCFV GCD SILL  TP   GE+ A PNN 
Sbjct  32    NVFTTIKPVLQHAIEKEKRMGASILRLFFHDCFVNGCDGSILLADTPHFVGEQHANPNNR  91

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+ VI+  K  +EK+CPGVVSCADIL +AARD+VV  GGP+W V LGRRDS  A   
Sbjct  92    SARGFKVIDRIKTAVEKACPGVVSCADILAIAARDSVVILGGPNWDVKLGRRDSRTANKT  151

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  ++P P S L  L + FA KGLS +D+VALSGAHT+GQ +C  FR  IYN +D+DP 
Sbjct  152   AANNEIPPPTSSLANLTSLFAAKGLSTKDMVALSGAHTIGQARCTSFRSHIYNDSDIDPS  211

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA  RK  CP+Q   GD NL+PLDL TP  FDNNYY+NL+ KKGL+ SDQ LFNGG TDS
Sbjct  212   FATLRKSNCPKQSGSGDMNLAPLDLQTPTTFDNNYYRNLVVKKGLMHSDQELFNGGSTDS  271

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +V  Y+     F + FV  MIK+ ++ PL+  +G IRK+CS VN
Sbjct  272   LVKSYSDGTGKFYSAFVEGMIKMGDVSPLVGSNGEIRKICSKVN  315



>gb|AAB02554.1| cationic peroxidase [Stylosanthes humilis]
Length=320

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/284 (57%), Positives = 200/284 (70%), Gaps = 2/284 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I++AV  AVS+E R+ ASL+RLHFHDCFVQGCDAS+LLD T    GEK A PN  
Sbjct  38    NALSTIKSAVNSAVSKEARLGASLLRLHFHDCFVQGCDASVLLDDTSTFTGEKTAFPNVN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+DVI+  K ++E  CPGVVSCADIL +AARD+VV+ GGPSW V LGRRDST A   
Sbjct  98    SARGFDVIDTIKSQVESLCPGVVSCADILALAARDSVVALGGPSWNVQLGRRDSTTASLN  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +DLP P  +L  LI+AF+KKG + ++LV LSGAHT+GQ +C  FR RIYN +++DP 
Sbjct  158   SANSDLPGPSFNLSGLISAFSKKGFTAKELVTLSGAHTIGQARCTTFRTRIYNESNIDPS  217

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFN-GGVTDS  333
             +A + +  CP    GD NLSP D+ TP  FDN YY NL  KKGLL +DQ LFN GG TDS
Sbjct  218   YAKSLQGNCPSVG-GDSNLSPFDVTTPNKFDNAYYINLKNKKGLLHADQQLFNGGGSTDS  276

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              V+ Y+ +   FNTDF +AMIK+  + PL    G IR  C   N
Sbjct  277   QVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  320



>ref|XP_009125598.1| PREDICTED: peroxidase P7 [Brassica rapa]
Length=324

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/284 (55%), Positives = 204/284 (72%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++ V+ AVS + RM AS++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAGPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+ VI+  K  +EK+CPGVVSCADIL +AARD+VV  GGP+W V +GRRD+  A  A
Sbjct  101   SARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P   L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR R+YN T+++  
Sbjct  161   AANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA  R+R CP     GD NL+PLD+ +   FDN+Y+KNLM ++GLL SDQ LFNGG TDS
Sbjct  221   FATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHSDQVLFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ SP +FN+DF +AMIK+ +I PL    G IRKVC   N
Sbjct  281   IVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_003538325.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=320

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 201/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I++AV+ AV++ERRM ASL+RLHFHDCFV GCDAS+LLD T    GEK A  N  
Sbjct  39    NALSTIKSAVKSAVAKERRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKSAAANLN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E SCPG+VSCADI+ VAARD+VV+ GGPSW + LGRRDST A   
Sbjct  99    SLRGFDVIDDIKSQLESSCPGIVSCADIVAVAARDSVVALGGPSWTIGLGRRDSTAASKE  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +D+PSP  DL  LI+AF+ KG + +++V LSGAHT GQ +C  FR RIYN T++D D
Sbjct  159   AATSDIPSPLMDLSDLISAFSNKGFTSKEMVVLSGAHTTGQAKCQFFRGRIYNETNIDSD  218

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + K  CP    GD NLSPLD+ T  +FDN Y+KNL+ KKGLL SDQ LF+GG TDS 
Sbjct  219   FATSAKSNCPSTD-GDSNLSPLDVTTNVLFDNAYFKNLVNKKGLLHSDQQLFSGGSTDSQ  277

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ S   F  DF SAM+K+  + PL    G IR  C  VN
Sbjct  278   VTTYSTSSSTFYADFASAMVKMGNLSPLTGSSGQIRTNCRKVN  320



>emb|CDY04948.1| BnaAnng01300D [Brassica napus]
Length=324

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/284 (55%), Positives = 204/284 (72%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++ V+ AVS + RM AS++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  41    NLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAGPNRN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+ VI+  K  +EK+CPGVVSCADIL +AARD+VV  GGP+W V +GRRD+  A  A
Sbjct  101   SARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQA  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P   L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR R+YN T+++  
Sbjct  161   AANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVYNETNINAA  220

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA  R+R CP     GD NL+PLD+ +   FDN+Y+KNLM ++GLL SDQ LFNGG TDS
Sbjct  221   FATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHSDQVLFNGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ SP +FN+DF +AMIK+ +I PL    G IRKVC   N
Sbjct  281   IVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>tpe|CAH69378.1| TPA: class III peroxidase 136 precursor [Oryza sativa Japonica 
Group]
Length=317

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 194/283 (69%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL  IR AVR A++RE RM ASL+RLHFHDCFV GCD S+LLD TP   GEK A PNN 
Sbjct  36    NALPTIRIAVRSAIARENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTFTGEKTAAPNNN  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K  IE  CP VVSCADIL VAAR++VV+ GGP+W V LGRRDST A   
Sbjct  96    SLRGFDVIDNIKAHIEGICPQVVSCADILAVAARESVVALGGPTWVVQLGRRDSTTASLD  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  D+P+P  DL  L  +F+ KGLS  D++ALSGAHT+GQ +C  FR RIY+ T++D  
Sbjct  156   TANNDIPAPTFDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNFRNRIYSETNIDTS  215

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
              A + K  CP    GD N+SPLD  TPY FDN YYKNL+ KKG+L SDQ LFNGG  DS 
Sbjct  216   LATSLKSNCPNTT-GDNNISPLDASTPYAFDNFYYKNLLNKKGVLHSDQQLFNGGSADSQ  274

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              + Y+ +   F TDF +AM+K+  I P+    G IRK C  VN
Sbjct  275   TTTYSSNMATFFTDFSAAMVKMGNINPITGSSGQIRKNCRKVN  317



>gb|AFR44628.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03453.1| class III peroxidase [Ginkgo biloba]
Length=316

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/283 (56%), Positives = 202/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++AV+QAV++E RM ASL+RLHFHDCFV GCD SILLD +  + GEK A+PN  
Sbjct  35    NVLSTVKSAVKQAVAKEARMGASLLRLHFHDCFVNGCDGSILLDDSSTLTGEKTAVPNAN  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+DVI+  K ++E  C GVVSCADILT+AARD+VV  GGPSWAV LGRRDS  A  +
Sbjct  95    SARGFDVIDNIKSQVEAVCSGVVSCADILTIAARDSVVELGGPSWAVPLGRRDSRTASLS  154

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  ++P P S L  L++ F  +GLS +D+VAL+G HT+GQ +C  FR  IYN T++D  
Sbjct  155   GANNNIPPPTSSLANLMSKFQAQGLSTKDMVALAGGHTIGQARCTSFRAHIYNDTNIDTT  214

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             +AN+ K +CP     D N+SPLD+VTP  FDNNY+KNL  KKGLL SDQ LFNGG TDS 
Sbjct  215   YANSLKAKCPRTG-SDNNISPLDVVTPTSFDNNYFKNLRAKKGLLHSDQELFNGGSTDSQ  273

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y  SP  F  DF ++M+K+  I+PL   +G IRK C   N
Sbjct  274   VTSYVTSPITFRNDFATSMVKMGNIKPLTGTNGEIRKNCRKPN  316



>ref|XP_006848019.1| hypothetical protein AMTR_s00029p00173440 [Amborella trichopoda]
 gb|ERN09600.1| hypothetical protein AMTR_s00029p00173440 [Amborella trichopoda]
Length=318

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 201/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             +AL+ IR+ +R A+S ERRM ASL+RLHFHDCFV GCDAS+LLD T     EK+A  NN 
Sbjct  37    HALSTIRSKIRSAISAERRMGASLIRLHFHDCFVNGCDASLLLDDTSSFSSEKNARANNN  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+A K ++E  CPGVVSCADIL VAARD+  + GGP+W V LGRRDS  A   
Sbjct  97    STRGFEVIDAVKSKVESICPGVVSCADILAVAARDSSKAMGGPTWTVKLGRRDSATASET  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  +LPS   +LD LI+ F++KGL+ +DLVALSG+HT+GQ QC  FR RI+N  ++D  
Sbjct  157   DANANLPSFTDNLDELISLFSRKGLNTQDLVALSGSHTIGQAQCSTFRDRIHNEANIDSG  216

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA+TR+R CP     D NL+PLDLVTP  FDNNY+KNL+Q KGLL SDQ LFN G TD +
Sbjct  217   FASTRQRGCPTSG-SDTNLAPLDLVTPTSFDNNYFKNLLQLKGLLHSDQVLFNNGSTDGL  275

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y++S   F +DF SAM+K+ +I PL    G IR  C   N
Sbjct  276   VRTYSESRSTFYSDFASAMVKMGDIGPLTGSSGQIRTNCGVPN  318



