BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23793_g3_i1 len=830 path=[9377:0-447 6431:448-515 5329:516-654
5468:655-691 8850:692-770 5003:771-829]

Length=830
                                                                      Score     E

ref|XP_008370617.1|  PREDICTED: pectinesterase                          230   6e-67   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    226   1e-65   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 225   3e-65   Ricinus communis
ref|XP_002314364.1|  putative pectinesterase family protein             225   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    225   3e-65   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    224   5e-65   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             224   8e-65   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    224   1e-64   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    224   1e-64   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             223   3e-64   Populus trichocarpa [western balsam poplar]
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     221   7e-64   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    221   8e-64   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    221   1e-63   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     220   2e-63   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    220   2e-63   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    219   3e-63   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    220   3e-63   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         219   4e-63   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    219   4e-63   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          219   5e-63   
emb|CDO98832.1|  unnamed protein product                                219   5e-63   
emb|CBI39537.3|  unnamed protein product                                221   9e-63   
ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    212   1e-62   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    217   2e-62   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    217   3e-62   
emb|CDY57858.1|  BnaC08g47740D                                          214   3e-62   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             216   4e-62   
ref|XP_006382447.1|  pectin methylesterase family protein               216   4e-62   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     215   1e-61   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    215   1e-61   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     215   1e-61   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    214   2e-61   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    214   2e-61   
emb|CDO98833.1|  unnamed protein product                                214   3e-61   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    214   3e-61   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    216   4e-61   
ref|XP_007031044.1|  Pectinesterase, putative                           215   4e-61   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    216   5e-61   
emb|CDO98834.1|  unnamed protein product                                213   5e-61   
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    216   5e-61   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    213   9e-61   
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    215   1e-60   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    213   1e-60   
emb|CBI22967.3|  unnamed protein product                                218   2e-60   
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    212   2e-60   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             212   3e-60   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    212   3e-60   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    212   3e-60   
emb|CDY71928.1|  BnaCnng75130D                                          206   3e-60   
ref|XP_002865716.1|  pectinesterase family protein                      211   5e-60   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     210   6e-60   
ref|XP_010654104.1|  PREDICTED: pectinesterase                          209   7e-60   
emb|CAN77092.1|  hypothetical protein VITISV_026596                     209   1e-59   Vitis vinifera
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    210   1e-59   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         210   1e-59   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     209   1e-59   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             209   2e-59   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    209   2e-59   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             209   2e-59   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          208   3e-59   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             209   3e-59   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    211   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872255.1|  pectinesterase family protein                      210   3e-59   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    209   4e-59   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    208   5e-59   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    208   5e-59   
emb|CDY34927.1|  BnaA01g32580D                                          208   6e-59   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    209   7e-59   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    209   8e-59   
ref|XP_002516960.1|  Pectinesterase precursor, putative                 207   9e-59   Ricinus communis
gb|AAQ21125.1|  pectinesterase                                          197   1e-58   Fragaria x ananassa
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    207   1e-58   
emb|CDY24663.1|  BnaA05g30620D                                          207   1e-58   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         207   1e-58   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    207   1e-58   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    207   2e-58   
gb|KEH15723.1|  pectinesterase                                          197   2e-58   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    206   2e-58   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     206   3e-58   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             208   4e-58   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    206   5e-58   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    205   6e-58   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    208   7e-58   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    205   7e-58   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             205   7e-58   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    205   8e-58   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    205   9e-58   
emb|CDY40719.1|  BnaC03g34350D                                          202   1e-57   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    204   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882495.1|  pectinesterase family protein                      204   1e-57   
emb|CDY33925.1|  BnaA02g30620D                                          204   1e-57   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    204   1e-57   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    204   1e-57   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    204   1e-57   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    204   2e-57   
emb|CAN75818.1|  hypothetical protein VITISV_005130                     202   2e-57   Vitis vinifera
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                208   2e-57   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    204   2e-57   
ref|XP_010661658.1|  PREDICTED: probable pectinesterase/pectinest...    202   2e-57   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          206   2e-57   
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    204   3e-57   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   204   3e-57   
emb|CDY05295.1|  BnaC05g45080D                                          203   3e-57   
emb|CDY05188.1|  BnaC05g46150D                                          204   3e-57   
gb|KEH21378.1|  pectinesterase                                          199   3e-57   
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                203   5e-57   
dbj|BAC42959.2|  putative pectin methylesterase                         203   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    202   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAF63815.1|  pectin methylesterase, putative                         202   5e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27751.1|  BnaA05g31600D                                          203   6e-57   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    203   6e-57   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             202   8e-57   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                202   8e-57   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     204   1e-56   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     202   1e-56   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    202   1e-56   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             204   1e-56   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             202   1e-56   
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    201   1e-56   
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    197   1e-56   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    201   2e-56   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    202   2e-56   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             201   3e-56   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   200   3e-56   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             201   3e-56   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         200   3e-56   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    201   3e-56   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    202   3e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99968.1|  BnaC09g03330D                                          202   4e-56   
ref|XP_002884519.1|  pectinesterase family protein                      202   5e-56   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    200   6e-56   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 199   6e-56   
gb|EPS59322.1|  pectinesterase                                          199   6e-56   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          200   6e-56   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    202   7e-56   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    202   7e-56   
ref|XP_008361835.1|  PREDICTED: pectinesterase-like                     191   7e-56   
emb|CDX74137.1|  BnaA03g29100D                                          201   8e-56   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    201   9e-56   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    199   9e-56   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             201   9e-56   
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    199   1e-55   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    199   1e-55   
emb|CDY19737.1|  BnaA09g03900D                                          198   1e-55   
emb|CDX71786.1|  BnaC08g30880D                                          198   1e-55   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   198   1e-55   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        198   1e-55   
ref|XP_010513751.1|  PREDICTED: probable pectinesterase/pectinest...    194   2e-55   
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   198   2e-55   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    202   2e-55   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    198   2e-55   
dbj|BAC42986.1|  putative pectinesterase                                200   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116752.1|  PREDICTED: probable pectinesterase/pectinest...    197   3e-55   
emb|CDY41145.1|  BnaA09g38700D                                          197   3e-55   
emb|CDY08030.1|  BnaC03g34930D                                          189   3e-55   
ref|XP_010253281.1|  PREDICTED: probable pectinesterase/pectinest...    198   3e-55   
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             198   3e-55   
ref|XP_003630894.1|  Pectinesterase                                     192   3e-55   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    198   3e-55   
emb|CDO97717.1|  unnamed protein product                                190   3e-55   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    200   4e-55   
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     197   4e-55   
ref|XP_006853048.1|  hypothetical protein AMTR_s00038p00046180          197   4e-55   
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    195   4e-55   
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             198   5e-55   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          198   6e-55   
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     196   6e-55   
ref|XP_006285748.1|  hypothetical protein CARUB_v10007222mg             199   6e-55   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                197   6e-55   
ref|XP_006402549.1|  hypothetical protein EUTSA_v10006472mg             196   6e-55   
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    197   7e-55   
ref|XP_006361902.1|  PREDICTED: probable pectinesterase/pectinest...    197   7e-55   
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    198   7e-55   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    199   8e-55   
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...    199   9e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231267.1|  PREDICTED: probable pectinesterase/pectinest...    196   1e-54   
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   194   1e-54   
ref|XP_010271283.1|  PREDICTED: pectinesterase                          196   1e-54   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    196   1e-54   
ref|XP_006361900.1|  PREDICTED: probable pectinesterase/pectinest...    196   1e-54   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    197   1e-54   
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   196   1e-54   
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    191   1e-54   Daucus carota [carrots]
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    196   1e-54   
ref|XP_002868170.1|  predicted protein                                  198   1e-54   
emb|CDY18942.1|  BnaC04g04080D                                          189   1e-54   
emb|CDX98808.1|  BnaC09g50270D                                          196   1e-54   
gb|EPS72184.1|  pectinesterase family protein                           196   1e-54   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    196   1e-54   
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  190   2e-54   
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     192   2e-54   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    196   2e-54   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    196   2e-54   
ref|XP_009628695.1|  PREDICTED: probable pectinesterase/pectinest...    194   2e-54   
ref|XP_009142158.1|  PREDICTED: probable pectinesterase/pectinest...    195   2e-54   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     196   2e-54   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    196   2e-54   
ref|XP_006414405.1|  hypothetical protein EUTSA_v10024582mg             197   2e-54   
ref|XP_011046483.1|  PREDICTED: probable pectinesterase/pectinest...    196   2e-54   
emb|CDX80933.1|  BnaC03g01870D                                          191   3e-54   
ref|XP_007219055.1|  hypothetical protein PRUPE_ppa004770mg             194   3e-54   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             196   3e-54   
ref|XP_006347998.1|  PREDICTED: probable pectinesterase/pectinest...    194   3e-54   
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                194   3e-54   
ref|XP_010069898.1|  PREDICTED: probable pectinesterase/pectinest...    195   3e-54   
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             193   3e-54   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    197   3e-54   
emb|CDP21547.1|  unnamed protein product                                197   3e-54   
ref|XP_004231159.2|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    194   3e-54   
emb|CDY66111.1|  BnaAnng21510D                                          197   3e-54   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    197   4e-54   
ref|XP_009107897.1|  PREDICTED: putative pectinesterase/pectinest...    197   4e-54   
ref|XP_002876579.1|  pectinesterase family protein                      194   4e-54   
ref|XP_008232608.1|  PREDICTED: probable pectinesterase/pectinest...    193   4e-54   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             194   4e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010552499.1|  PREDICTED: probable pectinesterase/pectinest...    194   5e-54   
ref|XP_008221458.1|  PREDICTED: pectinesterase                          194   5e-54   
gb|KDO36003.1|  hypothetical protein CISIN_1g029714mg                   185   5e-54   
ref|XP_010044212.1|  PREDICTED: pectinesterase                          194   5e-54   
gb|KEH29120.1|  pectinesterase/pectinesterase inhibitor                 193   5e-54   
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   194   5e-54   
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   194   6e-54   
emb|CDP21156.1|  unnamed protein product                                186   6e-54   
ref|XP_010543915.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    192   6e-54   
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    194   7e-54   
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    193   7e-54   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                194   7e-54   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                194   7e-54   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                194   8e-54   
emb|CDP19931.1|  unnamed protein product                                194   8e-54   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               193   8e-54   Ricinus communis
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     193   9e-54   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    195   1e-53   
ref|XP_006292970.1|  hypothetical protein CARUB_v10019247mg             193   1e-53   
ref|XP_010938361.1|  PREDICTED: probable pectinesterase/pectinest...    194   1e-53   
ref|XP_009600658.1|  PREDICTED: probable pectinesterase/pectinest...    194   1e-53   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                194   1e-53   
emb|CDX70179.1|  BnaA10g25280D                                          194   1e-53   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    195   1e-53   
ref|XP_003591168.1|  Pectinesterase                                     194   1e-53   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     192   1e-53   
ref|XP_007144962.1|  hypothetical protein PHAVU_007G198100g             193   2e-53   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    192   2e-53   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      192   2e-53   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    194   2e-53   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    194   2e-53   
ref|NP_191632.2|  putative pectinesterase/pectinesterase inhibito...    192   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     193   2e-53   
ref|XP_008795770.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    193   2e-53   
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g             193   2e-53   
gb|ABQ42392.1|  pectin methylesterase-like protein                      194   2e-53   Taiwania cryptomerioides
ref|XP_006369079.1|  pectinesterase family protein                      184   2e-53   
ref|XP_009122545.1|  PREDICTED: probable pectinesterase/pectinest...    194   2e-53   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     192   2e-53   
gb|KHN35618.1|  Pectinesterase 2                                        188   2e-53   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     192   2e-53   
gb|AFK42744.1|  unknown                                                 185   2e-53   
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             194   2e-53   
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             195   2e-53   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             194   3e-53   
gb|ABE67980.1|  pectin methylesterase                                   184   3e-53   Citrus bergamia [bergamot orange]
emb|CDX80613.1|  BnaC07g28310D                                          194   3e-53   
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   192   3e-53   
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             194   3e-53   
gb|EPS69059.1|  hypothetical protein M569_05708                         197   3e-53   
ref|XP_002315399.2|  hypothetical protein POPTR_0010s25400g             192   3e-53   Populus trichocarpa [western balsam poplar]
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    194   3e-53   
emb|CBI38888.3|  unnamed protein product                                185   3e-53   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          193   3e-53   
gb|AAQ21126.1|  pectinesterase                                          183   3e-53   Fragaria x ananassa
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     193   3e-53   
ref|XP_008800483.1|  PREDICTED: pectinesterase 3-like isoform X2        185   3e-53   
ref|XP_009130852.1|  PREDICTED: probable pectinesterase/pectinest...    193   3e-53   
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    191   3e-53   
ref|XP_010544635.1|  PREDICTED: probable pectinesterase/pectinest...    191   4e-53   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     192   4e-53   
emb|CDY11323.1|  BnaA03g01590D                                          192   4e-53   
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             190   5e-53   
gb|EPS70728.1|  pectinesterase                                          192   5e-53   
emb|CDY68790.1|  BnaAnng28400D                                          194   5e-53   
gb|AAR03544.1|  pectin methylesterase isoform 1                         183   5e-53   
emb|CDX74715.1|  BnaA05g04610D                                          189   5e-53   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          192   6e-53   
gb|AAN84553.1|  methyl pectinesterase                                   183   6e-53   
ref|XP_010548770.1|  PREDICTED: pectinesterase-like                     192   6e-53   
emb|CBI35795.3|  unnamed protein product                                193   7e-53   
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                   192   7e-53   
ref|XP_008344546.1|  PREDICTED: probable pectinesterase/pectinest...    183   7e-53   
ref|XP_010260072.1|  PREDICTED: pectinesterase-like                     191   7e-53   
emb|CDO97787.1|  unnamed protein product                                184   8e-53   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     191   8e-53   
ref|XP_009764218.1|  PREDICTED: probable pectinesterase/pectinest...    190   9e-53   
emb|CDY56347.1|  BnaCnng30140D                                          190   1e-52   
ref|XP_002512460.1|  Pectinesterase-2 precursor, putative               191   1e-52   
ref|XP_003630890.1|  Pectinesterase                                     190   1e-52   
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     189   1e-52   
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    190   1e-52   
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    191   1e-52   
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    187   1e-52   
emb|CDX74078.1|  BnaA03g29690D                                          191   1e-52   
ref|XP_010069899.1|  PREDICTED: probable pectinesterase/pectinest...    191   1e-52   
ref|XP_007031046.1|  Pectinesterase-2 precursor                         191   1e-52   
ref|XP_009134931.1|  PREDICTED: probable pectinesterase/pectinest...    191   1e-52   
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     189   1e-52   
gb|KFK37147.1|  hypothetical protein AALP_AA4G219300                    189   1e-52   
gb|AFW03480.1|  pectin methylesterase 1                                 191   1e-52   
gb|KDO53806.1|  hypothetical protein CISIN_1g0081982mg                  186   2e-52   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    191   2e-52   
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               190   2e-52   
ref|XP_003626199.1|  Pectinesterase                                     191   2e-52   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   190   2e-52   
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     190   2e-52   
gb|KDO87166.1|  hypothetical protein CISIN_1g0440421mg                  182   2e-52   
gb|AFB77929.1|  pectin methylesterase                                   191   2e-52   
ref|XP_006411580.1|  hypothetical protein EUTSA_v10016522mg             189   2e-52   
ref|XP_010523198.1|  PREDICTED: putative pectinesterase/pectinest...    189   2e-52   
ref|XP_009142324.1|  PREDICTED: probable pectinesterase/pectinest...    189   2e-52   
gb|KHN16553.1|  Pectinesterase 2                                        187   2e-52   
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    190   2e-52   
emb|CDP00815.1|  unnamed protein product                                190   2e-52   
gb|KHG08631.1|  Pectinesterase 3                                        191   2e-52   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        190   2e-52   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    191   2e-52   
ref|XP_008467117.1|  PREDICTED: pectinesterase                          190   2e-52   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    190   2e-52   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    190   2e-52   
ref|NP_566379.1|  pectinesterase 25                                     183   2e-52   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    191   2e-52   
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             191   2e-52   
ref|XP_010524121.1|  PREDICTED: probable pectinesterase/pectinest...    190   2e-52   
ref|XP_002511680.1|  Pectinesterase-2 precursor, putative               188   3e-52   
gb|AAM67242.1|  putative pectinesterase                                 182   3e-52   
ref|XP_010469150.1|  PREDICTED: probable pectinesterase/pectinest...    189   3e-52   
ref|XP_010423511.1|  PREDICTED: probable pectinesterase/pectinest...    191   3e-52   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     190   3e-52   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     189   3e-52   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             189   3e-52   
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    190   3e-52   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     189   3e-52   
ref|XP_006653811.1|  PREDICTED: probable pectinesterase/pectinest...    192   3e-52   
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     189   3e-52   
ref|XP_010413524.1|  PREDICTED: probable pectinesterase/pectinest...    189   3e-52   
ref|XP_008789972.1|  PREDICTED: probable pectinesterase/pectinest...    190   3e-52   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     189   3e-52   
ref|XP_003553884.1|  PREDICTED: probable pectinesterase/pectinest...    188   4e-52   
ref|XP_008390793.1|  PREDICTED: probable pectinesterase/pectinest...    182   4e-52   
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     189   4e-52   
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                189   4e-52   
ref|XP_002515774.1|  Pectinesterase-2 precursor, putative               189   4e-52   
gb|KHN11656.1|  Putative pectinesterase/pectinesterase inhibitor 33     187   4e-52   
gb|ABZ89800.1|  pectin methylesterase-like protein                      190   4e-52   
ref|XP_010260073.1|  PREDICTED: pectinesterase-like                     189   4e-52   
ref|XP_007222370.1|  hypothetical protein PRUPE_ppa003433mg             189   4e-52   
ref|XP_006576427.1|  PREDICTED: pectinesterase 2-like                   183   4e-52   
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    190   4e-52   
ref|XP_010452398.1|  PREDICTED: probable pectinesterase/pectinest...    190   5e-52   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   189   5e-52   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     189   5e-52   
gb|KEH29375.1|  pectinesterase/pectinesterase inhibitor                 189   5e-52   
ref|XP_009760201.1|  PREDICTED: probable pectinesterase/pectinest...    189   5e-52   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   186   5e-52   
ref|XP_006398954.1|  hypothetical protein EUTSA_v10013020mg             190   5e-52   
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    189   5e-52   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          189   5e-52   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          189   6e-52   
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     189   6e-52   
dbj|BAK06157.1|  predicted protein                                      194   6e-52   
ref|XP_004514850.1|  PREDICTED: pectinesterase 2-like                   188   6e-52   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    189   6e-52   
gb|KFK24938.1|  hypothetical protein AALP_AA8G044700                    189   6e-52   
ref|XP_004506985.1|  PREDICTED: probable pectinesterase/pectinest...    187   6e-52   
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   188   6e-52   
gb|EYU43523.1|  hypothetical protein MIMGU_mgv1a026199mg                187   7e-52   
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    189   7e-52   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     187   7e-52   
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    188   7e-52   
ref|XP_011090455.1|  PREDICTED: probable pectinesterase/pectinest...    187   7e-52   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   188   7e-52   
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     188   7e-52   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         186   8e-52   
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    189   9e-52   
dbj|BAK06954.1|  predicted protein                                      189   9e-52   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     188   9e-52   
gb|AAP04164.1|  putative pectinesterase                                 188   9e-52   
ref|XP_003591164.1|  Pectinesterase                                     189   9e-52   
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             187   9e-52   
ref|XP_004516727.1|  PREDICTED: probable pectinesterase/pectinest...    188   9e-52   
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   187   1e-51   
ref|XP_006649104.1|  PREDICTED: probable pectinesterase/pectinest...    187   1e-51   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     188   1e-51   
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                187   1e-51   
ref|XP_004150118.1|  PREDICTED: probable pectinesterase/pectinest...    188   1e-51   
gb|KFK26750.1|  hypothetical protein AALP_AA8G288600                    186   1e-51   
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   187   1e-51   
ref|XP_002882002.1|  predicted protein                                  187   1e-51   
gb|EMT19669.1|  Putative pectinesterase/pectinesterase inhibitor 21     192   1e-51   
ref|XP_007134835.1|  hypothetical protein PHAVU_010G080300g             187   1e-51   
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     187   1e-51   
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             188   1e-51   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    189   1e-51   
emb|CAA96436.1|  pectin methylesterase                                  181   1e-51   
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    188   1e-51   
tpg|DAA44943.1|  TPA: hypothetical protein ZEAMMB73_754551              185   1e-51   
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     188   2e-51   
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     187   2e-51   
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     188   2e-51   
ref|XP_003533518.1|  PREDICTED: probable pectinesterase/pectinest...    187   2e-51   
emb|CDY53657.1|  BnaC04g52910D                                          187   2e-51   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    187   2e-51   
ref|XP_002872846.1|  predicted protein                                  187   2e-51   
gb|AFW03475.1|  pectin methylesterase 1                                 188   2e-51   
gb|KHN35616.1|  Pectinesterase 2                                        183   2e-51   
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       188   2e-51   
ref|XP_002873178.1|  hypothetical protein ARALYDRAFT_487284             188   2e-51   
emb|CDX83392.1|  BnaA03g21140D                                          185   2e-51   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     188   2e-51   
ref|XP_009127434.1|  PREDICTED: probable pectinesterase/pectinest...    179   2e-51   
ref|XP_002266980.1|  PREDICTED: pectinesterase                          187   2e-51   
gb|EMS52976.1|  putative pectinesterase/pectinesterase inhibitor 21     191   2e-51   
ref|XP_004173650.1|  PREDICTED: probable pectinesterase/pectinest...    184   2e-51   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    187   2e-51   
ref|XP_003598362.1|  Pectinesterase                                     188   2e-51   
ref|XP_007199770.1|  hypothetical protein PRUPE_ppa003639mg             187   2e-51   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     188   2e-51   
gb|AAF16637.1|AC011661_15  T23J18.24                                    179   2e-51   
ref|XP_002310960.2|  hypothetical protein POPTR_0008s01180g             187   2e-51   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    187   2e-51   
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     187   2e-51   
emb|CAA96435.1|  pectin methylesterase                                  182   2e-51   
ref|XP_006290060.1|  hypothetical protein CARUB_v10003696mg             188   3e-51   
ref|XP_008451544.1|  PREDICTED: probable pectinesterase/pectinest...    187   3e-51   
ref|NP_192139.1|  Probable pectinesterase/pectinesterase inhibito...    187   3e-51   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          187   3e-51   
emb|CAA96434.1|  pectin methylesterase                                  182   3e-51   
emb|CAC01624.1|  putative pectin methylesterase                         187   3e-51   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             187   3e-51   
ref|XP_003604119.1|  Pectinesterase                                     188   3e-51   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  187   3e-51   
gb|AEL79481.1|  pectin methylesterase-like protein                      187   3e-51   
gb|KHN25547.1|  Pectinesterase 2                                        183   3e-51   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             187   3e-51   
ref|XP_008796891.1|  PREDICTED: pectinesterase-like                     185   3e-51   
ref|XP_010273806.1|  PREDICTED: pectinesterase-like isoform X2          187   3e-51   
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     179   3e-51   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    187   3e-51   
ref|XP_004499739.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    187   3e-51   
ref|XP_010273807.1|  PREDICTED: pectinesterase-like isoform X3          187   3e-51   
gb|KHN35621.1|  Putative pectinesterase/pectinesterase inhibitor 36     186   3e-51   
ref|XP_006401970.1|  hypothetical protein EUTSA_v10013190mg             187   3e-51   
ref|XP_010098737.1|  Putative pectinesterase/pectinesterase inhib...    185   3e-51   
ref|XP_003540571.1|  PREDICTED: probable pectinesterase/pectinest...    186   3e-51   
ref|XP_004299720.1|  PREDICTED: probable pectinesterase/pectinest...    187   3e-51   
ref|XP_003521962.2|  PREDICTED: probable pectinesterase/pectinest...    186   3e-51   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     187   4e-51   
ref|XP_010273805.1|  PREDICTED: pectinesterase-like isoform X1          187   4e-51   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          186   4e-51   
emb|CBI27741.3|  unnamed protein product                                182   4e-51   
emb|CDP20891.1|  unnamed protein product                                186   4e-51   
ref|XP_008391336.1|  PREDICTED: probable pectinesterase/pectinest...    184   4e-51   
ref|XP_010491028.1|  PREDICTED: probable pectinesterase/pectinest...    188   4e-51   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    186   4e-51   
emb|CDY55503.1|  BnaA05g34400D                                          186   4e-51   
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        186   4e-51   
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   186   4e-51   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    186   4e-51   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   188   4e-51   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     187   4e-51   
ref|XP_011079963.1|  PREDICTED: probable pectinesterase/pectinest...    187   4e-51   
emb|CDX95641.1|  BnaC03g25220D                                          184   4e-51   
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   184   5e-51   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    186   5e-51   
ref|XP_009142905.1|  PREDICTED: probable pectinesterase/pectinest...    186   5e-51   
ref|XP_009402517.1|  PREDICTED: pectinesterase-like                     186   5e-51   
ref|XP_006432534.1|  hypothetical protein CICLE_v10000705mg             187   5e-51   
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   186   5e-51   
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   186   5e-51   
ref|XP_008812398.1|  PREDICTED: probable pectinesterase/pectinest...    186   5e-51   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     187   5e-51   
emb|CAN60506.1|  hypothetical protein VITISV_022717                     179   5e-51   
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             185   5e-51   
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        186   5e-51   
gb|EPS66910.1|  pectinesterase family protein                           177   5e-51   
ref|XP_009355065.1|  PREDICTED: probable pectinesterase/pectinest...    187   5e-51   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             186   5e-51   
gb|ACJ85756.1|  unknown                                                 182   5e-51   
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     186   5e-51   
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             186   6e-51   
ref|XP_010921648.1|  PREDICTED: pectinesterase-like                     179   6e-51   
gb|EAY95754.1|  hypothetical protein OsI_17629                          190   6e-51   
emb|CAH68135.1|  B0414F07.5                                             190   6e-51   
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          187   6e-51   
ref|NP_196116.1|  putative pectinesterase/pectinesterase inhibito...    187   6e-51   
ref|NP_001054042.1|  Os04g0641200                                       190   6e-51   
ref|NP_001275775.1|  pectinesterase 2 precursor                         186   6e-51   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   186   6e-51   
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    185   6e-51   
ref|XP_010096538.1|  Pectinesterase 1                                   178   6e-51   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    187   6e-51   
ref|XP_010417837.1|  PREDICTED: probable pectinesterase/pectinest...    182   7e-51   
ref|XP_010932335.1|  PREDICTED: probable pectinesterase/pectinest...    186   7e-51   



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 134/190 (71%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQFYRDCTI+GTIDFVFG+A A+FQNCT +IRKPL N    QSC+VTAQG
Sbjct  404  YQDTLYTHAQRQFYRDCTISGTIDFVFGDATAIFQNCTFLIRKPLPN----QSCIVTAQG  459

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ I+I NS IT+ P Y        ++LGRPW+++SRT+I++S ID  I PEGW
Sbjct  460  RKERRQPSAIIIQNSTITADPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGW  519

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G WGL  C+Y E GNTG  +  ++R  W GIK +I + HA  F PG+F  GD WI 
Sbjct  520  LPWEGEWGLKTCFYAELGNTGPAANKARRVTWRGIK-KITENHAADFTPGRFFRGDKWIR  578

Query  285  ATKVPYAAGL  256
             + VPY  GL
Sbjct  579  LSGVPYIPGL  588



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 135/190 (71%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HAHRQFYRDCTI+GTIDF+FG+A+A+FQNC +++RKPL N    Q C+VTAQG
Sbjct  385  YQDTLYTHAHRQFYRDCTISGTIDFIFGDASAIFQNCKMLVRKPLDN----QQCIVTAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ I++ N  IT+   Y    +   SFLGRPW+++SRT+I+ S ID  I PEGW
Sbjct  441  RKERRQPSAIILQNCTITADASYVPVKAKFRSFLGRPWKEYSRTIIMQSFIDDIIQPEGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +G+  C+Y EFGN G GS ++ R KW GIK  I  AHA  F  G F+ G+TW+P
Sbjct  501  LPWMGDFGIKTCFYSEFGNRGPGSSMTGRVKWKGIK-TITPAHAVDFTVGTFLRGNTWLP  559

Query  285  ATKVPYAAGL  256
               VP++AG+
Sbjct  560  KFGVPFSAGM  569



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 133/190 (70%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQFYRDCT++GTIDFVFG+A  VFQNCT ++RKPL N    Q C+VTAQG
Sbjct  395  YQDTLYTHAKRQFYRDCTVSGTIDFVFGDAPVVFQNCTFLVRKPLEN----QQCIVTAQG  450

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +P+ I+I NS IT+ P  +       S+LGRPW++ SRT+I+ + ID  I PEGW
Sbjct  451  RKARRQPSAIIIQNSTITAHPELEPVKDQYKSYLGRPWKEFSRTIIMETFIDDLIQPEGW  510

