BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23793_g2_i1 len=668 path=[6069:0-361 6431:362-429 6498:430-568
5468:569-605 6673:606-667]

Length=668
                                                                      Score     E

ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    178   5e-50   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    181   1e-49   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    180   3e-49   
emb|CDO98832.1|  unnamed protein product                                179   8e-49   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          178   2e-48   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         177   3e-48   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             177   3e-48   
ref|XP_002314364.1|  putative pectinesterase family protein             177   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    176   9e-48   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    176   1e-47   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          176   1e-47   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    175   1e-47   
ref|XP_010654104.1|  PREDICTED: pectinesterase                          174   3e-47   
emb|CDO98833.1|  unnamed protein product                                174   3e-47   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    174   6e-47   
emb|CAN77092.1|  hypothetical protein VITISV_026596                     172   6e-47   Vitis vinifera
emb|CBI39537.3|  unnamed protein product                                174   9e-47   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             173   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             173   1e-46   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    173   1e-46   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     172   1e-46   
emb|CDO98834.1|  unnamed protein product                                172   1e-46   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 171   3e-46   Ricinus communis
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    171   6e-46   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    170   1e-45   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    170   1e-45   
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    169   2e-45   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     169   2e-45   
ref|XP_006382447.1|  pectin methylesterase family protein               169   3e-45   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    169   3e-45   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    167   8e-45   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    167   9e-45   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     167   2e-44   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    167   2e-44   
emb|CBI22967.3|  unnamed protein product                                170   2e-44   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    167   2e-44   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    167   2e-44   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             166   4e-44   
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    166   5e-44   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   166   5e-44   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     165   6e-44   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     165   6e-44   
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     165   6e-44   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     164   9e-44   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    164   1e-43   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    164   1e-43   
ref|XP_010661658.1|  PREDICTED: probable pectinesterase/pectinest...    163   1e-43   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    164   1e-43   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    164   1e-43   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    165   1e-43   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    164   2e-43   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     164   2e-43   
emb|CDX71786.1|  BnaC08g30880D                                          163   3e-43   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    163   3e-43   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             163   3e-43   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          163   3e-43   
ref|XP_010513751.1|  PREDICTED: probable pectinesterase/pectinest...    160   3e-43   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             163   3e-43   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     162   3e-43   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    163   4e-43   
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    160   5e-43   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    163   5e-43   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             162   6e-43   
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             163   6e-43   
ref|XP_006402549.1|  hypothetical protein EUTSA_v10006472mg             162   6e-43   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             163   6e-43   
ref|XP_009116752.1|  PREDICTED: probable pectinesterase/pectinest...    162   6e-43   
emb|CDY41145.1|  BnaA09g38700D                                          162   6e-43   
ref|XP_002516960.1|  Pectinesterase precursor, putative                 162   7e-43   Ricinus communis
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             163   7e-43   
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             163   8e-43   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    162   9e-43   
emb|CAN75818.1|  hypothetical protein VITISV_005130                     161   9e-43   Vitis vinifera
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    162   1e-42   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    162   1e-42   
gb|ABZ89800.1|  pectin methylesterase-like protein                      161   2e-42   Taiwania cryptomerioides
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    161   2e-42   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    163   2e-42   
gb|AAQ21125.1|  pectinesterase                                          153   2e-42   Fragaria x ananassa
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    161   2e-42   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    161   2e-42   
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    161   2e-42   
ref|XP_008800483.1|  PREDICTED: pectinesterase 3-like isoform X2        155   3e-42   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    160   3e-42   
gb|KEH15723.1|  pectinesterase                                          153   5e-42   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     159   6e-42   
ref|XP_009764218.1|  PREDICTED: probable pectinesterase/pectinest...    159   6e-42   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    160   6e-42   
ref|XP_008361835.1|  PREDICTED: pectinesterase-like                     153   6e-42   
ref|XP_002876579.1|  pectinesterase family protein                      159   7e-42   
emb|CDX70179.1|  BnaA10g25280D                                          159   8e-42   
ref|XP_009628695.1|  PREDICTED: probable pectinesterase/pectinest...    158   8e-42   
ref|XP_006369079.1|  pectinesterase family protein                      152   9e-42   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   159   9e-42   
ref|XP_010040919.1|  PREDICTED: probable pectinesterase/pectinest...    152   1e-41   
emb|CDX80933.1|  BnaC03g01870D                                          155   1e-41   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     158   1e-41   
ref|XP_009122545.1|  PREDICTED: probable pectinesterase/pectinest...    159   1e-41   
ref|XP_009142158.1|  PREDICTED: probable pectinesterase/pectinest...    158   1e-41   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          159   1e-41   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             159   1e-41   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    159   1e-41   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                158   1e-41   