>dbj|BAJ97638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/283 (55%), Positives = 200/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  + + V+ AV+ E RM AS++RL FHDCFVQGCD S+LLD T   +GEK A PNN S
Sbjct  38    ALGAVASVVQSAVANEPRMGASILRLFFHDCFVQGCDGSLLLDDTASFQGEKMATPNNGS  97

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+A K  +EK CPGVVSCAD+L +AARD+VV+ GGP+WAV +GRRDST A  + 
Sbjct  98    VRGFEVIDAIKVAVEKICPGVVSCADVLAIAARDSVVALGGPNWAVKVGRRDSTTASFSG  157

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  ++P P S L  L + FA +GLS++D+VALSG+HT+GQ +C  FR  +YN T++D  F
Sbjct  158   ANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQARCTNFRAHVYNETNIDSGF  217

Query  506   ANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             A TR+  CP     GD NL+PLDL TP  F+NNYYKNL+ KKGL+ SDQ LFNGG TD +
Sbjct  218   AGTRRSGCPPNSGSGDNNLAPLDLQTPTAFENNYYKNLVAKKGLMHSDQELFNGGATDPL  277

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y  S  AF  DFV  MIK+ +I PL   +G +RK C  +N
Sbjct  278   VQYYVSSQSAFFADFVEGMIKMGDISPLTGNNGEVRKNCRKIN  320



>sp|P00434.3|PERP7_BRARR RecName: Full=Peroxidase P7; AltName: Full=TP7 [Brassica rapa 
subsp. rapa]
Length=296

 Score =   335 bits (860),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/284 (55%), Positives = 203/284 (71%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+ +++ V+ AVS + RM AS++RL FHDCFV GCD SILLD T    GE++A PN  
Sbjct  13    NLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAGPNRN  72

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+ VI   K  +EK+CPGVVSCADIL +AARD+VV  GGP+W V +GRRD+  A  A
Sbjct  73    SARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQA  132

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +++P+P   L  LI++F+  GLS RD+VALSGAHT+GQ++C  FR R+YN T+++  
Sbjct  133   AANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVYNETNINAA  192

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA  R+R CP     GD NL+PLD+ +   FDN+Y+KNLM ++GLL SDQ LFNGG TDS
Sbjct  193   FATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHSDQVLFNGGSTDS  252

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ SP +FN+DF +AMIK+ +I PL    G IRKVC   N
Sbjct  253   IVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  296



>emb|CAL25300.1| properoxidase [Picea abies]
Length=310

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/279 (56%), Positives = 197/279 (71%), Gaps = 1/279 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL++++ AVRQAV+ E+RM ASL+RLHFHDCFV GCD S+LLD +  I GEK A PN  S
Sbjct  28    ALSVVKAAVRQAVANEKRMGASLLRLHFHDCFVNGCDGSVLLDDSSTITGEKTANPNANS  87

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARG+DVI+  K  +EK+C GVVSCADIL ++ARD+VV  GGPSW V LGRRDST A    
Sbjct  88    ARGFDVIDTIKSNVEKACSGVVSCADILAISARDSVVELGGPSWTVMLGRRDSTTASKNG  147

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  ++P P S L  LI+ F  +GLS +++VALSG HT+GQ +C  FR  IYN T++D  +
Sbjct  148   ANNNIPPPTSSLSNLISLFQAQGLSTKEMVALSGGHTIGQARCVNFRAHIYNETNIDSTY  207

Query  506   ANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             + + + +CP     GD NLSPLD VTP  FD NYY NL  KKGLL SDQ LFNGG TDS 
Sbjct  208   STSLQSKCPSTAGSGDSNLSPLDYVTPTAFDKNYYSNLKSKKGLLHSDQELFNGGSTDSQ  267

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVC  213
             V+ YA +  +F +DF +AM+K+  I+PL    G IRK C
Sbjct  268   VTTYASNQNSFFSDFAAAMVKMGNIKPLTGTSGQIRKNC  306



>ref|XP_007045344.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY01176.1| Peroxidase superfamily protein [Theobroma cacao]
Length=319

 Score =   336 bits (861),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/285 (60%), Positives = 202/285 (71%), Gaps = 12/285 (4%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ IR  +R A++RERRMAASL+RLHFHDCFVQ            V   EK A PNN 
Sbjct  44    NALSTIRKPIRTAIARERRMAASLIRLHFHDCFVQ----------VLVFPSEKLAPPNNH  93

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+ AK  +EK CPGVVSCADIL VAARDA V  GGPSW V LGRRDST A   
Sbjct  94    SVRGFEVIDQAKSAVEKVCPGVVSCADILAVAARDASVYVGGPSWTVKLGRRDSTTASPC  153

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDP  513
              A +DLP P   L  LI+ F  KGLS RD+VALSGAHT+GQ QCF F+ RIY N +++D 
Sbjct  154   LACSDLPRPNDSLKRLISRFRAKGLSARDMVALSGAHTIGQAQCFTFQERIYSNGSNIDA  213

Query  512   DFANTRKRQCPEQQI-GDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTD  336
              FA+ R+ +CP     G  NL+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG TD
Sbjct  214   GFASKRRLRCPATPGDGKSNLAALDLVTPNSFDNNYFKNLLQKKGLLQSDQVLFSGGSTD  273

Query  335   SIVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              IVSEY+++P  F +DF +AMIK+  I+P     GIIRK+CS VN
Sbjct  274   DIVSEYSRNPCTFKSDFATAMIKMGNIKPPTGSAGIIRKICSQVN  318



>ref|XP_002269918.1| PREDICTED: peroxidase 4 [Vitis vinifera]
 sp|A7NY33.1|PER4_VITVI RecName: Full=Peroxidase 4; Flags: Precursor [Vitis vinifera]
 emb|CBI15844.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   336 bits (861),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 196/282 (70%), Gaps = 1/282 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
              + +++ V+ AVS+ERRM ASL+RL FHDCFV GCDAS+LLD T    GE+ A+PN  S 
Sbjct  40    FDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASVLLDDTSSFTGEQTAVPNKNSI  99

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG +VI+  K ++E  CPGVVSCADI+ +AARD+VV  GGP W V LGRRDS  A  + A
Sbjct  100   RGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGPDWDVKLGRRDSKTASLSGA  159

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
               ++P P S L  LI+ F  +GLS RD+VALSGAHT+GQ +C  FR RIYN T++D  FA
Sbjct  160   NNNIPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQARCTSFRARIYNETNIDSSFA  219

Query  503   NTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
              TR+  CP     GD NL+PLDL TP  FDN YYKNL+ +KGLL SDQ L+NGG TDS V
Sbjct  220   KTRQASCPSASGSGDNNLAPLDLQTPTTFDNYYYKNLINQKGLLHSDQVLYNGGSTDSTV  279

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y  +P+ F +DFV+ MIK+ +I PL    G IRK C  VN
Sbjct  280   KTYVNNPKTFTSDFVAGMIKMGDITPLTGSEGEIRKSCGKVN  321



>emb|CBI27504.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   337 bits (864),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/260 (64%), Positives = 203/260 (78%), Gaps = 2/260 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRTA R+AVSRERRMAASL+RLHFHDCFVQGCDASILLD +  I+ EK+A  N  S
Sbjct  41    ALSTIRTATRKAVSRERRMAASLIRLHFHDCFVQGCDASILLDDSSSIQSEKNAPNNLNS  100

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARGY+VI   K ++E  CPG+VSCADIL VAARDA V+ GGP+W V LGRRDST +  ++
Sbjct  101   ARGYEVIHDVKSQVESICPGIVSCADILAVAARDASVAVGGPTWTVKLGRRDSTTSGLSQ  160

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIY-NHTDVDPD  510
               ++LPS    LD LI+ F  KGLS RD+VALSG+HT+GQ +C  FR RIY N TD+D  
Sbjct  161   VSSNLPSFRDSLDRLISLFGSKGLSTRDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAG  220

Query  509   FANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA+TR+R+CP +   GD NL+ LDLVTP  FDNNY+KNL+QKKGLLQSDQ LF+GG TDS
Sbjct  221   FASTRRRRCPADNGDGDDNLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  280

Query  332   IVSEYAKSPEAFNTDFVSAM  273
             IVSEY+K+ + F++DF  AM
Sbjct  281   IVSEYSKNRKTFSSDFALAM  300



>gb|AHL39176.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/282 (57%), Positives = 194/282 (69%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRTAV +AV +E RM ASL+RLHFHDCFVQGCDAS+LLD T    GEK A PN  S
Sbjct  36    ALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVQGCDASVLLDDTSSFTGEKTAGPNANS  95

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RGYDVI+  K ++E  CPGVVSCADIL VAARD+VV+  GPSW V LGRRDST A    
Sbjct  96    LRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTVQLGRRDSTTASLGA  155

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A +DLPSP  DL  LIT+F+ KG + +++VALSG+HT+GQ +C LFR R+YN T +D   
Sbjct  156   ANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLLFRNRVYNETSLDSTL  215

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + K  CP     D +LS LD  TP  FDN+Y+KNL   KGLL SDQ LF+GG TDS V
Sbjct  216   ATSLKSNCPNTG-SDDSLSSLDATTPVTFDNSYFKNLANNKGLLHSDQQLFSGGTTDSQV  274

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y+ +   F  DF SAM+K+  I PL    G IR  C+ VN
Sbjct  275   KTYSINSATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  316



>gb|EMT02760.1| Peroxidase 4 [Aegilops tauschii]
Length=283

 Score =   334 bits (857),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/282 (56%), Positives = 201/282 (71%), Gaps = 1/282 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
             L  +R+A+R A++RERR+ AS+VRL FHDCFVQGCDAS+LLD  P + GEK+A PN  S 
Sbjct  2     LKAVRSALRPAIARERRVGASIVRLFFHDCFVQGCDASLLLDDAPGLSGEKNAKPNKNSV  61