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G++GL  CWYGE+ N G GS +  R KW GIK  +++ HA  F PG+F+ GD+WI 
Sbjct  511  SPWFGSFGLKTCWYGEYNNYGPGSDMKNRVKWNGIKP-VSRQHAIDFTPGRFLRGDSWIK  569

Query  285  ATKVPYAAGL  256
             T VPYA  L
Sbjct  570  PTGVPYAPYL  579



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H  RQFYRDCTITGTIDF+FG+A AVFQNC L++RKPL N    Q C+VTAQG
Sbjct  384  YQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLDN----QQCIVTAQG  439

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  EPTG VI N  IT+ P Y        ++LGRPWR+ SRT+++ S ID  IAPEGW
Sbjct  440  RNETREPTGFVIQNCTITADPQYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGW  499

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++GL   +Y E+ N G+G+V + R KW GIK ++    A+G+   KFI GD WIP
Sbjct  500  LPWLGSFGLNTLFYSEYNNKGQGAVETNRVKWAGIK-KLTPEAADGYTAAKFIQGDEWIP  558

Query  285  ATKVPYAAGL  256
             T VPY AG+
Sbjct  559  QTGVPYTAGM  568



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 131/186 (70%), Gaps = 5/186 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLY HA RQFYRDC+I+GTIDFVFG+A+AVFQNC  ++RKPL N    Q C+VTAQG
Sbjct  390  HQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLEN----QQCIVTAQG  445

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +P+ ++I NS IT+ P          S+LGRPW+++SRT+I+ S ID  I PEGW
Sbjct  446  RKMRRQPSALIIQNSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGW  505

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ GT+GL  CWY EF N G GS  + R KW GIK  IN+ HA  F PG+F+ GD+WI 
Sbjct  506  LPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIKT-INRQHAMDFTPGRFLKGDSWIK  564

Query  285  ATKVPY  268
            AT +PY
Sbjct  565  ATGIPY  570



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H  RQFYRDCTITGTIDF+FG+A AVFQNC L++RKPL N    Q C+VTAQG
Sbjct  384  YQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLEN----QQCIVTAQG  439

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  EPTG VI N  IT+ P Y        ++LGRPWR+ SRT+++ S ID  IAPEGW
Sbjct  440  RNETREPTGFVIQNCTITADPKYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGW  499

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E+ N G+G+V + R KW GIK ++    A+G+   KFI GD WIP
Sbjct  500  LPWLGNFGLNTLFYSEYDNKGQGAVETNRVKWAGIK-KLTPEAADGYTAAKFIQGDEWIP  558

Query  285  ATKVPYAAGL  256
             T VPY AG+
Sbjct  559  QTGVPYTAGM  568



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 132/187 (71%), Gaps = 5/187 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H HRQFYRDCTI+GTIDFVFG+AAA+FQNCT ++ KPL +    QSC+VTAQG
Sbjct  404  YQDTLYTHTHRQFYRDCTISGTIDFVFGDAAAIFQNCTFVVHKPLPD----QSCIVTAQG  459

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ IVI NS IT+ P Y    +   ++LGRPW+++SRT+I+ S ID  I PEGW
Sbjct  460  RKEGRQPSAIVIQNSTITADPDYFLVKNVNKAYLGRPWKEYSRTIIMESYIDDVIQPEGW  519

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G WGL  C+Y EF NTG  +  ++R  W GIK +I + HA  F PGKF  GD WI 
Sbjct  520  LPWAGQWGLRTCFYTEFRNTGPAANKARRVTWQGIK-QITRRHAAQFTPGKFFRGDEWIK  578

Query  285  ATKVPYA  265
             + VPY+
Sbjct  579  LSGVPYS  585



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 134/194 (69%), Gaps = 5/194 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H HRQFYRDCTI+GTIDFVFG+AAA+FQNCT ++RKPL +    QSC+VTAQG
Sbjct  406  YQDTLYTHTHRQFYRDCTISGTIDFVFGDAAAIFQNCTFVVRKPLPD----QSCIVTAQG  461

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ IVI NS IT+ P Y    +   ++LGRPW+++SRT+I+ S ID  I PEGW
Sbjct  462  RKERRQPSAIVIQNSTITADPDYFPVKNVNRAYLGRPWKEYSRTIIMESYIDDVIQPEGW  521

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G WGL  C+Y EF NTG  +  ++R  W GIK +I + HA  F PGKF  GD WI 
Sbjct  522  LAWAGQWGLRTCFYTEFCNTGPAANKARRVTWQGIK-QITRRHAAQFTPGKFFRGDEWIK  580

Query  285  ATKVPYAAGLNPNK  244
             + VP   GL  N+
Sbjct  581  LSGVPCVPGLTTNR  594



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 132/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQFY DCTI+GTIDFVFG+A AVFQNCT +IRKPL N    QSC+VTAQG
Sbjct  399  YQDTLYTHAQRQFYCDCTISGTIDFVFGDATAVFQNCTFLIRKPLPN----QSCIVTAQG  454

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ I+I NS IT+ P Y        ++LGRPW+++SRT+I++S ID  I PEGW
Sbjct  455  RKERRQPSAIIIQNSTITAEPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGW  514

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G WGL  C+Y E GNTG  +  ++R  W GIK +I + H   F PG+F  GD WI 
Sbjct  515  LPWEGEWGLKTCFYAESGNTGPAANKARRVTWRGIK-QITENHTADFTPGRFFRGDKWIR  573

Query  285  ATKVPYAAGL  256
             + VPY  GL
Sbjct  574  LSGVPYIPGL  583



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 5/186 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLY HA RQFYRDC+I+GTIDFVFG+A+AVFQNC  ++RKPL N    Q C+VTAQG
Sbjct  390  HQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLEN----QQCIVTAQG  445

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +P+ ++I +S IT+ P          S+LGRPW+++SRT+I+ S ID  I PEGW
Sbjct  446  RKMRRQPSALIIQSSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGW  505

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ GT+GL  CWY EF N G GS  + R KW GIK  IN+ HA  F PG+F+ GD+WI 
Sbjct  506  LPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-TINRQHAMDFTPGRFLKGDSWIK  564

Query  285  ATKVPY  268
            AT +PY
Sbjct  565  ATGIPY  570



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 130/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HAHRQFYRDCTITGTIDF+FGNAAAVFQNC +++RKP+ N    Q C+VTAQG
Sbjct  383  YQDTLYTHAHRQFYRDCTITGTIDFIFGNAAAVFQNCKILVRKPMDN----QQCIVTAQG  438

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R Q  EPT I++ N  I+S P +        ++LGRPW+Q+SRT+I+  +ID  I PEGW
Sbjct  439  RTQRKEPTAIILQNCAISSDPTFFPVRHINKAYLGRPWKQYSRTIIMQCQIDDLIQPEGW  498

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  N G G+   KR KW GIK +I   HA  F  G+FI GD WI 
Sbjct  499  LPWMGDFALHTLFYAEINNRGPGAATDKRVKWKGIK-KITPQHALDFTVGRFIRGDPWIK  557

Query  285  ATKVPYAAGL  256
             T VPY++G+
Sbjct  558  PTGVPYSSGM  567



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   221 bits (563),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HAHRQFYRDCTITGTIDF+FGN A VFQNC +++RKP+ N    Q C+VTAQG
Sbjct  386  YQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCKILVRKPMDN----QQCIVTAQG  441

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R Q  EPT I++ N  I+S+P +        +FLGRPW+Q+SRT+I+ S+ID  I PEGW
Sbjct  442  RTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQPEGW  501

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  N G G+   KR KW GIK +I   HA  F   +FI GD WI 
Sbjct  502  LPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIK-KITMEHALDFTAARFIRGDPWIK  560

Query  285  ATKVPYAAGL  256
             T VPY +G+
Sbjct  561  PTGVPYTSGM  570



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HAHRQFYRDCTITGTIDF+FGN A VFQNC +++RKP+ N    Q C+VTAQG
Sbjct  383  YQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCKILVRKPMDN----QQCIVTAQG  438

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R Q  EPT I++ N  I+S+P +        +FLGRPW+Q+SRT+I+ S+ID  I PEGW
Sbjct  439  RTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQPEGW  498

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  N G G+   KR KW GIK +I   HA  F   +FI GD WI 
Sbjct  499  LPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIK-KITMEHALDFTAARFIRGDPWIK  557

Query  285  ATKVPYAAGL  256
             T VPY +G+
Sbjct  558  PTGVPYTSGM  567



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            ++QDTLY HA+RQ+YRDCTITGTIDF+FG+AAAVFQNC +++RKPL N G    CMVTAQ
Sbjct  384  SFQDTLYAHAYRQYYRDCTITGTIDFIFGDAAAVFQNCQMIVRKPLANQG----CMVTAQ  439

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR +       VI N  I + P + ++  P+ ++LGRPW+Q SRT+I+ + ID  IAPEG
Sbjct  440  GRKERRSTGVTVIQNCHILAEPAFLSTKPPVKAYLGRPWKQFSRTIIMQTLIDGFIAPEG  499

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W+P++G + L   +YGEF N G GS +S+R +W GI+  I  A AE F PG+   GD W+
Sbjct  500  WAPWEGNFALDTLYYGEFKNRGPGSDMSRRVRWKGIQ-TITPAIAESFTPGRLFAGDEWV  558

Query  288  PATKVPYAAGL  256
              + VPY AG+
Sbjct  559  RQSGVPYVAGM  569



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFYRDCTITGTIDFV G+AAAVFQNC ++IRKPL N    Q C+VTAQG
Sbjct  388  YQDTLYAHSKRQFYRDCTITGTIDFVLGDAAAVFQNCKMLIRKPLDN----QQCIVTAQG  443

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R++  E + +++ N  IT+ P Y      I+S+LGRPW+ +SRT+I+ S ID  I P+GW
Sbjct  444  RSKRREASALILQNCTITADPSYTPFKGQILSYLGRPWKAYSRTIIMESYIDDIIQPKGW  503

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL  C+Y E+ N G G+  ++R KW GIK +I   HA  F  G+F+ GD WI 
Sbjct  504  MPWLGDFGLNTCFYAEYKNRGPGASTARRVKWKGIK-KITPQHAVEFTAGRFMKGDRWIR  562

Query  285  ATKVPYAAGL  256
               VPY AG+
Sbjct  563  TAGVPYVAGM  572



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 131/192 (68%), Gaps = 7/192 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AAAVFQNC +++RKPL N    Q+CMVTA G
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHG  443

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R     PTGI++ N  I+  PGY+   +   ++LGRPW+ ++R +++ S+ID  IAPEGW
Sbjct  444  RLDRRSPTGIILQNCTISGEPGYEKDLNK--AYLGRPWKNYARAIVMQSQIDDVIAPEGW  501

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G+     CW+GEFGN G G+  +KRA W GIK  +   HA  F  G+F+ GD WI 
Sbjct  502  MEWIGSNNHQSCWFGEFGNRGLGADQTKRATWRGIK-ELTAQHAADFTAGRFVFGDRWIQ  560

Query  285  ATKVPYAAGLNP  250
             + VPY AG+ P
Sbjct  561  PSGVPYVAGMMP  572



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H  RQFYRDCTI+GTIDF+FG+AA +FQNCT ++RKPL N    Q C+VTAQG
Sbjct  390  YQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDN----QQCIVTAQG  445

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ I+I NS  T+ P Y    + + S+LGRPW++ SRT+I+ S I+  I P GW
Sbjct  446  RKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLIQPSGW  505

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L  C+Y EF N G G+    R KW GIK  I  +HA  FAPG+F+ GD WIP
Sbjct  506  LPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIKT-IKPSHAIDFAPGRFLSGDRWIP  564

Query  285  ATKVPYAAGL  256
            +T VPY +GL
Sbjct  565  STGVPYNSGL  574



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQFYR+C+I+GTIDFVFG+A  VFQNC  ++RKPL N    Q C+VTAQG
Sbjct  394  YQDTLYTHAKRQFYRECSISGTIDFVFGDAPVVFQNCKFLVRKPLEN----QQCIVTAQG  449

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R Q  +P+GI+I N   T+ P          S+LGRPW+Q SRT+I+ S ID  I PEGW
Sbjct  450  RKQRRQPSGIIIQNGTFTAHPELVPVKKQYKSYLGRPWKQFSRTIIMESYIDDIIEPEGW  509

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ GT+GL  CWY EF N G GS    R KW GIK  I++ HA  F PG+F+ GDTWI 
Sbjct  510  LPWFGTFGLKTCWYTEFNNYGPGSDKKARVKWNGIK-TIDRQHALDFTPGRFLRGDTWIK  568

Query  285  ATKVPYAAGL  256
             T +PY+  L
Sbjct  569  PTGIPYSPFL  578



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVHAHRQFYRDCTITGTIDF+FG++A VFQNC +++RKPL N    Q C+VTAQG
Sbjct  398  YQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCLILVRKPLDN----QQCIVTAQG  453

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  EPTGIV+ N  I+++  Y    +   S+LGRPW+  SRT+I+ S+ID  I+PEGW
Sbjct  454  RNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLISPEGW  513

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL  C+Y E+GN G  S  + R  W GIK +I   H   F  G+FI G  W+ 
Sbjct  514  LPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIK-QITGQHVNDFTVGRFISGHLWLG  572

Query  285  ATKVPYAAGL  256
            A+ VPY + +
Sbjct  573  ASGVPYTSDM  582



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 133/190 (70%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLY HA+RQ+YRDCTITGTIDF+FG+AAAVFQNC +++RKPL N G    CMVTAQG
Sbjct  385  FQDTLYAHAYRQYYRDCTITGTIDFIFGDAAAVFQNCQMIVRKPLANQG----CMVTAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +       VI N  I + P + ++  P+ ++LGRPW+Q SRT+I+ + ID  IAPEGW
Sbjct  441  RKERRSTGVTVIQNCHILAEPAFLSTTPPLKAYLGRPWKQFSRTIIMQTLIDGFIAPEGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+QG + L   +YGEF N G GS +S+R +W GI+  I  A A+ F PG+   GD W+ 
Sbjct  501  APWQGNFALDTLYYGEFKNRGPGSDMSRRVRWKGIQ-TITPAIADSFTPGRLFAGDEWVR  559

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  560  QSGVPYVAGM  569



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY H +RQ+YR+CTI+GTIDF+FG+A+AVFQ+C +++RKP+ N G    CMVTAQ
Sbjct  374  AYQDTLYTHTYRQYYRNCTISGTIDFIFGDASAVFQDCKMVVRKPMENQG----CMVTAQ  429

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR +      IV+ N QI + P +     PI ++LGRPW++ SRT+I+ + ID  IAPEG
Sbjct  430  GRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPEG  489

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            WSP+ G +G+  C+Y E+ N G G+  SKR +W GIK +I    A+ F PG +I GD WI
Sbjct  490  WSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIK-KITPQIAQSFTPGAYIQGDAWI  548

Query  288  PATKVPYAAGL  256
             A+ VPYA G+
Sbjct  549  TASGVPYAPGM  559



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   221 bits (564),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H  RQFYRDCTI+GTIDF+FG+AA +FQNCT ++RKPL N    Q C+VTAQG
Sbjct  390  YQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDN----QQCIVTAQG  445

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ I+I NS  T+ P Y    + + S+LGRPW++ SRT+I+ S I+  I P GW
Sbjct  446  RKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLIQPSGW  505

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L  C+Y EF N G G+    R KW GIK  I  +HA  FAPG+F+ GD WIP
Sbjct  506  LPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIKT-IKPSHAIDFAPGRFLSGDRWIP  564

Query  285  ATKVPYAAGL  256
            +T VPY +GL
Sbjct  565  STGVPYNSGL  574



>ref|XP_008351186.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Malus domestica]
Length=363

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AA VFQNC +++RKP+ N    Q+CMVTAQG
Sbjct  176  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQG  231

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +P+GI++ N  I+  P Y        S+LGRPW+  +RTV++ S+ID  IAPEGW
Sbjct  232  RIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGW  291

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G+     CW+GE+ N G GS +SKR KW GIK  ++   A  F  GKF+ GD WI 
Sbjct  292  MEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGIK-NLSADQAVAFTSGKFVEGDKWIK  350

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  351  PSGVPYVAGM  360



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HAHRQFYRDCTI+GTIDFVFGNAA  FQNC L++RKP+ N    Q C+VTA G
Sbjct  390  YQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLVVRKPMDN----QQCIVTAHG  445

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPT ++         P Y    S   ++LGRPW+Q+SRT+II S+ID  I PEGW
Sbjct  446  RMNRKEPTALIFQGCHFMGDPAYLPFKSINKAYLGRPWKQYSRTIIIGSQIDDIIQPEGW  505

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  N G G+V +KR KW GIK  I   HA  F P +FI GD WIP
Sbjct  506  LPWMGDFGLNTLFYAEVQNKGPGAVETKRVKWRGIK-HITPQHAADFTPRRFIDGDAWIP  564

Query  285  ATKVPYAAGL  256
            A  +PY++G+
Sbjct  565  AKGIPYSSGM  574



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H HRQFYRDC ITGTIDF+FG++AAVFQNC ++IRKPL N    Q+C+VTAQG
Sbjct  390  YQDTLYAHTHRQFYRDCVITGTIDFIFGDSAAVFQNCKMVIRKPLDN----QNCIVTAQG  445

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  E T +V+ N  IT  P Y         +LGRPW++ SRT+I+NS+ID  IAPEGW
Sbjct  446  RTERREATALVLQNCTITGDPAYLPVKDQNKGYLGRPWKEFSRTIIMNSRIDDVIAPEGW  505

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L  C+Y E  N G GS L  R KW GIK ++    A  + PG+FI GD WI 
Sbjct  506  LPWAGDFALNTCFYTEILNRGPGSKLDGRVKWRGIK-KVPAQRAVEYTPGRFIRGDWWIK  564

Query  285  ATKVPYAAGL  256
            A  VPY +G+
Sbjct  565  AAGVPYVSGM  574



>emb|CDY57858.1| BnaC08g47740D [Brassica napus]
Length=468

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 130/188 (69%), Gaps = 5/188 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDC I+GTIDFVFG+A AVFQNC  +IR+P+ N    Q C+VTAQG
Sbjct  285  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCEFVIRRPMDN----QQCIVTAQG  340

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+IT    Y+       +FLGRPW+++SRT+I+N+ ID  I PEGW
Sbjct  341  RKDRRETTGIVIHNSRITGDATYRPVKDKNRAFLGRPWKEYSRTIIMNTDIDDVIDPEGW  400

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS  ++R +W GI+ RI+   A GFAPG+F+ G+ WI 
Sbjct  401  LKWNETFALKTLFYSEYRNRGRGSGQARRVRWRGIQ-RISARQARGFAPGEFLRGNAWIT  459

Query  285  ATKVPYAA  262
              ++PY A
Sbjct  460  KRRIPYNA  467



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 129/190 (68%), Gaps = 7/190 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AAAVFQNC +++RKPL N    Q+CMVTAQG
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACMVTAQG  443

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R     P+ +++ N  I+   GY    +   ++LGRPW+ ++R +++ S+ID  IAPEGW
Sbjct  444  RLDRRSPSALILQNCTISGERGYDKELNK--AYLGRPWKSYARAIVMQSQIDDVIAPEGW  501

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT     CW+GEFGN G G+ LSKR  W G+K ++   HA  F  GKFI GD WI 
Sbjct  502  MDWTGTANHNTCWFGEFGNRGVGAELSKRVTWRGMK-KLTPEHAADFTAGKFIFGDRWIL  560

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  561  PSGVPYVAGM  570



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 126/186 (68%), Gaps = 5/186 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDT+Y HA RQFYRDC+I+GTIDFVFG+A+AVFQNC  +IRKPL N    Q C+VTAQG
Sbjct  391  HQDTMYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLIRKPLEN----QQCIVTAQG  446

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +P+ I+I NS IT+ P          S+LGRPW++ SRT+I+ S ID  I PEGW
Sbjct  447  RKMRRQPSAIIIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGW  506

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ GT+GL  CWY EF N G GS  + R KW GIK  I++ HA  F PG+F  G  WI 
Sbjct  507  LPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIKT-IDRQHALDFTPGRFFKGGAWIK  565

Query  285  ATKVPY  268
             T +PY
Sbjct  566  TTGIPY  571



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 130/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH++RQF+RDCTITGTIDF+FG+AAAVFQNC +++RKP+ N    Q+CMVTAQG
Sbjct  358  YQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCKMIVRKPMDN----QACMVTAQG  413

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R       GIV+ N QI +  G+  +  PI ++LGRPW++ SRT+I+ S+ID  IAPEGW
Sbjct  414  RKDHRGVGGIVMQNCQIKAEQGFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIAPEGW  473

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G + L   +Y E+ N G GS+   R  W G +  I    A  F PG FI+GD W+ 
Sbjct  474  SPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPGVFIMGDEWVK  533

Query  285  ATKVPYAAGL  256
             + VPY  G+
Sbjct  534  LSGVPYEPGM  543



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AA VFQNC +++RKP+ N    Q+CMVTAQG
Sbjct  391  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQG  446

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +P+GI++ N  I+  P Y        S+LGRPW+  +RTV++ S+ID  IAPEGW
Sbjct  447  RIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGW  506

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G+     CW+GE+ N G GS +SKR KW GIK  ++   A  F  GKF+ GD WI 
Sbjct  507  MEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGIKN-LSADQAVAFTSGKFVEGDKWIK  565

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  566  PSGVPYVAGM  575



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 135/191 (71%), Gaps = 5/191 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDT++ H HRQF+RDCTI+GTIDF+FGNA AVFQNCTL++RKPL N    ++C+VTA+G
Sbjct  377  YQDTVFAHNHRQFFRDCTISGTIDFIFGNARAVFQNCTLLVRKPLENQ---KACLVTAEG  433

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E + IV+ N +I  +P Y  +     ++LGRPW+ +SRTVI++S +D+ + PEGW
Sbjct  434  RTTINETSAIVLQNCRILPAPEYPVNDPTYKTYLGRPWKPYSRTVIMDSHLDSLVDPEGW  493

Query  465  SPFQGTWGLTD-CWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            +P+  T    D CWY E  N G G+ LS+R  WPGIK +I    A+ F PG+F++GD+WI
Sbjct  494  APWNVTSAHLDTCWYAELNNKGPGADLSRRVAWPGIK-KITVNEADDFTPGQFMVGDSWI  552

Query  288  PATKVPYAAGL  256
                +PY +GL
Sbjct  553  AGKGIPYDSGL  563



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AA VFQNC +++RKP+ N    Q+CMVTAQG
Sbjct  391  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQG  446

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +P+GI++ N  I+  P Y        S+LGRPW+  +RTV++ S+ID  IAPEGW
Sbjct  447  RIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGW  506

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G+     CW+GE+ N G GS +SKR KW GIK  +    A  F  GKF+ GD WI 
Sbjct  507  MEWTGSNNHQSCWFGEYRNRGPGSDMSKRVKWSGIKN-LGADQAVAFTSGKFVEGDKWIK  565

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  566  PSGVPYVAGM  575



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 127/190 (67%), Gaps = 7/190 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AAAVFQNC +++RKPL N    Q+CMVTA G
Sbjct  389  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHG  444

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R     PT +++ N  I+   GY    +   ++LGRPW+ ++R +++ S+ID  IAPEGW
Sbjct  445  RLDRRSPTALILQNCTISGESGYDKELNK--AYLGRPWKSYARAIVMQSQIDDVIAPEGW  502

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G      CW+GEFGN G G+ LSKR  W G+K ++   HA  F  GKFI GD WI 
Sbjct  503  MDWTGASNHNTCWFGEFGNRGVGAELSKRVTWRGMK-KLTPEHAADFTAGKFIFGDRWIL  561

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  562  PSGVPYVAGM  571



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY H +RQ+YR+CTI+GTIDF+FG+ +AVFQ C +++RKP+ N G    CMVTAQ
Sbjct  358  AYQDTLYTHTYRQYYRNCTISGTIDFIFGDGSAVFQGCKMVVRKPMENQG----CMVTAQ  413

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR +      IV+ N QI + P +     PI ++LGRPW++ SRT+I+ + ID  IAPEG
Sbjct  414  GRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPEG  473

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            WSP+ G +G+  C+Y E+ N G G+  SKR +W GIK +I    A+ F PG +I GD WI
Sbjct  474  WSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIK-KITPQIAQSFTPGAYIQGDAWI  532

Query  288  PATKVPYAAGL  256
             A+ V YA+G+
Sbjct  533  TASGVTYASGM  543



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 125/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HAHRQFYRDCTI+GTIDFVFGNAA  FQNC L++RKPL N    Q C+VTA G
Sbjct  391  YQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLVVRKPLDN----QQCIVTAHG  446

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPT ++  +      P Y    +   ++LGRPW+++SRT+II S ID  I PEGW
Sbjct  447  RLNRKEPTALIFQSCHFMGDPAYLPFKAINKAYLGRPWKEYSRTIIIGSTIDDIIQPEGW  506

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  N G G+  SKR KW GIK  I   HA  F P +FI GD WIP
Sbjct  507  LPWMGDFGLNTLFYAEVQNKGAGADESKRVKWRGIK-HITPQHAADFTPRRFIDGDAWIP  565

Query  285  ATKVPYAAGL  256
            A  +PY++G+
Sbjct  566  AKGIPYSSGM  575



>ref|XP_010434900.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 131/189 (69%), Gaps = 5/189 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDC I+GTIDFVFG+A AVFQNC  +IR+P+ N    Q C+VTAQG
Sbjct  508  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDN----QQCIVTAQG  563

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+I     Y    +   +FLGRPW+++SRT+I+N++ID  I PEGW
Sbjct  564  RKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGW  623

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS  ++R KW GI+ RI+   A  FAPG F+ G+TWIP
Sbjct  624  LKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIR-RISPRAAREFAPGNFLRGNTWIP  682

Query  285  ATKVPYAAG  259
             T++PY A 
Sbjct  683  QTRIPYNAN  691



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDCTITGTIDFVFG+AAAVFQNCT ++R PL    +GQ C+VTAQG
Sbjct  415  YQDTLYVHSKRQFYRDCTITGTIDFVFGDAAAVFQNCTFLVRVPL----NGQQCIVTAQG  470

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  A +PT IVI NS  T++P          ++LGRPW   SRT+I+ S +D  I PEGW
Sbjct  471  RTDARQPTAIVIQNSTFTAAPELVPVKDKYPTYLGRPWGNFSRTIIMESYLDDLIKPEGW  530

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            + + G WGL   +Y EF N G GS  + R  W GIK RI++A A GF PGKFI G  WI 
Sbjct  531  AIWDGPWGLNTSFYSEFNNYGPGSNKTGRVTWRGIK-RISQATAFGFTPGKFINGAAWIK  589

Query  285  ATKVPYAAGL  256
              +VPY  G 
Sbjct  590  PRRVPYTPGF  599



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG++A V QNC +++RKPL N    Q C+VTAQG
Sbjct  498  YQDTLYAHSHRQFYRDCTISGTIDFIFGDSATVLQNCKIIVRKPLEN----QQCIVTAQG  553

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  E + +V+ N  I+  P Y        ++LGRPW++ SRT+I+ S+ID  IAPEGW
Sbjct  554  RIERREVSALVLQNCTISGDPEYLPVKDKNKAYLGRPWKEFSRTLIMQSQIDDIIAPEGW  613

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   WY EFGN G G+V + R  W GIK +IN A A  F PG F+ GD WIP
Sbjct  614  LPWNGDFALNTLWYAEFGNRGPGAVQTHRVTWRGIK-KINAAIARRFTPGVFLRGDDWIP  672

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  673  KAGVPYTPGL  682



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H +RQFYRD TI+GTIDF+FG+AAAVFQNC L++R PL+N    Q+CMVTAQG
Sbjct  379  YQDTLYSHTYRQFYRDTTISGTIDFIFGDAAAVFQNCKLIVRMPLVN----QACMVTAQG  434

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  +     IV+ N  I + P   ++  P+ ++LGRPW+++SRT+I+ S ID  I P+GW
Sbjct  435  RNNSRSTGAIVLQNCSIVADPALLSADPPVRAYLGRPWKEYSRTIIMQSNIDGFIDPQGW  494

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ GT+GL   +Y E+ N G G+   +R  WPGI+  I    AE F PGK+ +GD+WI 
Sbjct  495  SPWMGTFGLKTLYYAEYQNRGPGANTDQRVDWPGIQ-HITPQVAESFTPGKYFIGDSWIT  553

Query  285  ATKVPYAAGL  256
            A+  PY  G+
Sbjct  554  ASGFPYVPGM  563



>ref|XP_010440226.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 5/189 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDC I+GTIDF+FG+A AVFQNC  +IR+P+ N    Q C+VTAQG
Sbjct  508  YQDTLYVHTHRQFYRDCRISGTIDFIFGDAKAVFQNCVFVIRRPMDN----QQCIVTAQG  563

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+I     Y    +   +FLGRPW+++SRT+I+N++ID  I PEGW
Sbjct  564  RKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGW  623

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS  ++R KW GI+ RI+   A  FAPG F+ G+TWIP
Sbjct  624  LKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIR-RISPRDAREFAPGNFLRGNTWIP  682