ref|XP_006292970.1|  hypothetical protein CARUB_v10019247mg             158   2e-41   
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   157   2e-41   
gb|KFK37147.1|  hypothetical protein AALP_AA4G219300                    157   2e-41   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    158   2e-41   
gb|AAP04164.1|  putative pectinesterase                                 157   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    158   2e-41   
ref|NP_191632.2|  putative pectinesterase/pectinesterase inhibito...    157   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511680.1|  Pectinesterase-2 precursor, putative               157   2e-41   Ricinus communis
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    158   2e-41   
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     157   2e-41   
emb|CDY11323.1|  BnaA03g01590D                                          158   3e-41   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    157   3e-41   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             157   3e-41   
emb|CDY71928.1|  BnaCnng75130D                                          155   3e-41   
ref|XP_009130852.1|  PREDICTED: probable pectinesterase/pectinest...    157   3e-41   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    157   3e-41   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                157   4e-41   
emb|CDX98808.1|  BnaC09g50270D                                          157   4e-41   
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     157   4e-41   
gb|AAQ21126.1|  pectinesterase                                          150   4e-41   Fragaria x ananassa
ref|XP_011046483.1|  PREDICTED: probable pectinesterase/pectinest...    157   4e-41   
ref|XP_006361902.1|  PREDICTED: probable pectinesterase/pectinest...    157   5e-41   
ref|XP_006361900.1|  PREDICTED: probable pectinesterase/pectinest...    157   5e-41   
emb|CDY34927.1|  BnaA01g32580D                                          157   5e-41   
gb|KEH21378.1|  pectinesterase                                          154   5e-41   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             157   5e-41   
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   156   5e-41   
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             157   6e-41   
ref|XP_006853048.1|  hypothetical protein AMTR_s00038p00046180          157   6e-41   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         157   6e-41   
ref|XP_010271283.1|  PREDICTED: pectinesterase                          156   6e-41   
ref|XP_010919483.1|  PREDICTED: pectinesterase 2-like                   156   6e-41   
emb|CDO97717.1|  unnamed protein product                                151   6e-41   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     157   6e-41   
ref|XP_004231267.1|  PREDICTED: probable pectinesterase/pectinest...    157   7e-41   
gb|AAR03544.1|  pectin methylesterase isoform 1                         150   7e-41   Fragaria x ananassa
ref|XP_003630894.1|  Pectinesterase                                     153   7e-41   
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                156   8e-41   
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     156   8e-41   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    157   9e-41   
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    156   9e-41   
gb|KFK24938.1|  hypothetical protein AALP_AA8G044700                    156   9e-41   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    156   1e-40   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    156   1e-40   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          156   1e-40   
emb|CBI27741.3|  unnamed protein product                                153   1e-40   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                156   1e-40   
gb|AAN84553.1|  methyl pectinesterase                                   149   1e-40   Lolium perenne [perennial ryegrass]
ref|XP_008796891.1|  PREDICTED: pectinesterase-like                     155   1e-40   
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          156   1e-40   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     156   1e-40   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    158   1e-40   
emb|CDY57858.1|  BnaC08g47740D                                          155   1e-40   
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   155   1e-40   
ref|XP_002872255.1|  pectinesterase family protein                      156   1e-40   
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     155   2e-40   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          155   2e-40   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        155   2e-40   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                155   2e-40   
ref|XP_010469150.1|  PREDICTED: probable pectinesterase/pectinest...    155   2e-40   
ref|XP_004231159.2|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    155   2e-40   
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    151   2e-40   Daucus carota [carrots]
ref|XP_008344546.1|  PREDICTED: probable pectinesterase/pectinest...    149   2e-40   
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    155   2e-40   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    156   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   155   2e-40   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     155   2e-40   
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  151   2e-40   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 155   2e-40   
gb|ABQ42392.1|  pectin methylesterase-like protein                      155   3e-40   Taiwania cryptomerioides
ref|XP_010096538.1|  Pectinesterase 1                                   149   3e-40   
ref|XP_009600658.1|  PREDICTED: probable pectinesterase/pectinest...    155   3e-40   
ref|XP_010548770.1|  PREDICTED: pectinesterase-like                     155   3e-40   
ref|XP_006347998.1|  PREDICTED: probable pectinesterase/pectinest...    154   4e-40   
gb|KEH29120.1|  pectinesterase/pectinesterase inhibitor                 154   4e-40   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     154   4e-40   
ref|XP_002865716.1|  pectinesterase family protein                      154   4e-40   
ref|XP_010423511.1|  PREDICTED: probable pectinesterase/pectinest...    154   4e-40   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   154   4e-40   
emb|CDY56347.1|  BnaCnng30140D                                          154   4e-40   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    155   4e-40   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             154   5e-40   
ref|NP_001042866.1|  Os01g0312500                                       152   5e-40   Oryza sativa Japonica Group [Japonica rice]
gb|EPS59322.1|  pectinesterase                                          154   5e-40   
gb|AFK42744.1|  unknown                                                 149   5e-40   
ref|XP_002873178.1|  hypothetical protein ARALYDRAFT_487284             154   5e-40   
ref|XP_006398954.1|  hypothetical protein EUTSA_v10013020mg             154   6e-40   
ref|XP_008812365.1|  PREDICTED: pectinesterase                          154   6e-40   
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                154   6e-40   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    154   6e-40   
ref|XP_008795770.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    154   6e-40   
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    154   6e-40   
ref|XP_006649104.1|  PREDICTED: probable pectinesterase/pectinest...    153   6e-40   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          154   7e-40   Vitis vinifera
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    154   7e-40   
ref|XP_010544635.1|  PREDICTED: probable pectinesterase/pectinest...    153   7e-40   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             153   7e-40   