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG+DVI+A K  +EK CPGVVSCADIL +AA ++VV  GGPSW V +GRRDST A    A
Sbjct  62    RGFDVIDAIKTAVEKECPGVVSCADILAIAAEESVVLLGGPSWEVKMGRRDSTTASFNGA  121

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
               ++P P S L  L + FA +GLS++D+VALSGAHT+GQ +C  FR  IYN T++D  FA
Sbjct  122   ENNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTFFRDHIYNDTNIDSGFA  181

Query  503   NTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
              +R+  CP     GD NL+PLDL TP  F+N+YYKNL+QK+G+L SDQ LFNGG  D++V
Sbjct  182   RSRQSGCPRTAGSGDNNLAPLDLQTPTTFENDYYKNLVQKRGILHSDQELFNGGAADALV  241

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              +Y  S   F  DFV  M+K+ +I PL   +G IRK C  +N
Sbjct  242   RQYIGSQSTFFQDFVVGMVKMGDITPLTGSNGQIRKNCRRIN  283



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score =   335 bits (860),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/279 (56%), Positives = 200/279 (72%), Gaps = 2/279 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L++I+TAV  A+S+E RM ASL+RLHFHDCFV GCDAS+LLD T    GEK A PN+ 
Sbjct  34    NVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKTANPNSG  93

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E +C GVVSCADIL VAARD+VV  GGPSW V LGRRDST A  +
Sbjct  94    SLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSWNVLLGRRDSTTASLS  153

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  D+P+P  +L +LI++F+ KG + R++VALSG+HT+GQ +C  FR R+YN T+++  
Sbjct  154   AANNDIPAPTLNLSSLISSFSNKGFNAREMVALSGSHTIGQARCTTFRDRLYNETNINSS  213

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             F  + K  CP Q  GD NLSPLD  +P  FDN YYKNL  +KG+L SDQ LFNGG TDSI
Sbjct  214   FGTSIKANCP-QNGGDNNLSPLD-TSPTTFDNAYYKNLQSQKGILHSDQQLFNGGSTDSI  271

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVC  213
             V+ Y+ +   F TDF  AM+K+  + PL   +G IRK C
Sbjct  272   VNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNC  310



>ref|XP_009358287.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=319

 Score =   335 bits (860),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 199/282 (71%), Gaps = 0/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL I+R AV  AV +E RM ASL+RLHFHDCFV GCDAS+LLD T    GEK ALPN  S
Sbjct  38    ALFIVRNAVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTANFTGEKTALPNTNS  97

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+  K E+E +CPGVVSCADIL +AARD+V+  GGPSW V LGRRDST A  + 
Sbjct  98    LRGFEVIDTIKSELESACPGVVSCADILAIAARDSVLLLGGPSWTVQLGRRDSTTASLSA  157

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A T+LPSP  +L+ LI+ F+ KG + ++LVALSG+HT+GQ +C LFR RI+N T++D  F
Sbjct  158   ANTELPSPSLNLNDLISFFSTKGFTTKELVALSGSHTMGQARCLLFRERIHNETNIDSSF  217

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + K  C      D NLS LD+ +P +FDN Y+KNL+  KGLL SDQ LF+GG TDS+V
Sbjct  218   AASLKLNCTASSGTDDNLSSLDVTSPVIFDNAYFKNLVNSKGLLHSDQQLFSGGSTDSLV  277

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + Y+ +   F TDF SAM+K+  + PL    G +R  C  +N
Sbjct  278   TTYSTTAGTFYTDFASAMVKMGSLSPLTGTTGQVRTNCRKIN  319



>gb|KHN29529.1| Cationic peroxidase 1 [Glycine soja]
Length=314

 Score =   335 bits (859),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 197/283 (70%), Gaps = 3/283 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I++ V  AV+ ERRM ASL+RLHFHDCF  GCDAS+LLD T    GEK A PN  
Sbjct  35    NALSTIKSEVVSAVNNERRMGASLLRLHFHDCF--GCDASVLLDDTSSFTGEKTAGPNAG  92

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E  CPGVVSCADIL VAARD+VV+ GG +W V LGRRDST A  +
Sbjct  93    SIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTVQLGRRDSTTASLS  152

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +DLP P S L  LI++F+ KG S ++LVALSG+HT+GQ QC  FR RIYN T++D  
Sbjct  153   SANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIYNDTNIDSS  212

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + +  CP    GD NL+PLD  +P  FDN Y+KNL  KKGLL SDQ LFNGG TDS 
Sbjct  213   FAKSLQGNCPSTG-GDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQ  271

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ +P +F TDF +AMIK+  + PL    G IR  C   N
Sbjct  272   VNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  314



>pdb|1SCH|A Chain A, Peanut Peroxidase
 pdb|1SCH|B Chain B, Peanut Peroxidase
Length=294

 Score =   334 bits (857),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 199/283 (70%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I++AV  AV++E RM ASL+RLHFHDCFVQGCDAS+LLD T    GEK A PN  
Sbjct  13    NALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSNFTGEKTAGPNAN  72

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+  K ++E  CPGVVSCADIL VAARD+VV+ GG SW V LGRRDST A  +
Sbjct  73    SIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLLGRRDSTTASLS  132

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +DLP+P+ +L  LI+AF+ KG + ++LV LSGAHT+GQ QC  FR RIYN +++DP 
Sbjct  133   SANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAFRTRIYNESNIDPT  192

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             +A + +  CP    GD NLSP D+ TP  FDN YY NL  KKGLL SDQ LFNG  TDS 
Sbjct  193   YAKSLQANCPSVG-GDTNLSPFDVTTPNKFDNAYYINLRNKKGLLHSDQQLFNGVSTDSQ  251

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ +   FNTDF +AMIK+  + PL    G IR  C   N
Sbjct  252   VTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  294



>ref|XP_010650833.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=307

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/282 (57%), Positives = 198/282 (70%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRTAV  AV+ E RM ASL+RLHFHDCFV GCD SILLD T    GEK A PN  S
Sbjct  27    ALSTIRTAVNTAVANENRMGASLLRLHFHDCFVNGCDGSILLDDTANFTGEKTAGPNADS  86

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+  K  +E  CPGVV+CADIL VAARD+VV+ GGP+W V LGRRDST A  + 
Sbjct  87    VRGFEVIDDIKSRVESVCPGVVTCADILAVAARDSVVALGGPTWTVQLGRRDSTTASISD  146

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A TD+PSP  DLD LI+AF+ KG S +++VALSG+HT+GQ++C +FR RIYN  ++D  F
Sbjct  147   AETDIPSPALDLDDLISAFSDKGFSAKEMVALSGSHTIGQSRCLVFRDRIYNDDNIDSSF  206

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + K  CP+   GD NLS LD  +P +FDN Y+KNL+  KGLL SDQ LFN G TDS V
Sbjct  207   AESLKSNCPDTD-GDDNLSALDDTSPVIFDNGYFKNLVDNKGLLHSDQELFNNGSTDSQV  265

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             S YA S  +F  DF +AM+K+  I PL    G IR  C  +N
Sbjct  266   SSYASSATSFYKDFTAAMVKMGNISPLTGTKGQIRVNCRKIN  307



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/284 (56%), Positives = 203/284 (71%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N  + +++ V+ A+S+E RM ASL+RL FHDCFV GCD SILLD T    GEK+A PN  
Sbjct  37    NLFSSVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRN  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K  +EK CPGVVSCADIL +AARD+V   GGP+W V LGRRD+  A  +
Sbjct  97    SARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNVKLGRRDARTASQS  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A   +P+P S+L+ LI+ F+  GLS +DLVALSG HT+GQ +C  FR RIYN T+++  
Sbjct  157   AANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFRARIYNETNIETA  216

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR++ CP     GD NL+PLDL TP  FDN Y+KNL+QKKGLL SDQ LFNGG TDS
Sbjct  217   FARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLHSDQQLFNGGSTDS  276

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             IV  Y+ +P  F++DF +AMIK+ +I PL   +G IRK C  +N
Sbjct  277   IVRGYSTNPGTFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  320



>ref|XP_004978554.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=331

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 200/279 (72%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++ V+ A++RE+RM AS++RL FHDCFVQGCDAS+LLD T   +GEK A PNN S RG+
Sbjct  53    VKSVVQAAIAREQRMGASILRLFFHDCFVQGCDASLLLDDTSSFQGEKMATPNNGSVRGF  112

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  +EK CPGVVSCADIL +AARD+VV  GGP+W V +GRRDST A  + A  +
Sbjct  113   EVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPNWDVKVGRRDSTTASFSGANNN  172

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+GQ +C  FR  +YN T++D  FA TR
Sbjct  173   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRAHVYNDTNIDGAFARTR  232

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP  F+NNYYKNL+ KKGLL SDQ LFNGG TD+ V  Y
Sbjct  233   QSACPRTSGSGDNNLAPLDLQTPTAFENNYYKNLVCKKGLLHSDQELFNGGSTDAQVQSY  292

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               S  AF  DFV+ MIK+  I PL   +G IRK C  +N
Sbjct  293   VSSQSAFFADFVTGMIKMGGITPLTGSNGEIRKNCRRIN  331



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/280 (57%), Positives = 203/280 (73%), Gaps = 2/280 (1%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++AV+ A+ +E RM ASL+RL FHDCFV GCD S+LLD T    GEK A PN  SARG+
Sbjct  42    VKSAVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLLDDTSSFTGEKRAAPNVNSARGF  101