Query  285  ATKVPYAAG  259
             T++PY A 
Sbjct  683  QTRIPYNAN  691



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H  RQFYR+CTI+GTIDF+FG+AA VFQNC +++RKP+ N    Q C+VTAQG
Sbjct  391  YQDTLYTHTKRQFYRECTISGTIDFLFGDAAVVFQNCLMLVRKPMAN----QQCIVTAQG  446

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIV+ N  I++ P   ++ +  VS+LGRPW+++SRT+I+ S+ID  I  +GW
Sbjct  447  RKDRHEATGIVLHNCTISADPTLSSASTTTVSYLGRPWKEYSRTIIMQSQIDGLINEDGW  506

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL  C+Y E GN G G+  +KR  W G K +++  HA  +   +FI G TW+P
Sbjct  507  QPWLGEFGLKTCFYTEIGNRGPGAATTKRVTWKGYK-KVDLTHAHKYTVQQFIQGKTWLP  565

Query  285  ATKVPYAAGL  256
             T VP+  GL
Sbjct  566  KTGVPFTPGL  575



>ref|XP_010449868.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 43 [Camelina sativa]
Length=691

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 5/189 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDC I+GTIDFVFG+A AVFQNC  +IR+P+ N    Q C+VTAQG
Sbjct  508  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDN----QQCIVTAQG  563

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+I     Y    +   +FLGRPW+++SRT+I+N++ID  I PEGW
Sbjct  564  RKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGW  623

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS  ++R KW GI+ RI+   A  F+PG F+ G+TWIP
Sbjct  624  LKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIR-RISPRAAREFSPGNFLRGNTWIP  682

Query  285  ATKVPYAAG  259
             T++PY A 
Sbjct  683  QTRIPYNAN  691



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH  RQFYRDCT++GTIDF+FG+AAA+FQ CT ++RKPL N    Q C+VTA G
Sbjct  388  YQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQGCTFLVRKPLPN----QQCIVTAHG  443

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ ++I N  I +            SFLGRPW+++SRT+I+ S I   I PEGW
Sbjct  444  RKERRQPSALIIQNCSIKADKDLAPVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGW  503

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G WGL  C+Y E+ N G GS  SKR KW GIK  I   HA  F  G+F++GD WI 
Sbjct  504  LPWAGDWGLKTCFYTEYNNYGPGSNKSKRVKWRGIKT-ITPQHALDFTAGRFVMGDRWIK  562

Query  285  ATKVPYAAGL  256
             T VPY +G+
Sbjct  563  PTGVPYVSGM  572



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   218 bits (555),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVHAHRQFYRDCTITGTIDF+FG++A VFQNC +++RKPL N    Q C+VTAQG
Sbjct  358  YQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCLILVRKPLDN----QQCIVTAQG  413

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  EPTGIV+ N  I+++  Y    +   S+LGRPW+  SRT+I+ S+ID  I+PEGW
Sbjct  414  RNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLISPEGW  473

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL  C+Y E+GN G  S  + R  W GIK +I   H   F  G+FI G  W+ 
Sbjct  474  LPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIK-QITGQHVNDFTVGRFISGHLWLG  532

Query  285  ATKVPYAAGL  256
            A+ VPY + +
Sbjct  533  ASGVPYTSDM  542



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 127/190 (67%), Gaps = 7/190 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AAAVFQNC +++RKPL N    Q+CMVTA G
Sbjct  389  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHG  444

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R     P+ +++ N  I+   GY    +   ++LGRPW+ ++R +++ S+ID  IAPEGW
Sbjct  445  RLDMRSPSALILQNCTISGERGYNKELNK--AYLGRPWKSYARAIVMQSQIDDVIAPEGW  502

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT     CW+ EFGN G G+ LSKR  W G+K ++   HA  F  GKF+ GD WI 
Sbjct  503  MDWTGTANHNTCWFSEFGNRGVGAELSKRVTWSGMK-KLTPEHAADFTAGKFMFGDRWIL  561

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  562  PSGVPYVAGM  571



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+HRQFYRDCTI+GT+DF+FG+   V QNC +++RKP+ N    QSCM+TAQG
Sbjct  386  YQDTLYVHSHRQFYRDCTISGTVDFIFGDGKVVLQNCNIVVRKPMKN----QSCMITAQG  441

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG+V+ N  I   P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  442  RTDVRESTGLVLHNCHIMGEPEYIPVKSINKAYLGRPWKEFSRTIIMRTNIDNVIDPAGW  501

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L+  +Y EF NTG GS  S+R KWPGIK +++   A  F P +F+ G+ WIP
Sbjct  502  LPWDGDFALSTLYYAEFENTGPGSDQSQRVKWPGIK-KLSPKQALRFTPARFLRGNLWIP  560

Query  285  ATKVPYAAGL  256
              +VPY   L
Sbjct  561  PNRVPYMGNL  570



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQFYRDC ++GTIDFVFG+AAAVFQNC  ++R+P+ N    Q C+VTAQG
Sbjct  393  YQDTLYTHAKRQFYRDCNVSGTIDFVFGDAAAVFQNCRFIVRRPMDN----QQCIVTAQG  448

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ I+I N    + P Y      + ++LGRPW++ SRT+I+ S ID  I P GW
Sbjct  449  RKERRQPSAIIIQNGTFVADPDYYPVRFELPAYLGRPWKEFSRTIIMESFIDDLIQPRGW  508

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVL-SKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
             P+ G +GL  C+Y EFGN G G+V  S+RAKW G+K  I   HA  F PG F  GD WI
Sbjct  509  LPWAGDFGLRTCFYTEFGNRGPGAVEPSRRAKWKGVKN-ITAKHARDFTPGSFFKGDWWI  567

Query  288  PATKVPYAAGL  256
              T +PY +G+
Sbjct  568  KRTGIPYVSGM  578



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 125/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH  RQFYRDCT++GTIDF+FG+AAA+FQ+CT ++RKPL N    Q C+VTA G
Sbjct  388  YQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQSCTFLVRKPLPN----QQCIVTAHG  443

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+ ++I N                 SFLGRPW+++SRT+I+ S I   I PEGW
Sbjct  444  RKERRQPSALIIQNCSFKPHADLVPVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGW  503

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G WGL  C+Y E+ N G GS  SKR KW GIK  I   HA  F PG+F+ GD WI 
Sbjct  504  LPWAGDWGLRTCFYTEYNNYGPGSDKSKRVKWRGIKN-ITPQHAVDFTPGRFLKGDRWIK  562

Query  285  ATKVPYAAGL  256
             T VPY +GL
Sbjct  563  PTGVPYVSGL  572



>emb|CDY71928.1| BnaCnng75130D, partial [Brassica napus]
Length=371

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+HRQFYRD TI+GT+DF+FG++ A+FQNC +++RKP+     GQ CMVTAQG
Sbjct  186  YQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPM----GGQGCMVTAQG  241

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPT IV+ N +I   P Y    +   ++LGRPW++ +RT+++ + I   I P GW
Sbjct  242  RTDVREPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGW  301

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            S + G + L   +Y E+ N+G GS  ++R KWPGI+ RI +  A GFAPG+F+ G +WIP
Sbjct  302  SAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQ-RITRPQALGFAPGRFLSGGSWIP  360

Query  285  ATKVPYAAGL  256
             T VPY   L
Sbjct  361  QTGVPYLPNL  370



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+HRQF+RDCTI+GT+DF+FG+A  V QNC +++RKP+     GQSCM+TAQG
Sbjct  387  YQDTLYVHSHRQFFRDCTISGTVDFIFGDAKVVLQNCNIVVRKPM----KGQSCMITAQG  442

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E +G+V+ N  IT  P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  443  RTDVRESSGLVLQNCHITGEPAYLPVKSINKAYLGRPWKEFSRTIIMGTTIDNIIDPAGW  502

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E+ N G GS  ++R KWPGIK +I+   A  F P +F+ G+ WIP
Sbjct  503  LPWNGDFALNTLYYAEYENNGPGSDQAQRVKWPGIK-KISPKQARRFTPARFLRGNLWIP  561

Query  285  ATKVPYAAGL  256
              +VPY   L
Sbjct  562  PNRVPYMGNL  571



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH++RQF+RDCTITGTIDF+FG+AAAVFQNC +++RKP+ N    Q+CMVTAQG
Sbjct  358  YQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCQMIVRKPMDN----QACMVTAQG  413

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R       GIV+ N QI +   +  +  PI ++LGRPW++ SRT+I+ S+ID  IAPEGW
Sbjct  414  RKDHRGVGGIVMQNCQIKAEHDFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIAPEGW  473

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G + L   +Y E+ N G GS+   R  W G +  I    A  F P  FI+GD W+ 
Sbjct  474  SPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPAVFIMGDEWVK  533

Query  285  ATKVPYAAGL  256
             + VPY  G+
Sbjct  534  LSGVPYEPGM  543



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 132/190 (69%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH  RQFYR C + GT+DF+FG+A AV QNC + +R+P+    S Q+ ++TAQG
Sbjct  349  YQDTLYVHTQRQFYRSCDVYGTVDFIFGDAVAVLQNCNIYVRRPM----SNQANVITAQG  404

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  +E TGI I NS++ ++P  +   S   ++LGRPWR++SRTV + + +D  I PEGW
Sbjct  405  RSDQNENTGISIHNSRVMAAPDLRPVQSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGW  464

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP++G +GL+  +YGE+ NTG G+    R KW G     + A A+ F  G+F++GD+WIP
Sbjct  465  SPWKGDFGLSTLYYGEYMNTGSGASTRGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIP  524

Query  285  ATKVPYAAGL  256
             T VPYA+GL
Sbjct  525  TTGVPYASGL  534



>emb|CAN77092.1| hypothetical protein VITISV_026596 [Vitis vinifera]
Length=507

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 131/190 (69%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH  RQFYR C + GT+DF+FG+A AV QNC + +R+P+ N    Q  ++TAQG
Sbjct  322  YQDTLYVHTQRQFYRSCDVYGTVDFIFGDAVAVLQNCNIYVRRPMSN----QPNVITAQG  377

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  +E TGI I NS++ ++P  +   S   ++LGRPWR++SRTV + + +D  I PEGW
Sbjct  378  RSDQNENTGISIHNSRVMAAPDLRPVQSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGW  437

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP++G +GL+  +YGE+ NTG G+    R KW G     + A A+ F  G+F++GD+WIP
Sbjct  438  SPWKGDFGLSTLYYGEYMNTGSGASTRGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIP  497

Query  285  ATKVPYAAGL  256
             T VPYA+GL
Sbjct  498  TTGVPYASGL  507



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 124/186 (67%), Gaps = 5/186 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLY  A RQF RDC+++GTIDFVFG+A+AVFQNC  +IRKPL N    Q C+VTAQG
Sbjct  391  HQDTLYTDAKRQFSRDCSVSGTIDFVFGHASAVFQNCKFLIRKPLEN----QQCIVTAQG  446

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +P+ IVI NS IT+ P          S+LGRPW++ SRT+I+ S ID  I PEGW
Sbjct  447  RKMRRQPSAIVIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGW  506

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ GT+GL  CWY EF N G GS  + R KW GIK  I++ HA  F PG+F  G  WI 
Sbjct  507  LPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIKT-IDRQHALDFTPGRFFKGGAWIK  565

Query  285  ATKVPY  268
             T +PY
Sbjct  566  TTGIPY  571



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+ H HRQFYRDCTITGTIDF+FG+AAAVFQNC +++RKPL N    Q+C+VTAQG
Sbjct  382  YQDTLFAHTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLEN----QNCVVTAQG  437

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R ++ E TG V+ N  IT+ P Y        ++LGRPW+++SRTV +  +ID  I P+GW
Sbjct  438  RNESREATGFVLQNCNITADPEYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLIDPKGW  497

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L    Y E+ N G GSV   R  W GIK +++   A  F   KFI GD WIP
Sbjct  498  LPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIK-KLSAQDAAAFTVAKFIGGDLWIP  556

Query  285  ATKVPYAAGL  256
            AT V YA+G+
Sbjct  557  ATGVSYASGM  566



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H++RQFY+DCTITGTIDF+FG+A+ VFQNC +++RKP    G  Q+CMVTAQG
Sbjct  375  YQDTLYTHSYRQFYKDCTITGTIDFIFGDASVVFQNCKMIVRKP----GDNQACMVTAQG  430

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        IV+ N  I + P + ++  PI ++LGRPW+++SRT+II S IDA I PEGW
Sbjct  431  RKDHRGVGAIVLQNCDIRAEPAFTSAQPPIKAYLGRPWKEYSRTIIIQSYIDAFIDPEGW  490

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ G + L   +Y E+ N G G+ + KR KW G K  I+   AE +AP  FI  D WI 
Sbjct  491  APWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQDNWIK  550

Query  285  ATKVPYA  265
             T + YA
Sbjct  551  KTGISYA  557



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 125/190 (66%), Gaps = 7/190 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AAAVFQNC +++RKPL N    Q+CMVTA G
Sbjct  391  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHG  446

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R     P+ +++ N  I+   GY    +   ++LGRPW   +R +++ S+ID  IAPEGW
Sbjct  447  RLDMRSPSALILQNCTISGERGYDKELNK--AYLGRPWTSLARAIVMQSQIDDVIAPEGW  504

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT     CW+GEFGN G G+ LSKR  W G+K ++    A  F  GKFI GD WI 
Sbjct  505  MEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMK-KLTPEQAADFTAGKFIFGDRWIL  563

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  564  PSGVPYVAGM  573



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AA VFQNC +++RKP+ N    Q+CMVTAQG
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQG  443

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +PT +V+ N  I+  P Y        ++LGRPW+  +RT+++ S+ID  I PEGW
Sbjct  444  RMDRRQPTAMVLQNCTISGDPEYILVKDKSKAYLGRPWKALARTIVMQSQIDDIITPEGW  503

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G+     CW+GE+GN G GS +++R  W GIK ++   HA  F  G+ + GD WI 
Sbjct  504  MEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIK-KLTPEHAVDFTAGRLMEGDKWIK  562

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  563  PSGVPYVAGM  572



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 125/190 (66%), Gaps = 7/190 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AAAVFQNC +++RKPL N    Q+CMVTA G
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHG  443

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R     P+ +++ N  I+   GY    +   ++LGRPW   +R +++ S+ID  IAPEGW
Sbjct  444  RLDMRSPSALILQNCTISGERGYDKELNK--AYLGRPWTSLARAIVMQSQIDDVIAPEGW  501

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT     CW+GEFGN G G+ LSKR  W G+K ++    A  F  GKFI GD WI 
Sbjct  502  MEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMK-KLTPEQAADFTAGKFIFGDRWIL  560

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  561  PSGVPYVAGM  570



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 126/186 (68%), Gaps = 4/186 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H++RQFY+DCTITGTIDF+FG+A+AVFQNC +++RKP    G  Q+CMVTAQG
Sbjct  375  YQDTLYTHSYRQFYKDCTITGTIDFIFGDASAVFQNCKMIVRKP----GDNQACMVTAQG  430

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        IV+ N  I + P + ++  PI ++LGRPW+++SRT+I+ S IDA I PEGW
Sbjct  431  RKDHRGVGAIVLQNCDIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQSYIDAFIDPEGW  490

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ G + L   +Y E+ N G G+ + KR KW G K  I+   AE +AP  FI  D WI 
Sbjct  491  APWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQDNWIK  550

Query  285  ATKVPY  268
             T + Y
Sbjct  551  KTGISY  556



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDCTI+GTIDF+FG+AA VFQNC +++RKP+ N    Q+CMVTAQG
Sbjct  388  YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQG  443

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +PT +V+ N  I+  P Y        ++LGRPW+  +RT+++ S+ID  I PEGW
Sbjct  444  RMDRRQPTAMVLQNCTISGDPEYIPVKDKSKAYLGRPWKALARTIVMQSQIDDIITPEGW  503

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G+     CW+GE+GN G GS +++R  W GIK ++   HA  F  G+ + GD WI 
Sbjct  504  MEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIK-KLTPEHAVDFTAGRLMEGDRWIK  562

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  563  PSGVPYVAGM  572



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL+N    Q+C +TA G
Sbjct  378  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLLN----QACPITAHG  433

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+    I   P Y        ++LGRPW+++SRT+I+N+ I   + PEGW
Sbjct  434  RKDPRESTGFVLQGCTIVGEPDYLAVKEQSKTYLGRPWKEYSRTIIMNTFIPDFVPPEGW  493

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ ++KR  WPGIK +++      F P ++I GD WIP
Sbjct  494  QPWLGEFGLNTLFYSEVQNTGPGAAITKRVTWPGIK-KLSDEEILKFTPAQYIQGDAWIP  552

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  553  GKGVPYILGL  562



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL+N    Q+C +TA G
Sbjct  377  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLLN----QACPITAHG  432

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+    I   P Y        ++LGRPW+++SRT+I+N+ I   I PEGW
Sbjct  433  RKDPRESTGFVLQGCTIVGEPDYLAVKENSKAYLGRPWKEYSRTIIMNTFIPDFIPPEGW  492

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ ++KR  WPGIK ++++     F P ++I GD WIP
Sbjct  493  QPWLGDFGLNTLFYSEVQNTGPGAPITKRVTWPGIK-KLSEEEILTFTPAQYIQGDAWIP  551

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  552  GKGVPYIPGL  561



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 128/188 (68%), Gaps = 5/188 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDC I+GTIDFVFG+A AVFQNC  ++R+P+ N    Q C+VTAQG
Sbjct  402  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCQFVVRRPMEN----QQCIVTAQG  457

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI  S+I   P Y    +   ++LGRPW+++SRTVI+NS ID  I PEGW
Sbjct  458  RKDRRETTGIVIHKSRIMGDPTYLPVKTKNRAYLGRPWKEYSRTVIMNSLIDDIIDPEGW  517

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ NTG GS  + R +W GI+  ++ + A  + P  F+ G+TWIP
Sbjct  518  MKWNETFALDTLYYAEYQNTGPGSDQAGRVRWNGIQ-HLSDSAATQYTPDNFLRGNTWIP  576

Query  285  ATKVPYAA  262
             T+VPYAA
Sbjct  577  KTRVPYAA  584



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY+H+HRQFYRDCTI+GT+DF+FG+   V Q C +++RKP+     GQSCM+TAQG
Sbjct  385  YQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPM----KGQSCMITAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG+V+ N  IT  P Y    S   ++LGRPW+Q SRT+I+ + ID  + P GW
Sbjct  441  RTDERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIDDVVDPAGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L   +Y E+ N G GS  S+R KWPGIK +++   A  F P +F+ G+ WIP
Sbjct  501  LPWNGSFALNTLYYAEYENNGPGSDQSQRVKWPGIK-KLSPKQALRFTPARFLRGNLWIP  559

Query  285  ATKVPYAAGL  256
             T+VPY   +
Sbjct  560  PTRVPYMGSM  569



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQ+TLYVH+HRQFYRDCT++GT+DF+FG+A  + QNC +++RKP       QSCMVTAQG
Sbjct  381  YQNTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----KRSQSCMVTAQG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   EPTGIV+ N  I   P Y    S   ++LGRPWRQ SRT+I+ + ID  I P GW
Sbjct  437  RSDVREPTGIVLHNCHIVGDPAYIPVKSRNKAYLGRPWRQFSRTIIMKTTIDDVIDPAGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +QG   L   +Y E  N G GS  ++R KWPG+K +++   A  F   +F+LGDTWIP
Sbjct  497  LLWQGESALKTLFYAEHLNIGPGSNQAQRVKWPGLK-KLSPEEALMFTGNRFLLGDTWIP  555

Query  285  ATKVPYAAGL  256
             T VPY A +
Sbjct  556  QTHVPYTANM  565



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   208 bits (529),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDCT++GT+DF+FG++  + QNC +++RKP+    +GQSCMVTAQG
Sbjct  375  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCKIVVRKPM----AGQSCMVTAQG  430

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   EPTGIV+ N  I   P Y    +   ++LGRPW++ SRT++I + +D  I P GW
Sbjct  431  RSDVREPTGIVVHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRTIVIKTTVDDVIDPAGW  490

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  N G G+  ++R KWPGIK ++    A  +   +F+ G+TWIP
Sbjct  491  LPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIK-KLTHEQALSYTCDRFLSGNTWIP  549

Query  285  ATKVPYAAGL  256
             T+VPY AG+
Sbjct  550  RTQVPYTAGM  559



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   209 bits (533),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQF+RDCTI+GTIDF+FG++A VFQNCTL++RKPL N    Q+C +TA G
Sbjct  380  YQDTLYTHSHRQFFRDCTISGTIDFLFGDSATVFQNCTLLVRKPLPN----QACPITAHG  435

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPTG V    +I   P Y    +   ++LGRPW+++SRT+I+N+ I   + P+GW
Sbjct  436  RQDPREPTGFVFQGCRIEGEPDYLAVKASSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGW  495

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+   +GL   +Y E  NTG GS L+ R  W GIK ++     + F P KFI GD+WIP
Sbjct  496  QPWNADFGLKTLFYSEIQNTGPGSDLASRVTWAGIK-KLTSKDIDQFTPAKFIQGDSWIP  554

Query  285  ATKVPYAAGL  256
            AT VPY  GL
Sbjct  555  ATGVPYTPGL  564



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQF+RDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  383  YQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  438

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPTG V    QI   P Y +  +   ++LGRPW+ +SRT+I+N+ I   + P+GW
Sbjct  439  RQDPREPTGFVFQGCQIAGEPDYLSVKATSKAYLGRPWKAYSRTIIMNTFIPDFVQPQGW  498

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL+  +Y E  NTG GS +  R  W GIK   N    + F P +FI GD+WIP
Sbjct  499  QPWNGDFGLSTLFYSEIQNTGPGSDVVNRVTWAGIKKLTNNDLLQ-FTPAQFIQGDSWIP  557

Query  285  ATKVPYAAGL  256
            AT VPY  G 
Sbjct  558  ATGVPYTPGF  567



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQ+TL+ H +RQFYR+CTITGTIDF+ G+AAAVFQNC +++RKPL N    Q C +TAQG
Sbjct  392  YQNTLFSHTYRQFYRECTITGTIDFISGDAAAVFQNCKMVVRKPLEN----QRCTITAQG  447

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPTG V+ N  IT+   Y        SFLGRPW+ +SRT+++ S ID  I P+GW
Sbjct  448  RNNTREPTGFVLQNCTITAEKDYLPVKLDSPSFLGRPWKPYSRTIVMQSSIDDIIDPKGW  507

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ GT+G+  C   E+GN G G+ L+ R  W GI  +++   AE F  GKF+ GD+WI 
Sbjct  508  APWMGTFGIDTCSLSEYGNRGPGATLTSRVTWKGIV-KLSPQDAEAFTAGKFLEGDSWIA  566

Query  285  ATKVPYAAGL  256
            AT VPY +G+
Sbjct  567  ATGVPYTSGM  576



>gb|AAQ21125.1| pectinesterase [Fragaria x ananassa]
Length=193

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYRDC I GT+DF+FG+A+A+ QNC + +RKP     S Q   VTAQ 
Sbjct  8    YQDTLYVYSQRQFYRDCNIYGTVDFIFGDASAILQNCNIYVRKP----SSNQINTVTAQS  63

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI+I N +IT++P  +       ++LGRPW+++SR VI+ S +D  IAP+GW
Sbjct  64   RRDPNENTGIIIHNCRITAAPDLRAVQGSFRTYLGRPWQKYSRVVIMKSNLDGLIAPQGW  123

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++GL   +YGE+ NTG G+    R KWPG +   +   A  F  G F+ GD W+P
Sbjct  124  FPWSGSFGLDTLYYGEYMNTGAGAATGGRVKWPGFRVITSATEAGKFTVGNFLAGDAWLP  183

Query  285  ATKVPYAAGL  256
             T VP+ AGL
Sbjct  184  GTGVPFEAGL  193



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY+H+HRQFYRDCTI+GT+DF+FG+   V Q C +++RKP+     GQSCM+TAQG
Sbjct  385  YQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPM----KGQSCMITAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG+V+ N  IT  P Y    S   ++LGRPW+Q SRT+I+ + I+  + P GW
Sbjct  441  RTNERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L   +Y E+ N G GS  S+R KWPGIK +++   A  F P +F+ G+ WIP
Sbjct  501  LPWNGSFALNTLYYAEYENNGLGSDQSQRVKWPGIK-KLSPKQALRFTPARFLRGNLWIP  559

Query  285  ATKVPYAAGL  256
             T+VPY   +
Sbjct  560  PTRVPYMGNM  569



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDCT++GT+DF+FG+A  + QNC +++RKP      GQSCMVTAQG
Sbjct  385  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKP----KRGQSCMVTAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V+ N  I   P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  441  RSDVRESTGLVLHNCHIMGEPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G + L   +Y E  N G GS  + R KWPGIK +++   A  +  G+F++GDTWIP
Sbjct  501  LPWKGDFALKTLYYAEHLNAGPGSNEALRVKWPGIK-KLSPEEALLYTGGRFLVGDTWIP  559

Query  285  ATKVPYAAGL  256
             T+VPY+A +
Sbjct  560  QTQVPYSANM  569



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H HRQFYRDCTITGTIDF+FG+AAAVFQNC +++RKPL N    Q+C+VTAQG
Sbjct  382  YQDTLYAHTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLEN----QNCIVTAQG  437

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R ++ E TG V+ N  IT+   Y        ++LGRPW+++SRTV +  +ID  I P+GW
Sbjct  438  RNESREATGFVLQNCNITADREYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLIDPKGW  497

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L    Y E+ N G GSV   R  W GIK +++   A+ F   KFI GD WIP
Sbjct  498  LPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIK-KLSAQDADAFTVAKFIGGDLWIP  556

Query  285  ATKVPYAAGL  256
             T + YA+G+
Sbjct  557  DTGISYASGM  566



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDCT++GT+DF+FG+A  + QNC +++RKP      GQSCMVTAQG
Sbjct  385  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKP----KRGQSCMVTAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V+ N  I   P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  441  RSDVRESTGLVLHNCHIMGDPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G + L   +Y E  N G GS  + R KWPGIK +++   A  +  G+F++GDTWIP
Sbjct  501  LPWKGDFALKTLYYAEHLNAGPGSNEALRVKWPGIK-KLSPEEALLYTGGRFLVGDTWIP  559

Query  285  ATKVPYAAGL  256
             T+VPY+A +
Sbjct  560  QTQVPYSANM  569



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 127/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  317  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  372

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+    I   P Y T      S+LGRPW+++SRT+ +N+ I   I PEGW
Sbjct  373  RKDPRESTGFVLQGCTIAGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFIPPEGW  432

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  NTG G+ ++KR  WPGIK ++++     F P ++I GD WIP
Sbjct  433  QPWLGNFALDTLFYSEVRNTGPGAGVTKRVTWPGIK-KLSEEEILKFTPAEYIQGDAWIP  491

Query  285  ATKVPYAAGLNP  250
               VPY  GL P
Sbjct  492  GKGVPYIPGLFP  503



>gb|KEH15723.1| pectinesterase [Medicago truncatula]
Length=228

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYV+A+RQFYRDC I GTIDF+FGNA  V QNC + +RKP+    S Q   VTAQG
Sbjct  43   FQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPM----SNQQNTVTAQG  98

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGIVI N +IT+S   K   + + ++LGRPW+++SRTV++ S +D  I  EGW
Sbjct  99   RTDPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGW  158

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ G + L+  +YGE+ N G G+    R KWPG     N + A  F+ G F+ GD+WI 
Sbjct  159  APWMGGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWIS  218

Query  285  ATKVPYAAGL  256
             + VP+ AGL
Sbjct  219  GSGVPFDAGL  228



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 129/186 (69%), Gaps = 4/186 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H++RQFY+DC+I+GTIDF+FG+A+AVFQNC +++RKP    G+ Q+CMVTAQG
Sbjct  371  YQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVRKP----GNNQACMVTAQG  426

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        IV+ N +I + P + ++  PI ++LGRPW+++SRT+I+ ++IDA I PEGW
Sbjct  427  RKDHRGVGAIVLRNCEIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQTQIDAFIDPEGW  486

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ G + L   +Y E+ N G G+   KR KW G K  I+   AE +AP  FI  D+WI 
Sbjct  487  APWNGNFALNTLYYAEYQNRGPGANTDKRVKWAGYKRNISPQEAEKYAPNIFIDQDSWIK  546

Query  285  ATKVPY  268
             T + Y
Sbjct  547  KTGISY  552



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 129/186 (69%), Gaps = 4/186 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H++RQFY+DC+I+GTIDF+FG+A+AVFQNC +++RKP    G+ Q+CMVTAQG
Sbjct  367  YQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVRKP----GANQACMVTAQG  422

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        I++ N +I++ P +  +  PI ++LGRPW+++SRT+I+ S+IDA I PEGW
Sbjct  423  RKDHRGVGAIILRNCEISAEPAFINTQPPIKAYLGRPWKEYSRTIIMQSQIDAFIDPEGW  482