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   153   7e-40   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    154   7e-40   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    154   8e-40   
emb|CAC01624.1|  putative pectin methylesterase                         154   8e-40   Populus tremula x Populus tremuloides
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     154   8e-40   
gb|KDO36003.1|  hypothetical protein CISIN_1g029714mg                   146   8e-40   
ref|NP_196116.1|  putative pectinesterase/pectinesterase inhibito...    154   8e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069353.1|  PREDICTED: pectinesterase-like                     153   9e-40   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    154   9e-40   
ref|XP_010452398.1|  PREDICTED: probable pectinesterase/pectinest...    154   9e-40   
ref|XP_009760201.1|  PREDICTED: probable pectinesterase/pectinest...    153   9e-40   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               153   1e-39   Ricinus communis
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    153   1e-39   
ref|XP_006828613.1|  hypothetical protein AMTR_s00129p00074780          154   1e-39   
gb|ABE67980.1|  pectin methylesterase                                   147   1e-39   Citrus bergamia [bergamot orange]
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                   153   1e-39   
emb|CDO97787.1|  unnamed protein product                                148   1e-39   
emb|CDY19737.1|  BnaA09g03900D                                          152   1e-39   
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             153   1e-39   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    153   1e-39   
ref|XP_010938361.1|  PREDICTED: probable pectinesterase/pectinest...    153   1e-39   
ref|XP_002315399.2|  hypothetical protein POPTR_0010s25400g             153   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010523198.1|  PREDICTED: putative pectinesterase/pectinest...    152   1e-39   
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    153   1e-39   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                155   2e-39   
ref|XP_010069351.1|  PREDICTED: pectinesterase-like                     152   2e-39   
emb|CBI35795.3|  unnamed protein product                                153   2e-39   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    152   2e-39   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             152   2e-39   
emb|CDX99968.1|  BnaC09g03330D                                          153   2e-39   
dbj|BAK06157.1|  predicted protein                                      155   2e-39   
ref|XP_002884519.1|  pectinesterase family protein                      153   2e-39   
gb|AFQ23194.1|  pectin methylesterase                                   152   2e-39   
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     152   2e-39   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    152   2e-39   
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   150   2e-39   
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    152   2e-39   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   152   2e-39   
ref|XP_010413524.1|  PREDICTED: probable pectinesterase/pectinest...    152   2e-39   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    153   2e-39   
gb|ABK94644.1|  unknown                                                 149   2e-39   Populus trichocarpa [western balsam poplar]
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    153   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     152   2e-39   
gb|KHG08631.1|  Pectinesterase 3                                        152   2e-39   
gb|AFB77929.1|  pectin methylesterase                                   152   2e-39   
dbj|BAC42986.1|  putative pectinesterase                                153   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002515774.1|  Pectinesterase-2 precursor, putative               152   2e-39   Ricinus communis
gb|AFW03480.1|  pectin methylesterase 1                                 152   3e-39   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         152   3e-39   
ref|XP_006411580.1|  hypothetical protein EUTSA_v10016522mg             152   3e-39   
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         152   3e-39   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  152   3e-39   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     152   3e-39   
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    152   3e-39   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    152   3e-39   
gb|EEC70505.1|  hypothetical protein OsI_01594                          152   3e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    152   3e-39   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      152   3e-39   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          152   3e-39   
ref|XP_009402517.1|  PREDICTED: pectinesterase-like                     152   3e-39   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    152   3e-39   
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     151   3e-39   
emb|CDY33925.1|  BnaA02g30620D                                          152   3e-39   
ref|XP_004296684.1|  PREDICTED: probable pectinesterase/pectinest...    152   3e-39   
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     152   3e-39   
gb|EEE54425.1|  hypothetical protein OsJ_01485                          152   4e-39   Oryza sativa Japonica Group [Japonica rice]
gb|KDP42887.1|  hypothetical protein JCGZ_23829                         152   4e-39   
ref|XP_006290060.1|  hypothetical protein CARUB_v10003696mg             152   4e-39   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    152   4e-39   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   151   4e-39   
ref|XP_009355065.1|  PREDICTED: probable pectinesterase/pectinest...    152   4e-39   
ref|XP_008390793.1|  PREDICTED: probable pectinesterase/pectinest...    146   4e-39   
gb|KHN16553.1|  Pectinesterase 2                                        150   4e-39   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             151   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_007031044.1|  Pectinesterase, putative                           152   5e-39   
gb|KDO87166.1|  hypothetical protein CISIN_1g0440421mg                  145   5e-39   
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    150   5e-39   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          152   5e-39   
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             151   5e-39   
ref|XP_003591164.1|  Pectinesterase                                     151   5e-39   
ref|XP_011090455.1|  PREDICTED: probable pectinesterase/pectinest...    150   5e-39   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             152   6e-39   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   150   6e-39   
ref|XP_006294020.1|  hypothetical protein CARUB_v10023013mg             151   6e-39   
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     151   6e-39   
ref|NP_566379.1|  pectinesterase 25                                     146   6e-39   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          151   6e-39   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     151   6e-39   
ref|XP_008457895.1|  PREDICTED: pectinesterase-like                     151   7e-39   
gb|KFK38464.1|  hypothetical protein AALP_AA3G116300                    151   7e-39   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          151   7e-39   
emb|CDY40719.1|  BnaC03g34350D                                          150   7e-39   
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             150   8e-39   
emb|CDY24663.1|  BnaA05g30620D                                          150   8e-39   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    150   8e-39   
ref|XP_010491028.1|  PREDICTED: probable pectinesterase/pectinest...    151   8e-39   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    150   8e-39   
ref|XP_010552499.1|  PREDICTED: probable pectinesterase/pectinest...    150   8e-39   