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+  K  +EK CPGVVSCADIL V ARD+VV  GGP+W V LGRRD+  A  A A   
Sbjct  102   EVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNVKLGRRDARTASQAAANRS  161

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHT-DVDPDFANT  498
             +P P S+L+ LI++F+  GLS +D+VALSGAHT+GQ +C  FR RIYN T ++D  FA T
Sbjct  162   IPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTFRARIYNETNNLDASFART  221

Query  497   RKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSE  321
             R+  CP     GD +L+PLDL TP  FDNNY+KNL+ KKGLL SDQ LFNGG  DSIV+ 
Sbjct  222   RQSNCPRSSGSGDNSLAPLDLQTPNKFDNNYFKNLVNKKGLLHSDQQLFNGGSADSIVTS  281

Query  320   YAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             Y+ +P +F++DFV+AMIK+ +I+PL   +G IRK C  +N
Sbjct  282   YSNNPRSFSSDFVTAMIKMGDIRPLTGSNGEIRKNCGRIN  321



>ref|XP_004978553.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=355

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/279 (56%), Positives = 197/279 (71%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++ V+ A+ +E+RM AS+VRL FHDCFVQGCD S+LLD TP  +GEK A PNN S RG+
Sbjct  77    VKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDGSLLLDDTPSFQGEKMATPNNGSVRGF  136

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  +EK CPGVVSCADIL +AARD+VV  GGP+W V +GRRDS  A  + A   
Sbjct  137   EVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPNWNVKVGRRDSMTASFSGANNS  196

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+G  +C  FR  +YN T++D   A TR
Sbjct  197   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLARCTNFRAHVYNETNIDGALARTR  256

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP VF+NNYYKNL+ KKGLL SDQ LFNGG TD+ V  Y
Sbjct  257   QSGCPSTSGTGDNNLAPLDLQTPTVFENNYYKNLVSKKGLLHSDQELFNGGATDAQVQSY  316

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               S  AF  DFV+ MIK+ +I PL   +G IRK C  +N
Sbjct  317   VSSQSAFFADFVTGMIKMGDITPLTGSNGEIRKNCRRIN  355



>emb|CAD67478.1| peroxidase [Asparagus officinalis]
Length=301

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/282 (56%), Positives = 197/282 (70%), Gaps = 1/282 (0%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
              + I+  ++ A+++E+RM AS++RL FHDCFV GCD SILL  T    GE+ A PNN S 
Sbjct  20    FSTIKPVLQSAIAKEKRMGASILRLFFHDCFVNGCDGSILLADTANFRGEQHAGPNNGSV  79

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG+ VI+  K  +E +CPGVVSCADIL VAARD+VV  GGP W V LGRRD+  A    A
Sbjct  80    RGFKVIDKIKTAVENACPGVVSCADILAVAARDSVVILGGPDWKVKLGRRDARTASATLA  139

Query  683   GTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFA  504
               ++P P S L  LI+ FA +GLS +D+VALSGAHT+GQ +C  FR  IYN  D+D  FA
Sbjct  140   NNNIPPPTSSLSNLISKFAAQGLSTKDMVALSGAHTIGQARCTSFRGHIYNDADIDASFA  199

Query  503   NTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             + R++ CP +   GD NL+PLDL TP  FDNNYYKNL+ KKGLL SDQ LFN G TDS+V
Sbjct  200   SLRQKICPRKSGSGDTNLAPLDLQTPTAFDNNYYKNLINKKGLLHSDQELFNNGATDSLV  259

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y+ S  +FN+DFV AMIK+ +I PL    G IRK+CS +N
Sbjct  260   KSYSNSEGSFNSDFVKAMIKMGDISPLTGSKGEIRKICSKIN  301



>ref|XP_006486214.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 198/284 (70%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L  +++ V+ AVS+E RM ASL+RL FHDCFV GCD S+LLD T    GEK+A+PN  
Sbjct  36    NLLPTVKSVVQSAVSKEARMGASLLRLFFHDCFVNGCDGSVLLDDTSSFTGEKNAVPNRN  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K  +EK+CPG VSCADIL + ARD+VV  GGPSW V LGRRDS  A  +
Sbjct  96    SARGFEVIDNIKSAVEKACPGAVSCADILAITARDSVVLLGGPSWEVKLGRRDSRTASQS  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A + +P P S+L+ L + F   GLS +DLVAL+G HT+GQ +C  FR  IYN T++D  
Sbjct  156   AANSGIPPPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQARCTSFRAHIYNETNIDAS  215

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+  CP     GD NL+PLDL TP  FDNNY+KNL+ +KGLL SDQ LFNGG TDS
Sbjct  216   FARTRQGNCPRANGTGDNNLAPLDLQTPTSFDNNYFKNLVNRKGLLHSDQQLFNGGSTDS  275

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              V  Y+ +P  F++DFV+ MIK+ +I PL    G IRK C  +N
Sbjct  276   QVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRKNCRRIN  319



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/283 (56%), Positives = 198/283 (70%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N  + ++  V+ A+++E+RM ASLVRL FHDCFV GCD SILLD T    GE+ A+PN  
Sbjct  37    NLFSTVKPVVQSAINQEKRMGASLVRLFFHDCFVNGCDGSILLDDTSSFTGEQTAVPNRN  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI++ K  +EK+CPGVVSCADIL +AARD+    GGPSW V LGRRD+  A  +
Sbjct  97    SVRGFEVIDSIKSAVEKACPGVVSCADILAIAARDSTAILGGPSWNVKLGRRDARTASLS  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A   +P+P S+L+ LI+ F+  GLS RDLVALSGAHT+GQ +C  FR RIYN T++D  
Sbjct  157   AANNGIPAPTSNLNQLISRFSALGLSTRDLVALSGAHTIGQARCTNFRTRIYNDTNIDSS  216

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA TR+  CP    GD NL+PLDL TP  FDNNY+KNL+ +KGLL SDQ LFN G TDSI
Sbjct  217   FAQTRRSNCPSTG-GDNNLAPLDLQTPTSFDNNYFKNLLVQKGLLHSDQELFNNGSTDSI  275

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+     F +DFV+ MIK+ +I PL    G IRK C  VN
Sbjct  276   VRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCGKVN  318



>ref|XP_004500339.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=318

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/282 (57%), Positives = 199/282 (71%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+II +AV  AVS+E+RM ASL+RLHFHDCFV GCDAS+LLD T    GEK A  N  S
Sbjct  38    ALSIINSAVCSAVSKEQRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKSAGANVNS  97

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+  K ++E +CPG+VSCADI+ VAARD+V + GGPSW+V LGRRDST A    
Sbjct  98    LRGFEVIDDIKTQLETACPGIVSCADIVAVAARDSVKALGGPSWSVGLGRRDSTTASKDA  157

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  D+PSP  DL  LI+AF+ KG +  ++V LSGAHT GQ +C LFR RIYN T +D +F
Sbjct  158   ATNDIPSPLMDLSDLISAFSNKGFTTNEMVVLSGAHTTGQARCQLFRGRIYNETTIDSNF  217

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + K  CP    GD NL+ LD+ T  +FDN Y+KNL+ KKGLL SDQ LF+GG TDS V
Sbjct  218   ATSVKSNCPSTG-GDSNLTSLDVTTNVLFDNAYFKNLVNKKGLLHSDQQLFSGGSTDSQV  276

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + Y+ SP  FN DF SAM+K+  + PL   +G IR  C  VN
Sbjct  277   TTYSTSPSTFNADFASAMVKMGNLSPLTGNNGQIRTNCHKVN  318



>ref|XP_004294750.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=318

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 200/282 (71%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ +RTAV  AV +E RM ASL+RLHFHDCFV GCDAS+LLD T    GEK ALPN  S
Sbjct  38    ALSTVRTAVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTANFTGEKTALPNLNS  97

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG+DV++  K ++E  CPGVVSCADIL +AARD+VVS GGPSW V LGRRDST A  + 
Sbjct  98    LRGFDVVDTIKSQLESICPGVVSCADILAIAARDSVVSLGGPSWIVQLGRRDSTTASLSA  157

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A ++LPSP  D++ LI+AF+ KG S ++LVALSG+HT+GQ +C LFR RIYN T ++  F
Sbjct  158   ANSELPSPSLDVNDLISAFSNKGFSAKELVALSGSHTMGQAKCVLFRDRIYNETSINSAF  217

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             + + K  CP     D NLSPLD+ +P  FDN YYKNL+  KGLL SDQ LF+GG TDS V
Sbjct  218   STSLKSNCPNSG-SDDNLSPLDVTSPVFFDNAYYKNLVNSKGLLHSDQQLFSGGSTDSQV  276

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + Y+ +  AF  DF +AM+K+  +  L   +G IR  C  +N
Sbjct  277   TTYSTTASAFFADFANAMVKMGNLNLLTGSNGQIRTNCRKIN  318



>sp|P22195.2|PER1_ARAHY RecName: Full=Cationic peroxidase 1; AltName: Full=PNPC1; Flags: 
Precursor [Arachis hypogaea]
 gb|AAB06183.1| cationic peroxidase [Arachis hypogaea]
Length=316

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 199/283 (70%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I++AV  AV++E RM ASL+RLHFHDCFVQGCDAS+LLD T    GEK A PN  
Sbjct  35    NALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSNFTGEKTAGPNAN  94

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+  K ++E  CPGVVSCADIL VAARD+VV+ GG SW V LGRRDST A  +
Sbjct  95    SIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLLGRRDSTTASLS  154

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +DLP+P+ +L  LI+AF+ KG + ++LV LSGAHT+GQ QC  FR RIYN +++DP 
Sbjct  155   SANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAFRTRIYNESNIDPT  214