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ G + L   +Y E+ N G G+   +R KW G K  I+   AE +AP  FI  D+WI 
Sbjct  483  APWNGNFALNTLYYAEYQNRGPGANTDRRVKWAGYKKSISPQEAEKYAPNIFIDQDSWIK  542

Query  285  ATKVPY  268
             T + Y
Sbjct  543  KTGISY  548



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 125/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  376  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  431

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+    I   P Y        S+LGRPW++ SRT+I+N+ I   I PEGW
Sbjct  432  RKDPRESTGFVLQGCTIVGEPDYLAVKETSKSYLGRPWKEFSRTIIMNTFIPDFIPPEGW  491

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  N G GS L+KR  WPGIK ++++     F P ++I GD WIP
Sbjct  492  QPWLGNFGLETLFYSEVRNIGPGSGLTKRVTWPGIK-KLSEEEILTFTPAQYIQGDAWIP  550

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  551  GKGVPYIPGL  560



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTID++FG+A + FQNC +++RKP+     GQSCMVTAQG
Sbjct  387  YQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCKMVVRKPM----GGQSCMVTAQG  442

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGI++ N +I   P Y    S   ++LGRPW++ SRT+I+ + ID  I P+GW
Sbjct  443  RTDKRESTGIILHNCRIMGDPAYIPVKSTNKAYLGRPWKEFSRTIIMRTTIDDIIDPKGW  502

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L    YGE+ N G GS    R KWPGIK +++   A  F  G+F+ G+TWIP
Sbjct  503  LEWNGNFALDTLEYGEYENNGSGSGQEMRVKWPGIK-KLSARQALQFTAGRFLRGNTWIP  561

Query  285  ATKVPYAAGL  256
              +VPY   +
Sbjct  562  RRRVPYTPNM  571



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDCT++GT+DF+FG++  + QNC +++RKP+    +GQSCMVTAQG
Sbjct  376  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCKIVVRKPM----AGQSCMVTAQG  431

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   EPTGIV+ N  I   P Y    +   ++LGRPW++ SRT+++ + +D  I P GW
Sbjct  432  RSDVREPTGIVLHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRTIVMKTIVDDVIDPAGW  491

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  N G G+  ++R KWPGIK ++    A  +   +F+ G+TWIP
Sbjct  492  LPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIK-KLTPEQALSYTGDRFLSGNTWIP  550

Query  285  ATKVPYAAGL  256
             T+VPY AG+
Sbjct  551  RTQVPYTAGM  560



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   208 bits (530),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 128/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQ+CTL++RKPL N    Q+C +TA G
Sbjct  378  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQSCTLLVRKPLPN----QACPITAHG  433

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+    I   P Y T      S+LGRPW+++SRT+ +N+ I   I PEGW
Sbjct  434  RKDPRESTGFVLQGCTIVGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFIPPEGW  493

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E GNTG G+ ++KR  WPGIK ++++       P ++I GD WIP
Sbjct  494  QPWLGNFGLETLFYSEVGNTGPGADVTKRVTWPGIK-KLSEEEILKITPAEYIQGDAWIP  552

Query  285  ATKVPYAAGLNP  250
               VPY  GL P
Sbjct  553  GKGVPYIPGLFP  564



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H++RQFYR CT++GTIDF+FGNAAAVFQNC L+IRKPL + G    C++TAQ 
Sbjct  402  YQDTLYAHSYRQFYRHCTVSGTIDFIFGNAAAVFQNCKLVIRKPLEDEG----CVITAQA  457

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPTG ++ N  I + P Y        +FLG PW++ SRT+I+ S +   IAPEGW
Sbjct  458  RQHVREPTGFILQNCTIMADPLYYPLRLKSKAFLGHPWKKFSRTIIMQSFLPDSIAPEGW  517

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ GT+G + C++ E+ N G G+ L  R KW GIK +I    A+GF P KF  G+ WI 
Sbjct  518  KPWMGTFGQSSCFFSEYENRGPGAALLGRVKWHGIK-KITPQQADGFTPSKFYQGNHWII  576

Query  285  ATKVPYAAGL  256
             T VPY  G+
Sbjct  577  PTGVPYEPGM  586



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVHAHRQFYRDCTI+GT+DF+FG+A ++FQNC +++RKP+     GQSC+VTAQG
Sbjct  382  YQDTLYVHAHRQFYRDCTISGTVDFIFGDAKSLFQNCNIVVRKPM----GGQSCIVTAQG  437

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIV+ N +IT  P Y    +   ++LGRPW+  SRT+++ + ID  I P GW
Sbjct  438  RTDVRESTGIVLHNCRITGEPAYIPVKAVNKAYLGRPWKVFSRTIVMMTNIDNVIDPAGW  497

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E+ N+G GS  ++R  W GIK  I+   A  F P +F+ G+ WIP
Sbjct  498  LPWDGDFALNTLYYAEYQNSGPGSNQAQRVNWAGIKN-ISPRQALKFTPARFLRGNLWIP  556

Query  285  ATKVPYAAGL  256
             T VPY   +
Sbjct  557  QTHVPYTPNM  566



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY+H+HRQFYRDCTI+GT+DF+FG+   V Q C +++RKP+      QSCM+TAQG
Sbjct  385  YQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPM----KSQSCMITAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG+V+ N  IT  P Y    S   ++LGRPW+Q SRT+I+ + I+  + P GW
Sbjct  441  RTDERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L   +Y E+ N G GS  S+R KWPGIK +++   A  F P +F+ G+ WIP
Sbjct  501  LPWNGSFALNTLYYAEYENNGLGSDQSQRVKWPGIK-KLSPKQALRFTPARFLRGNLWIP  559

Query  285  ATKVPYAAGL  256
             T+VPY   +
Sbjct  560  PTRVPYMGSM  569



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTID++FG+A + FQNC +++RKP+     GQSCMVTAQG
Sbjct  386  YQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPM----GGQSCMVTAQG  441

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIV+ N +IT  P Y        ++LGRPW+Q SRT+I+ + I+  I P+GW
Sbjct  442  RTDKRETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGW  501

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L    Y EF N G GS  + R KWPGIK +     A  F  GKF+ G TWIP
Sbjct  502  LEWNGNFALDTLEYAEFENKGPGSNQATRVKWPGIK-KFTPRQAGEFTAGKFLQGGTWIP  560

Query  285  ATKVPYAAGL  256
             T+VPY   +
Sbjct  561  QTQVPYLGNM  570



>emb|CDY40719.1| BnaC03g34350D [Brassica napus]
Length=448

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 127/196 (65%), Gaps = 8/196 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  79   YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  134

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+ A E TG V     I   P Y    +   ++LGRPWR+ SRT+I+NS +   + P+GW
Sbjct  135  RSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGW  194

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  W GIK   N+   + F P +FI G  W+P
Sbjct  195  MPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKTLSNEEILK-FTPDQFIQGGIWVP  253

Query  285  ATKVPYAAGL---NPN  247
               VPY  GL   NPN
Sbjct  254  GKGVPYTPGLLAANPN  269



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 125/186 (67%), Gaps = 5/186 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+HRQF+RDCT++GT+DF+FG+   V QNC +++RKP+      QSCM+TAQG
Sbjct  386  YQDTLYVHSHRQFFRDCTVSGTVDFIFGDGIVVLQNCNIVVRKPM----KSQSCMITAQG  441

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V+ N  IT  P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  442  RSDKRESTGLVLQNCHITGEPAYIPVKSINKAYLGRPWKEFSRTIIMGTTIDDVIDPAGW  501

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E+ N G GS  ++R KWPGIK +++   A  F P +F+ G+ WIP
Sbjct  502  LPWNGDFALNTLYYAEYENNGPGSNQAQRVKWPGIK-KLSPKQALRFTPARFLRGNLWIP  560

Query  285  ATKVPY  268
              +VPY
Sbjct  561  PNRVPY  566



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYVH+HRQFYRDCT++GT+DF+FG+A  + QNC +++RKP      GQSCMVTAQG
Sbjct  386  HQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----NKGQSCMVTAQG  441

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V+    IT  P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  442  RSNVRESTGLVLHGCHITGDPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGW  501

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  NTG GS  ++R KWPGIK ++    A  +   +F+ GDTWIP
Sbjct  502  LPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIK-KLTPQDALLYTGDRFLRGDTWIP  560

Query  285  ATKVPYAAGL  256
             T+VPY A +
Sbjct  561  QTQVPYTANI  570



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+HRQFYRD TI+GT+DF+FG++ A+FQNC +++RKP+     GQ CMVTAQG
Sbjct  385  YQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPM----GGQGCMVTAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R     PT IV+ N +I   P Y    +   ++LGRPW++ +RT+++ + I   I P GW
Sbjct  441  RTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            + + G + L   +Y E+ N+G GS  ++R KWPGI+ RI +  A GFAPG+F+ G +WIP
Sbjct  501  AAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQ-RITRPQALGFAPGRFLRGGSWIP  559

Query  285  ATKVPYAAGL  256
             T VPY   L
Sbjct  560  QTGVPYLPNL  569



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTID++FG+A + FQNC +++RKP+     GQSCMVTAQG
Sbjct  399  YQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPM----GGQSCMVTAQG  454

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIV+ N +IT  P Y        ++LGRPW+Q SRT+I+ + I+  I P+GW
Sbjct  455  RTDKRETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGW  514

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L    Y EF N G GS  + R KWPGIK +     A  F  GKF+ G TWIP
Sbjct  515  LEWNGNFALDTLEYAEFENKGPGSNQATRVKWPGIK-KFTPRQAGEFTAGKFLQGGTWIP  573

Query  285  ATKVPYAAGL  256
             T+VPY   +
Sbjct  574  QTQVPYLGNM  583



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 130/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDCTI+GTIDF+FG++A++FQNC ++ RKPL N    Q  +VTAQG
Sbjct  365  YQDTLYVHTHRQFYRDCTISGTIDFIFGDSASIFQNCLILARKPLDN----QQNIVTAQG  420

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    + + I++ N  I++ P Y    + + +FLGRPW+ +SRT I+ S+ID  I P+GW
Sbjct  421  RKMRQQASAIILHNCTISADPAYYDFRTKLPTFLGRPWKMYSRTFILQSQIDDLIHPDGW  480

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL  C+Y E  N G G+  SKR  W G+K  I+ AHA+ F+  +F+ G  W+P
Sbjct  481  LPWFGDFGLNTCFYTEVDNRGPGADKSKRVTWKGVKN-IDYAHAKKFSVQQFLHGGKWLP  539

Query  285  ATKVPYAAGLNP  250
             T VP+ A L P
Sbjct  540  RTGVPFTAELLP  551



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 124/193 (64%), Gaps = 5/193 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY   +RQFYRDCTITGT+DF+FG+  A+FQNC +++RKP    G  Q+CMVTAQ
Sbjct  381  AYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKP----GETQACMVTAQ  436

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   +E TGI + N  IT  P Y        ++LGRPW+  +R V++ S ID  IAPEG
Sbjct  437  GRTDHNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKNFARVVVMQSSIDEAIAPEG  496

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W+ + G     +C++GE+GNTG GS +++R KW  +K R+    A  F P +   GD WI
Sbjct  497  WTEWTGEEYHQNCFFGEYGNTGPGSDVTQRVKWSTVK-RLTPDQAAAFTPARVFEGDKWI  555

Query  288  PATKVPYAAGLNP  250
              + VPY  G+ P
Sbjct  556  KPSGVPYVPGMMP  568



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+HRQFYRD TI+GT+DF+FG++ A+FQNC +++RKP+     GQ CMVTAQG
Sbjct  385  YQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPM----GGQGCMVTAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R     PT IV+ N +I   P Y    +   ++LGRPW++ +RT+++ + I   I P GW
Sbjct  441  RTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            + + G + L   +Y E+ N+G GS  ++R KWPGI+ RI +  A GFAPG+F+ G +WIP
Sbjct  501  AAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQ-RITRPQALGFAPGRFLRGGSWIP  559

Query  285  ATKVPYAAGL  256
             T VPY   L
Sbjct  560  QTGVPYLPNL  569



>emb|CAN75818.1| hypothetical protein VITISV_005130 [Vitis vinifera]
Length=485

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH++RQF+RDC + GTIDF+FGNAA VFQNC + +RKP+    + QS M+TAQG
Sbjct  300  YQDTLYVHSNRQFFRDCHVYGTIDFIFGNAAVVFQNCDIYVRKPM----NRQSNMITAQG  355

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +EPTGI +  S++ SSP + T      SFLGRPW+++SRTV + + +D  I P GW
Sbjct  356  RDIPEEPTGISVQXSRVLSSPXFTTVKGSFKSFLGRPWKRYSRTVFLETDLDGLIDPRGW  415

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            + + G +GL+  +YGE+ N+G G+   +R KWPG         A  F   +FI G+ WIP
Sbjct  416  TEWSGNYGLSTLYYGEYNNSGGGASTKERVKWPGFHVLNGXEDAMPFTVSRFIQGEKWIP  475

Query  285  ATKVPYAAGL  256
            A+ VP++ G+
Sbjct  476  ASGVPFSPGI  485



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH +RQFY+DC I+GT+DF+FG++AAVFQ CTL++RKP+ N    Q C+VTAQG
Sbjct  361  YQDTLYVHTYRQFYKDCVISGTVDFIFGDSAAVFQGCTLVVRKPMDN----QQCIVTAQG  416

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +PTGIVI N    + P        I+S+LGRPW+++SRT+I+ S +D  I P+GW
Sbjct  417  RKDVRQPTGIVIQNCSFVADPELYPVRHKILSYLGRPWKEYSRTIIMESFLDDFIQPDGW  476

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y EF N G  +   KR KWPG+K  +  +  + F PG+F+ G+ WIP
Sbjct  477  MKWNETFALETLFYTEFNNRGPAAPKMKRVKWPGVK-ELPPSRVQRFTPGEFLDGNRWIP  535

Query  285  ATKVPYAAGL  256
             T+VPYAAG 
Sbjct  536  PTQVPYAAGF  545



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 126/196 (64%), Gaps = 8/196 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  A E TG V     I   P Y        ++LGRPW+++SRT+I+N+ I   I P+GW
Sbjct  437  RKDARESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  N G G+ L+ R  WPGIK  ++      F P ++I GD W+P
Sbjct  497  QPWLGNFGLDTLFYSEVQNIGPGAALAGRVTWPGIK-TLSDEEILSFTPDQYIQGDVWVP  555

Query  285  ATKVPYAAGL---NPN  247
               VPY  GL   +PN
Sbjct  556  GKGVPYTPGLLAADPN  571



>ref|XP_010661658.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Vitis vinifera]
 emb|CBI38889.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH++RQF+RDC + GTIDF+FGNAA VFQNC + +RKP+    + QS M+TAQG
Sbjct  300  YQDTLYVHSNRQFFRDCHVYGTIDFIFGNAAVVFQNCDIYVRKPM----NRQSNMITAQG  355

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +EPTGI +  S++ SSP + T      SFLGRPW+++SRTV + + +D  I P GW
Sbjct  356  RDIPEEPTGISVQASRVLSSPEFTTVKGSFKSFLGRPWKRYSRTVFLETDLDGLIDPRGW  415

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            + + G +GL+  +YGE+ N+G G+   +R KWPG         A  F   +FI G+ WIP
Sbjct  416  TEWSGNYGLSTLYYGEYNNSGGGASTKERVKWPGFHVLNGTEDAMPFTVSRFIQGEKWIP  475

Query  285  ATKVPYAAGL  256
            A+ VP++ G+
Sbjct  476  ASGVPFSPGI  485



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 125/191 (65%), Gaps = 7/191 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL VH +RQFYRDC I GTIDFVFG+ AAVFQNCTL +RKPL      Q C+VTAQG
Sbjct  380  YQDTLCVHTYRQFYRDCVIRGTIDFVFGDGAAVFQNCTLAVRKPL----KEQHCIVTAQG  435

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  A +PTG+V  N  I +   Y      + ++LGRPW+++SRT+I+ S ID  I PEGW
Sbjct  436  RTDARQPTGLVFQNCSIVADSSYDEVKGEVKTYLGRPWKEYSRTIIMESSIDDLIQPEGW  495

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKG-RINKAHAEGFAPGKFILGDTWI  289
              +  T+ L   +Y EF N G GS  ++RAKW G+K  +IN+   + F   +F+ GD WI
Sbjct  496  VEWNKTFALNTLFYTEFNNRGSGSSKTERAKWQGVKELQINR--VQRFTASQFLDGDAWI  553

Query  288  PATKVPYAAGL  256
            P+T +PY  G 
Sbjct  554  PSTGIPYTPGF  564



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 124/193 (64%), Gaps = 4/193 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQ+YRDCTITGTIDF+FG+ +A FQNC +++RKPL N    Q C+VTAQG
Sbjct  411  YQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDN----QHCIVTAQG  466

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +PT IVI NS I +   Y    + I S+LGRPWR HSRTVI+ + ID  I P+GW
Sbjct  467  RNVTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGW  526

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G +G+  C+Y E+GN G G+  + R  W G+K       A  F  GKF  GD WI 
Sbjct  527  LPWEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIK  586

Query  285  ATKVPYAAGLNPN  247
               VPY +G   N
Sbjct  587  PRGVPYVSGFVTN  599



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 124/193 (64%), Gaps = 4/193 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQ+YRDCTITGTIDF+FG+ +A FQNC +++RKPL N    Q C+VTAQG
Sbjct  407  YQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDN----QHCIVTAQG  462

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +PT IVI NS I +   Y    + I S+LGRPWR HSRTVI+ + ID  I P+GW
Sbjct  463  RNVTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGW  522

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G +G+  C+Y E+GN G G+  + R  W G+K       A  F  GKF  GD WI 
Sbjct  523  LPWEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIK  582

Query  285  ATKVPYAAGLNPN  247
               VPY +G   N
Sbjct  583  PRGVPYVSGFVTN  595



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDCT++GT+DF+FG+A  + QNC +++RK       GQSCMVTAQG
Sbjct  385  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKA----KRGQSCMVTAQG  440

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V+ N  I   P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  441  RSDVRESTGLVLHNCHIMGEPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGW  500

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G + L   +Y E  N G GS  + R KWPGIK +++   A  +  G+F++GDTWIP
Sbjct  501  LPWKGDFALKTLYYAEHLNAGAGSNEALRVKWPGIK-KLSPEEALLYTGGRFLVGDTWIP  559

Query  285  ATKVPYAAGL  256
             T+VPY A +
Sbjct  560  QTQVPYTANM  569



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 127/196 (65%), Gaps = 8/196 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  383  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  438

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I+  P Y        ++LGRPW+++SRT+I+N+ I   I P+GW
Sbjct  439  RKDVRESTGFVFQGCTISGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGW  498

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  WPGIK   N+   + F P ++I GD W+ 
Sbjct  499  QPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSNEEILK-FTPDQYIQGDVWVH  557

Query  285  ATKVPYAAGL---NPN  247
               VPY  GL   NPN
Sbjct  558  GKGVPYTPGLLAANPN  573



>gb|KEH21378.1| pectinesterase [Medicago truncatula]
Length=372

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYV+A+RQFYRDC I GTIDF+FGNA  V QNC + +RKP+ N    Q   VTAQG
Sbjct  187  FQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPMSN----QQNTVTAQG  242

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGIVI N +IT+S   K   + + ++LGRPW+++SRTV++ S +D  I  EGW
Sbjct  243  RTDPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGW  302

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ G + L+  +YGE+ N G G+    R KWPG     N + A  F+ G F+ GD+WI 
Sbjct  303  APWMGGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWIS  362

Query  285  ATKVPYAAGL  256
             + VP+ AGL
Sbjct  363  GSGVPFDAGL  372



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H HRQ+YRDCTI+GTIDF+FGNA A+ QNCTL++RKPL N    Q+C+VTA G
Sbjct  378  YQDTLYAHNHRQYYRDCTISGTIDFIFGNARALIQNCTLLVRKPLDN----QACVVTANG  433

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  ++E +  VI  S++ ++P Y      I SFLGRPW+++S+T+ + S+I+  I+PEGW
Sbjct  434  RTLSNETSAFVIHGSRVVAAPEYPVDDKRIQSFLGRPWKEYSKTIFMASEIEGFISPEGW  493

Query  465  SPFQGTWGLTD-CWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            SP+  T    D CWY E GN G G+ L+ R KWPGIK  I  A A  FAP  ++    WI
Sbjct  494  SPWDNTADHLDTCWYAEVGNRGPGADLTNRVKWPGIKN-ITMAEAAQFAPTMYMDSGHWI  552

Query  288  PATKVPYAAGL  256
                +P+ + L
Sbjct  553  EGKGIPFDSVL  563



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 126/188 (67%), Gaps = 5/188 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYVH+HRQFYRDCT++GT+DF+FG+A  + QNC +++RKP      GQ+CMVTAQG
Sbjct  384  HQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----NKGQTCMVTAQG  439

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V+    IT  P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  440  RSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGW  499

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  NTG GS  ++R KWPGIK ++    A  +   +F+ GDTWIP
Sbjct  500  LPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIK-KLTPQDALLYTGDRFLRGDTWIP  558

Query  285  ATKVPYAA  262
             T+VPY A
Sbjct  559  QTQVPYTA  566



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 126/188 (67%), Gaps = 5/188 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYVH+HRQFYRDCT++GT+DF+FG+A  + QNC +++RKP      GQ+CMVTAQG
Sbjct  384  HQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----NKGQTCMVTAQG  439

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V+    IT  P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  440  RSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGW  499

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  NTG GS  ++R KWPGIK ++    A  +   +F+ GDTWIP
Sbjct  500  LPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIK-KLTPQDALLYTGDRFLRGDTWIP  558

Query  285  ATKVPYAA  262
             T+VPY A
Sbjct  559  QTQVPYTA  566



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 126/188 (67%), Gaps = 5/188 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYVH+HRQFYRDCT++GT+DF+FG+A  + QNC +++RKP      GQ+CMVTAQG
Sbjct  378  HQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----NKGQTCMVTAQG  433

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V+    IT  P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  434  RSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGW  493

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  NTG GS  ++R KWPGIK ++    A  +   +F+ GDTWIP
Sbjct  494  LPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIK-KLTPQDALLYTGDRFLRGDTWIP  552

Query  285  ATKVPYAA  262
             T+VPY A
Sbjct  553  QTQVPYTA  560



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 126/196 (64%), Gaps = 8/196 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  383  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  438

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++SRT+I+N+ I   I P+GW
Sbjct  439  RKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGW  498

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  WPGIK   N+   + F P ++I GD W+ 
Sbjct  499  QPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSNEEILK-FTPDQYIQGDVWVH  557

Query  285  ATKVPYAAGL---NPN  247
               VPY  GL   NPN
Sbjct  558  GKGVPYTPGLLAANPN  573



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 126/196 (64%), Gaps = 8/196 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  383  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  438

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++SRT+I+N+ I   I P+GW
Sbjct  439  RKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGW  498

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  WPGIK   N+   + F P ++I GD W+ 
Sbjct  499  QPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSNEEILK-FTPDQYIQGDVWVH  557

Query  285  ATKVPYAAGL---NPN  247
               VPY  GL   NPN
Sbjct  558  GKGVPYTPGLLAANPN  573



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDCT++GT+DF+FG+A  + QNC +++RKP      GQSCMVTAQG
Sbjct  382  YQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----KGGQSCMVTAQG  437

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG+V+ N  I   P Y    S   ++LGRPW++ SRT+I+ + ID  I P GW
Sbjct  438  RTDVRESTGLVLHNCHIVGEPAYIPVKSVNKAYLGRPWKKFSRTIIMKTTIDDVIDPAGW  497

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G + L   +Y E  N G GS  ++R  WPGIK +++   A  +  G+F+ GDTWIP
Sbjct  498  LPWRGDFALETLYYAEHLNIGPGSNQAQRVNWPGIK-KLSPEEALLYTGGRFLHGDTWIP  556

Query  285  ATKVPYAAGL  256
             T+VPY A +
Sbjct  557  QTQVPYIANM  566



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA+RQFYRDC ITGTIDF+FG+A A+FQ C L++R+P+ +    Q+CMVTAQG
Sbjct  398  YQDTLYAHAYRQFYRDCQITGTIDFIFGDAVAIFQKCRLVVRQPMDD----QACMVTAQG  453

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R         V+    I + P +     P+ ++LGRPW+++SRT+++ S ID  IAPEGW
Sbjct  454  RKDQRSVGVTVLQGCDIVADPAFLAVKPPLDAYLGRPWKEYSRTIVMQSNIDGFIAPEGW  513

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G + L+  +YGE+ N G GS LS R  W GIK +I  A A+ F PG     DTW+ 
Sbjct  514  SPWMGNYALSTLYYGEYQNRGAGSGLSGRVTWKGIK-KITPAIAQSFTPGVVYKNDTWVS  572

Query  285  ATKVPYAAGL  256
             + +PY +G+
Sbjct  573  TSGIPYVSGM  582



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 122/191 (64%), Gaps = 7/191 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL VH +RQFYRDC I GTIDFVFG+ AAVFQNCTL +RKPL      Q C+VTAQG
Sbjct  380  YQDTLCVHTYRQFYRDCVIRGTIDFVFGDGAAVFQNCTLAVRKPL----KEQHCIVTAQG  435

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  A +PTG+V  N  I +   Y      + ++LGRPW+++SRT+I+ S ID  I PEGW
Sbjct  436  RTDARQPTGLVFQNCSIVADSSYNEVKGEVKTYLGRPWKEYSRTIIMESSIDDLIQPEGW  495

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKG-RINKAHAEGFAPGKFILGDTWI  289
              +  T+ L   +Y EF N G GS   +R KW G+K  +IN+     F   +F+ GD WI
Sbjct  496  VEWNKTFALNTLFYTEFNNRGSGSSKKERVKWQGVKELQINRVQR--FTASQFLDGDAWI  553

Query  288  PATKVPYAAGL  256
            P+T +PY  G 
Sbjct  554  PSTGIPYTPGF  564



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVHA+RQF+RDCTITGTIDF+FG+A++VFQ+C +++RKP+ N    Q+CMVTAQG
Sbjct  366  YQDTLYVHAYRQFFRDCTITGTIDFIFGDASSVFQSCKMIVRKPMAN----QACMVTAQG  421

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        IV+ N +I +   + ++   I ++LGRPW++ SRT+I+ S ID  I P+GW
Sbjct  422  RKDRRGVGAIVMQNCEIRAEHEFISTQPTIKAYLGRPWKEFSRTIIMQSLIDGFIDPQGW  481

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            S + G + L   +Y E+ N G G+  + R  W G K  I K  A GFAPG FIL D W+ 
Sbjct  482  SVWAGDFALHTLFYAEYENRGIGANSNNRVNWRGYKKNIGKEIAAGFAPGVFILADEWVR  541

Query  285  ATKVPYAAGL  256
             + VPY +GL
Sbjct  542  LSGVPYESGL  551



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 128/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H HRQFYR+CTI+GTIDF+FGN+A V Q C +++RKPL N    Q  +VTA G
Sbjct  391  YQDTLYAHTHRQFYRNCTISGTIDFIFGNSAVVLQKCRIVVRKPLEN----QQNIVTAHG  446

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPT I++ + +I + P      +   S+LGRPW+++SRT+I+ + ID  I P+GW
Sbjct  447  RKDRREPTAIILQSCRIVADPLLFPVRNTTRSYLGRPWKEYSRTIIMQTLIDDLINPDGW  506

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRI-NKAHAEGFAPGKFILGDTWI  289
             P+ G + L  C+Y E+ N G G+VL++R KW GIK  I     A+ F  G+FI GD+WI
Sbjct  507  LPWSGDFALKTCFYAEYNNRGPGAVLTQRVKWRGIKTSIMTPEKAQQFTAGRFIRGDSWI  566

Query  288  PATKVPYAAGLN  253
              T VPY +GL+
Sbjct  567  KPTGVPYDSGLS  578



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 125/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQF+RDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++SRT+I+N+ I   + P+GW
Sbjct  437  RKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+QG +GL   +Y E  NTG G+ ++ R  W GIK  ++      F P ++I GDTW+P
Sbjct  497  QPWQGDFGLKTLFYSEVQNTGPGATVANRVTWAGIK-TLSDEDILKFTPAQYIQGDTWVP  555

Query  285  ATKVPYAAGL  256
               VPY +GL
Sbjct  556  GKGVPYTSGL  565



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYVH+HRQFYRDCT++GT+DF+FG+A  + QNC +++RKP      GQSCMVTAQG
Sbjct  384  HQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----KKGQSCMVTAQG  439

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V+ N  IT    Y    S   ++LGRPW++ SRT+++ + ID  I P GW
Sbjct  440  RSNVRESTGLVLHNCHITGDSAYIPVKSESKAYLGRPWKEFSRTIVMKTAIDDVIDPAGW  499

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +Y E  NTG GS  + R KWPGIK ++    A  +   KF+ G+TWIP
Sbjct  500  LPWSGDFALKTLYYAEHLNTGPGSNQAHRVKWPGIK-KLTPQDALLYTGDKFLGGETWIP  558