ref|XP_007222370.1|  hypothetical protein PRUPE_ppa003433mg             150   8e-39   
emb|CDY53657.1|  BnaC04g52910D                                          150   9e-39   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    150   9e-39   
gb|AAM67242.1|  putative pectinesterase                                 145   9e-39   
ref|NP_181833.1|  putative pectinesterase/ pectinerase inhibitor 16     150   1e-38   
ref|XP_008346152.1|  PREDICTED: probable pectinesterase/pectinest...    150   1e-38   
ref|XP_004150118.1|  PREDICTED: probable pectinesterase/pectinest...    150   1e-38   
ref|XP_008673992.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    150   1e-38   
gb|EPS62329.1|  pectinesterase                                          150   1e-38   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          150   1e-38   
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   150   1e-38   
gb|AAF63815.1|  pectin methylesterase, putative                         150   1e-38   
dbj|BAC42959.2|  putative pectin methylesterase                         150   1e-38   
ref|XP_002512460.1|  Pectinesterase-2 precursor, putative               150   1e-38   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         150   1e-38   
gb|EYU25793.1|  hypothetical protein MIMGU_mgv1a020083mg                150   1e-38   
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             150   1e-38   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          150   1e-38   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    150   1e-38   
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   150   1e-38   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    150   1e-38   
gb|KDO53806.1|  hypothetical protein CISIN_1g0081982mg                  147   1e-38   
ref|XP_006469215.1|  PREDICTED: probable pectinesterase/pectinest...    150   1e-38   
emb|CAB95025.1|  pectin methylesterase                                  150   1e-38   
ref|XP_009417531.1|  PREDICTED: probable pectinesterase/pectinest...    150   2e-38   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             151   2e-38   
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    150   2e-38   
gb|KDO64577.1|  hypothetical protein CISIN_1g047288mg                   149   2e-38   
ref|XP_009122661.1|  PREDICTED: probable pectinesterase/pectinest...    150   2e-38   
emb|CDY36270.1|  BnaA01g31480D                                          150   2e-38   
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   149   2e-38   
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     148   2e-38   
ref|XP_008467117.1|  PREDICTED: pectinesterase                          150   2e-38   
ref|NP_192139.1|  Probable pectinesterase/pectinesterase inhibito...    150   2e-38   
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    150   2e-38   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    149   2e-38   
ref|XP_003604119.1|  Pectinesterase                                     150   2e-38   
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    150   2e-38   
emb|CBI38888.3|  unnamed protein product                                145   2e-38   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    149   2e-38   
ref|XP_007134835.1|  hypothetical protein PHAVU_010G080300g             149   2e-38   
ref|XP_002882495.1|  pectinesterase family protein                      149   2e-38   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    149   2e-38   
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             149   2e-38   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    149   2e-38   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     150   2e-38   
gb|EMT05022.1|  Pectinesterase 3                                        149   2e-38   
ref|XP_002872846.1|  predicted protein                                  149   2e-38   
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                     149   2e-38   
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    149   2e-38   
ref|XP_009339900.1|  PREDICTED: probable pectinesterase/pectinest...    149   2e-38   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    149   2e-38   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     149   2e-38   
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     149   2e-38   
ref|NP_001048322.1|  Os02g0783000                                       149   2e-38   
gb|AFW03475.1|  pectin methylesterase 1                                 149   2e-38   
ref|XP_006371892.1|  hypothetical protein POPTR_0018s05350g             144   2e-38   
gb|AAF16637.1|AC011661_15  T23J18.24                                    143   2e-38   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    149   2e-38   
gb|KHN35621.1|  Putative pectinesterase/pectinesterase inhibitor 36     149   2e-38   
dbj|BAD19539.1|  putative pectinesterase                                149   2e-38   
ref|XP_006287480.1|  hypothetical protein CARUB_v10000691mg             149   3e-38   
gb|KHN10148.1|  Putative pectinesterase/pectinesterase inhibitor 25     150   3e-38   
gb|EMT19669.1|  Putative pectinesterase/pectinesterase inhibitor 21     152   3e-38   
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          149   3e-38   
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   149   3e-38   
ref|XP_003521962.2|  PREDICTED: probable pectinesterase/pectinest...    149   3e-38   
ref|XP_007219055.1|  hypothetical protein PRUPE_ppa004770mg             149   3e-38   
emb|CAC18725.1|  putative pectin methylesterase                         149   3e-38   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             149   3e-38   
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        149   3e-38   
emb|CDY55503.1|  BnaA05g34400D                                          149   3e-38   
ref|XP_008371117.1|  PREDICTED: pectinesterase                          149   3e-38   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             149   3e-38   
ref|XP_010543030.1|  PREDICTED: pectinesterase 2-like                   149   3e-38   
ref|XP_008231877.1|  PREDICTED: probable pectinesterase/pectinest...    149   3e-38   
ref|XP_002880019.1|  pectinesterase family protein                      149   3e-38   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                149   3e-38   
ref|NP_001274969.1|  pectin methyl esterase                             149   3e-38   
ref|XP_007051173.1|  Pectinesterase, putative                           144   3e-38   
gb|EMS52976.1|  putative pectinesterase/pectinesterase inhibitor 21     152   3e-38   
ref|XP_010069899.1|  PREDICTED: probable pectinesterase/pectinest...    149   3e-38   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                149   3e-38   
ref|XP_002457749.1|  hypothetical protein SORBIDRAFT_03g012820          149   3e-38   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    149   3e-38   
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             149   3e-38   
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   149   3e-38   
emb|CDX74137.1|  BnaA03g29100D                                          150   4e-38   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        149   4e-38   
ref|XP_009142905.1|  PREDICTED: probable pectinesterase/pectinest...    149   4e-38   
ref|XP_004506985.1|  PREDICTED: probable pectinesterase/pectinest...    148   4e-38   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         147   4e-38   
gb|KHN10315.1|  Putative pectinesterase/pectinesterase inhibitor 25     150   4e-38   
gb|AFI23411.1|  pectin methylesterase                                   149   4e-38   
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     149   4e-38   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    148   4e-38   
ref|XP_006598050.1|  PREDICTED: probable pectinesterase/pectinest...    149   4e-38   
gb|KHG13344.1|  Uncharacterized protein F383_18528                      148   4e-38   
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    149   4e-38   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     148   4e-38   