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             +A + +  CP    GD NLSP D+ TP  FDN YY NL  KKGLL SDQ LFNG  TDS 
Sbjct  215   YAKSLQANCPSVG-GDTNLSPFDVTTPNKFDNAYYINLRNKKGLLHSDQQLFNGVSTDSQ  273

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ +   FNTDF +AMIK+  + PL    G IR  C   N
Sbjct  274   VTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  316



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/279 (56%), Positives = 198/279 (71%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             I++ V+ A+S E+RM ASL+RL FHDCFV GCD S+LLD T    GEK+A+PN  S RG+
Sbjct  42    IKSVVQSAISSEKRMGASLLRLFFHDCFVNGCDGSLLLDDTSSFTGEKNAIPNKGSVRGF  101

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             DVI+  K  +E++CPGVVSCADIL V ARD+VV  GGP+W V LGRRDS  A  + A  +
Sbjct  102   DVIDKIKTAVEQACPGVVSCADILAVTARDSVVLLGGPTWNVKLGRRDSRTASQSGANNN  161

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  LI+ F+ +GLS +++VAL GAHT+GQ +C  FR  +YN TD+D  FA TR
Sbjct  162   IPPPTSSLSNLISKFSAQGLSAKEMVALVGAHTIGQARCTNFRAHVYNDTDIDATFAKTR  221

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP  FDNNY+KNL+ KKGLL SDQ +F+GG T+S VS Y
Sbjct  222   QSNCPSTSGSGDNNLAPLDLQTPVAFDNNYFKNLVSKKGLLHSDQQVFSGGSTNSQVSTY  281

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + SP  +++DFV+AMIK+ +I PL    G IRK C   N
Sbjct  282   STSPSTWSSDFVAAMIKMGDISPLTGKSGEIRKNCRKTN  320



>ref|XP_002441703.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
 gb|EES15541.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
Length=328

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 202/279 (72%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +R+ ++ A++RE+RM AS++RL FHDCFVQGCDAS+LLD TP  +GEK A PNN SARG+
Sbjct  50    VRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLLLDDTPSFQGEKMANPNNGSARGF  109

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+A K  ++K CPGVVSCADIL +AARD+VV  GGPSW V +GRRDS  A  + A  +
Sbjct  110   EVIDAIKSAVDKVCPGVVSCADILAIAARDSVVILGGPSWDVKVGRRDSRTASFSGANNN  169

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+G  +C  FR  IYN T++D  FA +R
Sbjct  170   IPPPTSGLVNLTSLFAAQGLSQKDMVALSGAHTIGLARCTNFRAHIYNDTNIDGSFARSR  229

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP VF+NNYYKNL+ KKG+L SDQ LFNGG TD+ V  Y
Sbjct  230   QSVCPRTSGSGDNNLAPLDLQTPTVFENNYYKNLVYKKGILHSDQELFNGGSTDAQVQSY  289

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               S  AF  DFV+ MIK+ +I PL   +G IRK C  +N
Sbjct  290   VSSQSAFFADFVTGMIKMGDIMPLTGSNGEIRKNCRRIN  328



>ref|XP_007033589.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04515.1| Peroxidase superfamily protein [Theobroma cacao]
Length=322

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 199/282 (71%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL  I++AV  AVS+E RM ASL+RLHFHDCFV GCDASILLD T  I GEK A PNN S
Sbjct  42    ALATIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASILLDDTANITGEKTAGPNNNS  101

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RGY+VI+  K ++E  CP VVSCADI+ VAARD+VV+ GGPSW+V LGRRDST A    
Sbjct  102   VRGYEVIDTIKSQLESLCPAVVSCADIVAVAARDSVVALGGPSWSVLLGRRDSTTASLNA  161

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A +++P+P   L  LI+AF+ KG + +++VALSG+HT+GQ +C  FR RIYN T +DP F
Sbjct  162   ANSNIPAPTLSLSGLISAFSNKGFTAKEMVALSGSHTIGQARCTTFRSRIYNETTIDPSF  221

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + +  CP    GD NLSPLD  +P  FDN YYKNL  +KGLL SDQ LF+GG TDS V
Sbjct  222   ATSLRANCPSTG-GDNNLSPLDTTSPTSFDNAYYKNLQSQKGLLHSDQQLFSGGSTDSQV  280

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + Y+ +  +F TDF +AMIK+  + PL    G IR  C  VN
Sbjct  281   NAYSSNLGSFRTDFANAMIKMGNLSPLTGTSGQIRTNCRKVN  322



>ref|XP_002489046.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
 gb|EES20431.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
Length=320

 Score =   333 bits (855),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 197/279 (71%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             ++  V+ A+  E+R+ AS+VRL FHDCFVQGCDAS+LLD T   +GEK A PNN S RG+
Sbjct  42    VKPVVQSAIDSEKRVGASIVRLFFHDCFVQGCDASLLLDDTATFQGEKMATPNNGSVRGF  101

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+AAK  +E  CPGVVSCADIL +AARD+VV  GGPSW V +GRRDST A  + A  +
Sbjct  102   EVIDAAKSAVENVCPGVVSCADILAIAARDSVVILGGPSWDVKVGRRDSTTASFSGANNN  161

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P P S L  L + FA +GLS++D+VALSGAHT+GQ +C  FR  IYN T+VD  FA TR
Sbjct  162   IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRDHIYNDTNVDGAFARTR  221

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP     GD NL+PLDL TP VF+N+YYKNL+   GLL SDQ LFNGG TD++V  Y
Sbjct  222   QSGCPSTSGTGDNNLAPLDLQTPTVFENDYYKNLVSNMGLLHSDQELFNGGATDALVQSY  281

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               S  AF  DFV+ MIK+ +I PL    G IRK C  +N
Sbjct  282   VSSQSAFFADFVTGMIKMGDITPLTGSAGEIRKNCRRIN  320



>ref|XP_007206416.1| hypothetical protein PRUPE_ppa018664mg [Prunus persica]
 gb|EMJ07615.1| hypothetical protein PRUPE_ppa018664mg [Prunus persica]
Length=303

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 200/282 (71%), Gaps = 0/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+++R++V  AV +E RM ASL+RLHFHDCFV GCDAS+LLD T    GEK ALPN  S
Sbjct  22    ALSVVRSSVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSNFTGEKTALPNVRS  81

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG++VI+  K ++E  CPGVVSCADIL VAARD+V+  GGPSW V LGRRDST A  + 
Sbjct  82    LRGFEVIDTIKSQLESLCPGVVSCADILAVAARDSVLLFGGPSWTVQLGRRDSTTASLSD  141

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A T+LPSP  DL  LI++F+ KG S +++VALSG+HT+GQ +C +FR RIYN T+++ +F
Sbjct  142   ANTELPSPSLDLKDLISSFSTKGFSAKEMVALSGSHTMGQARCQMFRDRIYNETNINSEF  201

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A   K  C +    D NLSPLD+ +P  FDN Y+KNL+  KGLL SDQ LF+GG TDS+V
Sbjct  202   ATFLKSNCTQSSGTDDNLSPLDITSPVFFDNAYFKNLVDSKGLLHSDQQLFSGGSTDSLV  261

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + Y+ S   F TDF +AM+K+  + PL    G IR  C   N
Sbjct  262   TTYSNSSGTFYTDFANAMLKMGNLSPLTGTSGQIRTNCRKTN  303



>gb|EYU46002.1| hypothetical protein MIMGU_mgv1a009759mg [Erythranthe guttata]
Length=332

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/283 (55%), Positives = 200/283 (71%), Gaps = 2/283 (1%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
              + + +AV+ A+ +E+RM ASL+RLHFHDCFVQGCDAS+LLD T    GEK A PNN S 
Sbjct  50    FDTVESAVKSAIKKEKRMGASLIRLHFHDCFVQGCDASVLLDDTSSFTGEKTAAPNNNSI  109

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKA  684
             RG++V++  K ++E  CPGVVSCADIL +AARD+V   GGP W V +GRRDS  A  A A
Sbjct  110   RGFNVVDDIKSKVESVCPGVVSCADILAIAARDSVSILGGPEWDVKVGRRDSKTASLAAA  169

Query  683   GTD-LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
              +  +P P S L+ L+  F  +GLS +D+VALSGAHT+GQ +C LFR RIYN T++D  F
Sbjct  170   NSGVIPPPTSTLNNLVNRFQARGLSTKDMVALSGAHTIGQARCSLFRTRIYNETNIDASF  229

Query  506   ANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             A  R+  CP     GD NL+ LD+ +P  FDN YYKNL++KKGLL SDQ L+NGG TDS+
Sbjct  230   ARKRQDNCPRTTGSGDNNLASLDVKSPTFFDNAYYKNLIKKKGLLHSDQILYNGGSTDSL  289

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +  Y+K PE FN DFV+AMIK+ +I PL   +G IRK C   N
Sbjct  290   IETYSKKPETFNDDFVTAMIKMGDISPLTGSNGEIRKNCRRAN  332



>ref|XP_011021015.1| PREDICTED: cationic peroxidase 1-like [Populus euphratica]
Length=316

 Score =   333 bits (854),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/282 (57%), Positives = 196/282 (70%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IRTAV +AV +E RM ASL+RLHFHDCFV GCDAS+LLD T    GEK A PN  S
Sbjct  36    ALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKTAGPNANS  95

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RGYDVI+  K ++E  CPGVVSCADIL VAARD+VV+  GPSW V LGRRDST A  + 
Sbjct  96    LRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTVQLGRRDSTTASLSA  155

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A +DLPSP  DL  LIT+F+ KG + +++VALSG+HT+GQ +C +FR R+YN T +D   
Sbjct  156   ANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLMFRNRVYNETSLDSTL  215

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + K  CP+    D +LS LD  TP  FDN+Y+KNL+  KGLL SDQ LF+GG TDS V
Sbjct  216   ATSLKSNCPDTG-SDDSLSSLDATTPVTFDNSYFKNLVNNKGLLHSDQQLFSGGTTDSQV  274

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y+ +   F  DF SAM+K+  I PL    G IR  C+ VN
Sbjct  275   KTYSINYATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  316



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score =   333 bits (854),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 201/284 (71%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N  + ++  ++ A+S E+RM AS++RL FHDCFV GCD S+LLD T    GEK A PN  
Sbjct  37    NLFSTVQPVIQSAISSEKRMGASILRLFFHDCFVNGCDGSLLLDDTSSFTGEKTANPNRN  96

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG+DVI+  K  +EK+CPGVVSCADIL ++ARD+VV  GGP+W V LGRRD+  A  +
Sbjct  97    SARGFDVIDKIKAAVEKACPGVVSCADILAISARDSVVLLGGPNWNVKLGRRDARTASLS  156

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  ++P P S L  LI+ F+ +GLS  ++VALSGAHT+GQ +C  FR RIYN T++D  
Sbjct  157   GANNNIPPPTSSLSNLISKFSAQGLSANEMVALSGAHTIGQARCTSFRARIYNDTNIDGS  216

Query  509   FANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+  CP     GD NL+PLDL TP  FDN+Y+KNL+ +KGLL SDQ LFN G TDS
Sbjct  217   FAKTRRSNCPSTSGNGDNNLAPLDLQTPTSFDNDYFKNLVNQKGLLHSDQQLFNKGSTDS  276

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +VS Y+ +P  F++DFV+AMIK+ +I PL    G IRK C  +N
Sbjct  277   LVSTYSTNPSKFSSDFVAAMIKMGDISPLTGSQGEIRKNCRKIN  320



>ref|XP_010263838.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010263839.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Nelumbo nucifera]
Length=318

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 196/282 (70%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+II++AV  AV++ERRM ASL+RLHFHDCFV GCDASILLD T    GEK A PN  S
Sbjct  38    ALSIIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDASILLDDTSSFTGEKTAAPNANS  97

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
             ARG+DVI+  K ++E +CPGVVSCADIL VA+RD+VV+ GG SW V LGRRDST A    
Sbjct  98    ARGFDVIDTIKSQLESACPGVVSCADILAVASRDSVVALGGTSWTVQLGRRDSTTASLDD  157

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  +LPSP+ DL  LI+AFA KG + ++LV LSG H++GQ +C LFR RIYN T+VD  F
Sbjct  158   ANNNLPSPFLDLSDLISAFANKGFTAKELVVLSGGHSIGQARCSLFRSRIYNETNVDSSF  217

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + K  CP    GD  L+ LD  T  VFDN Y+ NL+  KGLL SDQ LFNGG TD+ V
Sbjct  218   AKSIKSNCPSAG-GDNTLANLDTTTSTVFDNAYFTNLLNNKGLLHSDQQLFNGGSTDAQV  276

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y+ +   F +DF +AMIK+  + PL    G IR  C  VN
Sbjct  277   RAYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQIRTNCRKVN  318



>ref|XP_010664359.1| PREDICTED: cationic peroxidase 1 isoform X3 [Vitis vinifera]
Length=316

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 199/282 (71%), Gaps = 2/282 (1%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+ IR AV  AV++ERRM ASL+RLHFHDCFV GCDASILLD T    GEK A PNN S
Sbjct  36    ALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTANFTGEKTAGPNNNS  95

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RGYDVI+  K ++E  CPGVVSCADI+ VAARD+VV+ GGP+W V LGRRDST A  + 
Sbjct  96    VRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGPTWTVQLGRRDSTTASFST  155

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A +DLP+P SDLD LI+ F+ KG + +++V LSG HT+G+ QC  FR RIYN T++D  F
Sbjct  156   ANSDLPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTIGKAQCSKFRDRIYNETNIDATF  215

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A +++  CP    GD+NLS LD  T  VFDN Y+ NL++KKGLL SDQ L+NG  TDS+V
Sbjct  216   ATSKQAICPSSG-GDENLSDLDETTT-VFDNVYFTNLIEKKGLLHSDQQLYNGNSTDSMV  273

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y+     F TD  SAM+K+  + PL    G IR  C A+N
Sbjct  274   ETYSNDSTTFFTDVASAMVKMGNLSPLTGTDGEIRTNCRAIN  315



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/280 (57%), Positives = 204/280 (73%), Gaps = 2/280 (1%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++AV+ A+++E RM ASL+RL FHDCFV GCD S+LLD T    GEK A PN  SARG+
Sbjct  42    VKSAVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDTSSFTGEKRAAPNVNSARGF  101

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+  K  +EK CPGVVSCADIL V ARD+VV  GGP+W V LGRRDS  A  + A + 
Sbjct  102   EVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNVKLGRRDSRTASQSAANSG  161

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHT-DVDPDFANT  498
             +P   S+L+ LI++F+  GLS +D+VALSGAHT+GQ +C  FR RIYN T ++D  FA T
Sbjct  162   IPPATSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSFRARIYNETNNLDASFART  221

Query  497   RKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSE  321
             R+  CP     GD NL+PLDL TP  FDNNY+KNL+ KKGLL SDQ LFNGG  DSIV+ 
Sbjct  222   RQSNCPRSSGSGDNNLAPLDLQTPNKFDNNYFKNLVDKKGLLHSDQQLFNGGSADSIVTS  281

Query  320   YAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             Y+ +P +F++DFV+AMIK+ +I+PL   +G IRK C  +N
Sbjct  282   YSNNPSSFSSDFVTAMIKMGDIRPLTGSNGEIRKNCRRLN  321



>ref|XP_003551179.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
 gb|KHN48392.1| Cationic peroxidase 1 [Glycine soja]
Length=320

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/283 (57%), Positives = 201/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+ I++AV+ AV++E RM ASL+RLHFHDCFV GCDAS+LLD T    GEK A  N  
Sbjct  39    NALSTIKSAVKSAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKSAAANLN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K ++E +CPG+VSCADI+ VAARD+VV+ GGPSW + LGRRDST A   
Sbjct  99    SLRGFDVIDDIKSQLESACPGIVSCADIVAVAARDSVVALGGPSWTIGLGRRDSTTASKD  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +D+PSP  DL+ LI+AF+ KG + +++V LSGAHT GQ +C  FR RIYN T++D D
Sbjct  159   AATSDIPSPLMDLNDLISAFSNKGFTSQEMVVLSGAHTTGQAKCQFFRGRIYNETNIDSD  218

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + K  CP    GD NLSPLD+ T  +FDN Y+KNL+ KKGLL SDQ LF+GG TDS 
Sbjct  219   FATSAKSNCPSTD-GDSNLSPLDVTTNVLFDNAYFKNLVNKKGLLHSDQQLFSGGSTDSQ  277

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ S   F  DF SAM+K+  + PL    G IR  C  VN
Sbjct  278   VTTYSTSSSTFYADFASAMVKMGNLSPLTGSSGQIRTNCRNVN  320



>gb|ABV24960.2| putative secretory peroxidase [Catharanthus roseus]
Length=330

 Score =   333 bits (854),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/281 (56%), Positives = 203/281 (72%), Gaps = 1/281 (0%)
 Frame = -2

Query  1040  NIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASAR  861
             N +R  V  AVS+E+RM ASL+RLHFHDCFVQGCD SILLD T  + GEK A PN  S R
Sbjct  50    NTVRKGVESAVSKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSLRGEKTAGPNVGSVR  109

Query  860   GYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAG  681
             G+DV++  K ++EK CPGVVSCADIL +AARD+VV+ GGPSW V +GRRDS  A  + A 
Sbjct  110   GFDVVDNIKSDVEKVCPGVVSCADILAIAARDSVVALGGPSWKVKVGRRDSKTASLSGAN  169

Query  680   TDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFAN  501
             + +P P S+L  LI++F   GLS +D+V LSG+HT+GQ +C +FR RIYN ++++  FA 
Sbjct  170   SRIPPPTSNLRNLISSFQAVGLSAKDMVVLSGSHTIGQARCTVFRARIYNESNIETSFAR  229

Query  500   TRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVS  324
             TR+  CP     GD +L+PLDL +P  FD NYYKNL+ KKGLL SDQ L+NGG T+S+V 
Sbjct  230   TRQGNCPLPTGNGDNSLAPLDLQSPNGFDINYYKNLINKKGLLHSDQELYNGGSTNSLVE  289

Query  323   EYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
              Y+K  +AF +DF +AMIK+ +I PL   +G +RK C  VN
Sbjct  290   AYSKDTKAFYSDFAAAMIKMGDISPLTGSNGEVRKNCRRVN  330



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score =   333 bits (853),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 199/276 (72%), Gaps = 2/276 (1%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             I++ V+ A+++E RM ASL+RL FHDCFV GCD S+LLD T    GEK A PN  S RG+
Sbjct  43    IKSTVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDTSSFTGEKRAAPNVNSVRGF  102

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+  K  +EK+CPG+VSCADIL V ARD+VV  GGP+W V LGRRD+  A    A + 
Sbjct  103   EVIDNIKSAVEKACPGIVSCADILAVTARDSVVILGGPNWNVKLGRRDARTASQGAANSS  162

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHT-DVDPDFANT  498
             +P+P  +L+ LI++F+  GLS +D+VALSGAHT+GQ +C  FR RIYN T ++D  FA T
Sbjct  163   IPAPTFNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTFRARIYNETNNIDSTFART  222

Query  497   RKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSE  321
             R+  CP     GD NL+PLDL TP  FDNNY+KNL+ KKGLL SDQ LFNGG  DSIV  
Sbjct  223   RQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLVNKKGLLHSDQQLFNGGSADSIVRS  282