Query  285  ATKVPYAAGL  256
             T+VPY A +
Sbjct  559  QTQVPYTANM  568



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+HR F+RDCT++GT+DF+FG+A  + QNC +++RKP +    GQSCMVTAQG
Sbjct  381  YQDTLYVHSHRHFFRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKL----GQSCMVTAQG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG+V+ N  IT  P Y    S   S+LGRPW+Q SRT+++ + ID  I P GW
Sbjct  437  RTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGRPWKQFSRTIVMKTLIDDVIDPAGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L   +Y E+ NTG GS  ++R KWPGI+ +I    A  +   +F+ G+TWIP
Sbjct  497  LEWSGDFALKTLYYAEYLNTGPGSNQAQRVKWPGIR-KITPQDALSYTGDRFLGGNTWIP  555

Query  285  ATKVPYAAGL  256
             T+VPY   +
Sbjct  556  QTQVPYTPNM  565



>ref|XP_008390620.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=388

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 122/193 (63%), Gaps = 5/193 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY   +RQFYRDCTITGT+DF+FG+  A+FQNC +++RKP    G  Q+CMVTAQ
Sbjct  200  AYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKP----GEAQACMVTAQ  255

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   +E TGI + N  IT  P Y        ++LGRPW++ +R V++ S ID  IAPEG
Sbjct  256  GRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKKFARVVVMQSSIDEAIAPEG  315

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W+ + G     +C++GE+GN G    +++R KW  +K R+    A  F P +   GD W+
Sbjct  316  WTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVK-RLTPDQAAAFTPARVFEGDKWV  374

Query  288  PATKVPYAAGLNP  250
              + VPY  G+ P
Sbjct  375  KPSGVPYVPGMMP  387



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 126/192 (66%), Gaps = 6/192 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            A+QDTLY HAHRQFYRDCTI+GTIDF+FG+A AVFQNC + ++KPL N    Q C+VTA 
Sbjct  390  AFQDTLYAHAHRQFYRDCTISGTIDFIFGDALAVFQNCQMFVKKPLEN----QQCIVTAS  445

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR++    + IV+ N  I++ P Y    +   ++LGRPW+ +SRT+I+ S+ID  I P+G
Sbjct  446  GRSERRSASAIVLQNCTISADPAYYPLRNINKAYLGRPWKDYSRTIIMQSQIDDLIQPQG  505

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILG-DTW  292
            W  + G + L  C+Y E+GN G GS  + RAKW GIK  +   H   F P  F  G D W
Sbjct  506  WLAWMGNFALNTCFYAEYGNRGAGSATTGRAKWRGIKS-MTAQHIVDFTPKAFFKGDDAW  564

Query  291  IPATKVPYAAGL  256
            I AT VPY+  L
Sbjct  565  ITATGVPYSPKL  576



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQF+RDCTI+GTIDFVFG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  382  YQDTLYTHSHRQFFRDCTISGTIDFVFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  437

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPTG V     I   P Y        ++LGRPW+++SRT+I+NS I   + P+GW
Sbjct  438  RQDPREPTGYVFQGCTIAGEPDYLAVKQTSKAYLGRPWKEYSRTIIMNSFIPDFVQPQGW  497

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  N G G+ L+ R  W GIK   N+   + FAP +FI  D W+P
Sbjct  498  QPWLGDFGLKTLFYSEVQNIGPGAALASRVTWAGIKTLSNEEILK-FAPAEFIQSDAWVP  556

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  557  GKGVPYIPGL  566



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 122/191 (64%), Gaps = 5/191 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY   +RQ+YRDCTITGT+DF+FG+  A+FQNC +++RKP    G  QSCMVTAQ
Sbjct  376  AYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQNCKMLVRKP----GDSQSCMVTAQ  431

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   +E T IV+ N  IT  P Y        ++LGRPW+  +R V++NS+ID  I PEG
Sbjct  432  GRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWKDFARVVVMNSQIDEAIQPEG  491

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W  + G+     C+ GE+GN G  + +++R KWP +K ++    A  F P K   GD WI
Sbjct  492  WIEWAGSQFHNTCFLGEYGNRGPRADMAQRVKWPSLK-KLTADQAATFTPAKLFEGDRWI  550

Query  288  PATKVPYAAGL  256
              + VPY +G+
Sbjct  551  KPSGVPYVSGM  561



>ref|XP_010264200.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=516

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH++RQFYR+C I GT+DF+FGNAA VFQNC +  RKP           VTAQG
Sbjct  332  YQDTLYVHSNRQFYRECDIYGTVDFIFGNAAVVFQNCNMFARKP-----KNSIVTVTAQG  386

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  ++ TGIVI NS+IT++   K   S + ++LGRPWRQ+SRTV++ + +D+ I P GW
Sbjct  387  RSDPNQNTGIVIHNSRITAASDLKPVQSSVKTYLGRPWRQYSRTVVLKTFLDSLIQPAGW  446

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L+  +YGE+ NTG GS  + R KW G     +   A  F  G FI+G  W+P
Sbjct  447  LPWSGSFALSTLYYGEYQNTGPGSSTANRVKWGGYHVITSVTEASKFTVGSFIVGGAWLP  506

Query  285  ATKVPYAAGL  256
            AT VP+ +GL
Sbjct  507  ATNVPFTSGL  516



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYTHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++SRT+I+N+ I   + P+GW
Sbjct  437  RKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  WPGIK   N    + F P ++I G+ W+P
Sbjct  497  QPWLGNFGLDTLFYSEVQNTGPGAALASRVTWPGIKTLSNDEILK-FTPDQYIQGNVWVP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTPGL  565



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 123/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYRDC I GT+DF+FGNA  VFQNC + +RKP+    SGQ   VTAQ 
Sbjct  358  YQDTLYVYSQRQFYRDCDIYGTVDFIFGNAVVVFQNCNIYVRKPM----SGQKNTVTAQA  413

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI+I NS++T++   +       S+LGRPW+++SRTVI+ S +D  I P GW
Sbjct  414  RTDPNENTGIIIHNSRVTAASDLRPVQGSFKSYLGRPWQEYSRTVILKSNLDGLIDPAGW  473

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L+  +Y E+ N+G G+    R KWPG         A  F  G F+ GD+WIP
Sbjct  474  LPWSGNFALSTLYYAEYMNSGSGASTGDRVKWPGYHVITKVTDAGKFTVGNFLAGDSWIP  533

Query  285  ATKVPYAAGL  256
            AT VP+ +GL
Sbjct  534  ATGVPFDSGL  543



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 124/190 (65%), Gaps = 9/190 (5%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY   HRQFYRDC I+GTIDF+FG+AAAVFQNC +++RKP    G  QSCMVTAQG
Sbjct  384  YQDTLYTQTHRQFYRDCIISGTIDFIFGDAAAVFQNCKMIVRKP----GPNQSCMVTAQG  439

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    EPTGIV+ N  I+   G+  + +  +++LGRPW+ +SRT+++ S+ID  I P GW
Sbjct  440  RLDKREPTGIVLQNCTISGEKGFDAATT--MAYLGRPWKMYSRTIVMQSQIDNVINPLGW  497

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT      W+GEF N G G+  ++R KW  +        A  FAPG  +LGD WI 
Sbjct  498  MEWTGTTNHETSWFGEFSNRGLGAATNQRVKWYKLA---TPEEAGAFAPGSILLGDKWIM  554

Query  285  ATKVPYAAGL  256
             + VPY AG+
Sbjct  555  PSGVPYVAGM  564



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQF+RDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++SRT+I+N+ I   + P+GW
Sbjct  437  RKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG GS L+ R  W GIK  +++     F P ++I GD WIP
Sbjct  497  QPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSEEDILKFTPAQYIQGDDWIP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTTGL  565



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTITGTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  377  YQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLAN----QACPITAHG  432

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+    I     Y        ++LGRPW+++S+T+I+ + I   I  EGW
Sbjct  433  RTDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGW  492

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+QG +GL   +Y E  NTG G+ ++ R  WPGIK ++++     + P K+I GD WIP
Sbjct  493  SPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWPGIK-KLSEEEIVEYTPAKYIQGDDWIP  551

Query  285  ATKVPYAAGL  256
               VPY  G 
Sbjct  552  GKGVPYTPGF  561



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQF+RDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++SRT+I+N+ I   + P+GW
Sbjct  437  RKDPREVTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG GS L+ R  W GIK  ++      F P ++I GDTW+P
Sbjct  497  QPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSDEDILKFTPAQYIQGDTWVP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTPGL  565



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 128/193 (66%), Gaps = 5/193 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLY H  RQFYRDCTITGTIDF+FG+AA++FQNC + +RKPL N    Q C+VTA G
Sbjct  395  FQDTLYSHTKRQFYRDCTITGTIDFIFGDAASIFQNCIIRVRKPLAN----QQCIVTASG  450

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E T I++ N  I + P Y    +   S+LGRPW+ +SRT+++ S+ID  I P+GW
Sbjct  451  RKDRREATAIILHNCTIGADPDYLPLRARNPSYLGRPWKPYSRTLVVQSQIDDFIHPQGW  510

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL  C+Y E  N G G+ ++KR  W G K +I+ +HA+ F   +FI G++W+ 
Sbjct  511  LPWLGDFGLNTCFYAEVDNRGPGATIAKRVAWKGYK-KIDYSHAQKFTVEQFIQGNSWLK  569

Query  285  ATKVPYAAGLNPN  247
             T VPY  GL P 
Sbjct  570  PTGVPYIPGLLPE  582



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYV+A+RQFYRDC I GTIDF+FGNA  V QNC + +RKP+    S Q   VTAQG
Sbjct  356  FQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPM----SNQKNTVTAQG  411

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGIVI N +IT+S   K   + + ++LGRPW+++SRTV++ S +D  I  EGW
Sbjct  412  RTDPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGW  471

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ G + L+  +YGE+ N G G+    R KWPG     N + A  F+ G F+ GD+WI 
Sbjct  472  APWMGGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWIS  531

Query  285  ATKVPYAAGL  256
             + VP+ AGL
Sbjct  532  GSGVPFDAGL  541



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLY HAHRQFYR+C I+GTIDFVFGNA ++FQNC  ++RKP+ N    Q+CMVTAQG
Sbjct  352  FQDTLYAHAHRQFYRNCRISGTIDFVFGNALSIFQNCQFIVRKPMAN----QACMVTAQG  407

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R Q +    IVI N +I +   +  +   + ++LGRPW+Q S T+I++S I   I+P+GW
Sbjct  408  RDQRNSNGAIVIQNGEIRAEQAFINAKPKVQAYLGRPWKQFSTTIIMSSYIGGSISPQGW  467

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ G++ L  C+Y E+ N G GS  S+R KW GIK  I+   A  +APGK    D WI 
Sbjct  468  APWAGSFALDTCYYAEYRNRGPGSNTSQRVKWKGIK-HIDPQTAARYAPGKAYGDDQWIR  526

Query  285  ATKVPYAAGL  256
               VPY +G+
Sbjct  527  RAGVPYVSGM  536



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 125/189 (66%), Gaps = 6/189 (3%)
 Frame = -3

Query  822  QDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQGR  643
            QDTLY    RQFYRDCT++GTIDF+FG+A AVFQNC LM+RKP    G  Q CMVTAQGR
Sbjct  396  QDTLYALRGRQFYRDCTVSGTIDFIFGDAQAVFQNCKLMVRKP----GPNQQCMVTAQGR  451

Query  642  AQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGWS  463
             +   P   +     ++S PGYK   +   ++LGRPW+++S+T+ + S ID  IAP+GW+
Sbjct  452  TEEKGPGAFIFEGCTVSSEPGYKAVKAKNPAYLGRPWKEYSKTIFMYSNIDDTIAPKGWT  511

Query  462  PFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGK-FILGDTWIP  286
             +QG + L   +Y EF N G G+  S+R KW GIK  ++   A+GF P K F+ GD WIP
Sbjct  512  EWQGNFALDTLYYAEFENKGAGADKSQRVKWKGIK-TLSAQEADGFTPAKLFVSGDKWIP  570

Query  285  ATKVPYAAG  259
             + VPYA G
Sbjct  571  ESGVPYAPG  579



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+ A E TG V     I   P Y    +   ++LGRPWR+ SRT+I+NS +   + P+GW
Sbjct  437  RSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  W GIK +++      F P +FI G  W+P
Sbjct  497  MPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIK-KLSNEEILKFTPDQFIQGGIWVP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTPGL  565



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   202 bits (514),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+ A E TG V     I   P Y    +   ++LGRPWR+ SRT+I+NS +   + P+GW
Sbjct  437  RSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  W GIK +++      F P +FI G  W+P
Sbjct  497  MPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIK-KLSNEEILKFTPDQFIQGGIWVP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTPGL  565



>ref|XP_008361835.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=233

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 123/191 (64%), Gaps = 4/191 (2%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQD+LYVH++RQF+  C + GT+DF+FGNAA V QNC +  RKP     SGQ  M+TAQ
Sbjct  47   AYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAVVLQNCDIHARKP----NSGQKNMLTAQ  102

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   ++ TGIVI  S+I ++   + S     +FLGRPW+++SRTVI+ S I   I P G
Sbjct  103  GRTDPNQNTGIVIQKSRIGATSDLQASKGSFKTFLGRPWKEYSRTVIMQSSITDIIDPVG  162

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W  + GT+ L   +YGE+ NTG G+  SKR  W G K   +   A+ + PG+FI G +W+
Sbjct  163  WHEWSGTFALNTLFYGEYANTGAGAGTSKRVTWKGFKVITSTTEAQAYTPGRFIAGGSWL  222

Query  288  PATKVPYAAGL  256
             +T  P+A GL
Sbjct  223  SSTGFPFALGL  233



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   201 bits (512),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+ A E TG V     I   P Y    +   ++LGRPWR+ SRT+I+NS +   + P+GW
Sbjct  437  RSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  W GIK +++      F P +FI G  W+P
Sbjct  497  MPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIK-KLSNEEILKFTPDQFIQGGIWVP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTPGL  565



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 119/190 (63%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL  H +RQFYRDCTI GTIDFVFG+AAAVFQNCTL +RKP+      Q C+VTAQG
Sbjct  381  YQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAVFQNCTLAVRKPM----KEQHCIVTAQG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  A +PTG+V  N  I +   Y      + ++LGRPW+Q+SRT+I+ S ID  I PEGW
Sbjct  437  RTDARQPTGLVFQNCSIVADESYNEVKGEVKTYLGRPWKQYSRTIIMESNIDDLIQPEGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+     +Y EF N G GS  + R +W G+K  +     + F    FI  D WIP
Sbjct  497  LEWNKTFAFETLFYTEFNNKGSGSSKTDRVRWSGVK-ELPIERVQRFTTSSFIDADLWIP  555

Query  285  ATKVPYAAGL  256
            +T VPY +G 
Sbjct  556  STGVPYTSGF  565



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   199 bits (507),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 121/191 (63%), Gaps = 5/191 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY   +RQ+YRDCTITGT+DF+FG+  A+FQNC +++RKP    G  QSCMVTAQ
Sbjct  375  AYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQNCKMLVRKP----GDSQSCMVTAQ  430

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   +E T IV+ N  IT  P Y        ++LGRPW+  +R V++ S+ID  I PEG
Sbjct  431  GRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWKDFARVVVMQSQIDEAIQPEG  490

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W  + G+     C+ GE+GN G  + +++R KWP +K ++    A  F P K   GD WI
Sbjct  491  WIEWAGSMFHNTCFLGEYGNKGPRADMAQRVKWPSLK-KLTADQAATFTPAKLFEGDRWI  549

Query  288  PATKVPYAAGL  256
              + VPY +G+
Sbjct  550  KPSGVPYVSGM  560



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   201 bits (512),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  379  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  434

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+   +I     Y        ++LGRPW+++S+T+I+N+ I   +  +GW
Sbjct  435  RKDPRESTGFVLQGCRIAGESDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFVPAQGW  494

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+QG +GL   +Y E  NTG G+ ++ R  WPGIK ++++     F P ++I GD WIP
Sbjct  495  QPWQGNFGLDTLFYSEVRNTGPGAPVTNRVTWPGIK-KLSEEEVLEFTPSRYIQGDAWIP  553

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  554  GKGVPYTPGL  563



>ref|XP_004297462.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Fragaria vesca subsp. vesca]
Length=548

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYRDC I GT+DF+FG+A+A+ QNC + +RKP     S Q   VTAQ 
Sbjct  363  YQDTLYVYSQRQFYRDCNIYGTVDFIFGDASAILQNCNIYVRKP----SSNQINTVTAQS  418

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI+I N +IT++P  +       ++LGRPW+++SR VI+ S +D  I P+GW
Sbjct  419  RRDPNENTGIIIHNCRITAAPDLRAVQGSFRTYLGRPWQKYSRVVIMKSNLDGLIEPQGW  478

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++GL   +YGE+ NTG G+    R KWPG +   +   A  F  G F+ GD W+P
Sbjct  479  FPWSGSFGLDTLYYGEYMNTGAGAATGGRVKWPGFRVITSATEAGKFTVGNFLAGDAWLP  538

Query  285  ATKVPYAAGL  256
             T VP+ AGL
Sbjct  539  GTGVPFEAGL  548



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 122/193 (63%), Gaps = 5/193 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY   +RQFYRDCTITGT+DF+FG+  A+FQNC +++RKP    G  Q+CMVTAQ
Sbjct  381  AYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKP----GEAQACMVTAQ  436

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   +E TGI + N  IT  P Y        ++LGRPW++ +R V++ S ID  IAPEG
Sbjct  437  GRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKKFARVVVMQSSIDEAIAPEG  496

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W+ + G     +C++GE+GN G    +++R KW  +K R+    A  F P +   GD W+
Sbjct  497  WTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVK-RLTPDQAAAFTPARVFEGDKWV  555

Query  288  PATKVPYAAGLNP  250
              + VPY  G+ P
Sbjct  556  KPSGVPYVPGMMP  568



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTITGTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  192  YQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLAN----QACPITAHG  247

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+    I     Y        ++LGRPW+++S+T+I+ + I   I  EGW
Sbjct  248  RKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGW  307

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+QG +GL   +Y E  NTG G+ ++ R  W GIK ++++     + P K+I GD WIP
Sbjct  308  SPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQGIK-KLSEEEIVEYTPAKYIQGDDWIP  366

Query  285  ATKVPYAAGL  256
               VPY  G 
Sbjct  367  GKGVPYTPGF  376



>emb|CDX71786.1| BnaC08g30880D [Brassica napus]
Length=522

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+ H+ RQFYRDC I GTIDF+FG+AAAVFQNC + +R+P+ + G+    M+TAQG
Sbjct  337  YQDTLFTHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQG  392

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGI I NS++ +SP ++       S+LGRPW+++SRTV + + +D  I P GW
Sbjct  393  RDNPHENTGISIQNSRVRASPEFEAVKGQFKSYLGRPWKKYSRTVFLKTDLDGLIDPRGW  452

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              ++G + L+  +YGEF NTG G+  S+R  WPG         A  F   +FI GD+WIP
Sbjct  453  REWRGDFALSTLYYGEFMNTGSGAGTSRRVSWPGFHVLHGADEASPFTVSRFIQGDSWIP  512

Query  285  ATKVPYAAGL  256
             T VP++AG+
Sbjct  513  ITGVPFSAGV  522



>ref|XP_010259034.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=517

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C I GT+DF+FGNAA V QNC +  RKP+  NG      VTAQG
Sbjct  333  YQDTLYVHSERQFYRECAIYGTVDFIFGNAAVVLQNCNIFSRKPI--NGV---VTVTAQG  387

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGIVI  SQIT++   K   S + ++LGRPWRQ+SRTVI+ S +D  I P GW
Sbjct  388  RIDPNQNTGIVIHTSQITAASDLKPVQSSVKAYLGRPWRQYSRTVILKSFLDNLIQPVGW  447

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G++GL   +YGE+ NTG GS  + R KW G +   + A A  F  G FI G +W+P
Sbjct  448  LEWSGSFGLNTLYYGEYQNTGPGSSTANRVKWGGYRVITSVAEASKFTVGNFIAGSSWLP  507

Query  285  ATKVPYAAGL  256
            A+ VP+ +GL
Sbjct  508  ASNVPFTSGL  517



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C I GT+DF+FGNAA V QNC +  R P       ++  VTAQG
Sbjct  365  YQDTLYVHSDRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARDP-----PNKTNTVTAQG  419

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  ++ TGI I N ++T++   K S + + ++LGRPW+Q+SRTV++ + +D+ I P+GW
Sbjct  420  RSDPNQNTGISIHNCRVTAASDLKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGW  479

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ GT+ L   +YGE+ NTG GS  + R KW G +   + A A  F P  FI G++W+P
Sbjct  480  MPWSGTFALKTLYYGEYLNTGPGSSTANRVKWGGYRVITSAAEASKFTPANFIAGNSWLP  539

Query  285  ATKVPYAAGL  256
            AT VP+ +GL
Sbjct  540  ATNVPFTSGL  549



>ref|XP_010513751.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=358

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+ H+ RQFYRDC I GTIDF+FG+AAAVFQNC + +R+P+ + G+    M+TAQG
Sbjct  173  YQDTLFTHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQG  228

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R      TGI I +S++ ++P ++       ++LGRPW+++SRTV + + +D  I P GW
Sbjct  229  RDDPHATTGISIQHSRVRAAPEFEAVKGRFKNYLGRPWKKYSRTVFLKTDLDGLIDPRGW  288

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G++ L+  +YGEF NTG G+  ++R  WPG      +  A  F   +FI GD+WIP
Sbjct  289  REWSGSYALSTLYYGEFMNTGAGAETTRRVNWPGFHVLRGEEEASPFTVSRFIQGDSWIP  348

Query  285  ATKVPYAAGL  256
             T VP++AG+
Sbjct  349  ITGVPFSAGV  358



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C + GT+DF+FGNAA V QNC +  R P       ++  VTAQG
Sbjct  341  YQDTLYVHSDRQFYRECDVYGTVDFIFGNAAVVLQNCNIFARDP-----PNKTNTVTAQG  395

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I N +IT++   K S + + ++LGRPW+Q+SRTV++ + +D+ I P+GW
Sbjct  396  RTDPNQNTGISIHNCRITAASDLKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGW  455

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ GT+ L   +YGE+ NTG GS  + R KW G +   + A A  F P  FI G++W+P
Sbjct  456  MPWSGTFALKTLYYGEYLNTGPGSSTANRVKWGGYRVITSAAEASKFTPANFIAGNSWLP  515

Query  285  ATKVPYAAGL  256
            AT VP+ +GL
Sbjct  516  ATNVPFTSGL  525



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H +RQFYRDC ITGTIDF+FG+AA  FQNCT ++RKPL N    Q+C+VTAQG
Sbjct  411  YQDTLYTHTYRQFYRDCKITGTIDFIFGDAAVFFQNCTFVVRKPLEN----QNCIVTAQG  466

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +PTGI+I NS+  + P Y    +   ++LGRPW+++S+T+I+ S+I   I PEGW
Sbjct  467  RMERHQPTGIIIHNSKFEADPDYYPVRNKNKAYLGRPWKEYSKTIIMESEIGDLIQPEGW  526

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G +GL   +YGE+ N G G+ L+ R KW G+K  I +  AE F P      D WI 
Sbjct  527  LPWEGNFGLDTSYYGEYNNFGDGARLTNRVKWRGVK-TIVRTRAEKFMPPILYENDDWIR  585

Query  285  ATKVPYAAGL  256
             + +PY   L
Sbjct  586  DSGIPYDPAL  595



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 126/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH  RQFYR+CTI+GTIDF+FG++  VFQNC +  RKPL N    Q  +VTAQG
Sbjct  365  YQDTLYVHTKRQFYRECTISGTIDFIFGDSPTVFQNCLIQARKPLDN----QQNIVTAQG  420

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    + + I++ N  I++ P Y  +   + +FLGRPW++ SRT ++ S++D  I P+GW
Sbjct  421  RKDRRQASAIILHNCTISADPAYFPARKKLPTFLGRPWKEFSRTFVLQSQLDDLIDPKGW  480

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL  C+Y E  N G G+ +S+R  W G+K  I+ AHA+ F    FI G+ W+P
Sbjct  481  LPWSGDFGLNSCFYTELDNRGPGADMSQRVNWKGVKS-IDYAHAQKFTVEHFIQGNAWLP  539

Query  285  ATKVPYAAGLNP  250
             T VP+  GL P
Sbjct  540  KTGVPFIPGLLP  551



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQ+TLY H+HRQF+RDCTI+GTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQNTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++SRT+I+N+ I   + P+GW
Sbjct  437  RKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG GS L+ R  W GIK  +++     F P ++I GD WIP
Sbjct  497  QPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSEEDILKFTPAQYIQGDDWIP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTTGL  565



>ref|XP_009116752.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Brassica rapa]
Length=521

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+ H+ RQFYRDC I GTIDF+FG+A+AVFQNC + +R+P+ + G+    M+TAQG
Sbjct  336  YQDTLFTHSLRQFYRDCHIYGTIDFIFGDASAVFQNCDIFVRRPMDHQGN----MITAQG  391

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGI I NS++ +SP ++       S+LGRPW+++SRTV + + +D  I P GW
Sbjct  392  RDNPHENTGISIQNSRVRASPEFEAVKGQFKSYLGRPWKKYSRTVFLKTDLDGLIDPRGW  451

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              ++G + L+  +YGEF NTG G+  S+R  WPG         A  F   +FI GD+WIP
Sbjct  452  REWRGDFALSTLYYGEFMNTGSGAGTSRRVSWPGFHVLHGADEASPFTVSRFIQGDSWIP  511

Query  285  ATKVPYAAGL  256
             T VP++AG+
Sbjct  512  ITGVPFSAGV  521



>emb|CDY41145.1| BnaA09g38700D [Brassica napus]
Length=521

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+ H+ RQFYRDC I GTIDF+FG+A+AVFQNC + +R+P+ + G+    M+TAQG
Sbjct  336  YQDTLFTHSLRQFYRDCHIYGTIDFIFGDASAVFQNCDIFVRRPMDHQGN----MITAQG  391

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGI I NS++ +SP ++       S+LGRPW+++SRTV + + +D  I P GW
Sbjct  392  RDNPHENTGISIQNSRVRASPEFEAVKGQFKSYLGRPWKKYSRTVFLKTDLDGLIDPRGW  451

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              ++G + L+  +YGEF NTG G+  S+R  WPG         A  F   +FI GD+WIP
Sbjct  452  REWRGDFALSTLYYGEFMNTGSGAGTSRRVSWPGFHVLHGADEASPFTVSRFIQGDSWIP  511

Query  285  ATKVPYAAGL  256
             T VP++AG+
Sbjct  512  ITGVPFSAGV  521



>emb|CDY08030.1| BnaC03g34930D [Brassica napus]
Length=239

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+VH+ RQFYRDCT+TGTIDFVFG+A  + QN  ++ RKP      GQ+C+V AQG
Sbjct  55   YQDTLFVHSQRQFYRDCTVTGTIDFVFGDAKCILQNSVIVFRKP----KKGQTCVVAAQG  110

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   E TG+V  N  +T    Y        SFLGRPW++ SRT+++ S +D  I P+GW
Sbjct  111  RSDRHESTGLVFQNCHVTGDEEYMAIRPAKKSFLGRPWKRFSRTIMLMSALDDVIDPDGW  170

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G + L   +Y E+ + G G+  S R KWPG+K  I    A+ +  G+F+ GD+WIP
Sbjct  171  LPWKGEFALKTLYYAEYLSGGFGANDSLRVKWPGVKN-ITAEEAQLYTGGRFLGGDSWIP  229

Query  285  ATKVPYAAGL  256
             T+VPY A L
Sbjct  230  HTQVPYIANL  239



>ref|XP_010253281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Nelumbo nucifera]
Length=560

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFYR+C I GT+DF+FGNAAAVFQNC +  R P+     GQ   +TAQG
Sbjct  375  YQDTLYAHSLRQFYRECDIYGTVDFIFGNAAAVFQNCNIYARLPM----QGQFNALTAQG  430

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I N  I ++P   +S     S+LGRPW+++SRTV + S ID+ I P GW
Sbjct  431  RTDPNQNTGISIHNCNIRAAPDLASSSGTTKSYLGRPWKEYSRTVYMQSIIDSLIDPAGW  490

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L+  +Y E+ NTG GSV + R  WPG    IN   A  F    FILGD+W+P
Sbjct  491  KEWSGNFALSTLYYAEYNNTGPGSVTTDRVSWPGYH-LINATDAANFTVSNFILGDSWLP  549

Query  285  ATKVPYAAGL  256
            AT VPY+ GL
Sbjct  550  ATIVPYSGGL  559



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 122/193 (63%), Gaps = 8/193 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQFYRDC I+GTIDFVFG+A AV QNCT  +RKP+ N    Q C+VTAQG
Sbjct  393  YQDTLYAHAMRQFYRDCIISGTIDFVFGDAVAVLQNCTFEVRKPMAN----QQCIVTAQG  448