ref|NP_001054042.1|  Os04g0641200                                       151   4e-38   
ref|XP_002317208.1|  pectin methylesterase family protein               149   4e-38   
gb|AAO85706.1|  pectin methyl-esterase                                  149   5e-38   
ref|NP_001275859.1|  pectinesterase 1 precursor                         149   5e-38   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    149   5e-38   
emb|CDY05295.1|  BnaC05g45080D                                          149   5e-38   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    149   5e-38   
ref|XP_010069898.1|  PREDICTED: probable pectinesterase/pectinest...    149   5e-38   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    150   5e-38   
ref|XP_004148470.1|  PREDICTED: probable pectinesterase/pectinest...    149   5e-38   
gb|EAY95754.1|  hypothetical protein OsI_17629                          151   5e-38   
emb|CAH68135.1|  B0414F07.5                                             151   5e-38   
ref|NP_191460.1|  pectinesterase 35                                     148   5e-38   
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     148   5e-38   
ref|XP_010103929.1|  putative pectinesterase/pectinesterase inhib...    148   5e-38   
ref|XP_010506161.1|  PREDICTED: probable pectinesterase/pectinest...    148   5e-38   
ref|XP_006448208.1|  hypothetical protein CICLE_v10014888mg             148   5e-38   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    150   5e-38   
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             149   5e-38   
ref|XP_008232608.1|  PREDICTED: probable pectinesterase/pectinest...    148   5e-38   
emb|CAC09455.2|  H0423H10.1                                             149   5e-38   
emb|CDY34642.1|  BnaC08g42010D                                          147   5e-38   
ref|XP_010684347.1|  PREDICTED: pectinesterase                          149   6e-38   
dbj|BAJ96804.1|  predicted protein                                      148   6e-38   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    148   6e-38   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 148   6e-38   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    149   6e-38   
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             147   6e-38   
ref|XP_010253281.1|  PREDICTED: probable pectinesterase/pectinest...    148   6e-38   
dbj|BAD94011.1|  pectin methylesterase like protein                     143   6e-38   
ref|XP_010493501.1|  PREDICTED: probable pectinesterase/pectinest...    148   6e-38   
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    148   6e-38   
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       148   6e-38   
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   148   7e-38   
emb|CDP21156.1|  unnamed protein product                                142   7e-38   
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           144   7e-38   
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     148   7e-38   
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     148   7e-38   
ref|XP_010489755.1|  PREDICTED: probable pectinesterase/pectinest...    148   7e-38   
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             148   7e-38   
ref|NP_001275846.1|  putative thermostable pectinesterase               148   7e-38   
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   147   8e-38   
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   147   8e-38   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     148   8e-38   
ref|XP_010524121.1|  PREDICTED: probable pectinesterase/pectinest...    148   8e-38   
ref|XP_008386683.1|  PREDICTED: probable pectinesterase/pectinest...    148   8e-38   
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             148   8e-38   
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                147   9e-38   
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               147   9e-38   
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    147   9e-38   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    148   9e-38   
emb|CDP19931.1|  unnamed protein product                                147   9e-38   
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    148   9e-38   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    148   9e-38   
ref|XP_010464750.1|  PREDICTED: probable pectinesterase/pectinest...    148   9e-38   
ref|XP_009400700.1|  PREDICTED: pectinesterase-like                     147   1e-37   
ref|XP_006432534.1|  hypothetical protein CICLE_v10000705mg             147   1e-37   
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             148   1e-37   
dbj|BAF95866.1|  pectin methylesterase isoform alpha                    142   1e-37   
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         147   1e-37   
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   147   1e-37   
emb|CDP15270.1|  unnamed protein product                                147   1e-37   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             147   1e-37   
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   147   1e-37   
ref|XP_010240510.1|  PREDICTED: probable pectinesterase/pectinest...    149   1e-37   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    147   1e-37   
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     147   1e-37   
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     147   1e-37   
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     147   1e-37   
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    147   1e-37   
ref|XP_008235120.1|  PREDICTED: probable pectinesterase/pectinest...    147   1e-37   
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     147   1e-37   
ref|XP_010674141.1|  PREDICTED: probable pectinesterase/pectinest...    144   1e-37   
ref|NP_173733.1|  probable pectinesterase/pectinesterase inhibitor 6    147   1e-37   
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...    148   1e-37   
ref|XP_010508475.1|  PREDICTED: probable pectinesterase/pectinest...    147   1e-37   
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     146   1e-37   
ref|XP_002310960.2|  hypothetical protein POPTR_0008s01180g             147   1e-37   
ref|XP_011000694.1|  PREDICTED: pectinesterase                          147   2e-37   
gb|ACN40984.1|  unknown                                                 147   2e-37   
emb|CDO97715.1|  unnamed protein product                                147   2e-37   
ref|XP_010247589.1|  PREDICTED: probable pectinesterase/pectinest...    147   2e-37   
emb|CDY05188.1|  BnaC05g46150D                                          147   2e-37   
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    146   2e-37   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   148   2e-37   
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   147   2e-37   
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     147   2e-37   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   147   2e-37   
gb|KHN04169.1|  Putative pectinesterase/pectinesterase inhibitor 21     146   2e-37   
dbj|BAD95369.1|  pectin methylesterase like protein                     145   2e-37   
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    146   2e-37   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     147   2e-37   
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     146   2e-37   
ref|XP_007199770.1|  hypothetical protein PRUPE_ppa003639mg             147   2e-37   
gb|KDO40320.1|  hypothetical protein CISIN_1g048471mg                   140   2e-37   
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 147   2e-37   
ref|XP_006653811.1|  PREDICTED: probable pectinesterase/pectinest...    149   2e-37   
gb|EPS70728.1|  pectinesterase                                          147   2e-37   
ref|XP_008221458.1|  PREDICTED: pectinesterase                          146   2e-37   
gb|EPS72184.1|  pectinesterase family protein                           147   2e-37   
ref|XP_006297260.1|  hypothetical protein CARUB_v10013273mg             147   2e-37   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     146   2e-37   