Query  320   YAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVC  213
             Y  +P +FN+DFV+AMIK+ +I+PL   +G IRK C
Sbjct  283   YINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRKNC  318



>ref|XP_003616748.1| Peroxidase [Medicago truncatula]
 gb|AES99706.1| class III peroxidase [Medicago truncatula]
Length=325

 Score =   333 bits (853),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 198/279 (71%), Gaps = 1/279 (0%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             ++  V+ A+S+E RM ASL+RL FHDCFV GCD SILLD T    GEK A PN  SARG+
Sbjct  47    VKCEVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKTANPNKNSARGF  106

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+  K  +EK CPG VSCADILT+ ARD+V   GGP+W V LGRRD+  A  + A  D
Sbjct  107   EVIDKIKSAVEKVCPGAVSCADILTITARDSVEILGGPTWDVKLGRRDARTASKSAANND  166

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTR  495
             +P+P S L+ LI+ F   GLS +DLVALSG HT+GQ +C  FR  IYN +++D  FA TR
Sbjct  167   IPAPTSSLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTFRAHIYNDSNIDTSFARTR  226

Query  494   KRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             +  CP+    GD NL+PLDL TP  FDN+Y+KNL+  KGLL SDQ LFNGG TDSIV EY
Sbjct  227   QSGCPKTSGSGDNNLAPLDLATPTSFDNHYFKNLVDSKGLLHSDQQLFNGGSTDSIVHEY  286

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +  P +F++DFV+AMIK+ +I PL   +G IRK C +VN
Sbjct  287   SLYPSSFSSDFVTAMIKMGDISPLTGSNGEIRKQCRSVN  325



>ref|XP_006387287.1| hypothetical protein POPTR_1332s00200g [Populus trichocarpa]
 gb|ERP46201.1| hypothetical protein POPTR_1332s00200g [Populus trichocarpa]
Length=267

 Score =   330 bits (847),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 196/260 (75%), Gaps = 3/260 (1%)
 Frame = -2

Query  977  VRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSCPGVVS  798
            VR    D  V GCDASILLD T  I+ EK AL N  SARGY+VI+ AK E+EK CPGVVS
Sbjct  10   VRKKIKDTAVIGCDASILLDETSSIQSEKTALGNLNSARGYNVIDKAKTEVEKICPGVVS  69

Query  797  CADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITAFAKKG  618
            CADI+ VAARDA    GGPS+AV LGRRDST A    A  +LP+ +  L++LI+ F KKG
Sbjct  70   CADIIAVAARDASAYVGGPSYAVKLGRRDSTTASRTLANAELPAFFESLESLISRFQKKG  129

Query  617  LSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTRKRQCPEQQIG-DKNLSPLD  441
            L+ RD+VALSG+HTLGQ QCF FR RIYNH+++D  FA+TR+R+CP  ++G D  L+PLD
Sbjct  130  LTARDMVALSGSHTLGQAQCFTFRERIYNHSNIDAGFASTRRRRCP--RVGSDATLAPLD  187

Query  440  LVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVSAMIKLS  261
            LVTP  FDNNY+KNLMQ KGLLQSDQ LFNGG TDSIVSEY+++P  F +DF SAMIK+ 
Sbjct  188  LVTPNSFDNNYFKNLMQNKGLLQSDQVLFNGGSTDSIVSEYSRNPARFRSDFGSAMIKMG  247

Query  260  EIQPLIDGHGIIRKVCSAVN  201
            +I  L    G IR++CSAVN
Sbjct  248  DIGLLTGSSGQIRRICSAVN  267



>ref|XP_010093550.1| Cationic peroxidase 1 [Morus notabilis]
 gb|EXB54257.1| Cationic peroxidase 1 [Morus notabilis]
Length=322

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 201/283 (71%), Gaps = 3/283 (1%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             NAL+I+++AV+ AVS E RM ASL+RLHFHDCF  GCDASILLD T    GEK+A PN  
Sbjct  43    NALSIVKSAVKTAVSNEARMGASLLRLHFHDCF--GCDASILLDDTSTFTGEKNAGPNAN  100

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DV++  K ++E +C GVVSCADIL VAARD+VV  GGPSW V LGRRD+T A  +
Sbjct  101   SVRGFDVVDTIKTQLESACAGVVSCADILAVAARDSVVLLGGPSWTVQLGRRDATTASQS  160

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              AG+++P+P ++L  LITAF+ KG + ++LVALSG HT+GQ +C  FR R+YN  +++  
Sbjct  161   AAGSNIPAPTTNLSGLITAFSNKGFTTKELVALSGGHTIGQAKCSSFRARLYNENNIEAS  220

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + K +CP     D NLSPLD+ +P  FDN Y+KN++  KGLL SDQ LFN G TDS 
Sbjct  221   FATSTKSKCPNSG-SDNNLSPLDVTSPTTFDNAYFKNVVSLKGLLHSDQQLFNNGSTDSQ  279

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+ +P +F TDF +AMIK+  + PL    G IR  C  VN
Sbjct  280   VRAYSTNPTSFRTDFANAMIKMGNLSPLTGTSGQIRTNCRKVN  322



>ref|XP_004234419.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=320

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 202/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N   I+R A+ QAV+RE R+ AS++RL FHDCFV GCDASILLD T    GEK+A PN  
Sbjct  39    NLQTIVRNAMTQAVNREARLGASILRLFFHDCFVNGCDASILLDDTSTFIGEKNANPNRN  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARGY+VI+  K ++E +CP V+SCADIL +AAR+  V  GGPSWAV LGRRD+  A  +
Sbjct  99    SARGYEVIDTIKTQVEAACPNVISCADILALAAREGTVLLGGPSWAVPLGRRDARTASQS  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A T +P+P S L TLI+ F+ KGLS RD+ ALSG+HT+GQ +C  FR RIYN T++DP 
Sbjct  159   AANTQIPAPSSSLATLISMFSAKGLSARDMTALSGSHTIGQARCTTFRNRIYNDTNIDPQ  218

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA TR+  CP    GD NL+PLD+ TP  FDN+YY+NL+ ++GLL SDQ LFNGG  D++
Sbjct  219   FAATRRATCPASG-GDANLAPLDIQTPNRFDNDYYQNLVVRRGLLHSDQELFNGGSQDAL  277

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+ +  +F +DF +AM+K+  I PL   +G IR  C A+N
Sbjct  278   VRSYSNNGASFRSDFAAAMVKMGNISPLTGTNGEIRTNCRAIN  320



>ref|XP_008228933.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=322

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 197/279 (71%), Gaps = 2/279 (1%)
 Frame = -2

Query  1037  IIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARG  858
             I+R A+ QAV+RE RMAAS++RL FHDCFV GCDASILLD T    GEK+A PN  SARG
Sbjct  46    IVRNAMSQAVAREARMAASILRLFFHDCFVNGCDASILLDDTATFTGEKNAFPNQNSARG  105

Query  857   YDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGT  678
             ++VI+  K  +E +C   VSCADIL +A+RD VV  GG SW V LGRRD+  A  + A  
Sbjct  106   FEVIDTIKTRVEAACNATVSCADILALASRDGVVLLGGTSWTVALGRRDARTASQSDANN  165

Query  677   DLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANT  498
              LPSP+++L TLI++FA KGL+  DL  LSG HT+GQ+QCFLF+ RIYN T++DP FA T
Sbjct  166   QLPSPFANLATLISSFAAKGLTASDLTVLSGGHTIGQSQCFLFKTRIYNETNIDPSFATT  225

Query  497   RKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEY  318
             RK  CP    GD NL+P D +TP  FDNNYYK L+ ++GLL SDQ LFN G  D++V  Y
Sbjct  226   RKATCPASG-GDTNLAPFD-ITPTRFDNNYYKALVARRGLLHSDQELFNSGSQDALVRTY  283

Query  317   AKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             + +  AF+ DF +AM K+S I PL   +G IRK C  VN
Sbjct  284   SNNAAAFSRDFAAAMAKMSAISPLTGTNGEIRKNCRLVN  322



>ref|XP_010263840.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=318

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 194/282 (69%), Gaps = 1/282 (0%)
 Frame = -2

Query  1046  ALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNAS  867
             AL+II++AV  AVS ERRM ASL+RLHFHDCFV GCDASILLD T    GEK ALPN  S
Sbjct  38    ALSIIKSAVDSAVSSERRMGASLLRLHFHDCFVNGCDASILLDDTSTFTGEKTALPNANS  97

Query  866   ARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAK  687
              RG+DVI+  K ++E +CPGVVSCADIL VAARD+VV+ GG SW V LGRRDST A    
Sbjct  98    VRGFDVIDTIKSQLESACPGVVSCADILAVAARDSVVALGGTSWTVQLGRRDSTTASLND  157

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
             A  DLP+P+ DL  LI+AFA KG +  +LV LSGAHT+GQ +C  FR RI+N T++D  F
Sbjct  158   ANNDLPAPFLDLSALISAFANKGFTANELVVLSGAHTIGQARCTTFRDRIHNETNIDSQF  217

Query  506   ANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIV  327
             A + K  CP    GD NL+ LD  T   FDN ++ NL+  KGLL SDQ LFNGG TDS V
Sbjct  218   ATSMKSNCPSSG-GDNNLANLDTTTATTFDNVFFTNLLSNKGLLHSDQQLFNGGSTDSQV  276

Query  326   SEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
               Y+ +   F +DF +AMIK+  + PL    G +R  C  VN
Sbjct  277   RTYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQLRTNCRRVN  318



>ref|XP_011080739.1| PREDICTED: peroxidase 4-like [Sesamum indicum]
Length=328

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 202/283 (71%), Gaps = 2/283 (1%)
 Frame = -2