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R + ++P+GI+I    I S P Y        ++L RPW+  SRT+I++S ID  I P+G+
Sbjct  449  RKERNQPSGIIIHGGSIVSDPSYYPVRFDNKAYLARPWKNFSRTIIMDSYIDDLITPDGY  508

Query  465  SPFQ---GTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDT  295
             P+Q   G  G+  C+Y E  N G G+  SKR KW GIK   N   A  F P  F  GD 
Sbjct  509  MPWQTVEGLSGMDTCFYSEINNHGPGADKSKRVKWEGIKSLSNDM-ATTFLPSPFFHGDD  567

Query  294  WIPATKVPYAAGL  256
            WI  T+VPY +GL
Sbjct  568  WIRVTRVPYDSGL  580



>ref|XP_003630894.1| Pectinesterase [Medicago truncatula]
Length=326

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 124/188 (66%), Gaps = 4/188 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYV+A+RQFYRDC I GTIDF+FGNA  V QNC + +RKP+    S Q   VTAQG
Sbjct  124  FQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPM----SNQQNTVTAQG  179

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGIVI N +IT+S   K   + + ++LGRPW+++SRTV++ S +D  I  EGW
Sbjct  180  RTDPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGW  239

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+ G + L+  +YGE+ N G G+    R KWPG     N + A  F+ G F+ GD+WI 
Sbjct  240  APWMGGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWIS  299

Query  285  ATKVPYAA  262
             + VP+ A
Sbjct  300  GSGVPFDA  307



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 121/191 (63%), Gaps = 5/191 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY   +RQ+YRDCTI+GT+DF+FG+  A+FQNC +++RKP    G  QSCMVTAQ
Sbjct  381  AYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQNCRMVVRKP----GDSQSCMVTAQ  436

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   +E T IV+ N  IT  P Y        ++LGRPW+  +R V+I S+ID  IAPEG
Sbjct  437  GRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKGFARVVVIQSQIDDAIAPEG  496

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W+ + G    T C+  E GN G G+ +SKR KW  +K ++    A  F P +   GD W+
Sbjct  497  WTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLK-KLTPEQAAAFTPARLFEGDKWV  555

Query  288  PATKVPYAAGL  256
              + VPY +G+
Sbjct  556  KPSGVPYVSGM  566



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C I GT+DF+FGNAA VFQ+C +  R P       ++  +TAQG
Sbjct  75   YQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVFQSCNIYARNP-----PNKTNTITAQG  129

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I+NS++T++   K   S + ++LGRPW+++SRTV + + +D  I P GW
Sbjct  130  RTDPNQNTGISILNSRVTAASDLKPVQSSVKTYLGRPWKEYSRTVFMKTFLDGLINPAGW  189

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +YGE+ NTG GS  +KR  W G     +   A  F  G FI G +W+P
Sbjct  190  MPWSGNFALNTLYYGEYANTGPGSSTAKRVNWKGYHVITSATEASKFTVGNFIAGSSWLP  249

Query  285  ATKVPYAAGL  256
            AT VP+ +GL
Sbjct  250  ATNVPFTSGL  259



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   200 bits (509),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H +RQFYRDC I+GTIDF+FG++AAVFQ CTL++RKPL N    Q C+VTAQG
Sbjct  377  YQDTLYTHTYRQFYRDCVISGTIDFIFGDSAAVFQGCTLLVRKPLDN----QQCIVTAQG  432

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +PTG+VI N  I +   Y      I S+LGRPW+Q+SRT+I+ S +D  I P+GW
Sbjct  433  RKDVRQPTGLVIQNCSIKADEAYYPLRKQIKSYLGRPWKQYSRTIIMESFLDDLIQPQGW  492

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+  T+ L   +Y EF N G  +  S+R KW GI+  +       F   +F+ G  WIP
Sbjct  493  LPWNETFALQTLFYTEFNNRGPAAPKSERVKWAGIR-ELPSNRIRRFTLEEFLDGHRWIP  551

Query  285  ATKVPYAAGL  256
             TKVP+A+G 
Sbjct  552  QTKVPHASGF  561



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 129/193 (67%), Gaps = 11/193 (6%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQFYRDCTI+GT+DFVFG+A AVFQNCT ++RK L N    Q C+VTAQG
Sbjct  377  YQDTLYAHAMRQFYRDCTISGTVDFVFGDAVAVFQNCTFVVRKALEN----QQCIVTAQG  432

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+G VI  S I S+    T      ++L RPW+ HSRT+ +N+ I+A I PEG+
Sbjct  433  RKERHQPSGTVIQGSSIVSN---HTENLDNKAYLARPWKNHSRTIFMNTYIEALIQPEGY  489

Query  465  SPFQGTWGLT---DCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDT  295
             P+QG  GL+   +C+Y E+ NTG GS  SKR KW GI    +++    ++P KF  GD 
Sbjct  490  MPWQGQNGLSGMDNCFYAEYNNTGPGSNKSKRVKWRGIITLTSES-VSRYSPYKFFHGDD  548

Query  294  WIPATKVPYAAGL  256
            WI  T++PY + +
Sbjct  549  WIKVTRIPYYSAV  561



>ref|XP_006853048.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
 gb|ERN14515.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
Length=532

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 123/191 (64%), Gaps = 4/191 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFYR+C I GTIDF+FGNAA VFQNC L  R P+    + Q+ + TAQG
Sbjct  345  YQDTLYTHSLRQFYRECDIYGTIDFIFGNAAVVFQNCNLYARMPM----ASQNNVFTAQG  400

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TG  I+N  +T+S  +  + S + S+LGRPW+++SRTV + S ID+ I   GW
Sbjct  401  RTDPNQNTGTSILNCSVTASSDFAWNSSSVNSYLGRPWKEYSRTVYMKSFIDSLIDSSGW  460

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L   +YGEF N+G G+  SKR  WPG    +N   A  F    FI+GD W+P
Sbjct  461  LPWSGDFALNTLYYGEFNNSGPGADTSKRVSWPGYHAIMNVTDAGNFTVSNFIMGDVWLP  520

Query  285  ATKVPYAAGLN  253
            AT V + AGL+
Sbjct  521  ATSVEFHAGLD  531



>ref|XP_010101979.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90903.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=463

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYRDC + GT+DF+FG+A A+ QNC +++RKP+    SGQ  +VT Q 
Sbjct  278  YQDTLYVYSQRQFYRDCNVYGTVDFIFGDAVAILQNCNILVRKPI----SGQENVVTCQT  333

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI+I NS+IT+S   +       ++LGRP +++SRTVI+ S +D  I P+GW
Sbjct  334  RTDPNENTGIIIQNSRITASSDLRPVQGSFETYLGRPLQKYSRTVIMTSSLDGLIDPKGW  393

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P  G + L+  +Y E+ N+G G+    R  WPG     + A A  F  G F+ GD+WIP
Sbjct  394  LPGSGNFALSTLYYAEYMNSGAGAATGGRVSWPGYHVLTSAAEAGKFTVGNFLGGDSWIP  453

Query  285  ATKVPYAAGL  256
            AT VP+AAGL
Sbjct  454  ATGVPFAAGL  463



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 125/193 (65%), Gaps = 8/193 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH  RQFYRDCTI+GTIDFVFGNA AVFQNCT ++RKP+ N    Q C+VTAQG
Sbjct  382  YQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMKN----QQCIVTAQG  437

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+GIVI    I S P + +      ++L RPW+ +SRT+I+++ ID  I  +G+
Sbjct  438  RKEKQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTNIDDLIHADGY  497

Query  465  SPFQGTW---GLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDT  295
             P+QG     G+  C+Y E+ NTG GS  SKR  W GI   +N   A  F+P KF  G  
Sbjct  498  LPWQGPEGPTGMDTCFYAEYHNTGPGSDKSKRVNWSGI-WNLNSKAAHSFSPSKFFHGTN  556

Query  294  WIPATKVPYAAGL  256
            WI  T +PY  G+
Sbjct  557  WIQVTGIPYFPGI  569



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 118/190 (62%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL  H +RQFYRDCTI GTIDFVFG+AAAVFQNCTL +RKP+      Q C+VTAQG
Sbjct  381  YQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAVFQNCTLAVRKPM----KEQHCIVTAQG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +P+GIV+ N  I +   Y        ++LGRPW+Q+SRT+I+ SKID  I PEGW
Sbjct  437  RTDLRQPSGIVLQNCSIVADESYNEVKGEAKTYLGRPWKQYSRTIIMESKIDDLIQPEGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+     +Y EF N G GS  + R  W G+K  +     + F    F+  D WIP
Sbjct  497  LEWNKTFAFDTLFYTEFNNKGLGSSKADRVTWSGVK-ELPIERVQRFTASNFLDADLWIP  555

Query  285  ATKVPYAAGL  256
            +T VPY +G 
Sbjct  556  STGVPYTSGF  565



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYR+C I GT+DF+FG+AA V QNC + +RKP+    SGQ   VTAQG
Sbjct  331  YQDTLYVYSQRQFYRNCDIYGTVDFIFGDAAVVLQNCNMHVRKPM----SGQKNTVTAQG  386

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI I +S +T++   K       ++LGRPW+++SRTV + + +D+ I P GW
Sbjct  387  RTDPNENTGISIHDSAVTAASDLKPVQGSFETYLGRPWQEYSRTVFMKTSLDSLIDPAGW  446

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L+  +YGE+ NTG G+  S+R KWPG     + A A  F  G F+ G++WIP
Sbjct  447  LEWSGNFALSTLYYGEYMNTGPGADTSQRVKWPGYHVITSAAEASKFTVGNFLSGNSWIP  506

Query  285  ATKVPYAAGL  256
            AT+VP+ +GL
Sbjct  507  ATEVPFTSGL  516



>ref|XP_006285748.1| hypothetical protein CARUB_v10007222mg [Capsella rubella]
 gb|EOA18646.1| hypothetical protein CARUB_v10007222mg [Capsella rubella]
Length=757

 Score =   199 bits (507),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 132/189 (70%), Gaps = 5/189 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDC I+GTIDFVFG+A AVFQNC  +IR+P+ N    Q C+VTAQG
Sbjct  574  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDN----QQCIVTAQG  629

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+I     Y+   +   +FLGRPW+++SRTVI+N++ID  I PEGW
Sbjct  630  RKDKRETTGIVIHNSRIIGDASYRPVKAKNRAFLGRPWKEYSRTVIMNTEIDDVIDPEGW  689

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS  S+R +W GI+   ++A  E F+PG F+ G+TWIP
Sbjct  690  LKWNETFALNTLFYTEYRNRGRGSGQSRRVRWRGIRRLSSRAVRE-FSPGNFLRGNTWIP  748

Query  285  ATKVPYAAG  259
             T++PY A 
Sbjct  749  QTRIPYNAN  757



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H +RQ+YRDCTI+GTIDF+FG++  +FQNC  ++RKP+ N    Q+CMVTAQG
Sbjct  356  YQDTLYAHNYRQYYRDCTISGTIDFIFGDSLCLFQNCVFIVRKPMDN----QACMVTAQG  411

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        IVI NS IT+ P + ++   I ++LGRPW++ SRT+I+ S+ID  I+P+GW
Sbjct  412  RVDPRSVGAIVIQNSHITAEPAFLSTKPAIDAYLGRPWKELSRTIIMQSEIDGFISPKGW  471

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G + L   +YGE+ N G GS L+ R  W GI+  + +  AE +  G    GD WI 
Sbjct  472  SPWMGNFALDTLYYGEYQNRGAGSDLANRVTWKGIQ-HMTQQKAEEWTGGAAFRGDEWIT  530

Query  285  ATKVPYAAGL  256
            ++ VPY   L
Sbjct  531  SSGVPYVPTL  540



>ref|XP_006402549.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
 gb|ESQ44002.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
Length=519

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+ H+ RQFYRDC I GTIDF+FG+A AVFQNC + +R+P+ + G+    M+TAQG
Sbjct  334  YQDTLFTHSLRQFYRDCHIYGTIDFIFGDAVAVFQNCDIFVRRPMDHQGN----MITAQG  389

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGI I +S++ ++P ++       S+LGRPW+++SRTV + ++ID  I P GW
Sbjct  390  RDNPHENTGISIQHSRVRAAPEFEAVKGRFKSYLGRPWKKYSRTVFLKTEIDGLIDPRGW  449

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              ++G + L+  +YGEF NTG G+  S+R  WPG      +  A  F   +FI GD+WIP
Sbjct  450  REWRGDFALSTLYYGEFMNTGSGAGTSRRVNWPGFHLLHGEEEASPFTVSRFIQGDSWIP  509

Query  285  ATKVPYAAGL  256
             T VP++AG+
Sbjct  510  ITGVPFSAGV  519



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 129/193 (67%), Gaps = 11/193 (6%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY HA RQFYRDCTI+GT+DFVFG+A AVFQNCT ++RK L N    Q C+VTAQG
Sbjct  400  YQDTLYAHAMRQFYRDCTISGTVDFVFGDAVAVFQNCTFVVRKALEN----QQCIVTAQG  455

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+G VI  S I S+    T      ++L RPW+ HSRT+ +N+ I+A I PEG+
Sbjct  456  RKERHQPSGTVIQGSSIVSN---HTENLDNKAYLARPWKNHSRTIFMNTYIEALIQPEGY  512

Query  465  SPFQGTWGLT---DCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDT  295
             P+QG  GL+   +C+Y E+ NTG GS  SKR KW GI    +++    ++P KF  GD 
Sbjct  513  MPWQGQNGLSGMDNCFYAEYNNTGPGSNKSKRVKWRGIITLTSES-VSRYSPYKFFHGDD  571

Query  294  WIPATKVPYAAGL  256
            WI  T++PY + +
Sbjct  572  WIKVTRIPYYSAV  584



>ref|XP_006361902.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25-like 
[Solanum tuberosum]
Length=564

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDC I GT+DF+FGNAAA+FQNC L  RKP+ +    Q  + TAQG
Sbjct  380  YQDTLYVHSLRQFYRDCDIYGTVDFIFGNAAAIFQNCNLFARKPMPD----QKNIFTAQG  435

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  ++ TGI I N  I ++P     P+  +SFLGRPW  +SRTVI+ S I   I P GW
Sbjct  436  RSDPNQNTGISIQNCTIQAAPDLAQDPNLTLSFLGRPWHNYSRTVIMQSYIGDVITPVGW  495

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT+GL   +YGEF N G G+  + R +WPG    +N   A  F    F +GDTW+P
Sbjct  496  LEWNGTYGLDTLYYGEFENYGPGANTTMRVQWPGY-SLMNALQAMNFTVYNFTMGDTWLP  554

Query  285  ATKVPYAAGL  256
             T VP++ GL
Sbjct  555  YTNVPFSQGL  564



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 123/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ R F+RDCTI+GTID++FGN  ++FQNC ++IRKP++N    Q+ +VTAQG
Sbjct  405  YQDTLYAHSGRHFFRDCTISGTIDYIFGNGESIFQNCKMVIRKPMVN----QANIVTAQG  460

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E + IV+    I++ P      +   S+LGRPW++ SRT+I+ + ID  I+P+GW
Sbjct  461  RKTEREVSAIVLQGCTISADPSLVPEKNVFKSYLGRPWKEFSRTIIMETDIDDSISPDGW  520

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL  C+Y EF N G G+VL+ R KWPGIK  +    A+ +    +I  D W+ 
Sbjct  521  MPWMGDFGLQTCYYAEFNNRGPGAVLTNRVKWPGIKTPLTPEQAQEYTAAPYIQADDWVK  580

Query  285  ATKVPYAAGL  256
               +PY  GL
Sbjct  581  PLGIPYVPGL  590



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   199 bits (505),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTITGTIDF+FG+AAAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  377  YQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLAN----QACPITAHG  432

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+    I     Y        ++LGRPW+++S+T+I+ + I   I  EGW
Sbjct  433  RKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGW  492

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+QG +GL   +Y E  NTG G+ ++ R  W GIK ++++     + P K+I GD WIP
Sbjct  493  SPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQGIK-KLSEEEIVEYTPAKYIQGDDWIP  551

Query  285  ATKVPYAAGL  256
               VPY  G 
Sbjct  552  GKGVPYTPGF  561



>ref|NP_193333.1| putative pectinesterase/pectinesterase inhibitor 43 [Arabidopsis 
thaliana]
 sp|O23447.1|PME43_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
43; Includes: RecName: Full=Pectinesterase inhibitor 43; AltName: 
Full=Pectin methylesterase inhibitor 43; Includes: RecName: 
Full=Pectinesterase 43; Short=PE 43; AltName: Full=Pectin 
methylesterase 43; Short=AtPME43; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB10377.1| pectinesterase like protein [Arabidopsis thaliana]
 emb|CAB78640.1| pectinesterase like protein [Arabidopsis thaliana]
 gb|AEE83677.1| putative pectinesterase/pectinesterase inhibitor 43 [Arabidopsis 
thaliana]
Length=701

 Score =   199 bits (505),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 129/189 (68%), Gaps = 5/189 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYR+C ++GTIDFVFG+A AVFQNC  +IR+P+      Q C+VTAQG
Sbjct  518  YQDTLYVHTHRQFYRNCRVSGTIDFVFGDAKAVFQNCEFVIRRPM----EHQQCIVTAQG  573

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+IT    Y    +   +FLGRPW++ SRT+I+N++ID  I PEGW
Sbjct  574  RKDRRETTGIVIHNSRITGDASYLPVKAKNRAFLGRPWKEFSRTIIMNTEIDDVIDPEGW  633

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS   +R +W GIK RI+   A  FAPG F+ G+TWIP
Sbjct  634  LKWNETFALNTLFYTEYRNRGRGSGQGRRVRWRGIK-RISDRAAREFAPGNFLRGNTWIP  692

Query  285  ATKVPYAAG  259
             T++PY A 
Sbjct  693  QTRIPYNAN  701



>ref|XP_004231267.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Solanum lycopersicum]
Length=560

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDC I GT+DF+FGNAAA+FQNC L  RKP+ +    Q  + TAQG
Sbjct  376  YQDTLYVHSLRQFYRDCDIYGTVDFIFGNAAAIFQNCNLFARKPMPD----QKNIFTAQG  431

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  ++ TGI I N  I ++P     P+  +SFLGRPW  +SRTVI+ S +   I P GW
Sbjct  432  RSDPNQNTGISIQNCTIQAAPDLAQDPNLTLSFLGRPWHNYSRTVIMQSYLGDVITPVGW  491

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT+GL   +YGEF N G G+  + R +WPG    +N + A  F    F +GDTW+P
Sbjct  492  LEWNGTYGLDTLYYGEFENYGPGANTTMRVQWPGY-SLMNASQAMNFTVYNFTMGDTWLP  550

Query  285  ATKVPYAAGL  256
             T VP++ GL
Sbjct  551  YTNVPFSQGL  560



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C I GT+DF+FGN+A V QNC +  RKP+     GQ C+VTAQG
Sbjct  246  YQDTLYVHSQRQFYRECYIYGTVDFIFGNSAVVLQNCMIYARKPM----QGQQCVVTAQG  301

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I NS++ ++   K     + ++LGRPW+++SRTV + S +D+ + P GW
Sbjct  302  RTDPNQNTGISIHNSRVMATDDLKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGW  361

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L   +YGEF N+G GS  + R KW G +   + + A  F  G FI G++W+P
Sbjct  362  LEWSGNFALNTLYYGEFKNSGLGSSTANRVKWKGYRVITSASEAAKFTVGSFISGNSWLP  421

Query  285  ATKVPYAAGL  256
             T VP+ AGL
Sbjct  422  GTGVPFTAGL  431



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 130/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYRDC I GT+DF+FG+A AV QNC + +RKP+    SGQ   +TAQG
Sbjct  347  YQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPM----SGQRNTLTAQG  402

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI I NS++T++   +       ++LGRPW+++SRTV + + +D+ I P+GW
Sbjct  403  RTDPNENTGISIHNSRVTAASDLRPLQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPDGW  462

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G++ L+  +YGE+ NTG G+  S+R KWPG    ++ + A  F  G F+ GDTWIP
Sbjct  463  LEWSGSFALSTLYYGEYMNTGVGASTSQRVKWPGFH-VMSASDAGKFTVGNFLGGDTWIP  521

Query  285  ATKVPYAAGL  256
            AT VP+ +G+
Sbjct  522  ATGVPFTSGM  531



>ref|XP_010101977.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90901.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=514

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYRDC + GT+DF+ G+A A+ QNC +++RKP+    S Q   VT+Q 
Sbjct  329  YQDTLYVYSQRQFYRDCNVYGTVDFICGDAVAILQNCNILVRKPM----SDQRNTVTSQA  384

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI+I NS+IT+S   +       ++LGRPW+++SRTVI+ S +D  I P+GW
Sbjct  385  RTDPNENTGIIIHNSRITASSDLRPVQGSFETYLGRPWQKYSRTVIMKSSLDGLIDPKGW  444

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L+  +Y EF N+G G+    R  WPG     + A A  F  G F+ GD+WIP
Sbjct  445  LPWSGNFALSTLYYAEFMNSGAGAATGGRVSWPGYHVLTSAAEAGKFTVGNFLGGDSWIP  504

Query  285  ATKVPYAAGL  256
            AT VP+AAGL
Sbjct  505  ATGVPFAAGL  514



>ref|XP_006361900.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25-like 
[Solanum tuberosum]
Length=566

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDC I GT+DF+FGNAAA+FQNC L  RKP+ +    Q  + TAQG
Sbjct  382  YQDTLYVHSLRQFYRDCDIYGTVDFIFGNAAAIFQNCNLFARKPMPD----QKNIFTAQG  437

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  ++ TGI I N  I ++P     P+  +SFLGRPW  +SRTVI+ S I   I P GW
Sbjct  438  RSDPNQNTGISIQNCTIQAAPDLAQDPNLTLSFLGRPWHNYSRTVIMQSYIGDVITPVGW  497

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT+GL   +YGEF N G G+  + R +WPG    +N   A  F    F +GDTW+P
Sbjct  498  LEWNGTYGLDTLYYGEFENYGPGANTTMRVQWPGY-SLMNALQAMNFTVYNFTMGDTWLP  556

Query  285  ATKVPYAAGL  256
             T VP++ GL
Sbjct  557  YTNVPFSQGL  566



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 126/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H  RQFYRDCTITGTIDF+FG++A++FQNC + +RKPL N    Q C+VTA G
Sbjct  396  YQDTLYCHTKRQFYRDCTITGTIDFIFGDSASIFQNCLIKVRKPLAN----QQCIVTASG  451

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E T I++ N  I++   Y        S+LGRPW+ +SRT+I+ S+ID  I PEGW
Sbjct  452  RKDRREATAIILHNCTISADSEYLPFHIQNPSYLGRPWKPYSRTIIMQSQIDEFIHPEGW  511

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G  GL  C+Y E  N G G+ ++KR  W G K +I+ +HA+ F   +FI G++W+ 
Sbjct  512  LPWLGDVGLHTCFYAEVDNHGLGANVTKRVTWRGYK-KIDSSHAQQFTVQRFIQGNSWLR  570

Query  285  ATKVPYAAGLNP  250
             T VPY  GL P
Sbjct  571  PTGVPYIPGLLP  582



>ref|XP_010277646.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=521

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH++RQFY+ C I GT+DF+FGNAAAV Q+C +  RKP+       + +VTAQG
Sbjct  337  YQDTLYVHSNRQFYKQCDIYGTVDFIFGNAAAVLQDCNIYARKPI-----AGTVVVTAQG  391

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  A++ TGIVI NS+IT++P  K     + ++LGRPW+ +SRTVI+ + +D+ I P GW
Sbjct  392  RLNANQSTGIVIHNSRITAAPDLKPVQRSVETYLGRPWQLYSRTVILKTFLDSLINPAGW  451

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT+ L   +YGEF NTG GS  + R KW G     + A A  F  G FI G++W+P
Sbjct  452  MEWNGTFALNTLYYGEFQNTGPGSSTANRVKWGGYHVITSAAEASQFTVGNFIDGNSWLP  511

Query  285  ATKVPYAAGL  256
             T VP+ +GL
Sbjct  512  DTNVPFTSGL  521



>sp|P83218.1|PME_DAUCA RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Daucus carota]
Length=319

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 124/191 (65%), Gaps = 4/191 (2%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQD+LYVH++RQF+ +C I GT+DF+FGNAA V Q+C +  R+P    GSGQ  MVTAQ
Sbjct  133  AYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRP----GSGQKNMVTAQ  188

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   ++ TGIVI  S+I ++   +   S   ++LGRPW+++SRTV++ S I   I P G
Sbjct  189  GRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSRTVVMQSSITNVINPAG  248

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W P+ G + L   +YGE+ NTG G+  S R  W G K   +   A+GF PG FI G +W+
Sbjct  249  WFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTEAQGFTPGSFIAGGSWL  308

Query  288  PATKVPYAAGL  256
             AT  P++ GL
Sbjct  309  KATTFPFSLGL  319



>ref|XP_007045218.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY01050.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=520

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYRDC I GT+DF+FG+A AV QNC + IRKP+    S Q   VTAQG
Sbjct  336  YQDTLYVYSQRQFYRDCDIYGTLDFIFGDAVAVLQNCNIYIRKPM----SNQRNTVTAQG  391

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  A+E TGI+I NS++T+S   +       S+LGRPW+++SRTV + S +D  I  EGW
Sbjct  392  RTDANENTGIIIHNSRVTASSDLRGVQGSFKSYLGRPWQKYSRTVFMKSVLDGVITAEGW  451

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L+  +Y E  NTG G+  S R KW G    I+ A A  F  G F+ GD WIP
Sbjct  452  LPWSGSFALSTLYYAEHMNTGAGADTSGRVKWGGYH-VISAAEAGKFTVGNFLAGDAWIP  510

Query  285  ATKVPYAAGL  256
             T VP+ AGL
Sbjct  511  GTGVPFDAGL  520



>ref|XP_002868170.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44429.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=713

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 129/189 (68%), Gaps = 5/189 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYR+C ++GTIDFVFG+A AVFQNC  +IR+P+      Q C+VTAQG
Sbjct  530  YQDTLYVHTHRQFYRNCRVSGTIDFVFGDAKAVFQNCEFVIRRPM----EHQQCIVTAQG  585

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+IT    Y    +   +FLGRPW++ SRT+I+N++ID  I PEGW
Sbjct  586  RKDRRETTGIVIHNSRITGDASYLPVKAKNRAFLGRPWKEFSRTIIMNTEIDDVIDPEGW  645

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS   +R +W GIK RI+   A  FAPG F+ G+TWIP
Sbjct  646  LKWNETFALNTLFYTEYRNRGRGSGQGRRVRWRGIK-RISDRVAREFAPGNFLRGNTWIP  704

Query  285  ATKVPYAAG  259
             T++PY A 
Sbjct  705  QTRIPYNAN  713



>emb|CDY18942.1| BnaC04g04080D [Brassica napus]
Length=258

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 126/190 (66%), Gaps = 6/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH++RQFYRDC + GT+DF+FGNAAAV QNC +  R+P       ++  +TAQG
Sbjct  75   YQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRP-----RSKTNTITAQG  129

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  ++ TGI+I NS++T++   +       ++LGRPWRQ+SRTV + + +D+ I P GW
Sbjct  130  RSDRNQNTGIIIHNSRVTAASDLRPILGSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGW  189

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L+  +Y EF NTG G+  S R KWPG +   + + A  F  G FI G +WIP
Sbjct  190  LEWNGNFALSTLFYAEFQNTGPGASTSGRVKWPGFRVLRSASEASRFTVGSFIAGSSWIP  249

Query  285  ATKVPYAAGL  256
            ++ VP+ +GL
Sbjct  250  SS-VPFTSGL  258



>emb|CDX98808.1| BnaC09g50270D [Brassica napus]
Length=578

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C I GT+DF+FGNAAAVFQNC +  RKP++N    Q   VTA G
Sbjct  390  YQDTLYVHSLRQFYRECDIYGTVDFIFGNAAAVFQNCNIYARKPMVN----QKNAVTAHG  445

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I+N  I ++P     P+P ++FLGRPW+ +SRTV I S I   I P GW
Sbjct  446  RTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPVGW  505

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT GL    YGE+ N G G+  SKR +WPG    +N A A  F    F LGDTW+P
Sbjct  506  LEWNGTTGLDTISYGEYDNFGPGANTSKRVQWPGY-SLLNLAQAMIFTVYNFTLGDTWLP  564

Query  285  ATKVPYAAGL  256
             T +P+  GL
Sbjct  565  QTDIPFYGGL  574



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H +RQFYR+CTI+GTIDFVFG+A AVFQ C  ++RKP IN    Q+CMVTAQG
Sbjct  376  YQDTLYAHGYRQFYRNCTISGTIDFVFGDATAVFQKCRFIVRKPDIN----QNCMVTAQG  431

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  +      VI NS+I    G+      I +FLGRPW+++SRT+I+N+ ID  I P GW
Sbjct  432  RKDSRSIGVTVIQNSEIVPEAGFTAVKPKIDAFLGRPWKEYSRTLIMNTFIDGFIDPAGW  491