>ref|XP_008351186.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Malus domestica]
Length=363

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 114/169 (67%), Gaps = 5/169 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA VFQ+CK+I+RKPM N    Q+CMVTAQGR    +P+GI + N  IS  PEY+
Sbjct  200  FIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQGRIDRRQPSGIILQNCTISGDPEYI  255

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW+  ARTV++ S+ID  IAPEGW  + G+   + CW+GE+ N G G+
Sbjct  256  PVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYRNRGPGS  315

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK*VSI  161
             +SKR KW+G+K  ++  QA  F  GKF+ GD WI  SGVPY A  VS+
Sbjct  316  HMSKRVKWSGIKN-LSADQAVAFTSGKFVEGDKWIKPSGVPYVAGMVSV  363



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 114/169 (67%), Gaps = 5/169 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA VFQ+CK+I+RKPM N    Q+CMVTAQGR    +P+GI + N  IS  PEY+
Sbjct  415  FIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQGRIDRRQPSGIILQNCTISGDPEYI  470

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW+  ARTV++ S+ID  IAPEGW  + G+   + CW+GE+ N G G+
Sbjct  471  PVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYRNRGPGS  530

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK*VSI  161
            D+SKR KW+G+K  +   QA  F  GKF+ GD WI  SGVPY A  VS+
Sbjct  531  DMSKRVKWSGIKN-LGADQAVAFTSGKFVEGDKWIKPSGVPYVAGMVSV  578



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 114/169 (67%), Gaps = 5/169 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA VFQ+CK+I+RKPM N    Q+CMVTAQGR    +P+GI + N  IS  PEY+
Sbjct  415  FIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQGRIDRRQPSGIILQNCTISGDPEYI  470

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW+  ARTV++ S+ID  IAPEGW  + G+   + CW+GE+ N G G+
Sbjct  471  PVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYRNRGPGS  530

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK*VSI  161
             +SKR KW+G+K  ++  QA  F  GKF+ GD WI  SGVPY A  VS+
Sbjct  531  HMSKRVKWSGIKN-LSADQAVAFTSGKFVEGDKWIKPSGVPYVAGMVSV  578



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 110/163 (67%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+AVFQ CK+++RKPM N G    CMVTAQGR +      I + N  I A P +L
Sbjct  399  FIFGDASAVFQDCKMVVRKPMENQG----CMVTAQGRKERRGIGAIVLQNCQIVADPAFL  454

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                PI ++LGRPW++ +RT+I+ + ID  IAPEGWSP+ G +G++ C+Y E+ N G GA
Sbjct  455  AVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGA  514

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D SKR +W G+K  IT   A  F PG +I GD WI ASGVPY+
Sbjct  515  DTSKRVQWKGIKK-ITPQIAQSFTPGAYIQGDAWITASGVPYA  556



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 112/162 (69%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A A+FQ+C  +IRKP+ N    QSC+VTAQGR +  +P+ I I NS I+A P+Y 
Sbjct  428  FVFGDATAIFQNCTFLIRKPLPN----QSCIVTAQGRKERRQPSAIIIQNSTITADPDYF  483

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+I++S ID  I PEGW P++G WGL+ C+Y E GNTG  A
Sbjct  484  PVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAELGNTGPAA  543

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + ++R  W G+K  IT+  A +F PG+F  GD WI  SGVPY
Sbjct  544  NKARRVTWRGIKK-ITENHAADFTPGRFFRGDKWIRLSGVPY  584



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 109/163 (67%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A  VFQ+CK ++RKP+ N    Q C+VTAQGR Q  +P+GI I N   +A PE +
Sbjct  418  FVFGDAPVVFQNCKFLVRKPLEN----QQCIVTAQGRKQRRQPSGIIIQNGTFTAHPELV  473

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW+Q +RT+I+ S ID  I PEGW P+ GT+GL+ CWY EF N G G+
Sbjct  474  PVKKQYKSYLGRPWKQFSRTIIMESYIDDIIEPEGWLPWFGTFGLKTCWYTEFNNYGPGS  533

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D   R KW G+K  I +  A +F PG+F+ GDTWI  +G+PYS
Sbjct  534  DKKARVKWNGIK-TIDRQHALDFTPGRFLRGDTWIKPTGIPYS  575



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 112/165 (68%), Gaps = 5/165 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAA+FQ+C  ++ KP+ +    QSC+VTAQGR +  +P+ I I NS I+A P+Y 
Sbjct  428  FVFGDAAAIFQNCTFVVHKPLPD----QSCIVTAQGRKEGRQPSAIVIQNSTITADPDYF  483

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW++++RT+I+ S ID  I PEGW P+ G WGL  C+Y EF NTG  A
Sbjct  484  LVKNVNKAYLGRPWKEYSRTIIMESYIDDVIQPEGWLPWAGQWGLRTCFYTEFRNTGPAA  543

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK  173
            + ++R  W G+K  IT+  A +F PGKF  GD WI  SGVPYS K
Sbjct  544  NKARRVTWQGIKQ-ITRRHAAQFTPGKFFRGDEWIKLSGVPYSYK  587



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AVFQ+CKL++RKP+ N    Q C+VTAQGR++  EPTG  I N  I+A P+Y 
Sbjct  408  FIFGDAIAVFQNCKLVVRKPLDN----QQCIVTAQGRNETREPTGFVIQNCTITADPQYF  463

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPWR+ +RT+++ S ID  IAPEGW P+ G++GL   +Y E+ N G+GA
Sbjct  464  PVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGWLPWLGSFGLNTLFYSEYNNKGQGA  523