Query  1043  LNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASA  864
              +I+++ V+ AV  E+RM ASL+RLHFHDCFVQGCDASILLD TP  +GEK A  NN S 
Sbjct  46    FSIVKSVVKSAVMEEKRMGASLLRLHFHDCFVQGCDASILLDDTPTFKGEKTAGGNNNSV  105

Query  863   RGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDS-TMAYHAK  687
             RGY+VI+  K ++E  CPG+VSCADI+T+AARD+VV  GGP+W V +GRRDS T +  A 
Sbjct  106   RGYEVIDHIKSKVEAVCPGIVSCADIVTIAARDSVVFLGGPNWKVTVGRRDSKTASLEAA  165

Query  686   AGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDF  507
                 LP P S+L TLI  F  +GLS  DLVALSG HT+G+ +C +FR RIYN T +D  F
Sbjct  166   NSGVLPGPDSNLSTLIQKFQDQGLSPTDLVALSGTHTIGKARCVVFRERIYNDTIIDASF  225

Query  506   ANTRKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             A  R+R+CP    +GD N +PLD  TP +FD  Y+KNL+ KKGLL SDQ L++GG TDS+
Sbjct  226   AKKRQRRCPRNSGLGDDNFAPLDNKTPKIFDTAYFKNLIAKKGLLHSDQVLYDGGSTDSL  285

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+KSPE+FN D V AMIK+ +I PL   +G IRK C   N
Sbjct  286   VELYSKSPESFNKDLVVAMIKMGDISPLTGSNGEIRKNCRKPN  328



>ref|XP_004240055.1| PREDICTED: cationic peroxidase 1-like [Solanum lycopersicum]
Length=317

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/283 (55%), Positives = 201/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L+II+TAV  A+++E RM ASL+RLHFHDCFV GCDAS+LLD T    GEK A PN+ 
Sbjct  36    NVLSIIKTAVNSAIAKESRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKTANPNSG  95

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG+DVI+  K +IE SC GVVSCADIL VAARD+VV  GGPSW V LGRRDST A  +
Sbjct  96    SLRGFDVIDTIKTQIESSCAGVVSCADILAVAARDSVVKLGGPSWTVLLGRRDSTTASLS  155

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A +D+P+P  +L +LI++F+ KG + R++VALSG+HT+GQ +C  FR R++N TD++  
Sbjct  156   NANSDIPAPTLNLSSLISSFSNKGFNTREMVALSGSHTIGQARCTTFRDRLHNETDINAS  215

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA + K +CP Q   D N+SPLD  +P  FDN YYKNL  +KGLL SDQ L +GG TDSI
Sbjct  216   FATSIKSKCP-QSGSDNNVSPLDTTSPTTFDNIYYKNLRIQKGLLHSDQQLSSGGSTDSI  274

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V+ Y+ +   F  DF  AM+K+  + PL   +G IRK C   N
Sbjct  275   VNTYSSNSATFLADFAKAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>gb|AAZ42168.1| lignin peroxidase-like [Cucumis sativus]
Length=237

 Score =   329 bits (843),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 185/238 (78%), Gaps = 1/238 (0%)
 Frame = -2

Query  971  LHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGYDVIEAAKREIEKSCPGVVSCA  792
            LHFHDCFVQGCDASILLD TP + GE++A PN  SARGY VI  AK  +EK CPGVVSCA
Sbjct  1    LHFHDCFVQGCDASILLDDTPSMIGEQNAAPNRDSARGYGVIHNAKTAVEKICPGVVSCA  60

Query  791  DILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTDLPSPYSDLDTLITAFAKKGLS  612
            DIL VAARDA  + GGPSW V LGRRDST A  A A  +LP   + LD LI+ F+ KGLS
Sbjct  61   DILAVAARDASFAVGGPSWTVRLGRRDSTTASKALAENELPHFQAGLDRLISIFSNKGLS  120

Query  611  KRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPDFANTRKRQCPEQQIGDKNLSPLDLVT  432
             RD+VALSG+HT+GQ QCFLFR RIYN T++D  FA+TR+R CP    G+ NL+PLDLVT
Sbjct  121  TRDMVALSGSHTIGQAQCFLFRNRIYNQTNIDAGFASTRRRNCPTSS-GNGNLAPLDLVT  179

Query  431  PYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSEYAKSPEAFNTDFVSAMIKLSE  258
            P  FDNNY+KNL+Q+KGLL++DQ LFNGG TDSIV+EY+K P  F +DF +AMIK+ +
Sbjct  180  PNSFDNNYFKNLVQRKGLLETDQVLFNGGSTDSIVTEYSKDPTMFKSDFAAAMIKMGK  237



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/280 (56%), Positives = 201/280 (72%), Gaps = 2/280 (1%)
 Frame = -2

Query  1034  IRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNASARGY  855
             +++ V+ A++RE RM ASL+RL FHDCFV GCD S+LLD T    GEK A PN  S RG+
Sbjct  45    VKSTVQSAINRETRMGASLLRLFFHDCFVNGCDGSLLLDDTSSFTGEKRAAPNVNSVRGF  104

Query  854   DVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHAKAGTD  675
             +VI+  K  +EK+CPGVVSCADIL + ARD+VV  GGP+W V LGRRD+  A    A + 
Sbjct  105   EVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPNWNVKLGRRDARTASQGAANSS  164

Query  674   LPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHT-DVDPDFANT  498
             +P P S+L+ LI++F+  GLS  D+VALSGAHT+GQ +C  FR RIYN T ++D  FA T
Sbjct  165   IPPPTSNLNQLISSFSAVGLSTTDMVALSGAHTIGQARCTSFRARIYNETNNIDSSFATT  224

Query  497   RKRQCPEQQ-IGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSIVSE  321
             R+R CP     GD NL+PLDL TP  FDNNY+KNL+ K+GLL SDQ LFNGG  DSIV+ 
Sbjct  225   RQRNCPRNSGSGDNNLAPLDLQTPTKFDNNYFKNLVSKRGLLHSDQQLFNGGSADSIVTS  284

Query  320   YAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             Y+ +P +F++DFV+AMIK+ + +PL   +G IRK C   N
Sbjct  285   YSNNPSSFSSDFVTAMIKMGDNRPLTGSNGEIRKNCRTRN  324



>ref|XP_009593782.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/283 (54%), Positives = 202/283 (71%), Gaps = 1/283 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N   I+ +A+RQAV+RE R+ AS++RL FHDCFV GCDASILLD T    GEK+A PN  
Sbjct  38    NLQTIVSSAMRQAVNRESRLGASILRLFFHDCFVNGCDASILLDDTATFTGEKNANPNRN  97

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             SARG++VI+  K ++E +CP  VSCADIL +AAR+ VV  GGPSWAV LGRRD+  A  +
Sbjct  98    SARGFEVIDTIKTQVEAACPNAVSCADILALAAREGVVLLGGPSWAVPLGRRDARTASQS  157

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A T +P+P S L TL++ F+ KGL+ RD+ ALSG HT+GQ +C  FR RIYN T++D  
Sbjct  158   AANTQIPAPTSSLSTLLSMFSAKGLNARDMTALSGGHTIGQARCTTFRTRIYNDTNIDAQ  217

Query  509   FANTRKRQCPEQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDSI  330
             FA TR+  CP    GD NL+PLD+ TP  FDN+YY+NL+ ++GLL SDQ LFNGG  D++
Sbjct  218   FATTRRATCPSSG-GDANLAPLDIQTPNRFDNDYYQNLVARRGLLHSDQELFNGGSQDAL  276

Query  329   VSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             V  Y+ +  AF +DF +AM+++  I PL   +G IR+ C A+N
Sbjct  277   VRSYSTNGAAFRSDFAAAMVRMGNISPLTGTNGEIRRNCRAIN  319



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 197/284 (69%), Gaps = 1/284 (0%)
 Frame = -2

Query  1049  NALNIIRTAVRQAVSRERRMAASLVRLHFHDCFVQGCDASILLDSTPVIEGEKDALPNNA  870
             N L  + + V+ A+++E RM ASL+RL FHDCFV GCD SILLD T    GEK ALPN+ 
Sbjct  39    NLLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKTALPNSG  98

Query  869   SARGYDVIEAAKREIEKSCPGVVSCADILTVAARDAVVSAGGPSWAVNLGRRDSTMAYHA  690
             S RG++VI+  K  +EK+CPGVVSCADILT+ ARD+VV  GGP+W V LGRRD+  A   
Sbjct  99    SVRGFEVIDQIKSAVEKACPGVVSCADILTITARDSVVILGGPTWNVKLGRRDARTASRT  158

Query  689   KAGTDLPSPYSDLDTLITAFAKKGLSKRDLVALSGAHTLGQTQCFLFRYRIYNHTDVDPD  510
              A  ++P P   L  L+++F+ +GLS  D+VAL+G HT+GQ +C  FR RIYN +++D  
Sbjct  159   AANNNIPQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIGQARCTSFRTRIYNESNIDAS  218

Query  509   FANTRKRQCP-EQQIGDKNLSPLDLVTPYVFDNNYYKNLMQKKGLLQSDQNLFNGGVTDS  333
             FA TR+  CP     G  NL+PLDL TP  FDN YYKNL+ +KGLL SDQ LF+GG T+S
Sbjct  219   FAKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYKNLVSQKGLLHSDQQLFSGGSTNS  278

Query  332   IVSEYAKSPEAFNTDFVSAMIKLSEIQPLIDGHGIIRKVCSAVN  201
             +V  Y  +P  FN DF++AMIK+ +I+PL   +G +RK C   N
Sbjct  279   LVQTYGSNPSRFNADFIAAMIKMGDIKPLTGSNGEVRKNCRKTN  322



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2412469996800