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G +GL   +YGE+ N G G+  SKR  W GI+ +I    A  F   K  L D W+ 
Sbjct  492  SPWMGNYGLNTLYYGEYQNKGPGADTSKRVTWKGIQ-KITPEIALSFTAQKVYLNDGWVT  550

Query  285  ATKVPYAAGL  256
             + VPY  GL
Sbjct  551  NSSVPYTPGL  560



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 125/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYVH+HR F+RDCT++GT+DF+FG+A  + QNC +++RKP +    GQSCMVTAQG
Sbjct  380  HQDTLYVHSHRHFFRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKL----GQSCMVTAQG  435

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG+V+ N  IT  P Y    S   S+LGRPW+Q SRT+++ + ID  I P GW
Sbjct  436  RTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGRPWKQFSRTIVMKTMIDDVIDPAGW  495

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L   +Y E  NTG GS  ++R KWPGI+ ++    A  +   +F+ G+TWIP
Sbjct  496  LAWSGDFALKTLYYAEHLNTGPGSNQAQRVKWPGIR-KLTPQDALLYTGDRFLGGNTWIP  554

Query  285  ATKVPYAAGL  256
             T+VPY   +
Sbjct  555  PTQVPYTPNM  564



>pdb|1GQ8|A Chain A, Pectin Methylesterase From Carrot
Length=319

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 124/191 (65%), Gaps = 4/191 (2%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQD+LYVH++RQF+ +C I GT+DF+FGNAA V Q+C +  R+P    GSGQ  MVTAQ
Sbjct  133  AYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRP----GSGQKNMVTAQ  188

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   ++ TGIVI  S+I ++   +   S   ++LGRPW+++SRTV++ S I   I P G
Sbjct  189  GRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSRTVVMQSSITNVINPAG  248

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W P+ G + L   +YGE+ NTG G+  S R  W G K   +   A+GF PG FI G +W+
Sbjct  249  WFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTEAQGFTPGSFIAGGSWL  308

Query  288  PATKVPYAAGL  256
             AT  P++ GL
Sbjct  309  KATTFPFSLGL  319



>gb|KHN04166.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=394

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 124/193 (64%), Gaps = 8/193 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H  RQFYRDCTI+GTIDFVFGNA AVFQNCT ++RKP+ N    Q C+VTAQG
Sbjct  193  YQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMEN----QQCIVTAQG  248

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+GIVI    I S P + +      ++L RPW+ +SRT+I+++ ID  I  +G+
Sbjct  249  RKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLIDADGY  308

Query  465  SPFQGTW---GLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDT  295
             P+QG     G+  C+Y E+ N G GS  SKR KW GI   +N   A  F+P KF  G  
Sbjct  309  LPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNSKAARWFSPSKFFHGTD  367

Query  294  WIPATKVPYAAGL  256
            WI  T +PY  G+
Sbjct  368  WIEVTGIPYFPGV  380



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 121/192 (63%), Gaps = 4/192 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H  RQ+YRDCT+TGTIDF+FGNA  VFQNC + +R+ + N    Q  ++TAQG
Sbjct  369  YQDTLYTHTSRQYYRDCTVTGTIDFIFGNAQVVFQNCLIQVRRCMDN----QQNIITAQG  424

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +     G VI+N  I   P +K     + +FLGRPW+++SRT+ I S+I   I P+GW
Sbjct  425  RKEKHSAGGTVILNCTIEPHPEFKEHAGRLRTFLGRPWKEYSRTLYIQSEIGGFIDPQGW  484

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL  C+Y E  N G GS +SKRAKW G+K    +   + +   KFI G TWIP
Sbjct  485  LPWLGDFGLNTCYYAEVDNHGPGSDMSKRAKWRGVKTVTYQQAQQKYTIEKFIQGQTWIP  544

Query  285  ATKVPYAAGLNP  250
               VPY  GL P
Sbjct  545  KYGVPYIPGLLP  556



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 125/192 (65%), Gaps = 5/192 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFYRDCTITGTIDF+FG++A + QNC +++RKP+ N    Q  +VTA G
Sbjct  378  YQDTLYAHSGRQFYRDCTITGTIDFIFGDSATMLQNCMIIVRKPMDN----QQNIVTAHG  433

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        +VI N  ITS P Y  S   + ++LGRPW+ +SRT+I+ S++D  + P+GW
Sbjct  434  RIDRQGNGALVIQNCTITSDPAYYPSRKKLPTYLGRPWKPYSRTLILQSQLDDLVHPDGW  493

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G  GL  C+Y E  N G G+ L+KR  WPGIK +++   A+ F    ++ G TWIP
Sbjct  494  MPWNGNIGLDTCFYAELDNRGPGANLTKRVTWPGIK-KLSYDEAQRFTVEHYLFGQTWIP  552

Query  285  ATKVPYAAGLNP  250
             T VP+  GL P
Sbjct  553  RTGVPFIPGLLP  564



>ref|XP_009628695.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nicotiana tomentosiformis]
Length=490

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 123/186 (66%), Gaps = 4/186 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL VH+ RQFYRDC I GTIDF+FG+AAAVFQNC + +++P+      QS M+TAQG
Sbjct  307  YQDTLLVHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVKRPM----DHQSNMITAQG  362

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  ++E TGIVI+NS++  S  +       +++LGRPW+++SRTV I + +D  I P+GW
Sbjct  363  RDDSNENTGIVILNSRVAPSSEFSAVKGSFMNYLGRPWKKYSRTVFIKTDLDGLIHPKGW  422

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L+  +YGE+ NTG G+ +  R  WPG     +   A  F    FI G++WIP
Sbjct  423  KEWSGNFALSTLYYGEYMNTGSGADIGNRVNWPGFHVLRDANEASPFTVRNFIQGESWIP  482

Query  285  ATKVPY  268
            A+ VPY
Sbjct  483  ASGVPY  488



>ref|XP_009142158.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Brassica rapa]
 emb|CDY30378.1| BnaA04g24790D [Brassica napus]
Length=516

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 125/190 (66%), Gaps = 13/190 (7%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQD+LY H+ RQFYRD  ITGT+D++FGN+AAVFQ+C ++ RKPL    SGQ+  VTAQG
Sbjct  338  YQDSLYTHSKRQFYRDTDITGTVDYIFGNSAAVFQSCNIVARKPL----SGQTNFVTAQG  393

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+   + TGI I N +IT+            ++LGRPW+++SRTV++ S +D  I P GW
Sbjct  394  RSNPGQNTGISIQNCKITAQS---------TTYLGRPWKEYSRTVVMQSFLDGSIHPSGW  444

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G +GL   +YGEFGN+G GS +S R KW G    +    AEGF    FI G  W+P
Sbjct  445  SPWSGGFGLKTLFYGEFGNSGPGSSVSGRVKWAGYHSSLTVKEAEGFTVANFIGGTMWLP  504

Query  285  ATKVPYAAGL  256
            +T V + +GL
Sbjct  505  STGVSFDSGL  514



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 127/194 (65%), Gaps = 8/194 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFYRDC ITGTIDFVFG+AAAVFQNC L++RKP    G GQ+CMVTAQG
Sbjct  363  YQDTLYAHSGRQFYRDCIITGTIDFVFGDAAAVFQNCKLIVRKP----GDGQNCMVTAQG  418

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        +V+ N +I + P +  +  PI +FLGRPW+++SRT+I+ S ID  I P GW
Sbjct  419  RTTPASKGALVMQNCEIKAEPEFLATKPPIKAFLGRPWKEYSRTIIMQSYIDGFIDPTGW  478

Query  465  SPFQGT-WGLTDCWYGEFGNTGKGSVLSKR-AKWPGIKGRINKAHAEGFAPGKFI--LGD  298
            +P+  T +G+  CWY E+ N G G+ L KR + W G +  I+   A  F  G FI     
Sbjct  479  APWNTTEFGIHTCWYAEYQNRGPGASLDKRISHWRGYQKGISGDVANSFTAGLFINPTDS  538

Query  297  TWIPATKVPYAAGL  256
            +++P   +PY AG+
Sbjct  539  SFLPKADIPYEAGM  552



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 124/192 (65%), Gaps = 5/192 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH  RQFYRDC I+GTIDF+FG+ AAV QNC ++ RKP+ N    Q  +VTAQG
Sbjct  365  YQDTLYVHTKRQFYRDCNISGTIDFIFGDGAAVLQNCLILARKPMDN----QQNIVTAQG  420

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    + T IV+ N  I++ P +      + +FLGRPW++ SRT ++ S++D  I P+GW
Sbjct  421  RKDRRQATAIVLHNCTISADPAFFPFREKLPTFLGRPWKEFSRTFVLQSQLDDLIDPKGW  480

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+   +GL  C+Y E  N G G+  S+R KW G+K  I  AHA+ F    FI G+TW+P
Sbjct  481  LPWFENFGLNTCFYTELDNRGPGANTSQRVKWKGVKT-IGYAHAQKFTVEHFIQGNTWLP  539

Query  285  ATKVPYAAGLNP  250
             + VPY  GL P
Sbjct  540  KSGVPYIPGLLP  551



>ref|XP_006414405.1| hypothetical protein EUTSA_v10024582mg [Eutrema salsugineum]
 gb|ESQ55858.1| hypothetical protein EUTSA_v10024582mg [Eutrema salsugineum]
Length=684

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 126/189 (67%), Gaps = 5/189 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDC I+GTIDFVFG+A AVFQNC  +IR+P+ N    Q C+VTAQG
Sbjct  501  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCEFVIRRPMDN----QQCIVTAQG  556

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+IT    Y    +   +FLGRPW+++SRT+I+N++ID  I PEGW
Sbjct  557  RKDRRETTGIVIHNSRITGDATYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGW  616

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS  ++         R++   A+ F+PG F+ G+ WIP
Sbjct  617  LKWNETFALNTLFYSEYRNRGRGSGQAR-RVRWRGIRRMSDRDAKEFSPGNFLRGNAWIP  675

Query  285  ATKVPYAAG  259
             T+VPY A 
Sbjct  676  QTRVPYNAN  684



>ref|XP_011046483.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Populus euphratica]
Length=569

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 123/191 (64%), Gaps = 5/191 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C + GT+DF+FGNAAAVFQNC L  RKP++N    Q    TAQG
Sbjct  384  YQDTLYVHSLRQFYRECDVYGTVDFIFGNAAAVFQNCNLYARKPMLN----QKNAFTAQG  439

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I N  I ++P      +  ++FLGRPW+++SRTVI+ S I   I P GW
Sbjct  440  RTDPNQNTGISIHNCTIEAAPDLAMDRNSTLNFLGRPWKEYSRTVIMQSYIGELIQPVGW  499

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT GL   +YGEF N G G+  S+R +WPG    +N   A  F    F +GDTW+P
Sbjct  500  LEWNGTVGLDTIYYGEFQNYGPGANTSRRVQWPGFN-LMNTTQAVNFTVYNFTMGDTWLP  558

Query  285  ATKVPYAAGLN  253
             T VP++ GL+
Sbjct  559  YTDVPFSGGLD  569



>emb|CDX80933.1| BnaC03g01870D [Brassica napus]
Length=352

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 119/190 (63%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C I GTIDF+FGNAAAVFQNC +  RKP+      Q   VTA G
Sbjct  164  YQDTLYVHSLRQFYRECDIYGTIDFIFGNAAAVFQNCNIYARKPM----EHQKNAVTAHG  219

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I+N  I ++P     P+P ++FLGRPW+ +SRTV I S I   I P GW
Sbjct  220  RTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPVGW  279

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT GL    YGE+ N G G+  SKR +W G    +N A A  F    F LGDTW+P
Sbjct  280  LEWNGTTGLDTISYGEYDNFGPGANTSKRVQWSGYS-LLNLAQAMNFTVYNFTLGDTWLP  338

Query  285  ATKVPYAAGL  256
             T +P+  GL
Sbjct  339  QTDIPFYGGL  348



>ref|XP_007219055.1| hypothetical protein PRUPE_ppa004770mg [Prunus persica]
 gb|EMJ20254.1| hypothetical protein PRUPE_ppa004770mg [Prunus persica]
Length=492

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVHA+RQFYRDC I GTIDF+FGNA AV QNC + +R+P+    + QS M+TAQG
Sbjct  307  YQDTLYVHANRQFYRDCQIYGTIDFIFGNAIAVLQNCDIFVRRPM----NSQSNMITAQG  362

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  E TGIVI   ++  +P +        S+LGRPW++ SRTV + + +D  I P+GW
Sbjct  363  RDKESETTGIVIHGCRVRPAPEFARVKGSFRSYLGRPWKRFSRTVFMKTDLDGLIDPKGW  422

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            + ++G++GL+  +YGE+ NTG G+   +R KWPG     +   A  F   KFI G  W+P
Sbjct  423  TEWRGSYGLSTLFYGEYMNTGTGASTEQRVKWPGFHVLNSPQEASPFTVNKFIQGQFWLP  482

Query  285  ATKVPYAAGL  256
            AT VP+  G+
Sbjct  483  ATGVPFWPGI  492



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 120/191 (63%), Gaps = 5/191 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY   +RQ+YRDCTI+GT+DF+FG+  A+FQNC +++RKP    G  QSCMVTAQ
Sbjct  382  AYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQNCRMVVRKP----GDSQSCMVTAQ  437

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   +E T IV+ N  IT  P Y        ++LGRPW+  +R V+I S+ID  IAPEG
Sbjct  438  GRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKGFARVVVIQSQIDNAIAPEG  497

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W+ + G    T C+  E GN G G+ +SKR KW  +  ++    A  F P +   GD W+
Sbjct  498  WTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLM-KLTPEQAAAFTPARLFEGDKWV  556

Query  288  PATKVPYAAGL  256
              + VPY +G+
Sbjct  557  KPSGVPYVSGM  567



>ref|XP_006347998.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Solanum tuberosum]
Length=495

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL VH+ RQFYRDC + GTIDF+FG+A+AVFQNC + +++P+      QS M+TAQG
Sbjct  310  YQDTLLVHSLRQFYRDCHVYGTIDFIFGDASAVFQNCDIFVKRPM----DYQSNMITAQG  365

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  ++E TGIVI+NS+++SS  +        ++LGRPW+++SRTV I + +D  I P+GW
Sbjct  366  RDDSNENTGIVILNSRVSSSSEFTAVKDSFKNYLGRPWKKYSRTVFIKTDLDGLIDPKGW  425

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L+  +Y E+ NTG G+    R  WPG     +   A  F    FI G++WIP
Sbjct  426  KEWSGDFALSTLYYAEYMNTGSGANTGNRVNWPGFHVLRDANEASPFTVTNFIQGESWIP  485

Query  285  ATKVPYAAGL  256
            A+ VPY AG+
Sbjct  486  ASGVPYWAGI  495



>gb|EYU24929.1| hypothetical protein MIMGU_mgv1a025888mg, partial [Erythranthe 
guttata]
Length=486

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 127/190 (67%), Gaps = 8/190 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYR+C I GTIDF+FG++ +V QN  + IRKP+ N    Q   VTAQG
Sbjct  305  YQDTLYVYSQRQFYRNCDIYGTIDFIFGDSVSVIQNSNIYIRKPMSN----QKNTVTAQG  360

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGIVI NS++TS+ G  + P P  S+LGRPW+Q+SRTV +   ID  I P GW
Sbjct  361  RKDPNENTGIVIHNSRVTSASG--SGPGP--SYLGRPWQQYSRTVFMKCAIDGIIEPAGW  416

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L+  +YGE+ NTG G+    R KWPG     + A A  F+ G F+ G +WIP
Sbjct  417  LPWSGSFALSTLYYGEYMNTGSGASTGGRVKWPGFHVITSAAEAGKFSVGNFLAGGSWIP  476

Query  285  ATKVPYAAGL  256
            AT VPY +G+
Sbjct  477  ATGVPYTSGV  486



>ref|XP_010069898.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Eucalyptus grandis]
Length=562

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 121/191 (63%), Gaps = 5/191 (3%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLY H+ RQFYR+C + GT+DF+FGNAA VFQNC L  R PL    SGQS M+TAQ
Sbjct  376  AYQDTLYTHSMRQFYRECDVYGTVDFIFGNAAVVFQNCNLYPRLPL----SGQSNMITAQ  431

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   ++ TG  I N  I ++    +S + + ++LGRPW+Q+SRTV + S +D+ I P G
Sbjct  432  GRTDVNQNTGTSIHNCTIRAADDLASSNTSVQTYLGRPWKQYSRTVYMQSFMDSLINPAG  491

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W  + G + L+  +Y E+ NTG GS  + R  WPG    IN   A  F    F+LGD W+
Sbjct  492  WQIWSGDFALSTLYYAEYNNTGPGSNTTNRVTWPGYH-VINATDAANFTVSSFLLGDAWL  550

Query  288  PATKVPYAAGL  256
            P T VPY  GL
Sbjct  551  PQTGVPYTGGL  561



>ref|XP_007222925.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
 gb|EMJ24124.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
Length=472

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYR+C + GTIDF+ G+A AV QNC + +RKP+ N    Q   VTAQ 
Sbjct  287  YQDTLYVYSQRQFYRECDVYGTIDFICGDATAVLQNCNVYVRKPMSN----QVNTVTAQS  342

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  A+E TGIVI +S++T++P  +       ++LGRPW+++SRTVI+ S +D  I P GW
Sbjct  343  RTDANENTGIVIHSSRVTAAPDLRAVQGSFRTYLGRPWKKYSRTVIMKSDLDGLIDPAGW  402

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L+  +YGE+ N+G G     R KWPG +   +   A  F  G  + G++WIP
Sbjct  403  FPWSGSFALSTLYYGEYMNSGAGGATGGRVKWPGYRVITSAVEAGKFTVGNILAGESWIP  462

Query  285  ATKVPYAAGL  256
            AT VP++AGL
Sbjct  463  ATGVPFSAGL  472



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 121/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQFYRDCTI+GTIDF+FG+AAAVFQNCT ++RKPL N    Q+C +TA G
Sbjct  380  YQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTFLVRKPLPN----QACPITAHG  435

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V+    I+    Y        ++LGRPW+++SRT+I+N+ I   I PEGW
Sbjct  436  RKDPRETTGFVLQGCTISGETDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIPPEGW  495

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+   +GL   +Y E  NTG G+    R  WPGIK ++ +     F P ++I GD WIP
Sbjct  496  QPWLDNFGLETLFYSEVRNTGPGAPAMNRVTWPGIK-KLGEEEILKFTPAQYIQGDAWIP  554

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  555  GKGVPYTPGL  564



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLY H +RQFYR+C I+GTIDFVFG++AAV QNCTL +RKPL N    Q C+VTAQG
Sbjct  379  FQDTLYAHTYRQFYRNCKISGTIDFVFGDSAAVLQNCTLEVRKPLDN----QQCIVTAQG  434

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    +PTG+V+ N    + P Y      + S+LGRPW++ SRT+I+ S ID  I PEGW
Sbjct  435  RKDVRQPTGLVLQNCSFVADPAYFPYRFQLKSYLGRPWKEFSRTIIMESFIDDLIQPEGW  494

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G++ L   +Y EF N G  S    RA+W G+K  +  +  E F P KFI G+ WI 
Sbjct  495  LAWNGSFALDTLFYAEFNNRGPSSNKMLRAQWNGVK-ELPSSRVERFLPSKFIDGNHWIK  553

Query  285  ATKVPYAAGL  256
            + +VPY +G 
Sbjct  554  SARVPYNSGF  563



>ref|XP_004231159.2| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 36 [Solanum lycopersicum]
Length=502

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL VH+ RQFYRDC I GTIDF+FG+A+AVFQNC + +++P+      QS M+TAQG
Sbjct  317  YQDTLLVHSLRQFYRDCHIYGTIDFIFGDASAVFQNCDIFVKRPM----DSQSNMITAQG  372

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
               ++E TGIVI+NS+++SS  +        ++LGRPW+++SRTV I + +D  I P+GW
Sbjct  373  XDDSNENTGIVILNSRVSSSSEFTAVKDSFKNYLGRPWKKYSRTVFIKTDLDGLIDPKGW  432

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L+  +Y E+ NTG G+    R  WPG     +   A  F    FI G++WIP
Sbjct  433  KEWSGDFALSTLYYAEYMNTGSGANTGNRVNWPGFHVLHDANEASQFTVRNFIQGESWIP  492

Query  285  ATKVPYAAGL  256
            A+ VPY AG+
Sbjct  493  ASGVPYWAGI  502



>emb|CDY66111.1| BnaAnng21510D [Brassica napus]
Length=736

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 125/188 (66%), Gaps = 5/188 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDC I+GTIDFVFG+A AVFQNC  +IR+P+ N    Q C+VTAQG
Sbjct  553  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCEFVIRRPMDN----QQCIVTAQG  608

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+IT    Y+   +   +FLGRPW+++SRT+I+N+ ID  I PEGW
Sbjct  609  RKDRRETTGIVIHNSRITGDATYRPVKAKNRAFLGRPWKEYSRTIIMNTNIDDVIDPEGW  668

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS  ++         RI+   A GFAPG+F+ G+ WI 
Sbjct  669  LKWNETFALKTLFYSEYRNRGRGSGQAR-RVRWRGIRRISARQARGFAPGEFLRGNAWIT  727

Query  285  ATKVPYAA  262
              ++PY A
Sbjct  728  KRRIPYNA  735



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   197 bits (500),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQF+RDCTI+GTIDF+FG++AAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++SRT+I+N+ I   I P+GW
Sbjct  437  RIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  W GIK  ++      F P ++I GD W+P
Sbjct  497  LPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEEVLMFTPAQYIQGDIWVP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTPGL  565



>ref|XP_009107897.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Brassica rapa]
Length=753

 Score =   197 bits (501),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 125/188 (66%), Gaps = 5/188 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH HRQFYRDC I+GTIDFVFG+A AVFQNC  +IR+P+ N    Q C+VTAQG
Sbjct  570  YQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCEFVIRRPMDN----QQCIVTAQG  625

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIVI NS+IT    Y+   +   +FLGRPW+++SRT+I+N+ ID  I PEGW
Sbjct  626  RKDRRETTGIVIHNSRITGDATYRPVKAKNRAFLGRPWKEYSRTIIMNTNIDDVIDPEGW  685

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +  T+ L   +Y E+ N G+GS  ++         RI+   A GFAPG+F+ G+ WI 
Sbjct  686  LKWNETFALKTLFYSEYRNRGRGSGQAR-RVRWRGIRRISARQARGFAPGEFLRGNAWIT  744

Query  285  ATKVPYAA  262
              ++PY A
Sbjct  745  KRRIPYNA  752



>ref|XP_002876579.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52838.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+ H+ RQFYRDC I GTIDF+FG+A AVFQNC + +R+P+ + G+    M+TAQG
Sbjct  335  YQDTLFTHSLRQFYRDCHIYGTIDFIFGDATAVFQNCDIFVRRPMDHQGN----MITAQG  390

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R      +GI I +S+I ++P ++       S+LGRPW+++SRTV++ + ID  I P GW
Sbjct  391  RDDPHSNSGISIQHSRIRAAPEFEAVKGRFKSYLGRPWKKYSRTVLLKTDIDELIDPRGW  450

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G++ L+  +YGEF NTG G+  S+R  WPG      +  A  F   +FI GD+WIP
Sbjct  451  REWSGSYALSTLYYGEFMNTGAGAGTSRRVNWPGFHVLRGQEEASPFTVSRFIQGDSWIP  510

Query  285  ATKVPYAAGL  256
             T VP++AG+
Sbjct  511  ITGVPFSAGV  520



>ref|XP_008232608.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Prunus mume]
Length=490

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVHA+RQFYRDC I GTIDF+FGNA AV QNC + +R+P+    + QS M+TAQG
Sbjct  305  YQDTLYVHANRQFYRDCQIYGTIDFIFGNAIAVLQNCDIFVRRPM----NSQSNMITAQG  360

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  E TGIVI   ++  +P +        S+LGRPW++ SRTV + + +D  I P+GW
Sbjct  361  RDKELETTGIVIHGCRVRPAPEFARVTGSFRSYLGRPWKRFSRTVFMETDLDGLIDPKGW  420

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            + ++G++GL+  +YGE+ NTG G+   +R KWPG     +   A  F+  KFI G  W+P
Sbjct  421  TEWRGSYGLSTLFYGEYMNTGTGASTEQRVKWPGFHVLNSPQEASPFSVNKFIQGQFWLP  480

Query  285  ATKVPYAAGL  256
            AT VP+  G+
Sbjct  481  ATGVPFWPGI  490



>ref|XP_002314796.1| pectin methylesterase 6 family protein [Populus trichocarpa]
 gb|EEF00967.1| pectin methylesterase 6 family protein [Populus trichocarpa]
Length=531

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 123/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDC I GT+DF+FG+A AV QNC + +R+P+    S Q+  VTAQG
Sbjct  346  YQDTLYVHSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRRPM----SKQTNTVTAQG  401

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   DE TGIVI NS++ ++P  +       S+LGRPW+++SRTV + S ID  I P GW
Sbjct  402  RTDPDENTGIVIHNSRVMAAPDLRPVQGSFKSYLGRPWKKYSRTVFLKSNIDGLIDPAGW  461

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P++G + L+  +YGE+ +TG G+    R KWPG     +   A  F    F+ G++WI 
Sbjct  462  LPWKGDFALSTLYYGEYMSTGSGASTKGRVKWPGYHTITSPLEAGKFTVENFLAGNSWIS  521

Query  285  ATKVPYAAGL  256
            A  VP+ +GL
Sbjct  522  AAGVPFESGL  531



>ref|XP_010552499.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Tarenaya hassleriana]
Length=536

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 129/190 (68%), Gaps = 8/190 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFYR+  I+GT+DF+FGN+AAVFQ+C +M RKPL    SGQ+  VTAQG
Sbjct  353  YQDTLYTHSKRQFYRETDISGTVDFIFGNSAAVFQSCNIMARKPL----SGQNNFVTAQG  408

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  +++ TG+ I N +I ++     S +    +LGRPW+Q+SRTV++ S ID  I P GW
Sbjct  409  RISSNQNTGLSIHNCRIGAAESLGGSKT----YLGRPWKQYSRTVVMQSFIDGSIHPSGW  464

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G++ L   +YGE+GN+G GS +S R KW G    +  A A+GF    FI G+ W+P
Sbjct  465  SPWSGSFALNTLFYGEYGNSGPGSSVSGRVKWSGYHPSLTLAEAQGFTVSGFIQGNMWLP  524

Query  285  ATKVPYAAGL  256
            +T V + +GL
Sbjct  525  STGVSFDSGL  534



>ref|XP_008221458.1| PREDICTED: pectinesterase [Prunus mume]
Length=520

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV+A RQFYR+C + GT+DF+ G+A AV QNC + +RKP+ N    Q   VTAQ 
Sbjct  335  YQDTLYVYAQRQFYRECDVYGTVDFICGDATAVLQNCNMYVRKPMSN----QVNTVTAQS  390

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R  A+E TGIVI +S++T++P  +       ++LGRPW+++SRTVI+ S +D  I P GW
Sbjct  391  RTDANENTGIVIHSSRVTAAPDLRAVQGSFRTYLGRPWQKYSRTVIMKSDLDGLIDPAGW  450

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L+  +YGE+ N+G G+    R KWPG +   +   A  F  G  + G++WIP
Sbjct  451  FPWNGNFALSTLYYGEYMNSGAGAATGGRVKWPGYRVITSAVEAGKFTVGNILAGESWIP  510

Query  285  ATKVPYAAGL  256
            AT VP++AGL
Sbjct  511  ATGVPFSAGL  520



>gb|KDO36003.1| hypothetical protein CISIN_1g029714mg [Citrus sinensis]
Length=189

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 121/191 (63%), Gaps = 4/191 (2%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLYVH++RQF+ +C I GT+DF+FGNAAAV QNC +  RKP     SGQ  MVTAQ
Sbjct  3    AYQDTLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQNCDIHARKP----NSGQKNMVTAQ  58

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GRA  ++ TGIVI  S+I ++   K       ++LGRPW+++SRTVI+ S I   I P G
Sbjct  59   GRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDVIHPAG  118

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W  + G + L   +YGE  N G G+  S R KW G +   +   A+ F PG FI G +W+
Sbjct  119  WHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFIAGSSWL  178

Query  288  PATKVPYAAGL  256
             +T  P++ GL
Sbjct  179  GSTGFPFSLGL  189



>ref|XP_010044212.1| PREDICTED: pectinesterase [Eucalyptus grandis]
Length=552

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 129/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV+A RQFYRDC I GT DF+FG+A  V QNC + IRKP+    SGQ   VTAQG
Sbjct  367  YQDTLYVYAQRQFYRDCDIYGTQDFIFGDAVTVLQNCNIYIRKPI----SGQINTVTAQG  422

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  +E TGI++ NS++T+S   K       ++LGRPW+++SRTV + + +D+ IAP+GW
Sbjct  423  RSDPNENTGIIVHNSRVTASSDMKPVQGSFKNYLGRPWQKYSRTVFMRTFLDSLIAPQGW  482