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R KWAG+K +  +A AD +   KFI GD WIP +GVPY+A
Sbjct  524  VETNRVKWAGIKKLTPEA-ADGYTAAKFIQGDEWIPQTGVPYTA  566



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AVFQ+CKL++RKP+ N    Q C+VTAQGR++  EPTG  I N  I+A P+Y 
Sbjct  408  FIFGDAIAVFQNCKLVVRKPLEN----QQCIVTAQGRNETREPTGFVIQNCTITADPKYF  463

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPWR+ +RT+++ S ID  IAPEGW P+ G +GL   +Y E+ N G+GA
Sbjct  464  PVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGWLPWLGNFGLNTLFYSEYDNKGQGA  523

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R KWAG+K +  +A AD +   KFI GD WIP +GVPY+A
Sbjct  524  VETNRVKWAGIKKLTPEA-ADGYTAAKFIQGDEWIPQTGVPYTA  566



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A AVFQ+C  +IRKP+ N    QSC+VTAQGR +  +P+ I I NS I+A P+Y 
Sbjct  423  FVFGDATAVFQNCTFLIRKPLPN----QSCIVTAQGRKERRQPSAIIIQNSTITAEPDYF  478

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+I++S ID  I PEGW P++G WGL+ C+Y E GNTG  A
Sbjct  479  PVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAESGNTGPAA  538

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + ++R  W G+K +     AD F PG+F  GD WI  SGVPY
Sbjct  539  NKARRVTWRGIKQITENHTAD-FTPGRFFRGDKWIRLSGVPY  579



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 116/165 (70%), Gaps = 7/165 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAIL-NSVISATPEY  491
            FIFG+AAAVFQ+C++I+RKP+ N G    CMVTAQGR +    TG+ ++ N  I A P +
Sbjct  409  FIFGDAAAVFQNCQMIVRKPLANQG----CMVTAQGRKER-RSTGVTVIQNCHILAEPAF  463

Query  490  LTAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKG  311
            L+   P+ ++LGRPW+Q +RT+I+ + ID  IAPEGW+P+QG + L+  +YGEF N G G
Sbjct  464  LSTTPPLKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWQGNFALDTLYYGEFKNRGPG  523

Query  310  ADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            +D+S+R +W G++  IT A AD F PG+   GD W+  SGVPY A
Sbjct  524  SDMSRRVRWKGIQ-TITPAIADSFTPGRLFAGDEWVRQSGVPYVA  567



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 112/163 (69%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A+AVFQ+CK ++RKP+ N    Q C+VTAQGR    +P+ + I NS I+A P+  
Sbjct  414  FVFGDASAVFQNCKFLVRKPLEN----QQCIVTAQGRKMRRQPSALIIQNSTITAHPDLF  469

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RT+I+ S ID  I PEGW P+ GT+GL+ CWY EF N G G+
Sbjct  470  PERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGS  529

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              + R KW G+K  I +  A +F PG+F+ GD+WI A+G+PY+
Sbjct  530  SKNLRVKWNGIK-TINRQHAMDFTPGRFLKGDSWIKATGIPYT  571



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AV Q+C + +R+PM    S Q+ ++TAQGRS  +E TGI+I NS + A P+  
Sbjct  373  FIFGDAVAVLQNCNIYVRRPM----SNQANVITAQGRSDQNENTGISIHNSRVMAAPDLR  428

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPWR+++RTV + + +D  I PEGWSP++G +GL   +YGE+ NTG GA
Sbjct  429  PVQSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTLYYGEYMNTGSGA  488

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
                R KW G   + + A+AD+F  G+F++GD+WIP +GVPY++
Sbjct  489  STRGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIPTTGVPYAS  532



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+ +AVFQ CK+++RKPM N G    CMVTAQGR +      I + N  I A P +L
Sbjct  383  FIFGDGSAVFQGCKMVVRKPMENQG----CMVTAQGRKERRGIGAIVLQNCQIVADPAFL  438

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                PI ++LGRPW++ +RT+I+ + ID  IAPEGWSP+ G +G++ C+Y E+ N G GA
Sbjct  439  AVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGA  498

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D SKR +W G+K  IT   A  F PG +I GD WI ASGV Y++
Sbjct  499  DTSKRVQWKGIKK-ITPQIAQSFTPGAYIQGDAWITASGVTYAS  541



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 112/169 (66%), Gaps = 5/169 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA VFQ+CK+I+RKPM N    Q+CMVTAQGR    +PT + + N  IS  PEY+
Sbjct  412  FIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQGRMDRRQPTAMVLQNCTISGDPEYI  467

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+  ART+++ S+ID  I PEGW  + G+   + CW+GE+GN G G+
Sbjct  468  LVKDKSKAYLGRPWKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGS  527

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK*VSI  161
            D+++R  W+G+K  +T   A +F  G+ + GD WI  SGVPY A  VS+
Sbjct  528  DMTRRVTWSGIKK-LTPEHAVDFTAGRLMEGDKWIKPSGVPYVAGMVSV  575



>emb|CAN77092.1| hypothetical protein VITISV_026596 [Vitis vinifera]
Length=507

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 112/164 (68%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AV Q+C + +R+PM    S Q  ++TAQGRS  +E TGI+I NS + A P+  
Sbjct  346  FIFGDAVAVLQNCNIYVRRPM----SNQPNVITAQGRSDQNENTGISIHNSRVMAAPDLR  401

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPWR+++RTV + + +D  I PEGWSP++G +GL   +YGE+ NTG GA
Sbjct  402  PVQSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTLYYGEYMNTGSGA  461

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
                R KW G   + + A+AD+F  G+F++GD+WIP +GVPY++
Sbjct  462  STRGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIPTTGVPYAS  505