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G++ L+  +YGE+ NTG G+    R  WPG    ++   A  F  G F+ G++W+P
Sbjct  483  YPWSGSFALSTLYYGEYMNTGGGAGTGGRVNWPGYHATMSATEAAKFTVGNFLAGNSWLP  542

Query  285  ATKVPYAAGL  256
            AT VP++AGL
Sbjct  543  ATGVPFSAGL  552



>gb|KEH29120.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=489

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 121/191 (63%), Gaps = 4/191 (2%)
 Frame = -3

Query  828  AYQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQ  649
            AYQDTLYVH++RQFYRDC I GTIDF+FG+AA V QNC + IRKP+    S QS  +TAQ
Sbjct  303  AYQDTLYVHSNRQFYRDCHIYGTIDFIFGDAAVVLQNCDIFIRKPM----SHQSNFITAQ  358

Query  648  GRAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEG  469
            GR   ++PTGI I N ++     +      I SFLGRPW+++SRTV I S +D  I P+G
Sbjct  359  GRDDPNKPTGISIQNCRVRPDSDFSMVKDSIKSFLGRPWKKYSRTVFIKSDLDGLIHPKG  418

Query  468  WSPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWI  289
            W  ++G + L+  +YGE+ NTG G+    R  WPG     +   A  F   +F+ G+ WI
Sbjct  419  WGEWEGNFALSTLYYGEYMNTGNGASTQNRVNWPGFHVLKSSDEASQFTVSRFLQGEHWI  478

Query  288  PATKVPYAAGL  256
             A+ VP  +G+
Sbjct  479  SASGVPVWSGI  489



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C I GT+DF+FGN+A V QNC +  RKP+     GQ C+VTAQG
Sbjct  335  YQDTLYVHSQRQFYRECYIYGTVDFIFGNSAVVLQNCMIYARKPM----QGQQCVVTAQG  390

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I NS++ ++   K     + ++LGRPW+++SRTV + S +D+ + P GW
Sbjct  391  RTDPNQNTGISIHNSRVMATDDLKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGW  450

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L   +YGEF N+G GS  + R KW G +   + + A  F  G FI G++W+P
Sbjct  451  LEWSGNFALNTLYYGEFKNSGPGSSTANRVKWKGYRVITSASEAAKFTVGSFIAGNSWLP  510

Query  285  ATKVPYAAGL  256
             T VP+ AGL
Sbjct  511  GTGVPFTAGL  520



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFY+DC + GT+DF+FGNAA V QNC +  RKP+    SGQ   +TAQG
Sbjct  334  YQDTLYTHSQRQFYKDCYVYGTVDFIFGNAAVVLQNCMIYARKPM----SGQKNTITAQG  389

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I +S++ ++P +K+S   + +FLGRPW+++SRTV + S +D  + P GW
Sbjct  390  RTDPNQNTGISIHDSRVMAAPDFKSSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGW  449

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L   +YGE+ N G G+  S+R KW G +   + + A  F    FI G +W+P
Sbjct  450  LEWSGNFALKTLYYGEYKNIGPGAPTSRRVKWGGYRVITSSSEASKFTVNNFIAGSSWLP  509

Query  285  ATKVPYAAGL  256
            AT VP+ AGL
Sbjct  510  ATNVPFTAGL  519



>emb|CDP21156.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 5/191 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C I GT+DF+FGN+AAVFQNC L  RKP+ N    Q   VTAQG
Sbjct  48   YQDTLYVHSLRQFYRECDIYGTVDFIFGNSAAVFQNCNLFARKPMPN----QKNAVTAQG  103

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I N  + ++P      +   ++LGRPW+++SRTV++ S I   I P+GW
Sbjct  104  RTDPNQNTGISIQNCSVQAAPNLSLDLNSTSTYLGRPWKEYSRTVVMQSFIGDLINPQGW  163

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +    GL   +YGE+ N G G+  S+R +WPG    +N   A  F    F +GDTW+P
Sbjct  164  LEWNANMGLDKIYYGEYENYGPGANTSRRVRWPGYS-HMNDLDALNFTMYNFAMGDTWLP  222

Query  285  ATKVPYAAGLN  253
             T +P++ GL+
Sbjct  223  YTNIPFSRGLH  233



>ref|XP_010543915.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 47 [Tarenaya hassleriana]
Length=479

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 119/194 (61%), Gaps = 5/194 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYRDC I GTIDF+FGNAAAVFQNC L  RKPL N    Q    TAQG
Sbjct  291  YQDTLYVHSLRQFYRDCDIYGTIDFIFGNAAAVFQNCNLYARKPLEN----QKNAFTAQG  346

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I N  I ++P     P+  ++FLGRPW+ +SRTV + S I   +  EGW
Sbjct  347  RTDPNQNTGISIHNCTIQAAPDLAADPNSTLTFLGRPWKPYSRTVYMQSYISEVVQAEGW  406

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT GL   +YGE+ N G GS  S R +WPG    +N   A  F      +GDTW+P
Sbjct  407  LEWNGTTGLDTIFYGEYENIGPGSNTSSRVQWPGYS-LMNLTQAMNFTVYNLTMGDTWLP  465

Query  285  ATKVPYAAGLNPNK  244
             T +P+  GL  N+
Sbjct  466  QTDIPFCGGLVHNE  479



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYVH+HR F+R+CT++GT+DF+FG+A  + QNC +++RKP      GQSCMVTAQG
Sbjct  384  HQDTLYVHSHRHFFRECTVSGTVDFIFGDAKCILQNCKIVVRKP----KKGQSCMVTAQG  439

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG+V+ N  IT  P Y    S   S+LGRPW+Q SRT+I+ + ID  I P GW
Sbjct  440  RTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGRPWKQFSRTIIMKTMIDDVIDPAGW  499

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L   +Y E  NTG GS  ++R KWPGI+ ++    A  +   +F+ G+TWIP
Sbjct  500  LAWSGDFALKTLYYAEHLNTGPGSNQAQRVKWPGIR-KLTPQDALLYTGDRFLGGNTWIP  558

Query  285  ATKVPYAAGL  256
             T+VPY   +
Sbjct  559  QTQVPYTPNM  568



>ref|XP_010524372.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 125/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH++RQFYR+C I GT+DF+FGNAAAVFQNC +  R+P       ++  VTAQG
Sbjct  329  YQDTLYVHSNRQFYRECDIYGTVDFIFGNAAAVFQNCNIFARRP-----RNKTNTVTAQG  383

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  ++ TGIVI NS++T+    +     + ++LGRPWRQ+SRTV + + +D  I P GW
Sbjct  384  RSDPNQNTGIVIHNSRVTAGSDLQPVLGSVKTYLGRPWRQYSRTVFMKTFLDGLIDPRGW  443

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L+  +Y E+ NTG GS  S R  WPG +     + A  F  G FI G++WIP
Sbjct  444  LEWNGNFALSTLFYAEYQNTGPGSSTSGRVTWPGFRVLTAASDASRFTVGSFIAGNSWIP  503

Query  285  ATKVPYAAGL  256
            AT VP+ +GL
Sbjct  504  ATNVPFTSGL  513



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H +RQ+YRD TI+GTIDF+FG++ A FQNC  ++RKP+ N    Q+CMVTAQG
Sbjct  397  YQDTLYAHNYRQYYRDSTISGTIDFIFGDSLAYFQNCKFIVRKPMEN----QACMVTAQG  452

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        IVI N  IT+ P +  +  PI ++LGRPW++ SRT+I+ + I   IAPEGW
Sbjct  453  RVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGW  512

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G + L  C+YGE+ N G GS L+KR  W GIK +I    A  +  G    GD WI 
Sbjct  513  SPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKGIK-KITPEIALSWTAGLAFKGDDWIK  571

Query  285  ATKVPY  268
            ++ VPY
Sbjct  572  SSGVPY  577



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H +RQFY DC+I+GTIDF+FG++ ++FQNC  ++RKP+ N    Q+CMVTAQG
Sbjct  379  YQDTLYAHNYRQFYSDCSISGTIDFIFGDSLSLFQNCKFIVRKPMDN----QACMVTAQG  434

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        IVI N  IT+   +  +   I ++LGRPW++ SRT+I+ S ID  I+P+GW
Sbjct  435  RVDPRSVGAIVIQNGHITAEAAFLATKPAIDAYLGRPWKELSRTIIMQSDIDGFISPDGW  494

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G + L  C+YGE+ N G GS L+ R  W GIK +I    A+ +  G    GD WI 
Sbjct  495  SPWMGNFALDTCYYGEYQNRGAGSGLANRVTWKGIK-KITPEIAQSWTGGVAFKGDEWIK  553

Query  285  ATKVPYAAGL  256
            A +VPY   L
Sbjct  554  AARVPYVPTL  563



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H +RQFY DC+I+GTIDF+FG++ ++FQNC  ++RKP+ N    Q+CMVTAQG
Sbjct  377  YQDTLYAHNYRQFYSDCSISGTIDFIFGDSLSLFQNCKFIVRKPMDN----QACMVTAQG  432

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        IVI N  IT+   +  +   I ++LGRPW++ SRT+I+ S ID  I+P+GW
Sbjct  433  RVDPRSVGAIVIQNGHITAEAAFLATKPAIDAYLGRPWKELSRTIIMQSDIDGFISPDGW  492

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G + L  C+YGE+ N G GS L+ R  W GIK +I    A+ +  G    GD WI 
Sbjct  493  SPWMGNFALDTCYYGEYQNRGAGSGLANRVTWKGIK-KITPEIAQSWTGGVAFKGDEWIK  551

Query  285  ATKVPYAAGL  256
            A +VPY   L
Sbjct  552  AARVPYVPTL  561



>emb|CDP19931.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            +QDTLYVH+ RQFYR+C + GTID++FGNAA VFQ C ++ R P+     GQ   +TAQ 
Sbjct  359  HQDTLYVHSFRQFYRECDVYGTIDYIFGNAAVVFQGCNVISRLPM----PGQFTAITAQS  414

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   DE TGI + N  I  +    ++ + + S+LGRPWR +SRTVII S ID  IAPEGW
Sbjct  415  RDIEDESTGISLQNCSILPTNDLNSNLATVKSYLGRPWRNYSRTVIIKSYIDEHIAPEGW  474

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            +P+QG  GL+  +YGE+GN G G+V   R  WPG    +N   A  FA  +FI GD W+ 
Sbjct  475  TPWQGDQGLSTLYYGEYGNDGPGAVTDNRVTWPGFH-IMNYDDASNFAVSEFITGDEWLD  533

Query  285  ATKVPYAAGL  256
            +T  PY  G+
Sbjct  534  STNFPYDNGI  543



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 122/190 (64%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYRDC I GTIDF+FG+A AV QNC + +R+P+    +GQ   VTAQG
Sbjct  344  YQDTLYVYSQRQFYRDCDIYGTIDFIFGDAVAVLQNCNIYVRRPM----NGQKNTVTAQG  399

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGIVI NS + ++   +       ++LGRPW+++SRT+ + S +D  I P GW
Sbjct  400  RKDPNENTGIVIHNSNVMATSDMRPVQGSFKTYLGRPWQKYSRTLFMKSNLDGLIDPAGW  459

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L+  +YGE+ NTG G+  ++R  WPG         A  F  G F+ GD+WIP
Sbjct  460  LPWSGNFALSTLYYGEYMNTGSGASTARRVNWPGYHVITKATDAGKFTVGNFLAGDSWIP  519

Query  285  ATKVPYAAGL  256
             T VP+ +GL
Sbjct  520  GTGVPFDSGL  529



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   193 bits (490),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYRDC I GT+DF+FG+AA VFQNC + +RKP+    SGQ   VTAQG
Sbjct  330  YQDTLYVYSQRQFYRDCNIYGTVDFIFGDAAVVFQNCDMYVRKPM----SGQKNTVTAQG  385

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI I +S +T++   K       ++LGRPW+++SRTV + + +D+ I P GW
Sbjct  386  RTDPNENTGISIHDSAVTAASDLKPVQGSFQTYLGRPWQKYSRTVYMKTSLDSLIDPAGW  445

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L+  +YGE+ NTG G+  S+R  WPG     + A A  F  G F+ G +WIP
Sbjct  446  LEWNGDFALSTLYYGEYMNTGAGADTSRRVNWPGYHVITSAAVASQFTVGNFLSGGSWIP  505

Query  285  ATKVPYAAGL  256
            AT VPY + L
Sbjct  506  ATGVPYTSDL  515



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQF+RDCTI+GTIDF+FG++AAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++S+T+I+N+ I   I P+GW
Sbjct  437  RIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  W GIK  ++      F P ++I GD W+P
Sbjct  497  LPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEEVLMFTPAQYIQGDIWVP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTPGL  565



>ref|XP_006292970.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
 gb|EOA25868.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
Length=527

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+ H+ RQFYRDC I GTIDF+FG+AAAVFQNC + +R+P+ + G+    M+TAQG
Sbjct  342  YQDTLFTHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQG  397

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R      TGI I +S++ ++P ++       ++LGRPW+++SRTV + + +D  I P GW
Sbjct  398  RDDPHANTGISIQHSRVRAAPEFEAVKGQFKNYLGRPWKKYSRTVFLKTDLDGLIDPRGW  457

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G + L+  +YGEF NTG G+  S+R  WPG     ++  A  F+  +FI GD+WIP
Sbjct  458  REWSGGYALSTLYYGEFMNTGTGAGTSRRVNWPGFHVLRDEGEASPFSVSRFIQGDSWIP  517

Query  285  ATKVPYAAGL  256
             T VP++AG+
Sbjct  518  ITGVPFSAGV  527



>ref|XP_010938361.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Elaeis guineensis]
Length=575

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 118/190 (62%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFYR+C I GT+D++FGNAA VFQNC +  R P+     GQS  VTAQG
Sbjct  390  YQDTLYTHSMRQFYRECDIYGTVDYIFGNAAVVFQNCNIYSRLPM----QGQSNTVTAQG  445

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TG VI    I ++P   +     +++LGRPW+ +SRTVI+ S +D+ I P+GW
Sbjct  446  RTDPNQNTGTVIQECNIVAAPDLASDGGSTITYLGRPWKNYSRTVIMESFMDSSIDPKGW  505

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L+  +Y EF NTG GS    R  WPG    IN   A  F    FILGD W+P
Sbjct  506  MPWDGDFALSTLYYAEFNNTGPGSDTRNRVTWPGFH-VINSTDASNFTVSNFILGDDWLP  564

Query  285  ATKVPYAAGL  256
               VPY+ GL
Sbjct  565  QAGVPYSTGL  574



>ref|XP_009600658.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Nicotiana tomentosiformis]
Length=566

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFYR+C I GT+DF+FGNAAAVFQNC L  RKPL +    Q  + TAQG
Sbjct  382  YQDTLYTHSLRQFYRECNIYGTVDFIFGNAAAVFQNCNLFARKPLPD----QKNIFTAQG  437

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R+  ++ TGI I N  I ++P      +  +SFLGRPW  +SRTVI+ S I   IAP GW
Sbjct  438  RSDPNQNTGISIQNCTIQAAPDLAQDMNLTLSFLGRPWHNYSRTVIMQSYIGDVIAPVGW  497

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT GL   +YGEF N G G+  +KR +WPG    +N + A  F    F +GDTW+P
Sbjct  498  LEWNGTNGLDTLYYGEFENYGPGANTTKRVEWPGYY-LMNASQAMNFTVYNFTMGDTWLP  556

Query  285  ATKVPYAAGL  256
            +T VP++ GL
Sbjct  557  STNVPFSQGL  566



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 120/186 (65%), Gaps = 5/186 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H +RQ+YRD TI+GTIDF+FG++ A FQNC  ++RKP+ N    Q+CMVTAQG
Sbjct  380  YQDTLYAHNYRQYYRDSTISGTIDFIFGDSLAYFQNCKFIVRKPMDN----QACMVTAQG  435

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R        IVI N  IT+ P +  +  PI ++LGRPW++ SRT+I+ + I   IAPEGW
Sbjct  436  RVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGW  495

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G + L  C+YGE+ N G GS L+KR  W GIK +I    A  +  G    GD WI 
Sbjct  496  SPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKGIK-KITPEIALSWTAGLAFKGDDWIK  554

Query  285  ATKVPY  268
               VPY
Sbjct  555  TAGVPY  560



>emb|CDX70179.1| BnaA10g25280D [Brassica napus]
Length=598

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 121/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH+ RQFYR+C I GT+DF+FGNAAAVFQNC +  RKP++N    Q   VTA G
Sbjct  410  YQDTLYVHSLRQFYRECDIYGTVDFIFGNAAAVFQNCNIYARKPMVN----QKNAVTAHG  465

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TGI I+N  I ++P     P+P ++FLGRPW+ +SRTV I S I   I P GW
Sbjct  466  RTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPVGW  525

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT GL    YGE+ N G G+  SKR +W G    +N A A  F    F LGDTW+P
Sbjct  526  LEWNGTTGLDTISYGEYDNFGPGANTSKRVQWVGY-SLLNLAQAMNFTVYNFTLGDTWLP  584

Query  285  ATKVPYAAGL  256
             T +P+  GL
Sbjct  585  QTDIPFYGGL  594



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 122/190 (64%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+HRQF+RDCTI+GTIDF+FG++AAVFQNCTL++RKPL N    Q+C +TA G
Sbjct  381  YQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPN----QACPITAHG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TG V     I   P Y        ++LGRPW+++S+T+I+N+ I   I P+GW
Sbjct  437  RIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQPQGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G +GL   +Y E  NTG G+ L+ R  W GIK  ++      F P ++I GD W+P
Sbjct  497  LPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEEVLMFTPAQYIQGDIWVP  555

Query  285  ATKVPYAAGL  256
               VPY  GL
Sbjct  556  GKGVPYTPGL  565



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 126/198 (64%), Gaps = 11/198 (6%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYVH  RQFYRDCTI+GTIDF+FG+A +VFQNCT +++KPL N    Q C+VTAQG
Sbjct  397  YQDTLYVHTMRQFYRDCTISGTIDFIFGDAISVFQNCTFLVKKPLEN----QQCIVTAQG  452

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+GIVI N  I +        +   ++L RPW+  SRTV + + I   I P+G+
Sbjct  453  RKERHQPSGIVIQNCHIVADTHNVKFDNK--AYLARPWKNFSRTVFMKTYIGDLIQPDGF  510

Query  465  SPFQG----TWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGD  298
             P+QG      G+  C+Y E+ N G GS  SKR KWPGIK   +++ A  F P  F  GD
Sbjct  511  MPWQGPNGTVSGIDTCFYAEYNNKGPGSDKSKRVKWPGIKTLTSQS-ASHFLPSMFFHGD  569

Query  297  TWIPATKVPYAAGLNPNK  244
             WI  TK+PY++G    K
Sbjct  570  DWIKVTKIPYSSGEKSTK  587



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV++ RQFYR+C I GT+DF+FG+A  VFQ+C + +RKP+    SGQ   VTAQG
Sbjct  337  YQDTLYVYSQRQFYRNCDIYGTVDFIFGDAVVVFQSCNIYVRKPM----SGQQNTVTAQG  392

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI I NS +T++   +       ++LGRPW+++SRTV + + +D+ I P GW
Sbjct  393  RTDHNENTGISIHNSIVTAASDLRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLINPAGW  452

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G++GL+  +Y E+ NTG G+  SKR  WPG     + + A  F  G F+ GD+WIP
Sbjct  453  LEWSGSFGLSTLYYAEYMNTGAGADTSKRVNWPGYHVIASSSEASKFTVGGFLSGDSWIP  512

Query  285  ATKVPYAAGL  256
            AT VP++ GL
Sbjct  513  ATGVPFSFGL  522



>ref|XP_007144962.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16956.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=566

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 128/195 (66%), Gaps = 11/195 (6%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            Y+DTLYVHA RQFYRDCTI+GT DFVFG+A AVFQNCT ++RKPL N    Q  +VTAQG
Sbjct  378  YEDTLYVHAMRQFYRDCTISGTTDFVFGDAVAVFQNCTFVVRKPLEN----QPLIVTAQG  433

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+GIVI  S I S+   K       ++L RP + +SRT+ +N+ ++  I P+G+
Sbjct  434  RKEKHQPSGIVIQGSSIVSNHRMKFDKK---AYLARPLKNYSRTIFMNTYMEGFIEPDGY  490

Query  465  SPF---QGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDT  295
             P+   QG  G+  C+Y E+ N+G GS  SKR KWPGIK ++N   A  ++P  F  GD 
Sbjct  491  VPWKGPQGLSGMNTCFYAEYNNSGPGSNKSKRVKWPGIK-KLNSKSASEYSPLNFFHGDD  549

Query  294  WIPATKVPYAAGLNP  250
            W+  T++PY +   P
Sbjct  550  WVKITRIPYYSSTLP  564



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV+A+RQFYRDC I GTIDF+FG+A  V QNC + +RKP+    S Q   VTAQ 
Sbjct  337  YQDTLYVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYVRKPM----SNQQNTVTAQA  392

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI+I N +IT++           +FLGRPW+++SRTV++ S +D  I P GW
Sbjct  393  RTDPNENTGIIIHNCRITAAGDLIAVQGSFKTFLGRPWQKYSRTVVMKSALDGLIDPAGW  452

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G +GL+  +Y E+ NTG G+  + R KWPG +  I+ + A  F  G F+ G +WI 
Sbjct  453  SPWSGNFGLSSLYYAEYANTGAGASTAGRVKWPGFR-LISSSEAVKFTVGNFLAGGSWIS  511

Query  285  ATKVPYAAGL  256
             + VP+ AGL
Sbjct  512  GSGVPFDAGL  521



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLYV+A+RQFYRDC I GTIDF+FG+A  V QNC + +RKP+    S Q   VTAQ 
Sbjct  337  YQDTLYVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYVRKPM----SNQQNTVTAQA  392

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +E TGI+I N +IT++           +FLGRPW+++SRTV++ S +D  I P GW
Sbjct  393  RTDPNENTGIIIHNCRITAAGDLIAVQGSFKTFLGRPWQKYSRTVVMKSALDGLIDPAGW  452

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
            SP+ G +GL+  +Y E+ NTG G+  + R KWPG +  I+ + A  F  G F+ G +WI 
Sbjct  453  SPWSGNFGLSSLYYAEYANTGAGASTAGRVKWPGFR-LISSSEAVKFTVGNFLAGGSWIS  511

Query  285  ATKVPYAAGL  256
             + VP+ AGL
Sbjct  512  GSGVPFDAGL  521



>ref|XP_008460558.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Cucumis melo]
Length=595

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 119/190 (63%), Gaps = 6/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY  AHRQFYR C ITGTIDF+FG+AAA+FQNC +MIRKPL N    Q  +VTAQG
Sbjct  411  YQDTLYAQAHRQFYRSCLITGTIDFIFGDAAAIFQNCNMMIRKPLDN----QQNIVTAQG  466

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R    E TGIV+ N +I      +   S   S+LGRPW++ SRT+++ SKI+  I P+GW
Sbjct  467  RTDKHETTGIVLQNCKILPDKTLEAVKSQFKSYLGRPWKEFSRTIVMESKIEDVIHPDGW  526

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              +QG + L   +Y EF N G G+    R KWPG K  I+K  A  F  G F+  D WI 
Sbjct  527  MAWQGDFALKTLYYAEFNNQGPGAKTDARVKWPGYK-VIDKDEAAKFTIGTFLELD-WIE  584

Query  285  ATKVPYAAGL  256
            +T  P   GL
Sbjct  585  STSAPVHVGL  594



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 124/193 (64%), Gaps = 8/193 (4%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H  RQFYRDCTI+GTIDFVFGNA AVFQNCT ++RKP+ N    Q C+VTAQG
Sbjct  381  YQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMEN----QQCIVTAQG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+GIVI    I S P + +      ++L RPW+ +SRT+I+++ ID  I  +G+
Sbjct  437  RKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLIDADGY  496

Query  465  SPFQGTW---GLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDT  295
             P+QG     G+  C+Y E+ N G GS  SKR KW GI   +N   A  F+P KF  G  
Sbjct  497  LPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNSKAARWFSPSKFFHGTD  555

Query  294  WIPATKVPYAAGL  256
            WI  T +PY  G+
Sbjct  556  WIEVTGIPYFPGV  568



>ref|NP_191632.2| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
 sp|Q84R10.2|PME36_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
36; Includes: RecName: Full=Pectinesterase inhibitor 36; AltName: 
Full=Pectin methylesterase inhibitor 36; Includes: RecName: 
Full=Pectinesterase 36; Short=PE 36; AltName: Full=Pectin 
methylesterase 36; Short=AtPME36; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE80101.1| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
Length=519

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTL+ H+ RQFYRDC I GTIDF+FG+AAAVFQNC + +R+P+ + G+    M+TAQG
Sbjct  334  YQDTLFTHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQG  389

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R      +GI I +S+I ++P ++       S+LGRPW+++SRTV + + ID  I P GW
Sbjct  390  RDDPHTNSGISIQHSRIRAAPEFEAVKGRFKSYLGRPWKKYSRTVFLKTDIDELIDPRGW  449

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + G++ L+  +YGEF NTG G+   +R  WPG      +  A  F   +FI GD+WIP
Sbjct  450  REWSGSYALSTLYYGEFMNTGAGAGTGRRVNWPGFHVLRGEEEASPFTVSRFIQGDSWIP  509

Query  285  ATKVPYAAGL  256
             T VP++AG+
Sbjct  510  ITGVPFSAGV  519



>ref|XP_009409132.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=568

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 124/191 (65%), Gaps = 4/191 (2%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY+H+ RQF+R C I GT+DF+FGNAAAV Q+C + +R+P  N    Q  MVTA G
Sbjct  381  YQDTLYLHSLRQFFRGCLIQGTVDFIFGNAAAVLQDCDIQVRRPNPN----QKNMVTASG  436

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   +EPTGIVI  S+IT++P          ++LGRPW++++RTVI+ S+I   I PEGW
Sbjct  437  RDDPNEPTGIVIHRSRITAAPDLAPVQGSFRTYLGRPWKEYARTVIMESEISDVIEPEGW  496

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
              + GT+ L   +YGE+ NTG G+    R +W G K   + A A  F PG FI G +W+ 
Sbjct  497  HEWSGTFALDTLYYGEYRNTGAGAGTGSRVQWKGYKVITSAAEAAEFTPGSFIAGSSWLE  556

Query  285  ATKVPYAAGLN  253
            AT  PY+ GL+
Sbjct  557  ATGFPYSLGLS  567



>ref|XP_008795770.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 41 [Phoenix dactylifera]
Length=576

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 119/190 (63%), Gaps = 5/190 (3%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            YQDTLY H+ RQFYR+C I GT+D++FGNAA VFQNC +  R P+     GQS  +TAQG
Sbjct  391  YQDTLYTHSMRQFYRECDIYGTVDYIFGNAAVVFQNCNIYSRLPM----QGQSNTITAQG  446

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R   ++ TG  + +  I ++          +++LGRPW+ +SRTVI+ S +D+ I P GW
Sbjct  447  RTDPNQNTGTTVQDCNIRAAADLAADSGSTITYLGRPWKNYSRTVIMESFMDSSIDPRGW  506

Query  465  SPFQGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDTWIP  286
             P+ G + L+  +Y EF NTG GS  S R  WPG+   IN   A  F    FILGD W+P
Sbjct  507  MPWDGDFALSTLYYAEFNNTGPGSDTSNRVTWPGLH-VINSTDASNFTVSNFILGDNWLP  565

Query  285  ATKVPYAAGL  256
             T VPY++GL
Sbjct  566  QTGVPYSSGL  575



>ref|XP_007144961.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16955.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=578

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 128/195 (66%), Gaps = 11/195 (6%)
 Frame = -3

Query  825  YQDTLYVHAHRQFYRDCTITGTIDFVFGNAAAVFQNCTLMIRKPLINNGSGQSCMVTAQG  646
            Y+DTLYVHA RQFYRDCTI+GT DFVFG+A AVFQNCT ++RKPL N    Q  +VTAQG
Sbjct  390  YEDTLYVHAMRQFYRDCTISGTTDFVFGDAVAVFQNCTFVVRKPLEN----QPLIVTAQG  445

Query  645  RAQADEPTGIVIMNSQITSSPGYKTSPSPIVSFLGRPWRQHSRTVIINSKIDAPIAPEGW  466
            R +  +P+GIVI  S I S+   K       ++L RP + +SRT+ +N+ ++  I P+G+
Sbjct  446  RKEKHQPSGIVIQGSSIVSNHRMKFDKK---AYLARPLKNYSRTIFMNTYMEGFIEPDGY  502

Query  465  SPF---QGTWGLTDCWYGEFGNTGKGSVLSKRAKWPGIKGRINKAHAEGFAPGKFILGDT  295
             P+   QG  G+  C+Y E+ N+G GS  SKR KWPGIK ++N   A  ++P  F  GD 
Sbjct  503  VPWKGPQGLSGMNTCFYAEYNNSGPGSNKSKRVKWPGIK-KLNSKSASEYSPLNFFHGDD  561

Query  294  WIPATKVPYAAGLNP  250
            W+  T++PY +   P
Sbjct  562  WVKITRIPYYSSTLP  576



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1578431504286