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   174 bits (442),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 81/178 (46%), Positives = 116/178 (65%), Gaps = 8/178 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA +FQ+C  ++RKP+ N    Q C+VTAQGR +  +P+ I I NS  +A PEY 
Sbjct  414  FIFGDAAVIFQNCTFVVRKPLDN----QQCIVTAQGRKERRQPSAIIIQNSTFTADPEYY  469

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + + S+LGRPW++ +RT+I+ S I+  I P GW P+ G + L  C+Y EF N G GA
Sbjct  470  PYRNELKSYLGRPWKEFSRTIIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGA  529

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK*VSITSL*YNVTS  134
                R KW G+K  I  + A +FAPG+F+ GD WIP++GVPY++   ++ S   NVT+
Sbjct  530  KTHDRVKWRGIK-TIKPSHAIDFAPGRFLSGDRWIPSTGVPYNSGLFTLLS---NVTT  583



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 112/163 (69%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A+AVFQ+CK ++RKP+ N    Q C+VTAQGR    +P+ + I +S I+A P+  
Sbjct  414  FVFGDASAVFQNCKFLVRKPLEN----QQCIVTAQGRKMRRQPSALIIQSSTITAHPDLF  469

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RT+I+ S ID  I PEGW P+ GT+GL+ CWY EF N G G+
Sbjct  470  PERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGS  529

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              + R KW G+K  I +  A +F PG+F+ GD+WI A+G+PY+
Sbjct  530  SKNLRVKWNGIK-TINRQHAMDFTPGRFLKGDSWIKATGIPYT  571



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 112/169 (66%), Gaps = 5/169 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA VFQ+CK+I+RKPM N    Q+CMVTAQGR    +PT + + N  IS  PEY+
Sbjct  412  FIFGDAAVVFQNCKMIVRKPMDN----QACMVTAQGRMDRRQPTAMVLQNCTISGDPEYI  467

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+  ART+++ S+ID  I PEGW  + G+   + CW+GE+GN G G+
Sbjct  468  PVKDKSKAYLGRPWKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGS  527

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK*VSI  161
            D+++R  W+G+K  +T   A +F  G+ + GD WI  SGVPY A  VS+
Sbjct  528  DMTRRVTWSGIKK-LTPEHAVDFTAGRLMEGDRWIKPSGVPYVAGMVSV  575



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 117/169 (69%), Gaps = 5/169 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+A+FQ+CK+++RKP+ N    Q C+VTAQGR +  +P+ I + N  I+A   Y+
Sbjct  409  FIFGDASAIFQNCKMLVRKPLDN----QQCIVTAQGRKERRQPSAIILQNCTITADASYV  464

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   SFLGRPW++++RT+I+ S ID  I PEGW P+ G +G++ C+Y EFGN G G+
Sbjct  465  PVKAKFRSFLGRPWKEYSRTIIMQSFIDDIIQPEGWLPWMGDFGIKTCFYSEFGNRGPGS  524

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK*VSI  161
             ++ R KW G+K  IT A A +F  G F+ G+TW+P  GVP+SA  V++
Sbjct  525  SMTGRVKWKGIK-TITPAHAVDFTVGTFLRGNTWLPKFGVPFSAGMVAV  572



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 116/165 (70%), Gaps = 7/165 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAIL-NSVISATPEY  491
            FIFG+AAAVFQ+C++I+RKP+ N G    CMVTAQGR +    TG+ ++ N  I A P +
Sbjct  409  FIFGDAAAVFQNCQMIVRKPLANQG----CMVTAQGRKER-RSTGVTVIQNCHILAEPAF  463

Query  490  LTAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKG  311
            L+   P+ ++LGRPW+Q +RT+I+ + ID  IAPEGW+P++G + L+  +YGEF N G G
Sbjct  464  LSTKPPVKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWEGNFALDTLYYGEFKNRGPG  523

Query  310  ADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            +D+S+R +W G++  IT A A+ F PG+   GD W+  SGVPY A
Sbjct  524  SDMSRRVRWKGIQ-TITPAIAESFTPGRLFAGDEWVRQSGVPYVA  567



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 112/162 (69%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CKLI+R P++N    Q+CMVTAQGR+       I + N  I A P  L
Sbjct  403  FIFGDAAAVFQNCKLIVRMPLVN----QACMVTAQGRNNSRSTGAIVLQNCSIVADPALL  458

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +A  P+ ++LGRPW++++RT+I+ S ID  I P+GWSP+ GT+GL+  +Y E+ N G GA
Sbjct  459  SADPPVRAYLGRPWKEYSRTIIMQSNIDGFIDPQGWSPWMGTFGLKTLYYAEYQNRGPGA  518

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            +  +R  W G++  IT   A+ F PGK+ +GD+WI ASG PY
Sbjct  519  NTDQRVDWPGIQH-ITPQVAESFTPGKYFIGDSWITASGFPY  559



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 111/163 (68%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A  VFQ+C  ++RKP+ N    Q C+VTAQGR    +P+ I I NS I+A PE  
Sbjct  419  FVFGDAPVVFQNCTFLVRKPLEN----QQCIVTAQGRKARRQPSAIIIQNSTITAHPELE  474

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++ +RT+I+ + ID  I PEGWSP+ G++GL+ CWYGE+ N G G+
Sbjct  475  PVKDQYKSYLGRPWKEFSRTIIMETFIDDLIQPEGWSPWFGSFGLKTCWYGEYNNYGPGS  534

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D+  R KW G+K V ++  A +F PG+F+ GD+WI  +GVPY+
Sbjct  535  DMKNRVKWNGIKPV-SRQHAIDFTPGRFLRGDSWIKPTGVPYA  576



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 109/164 (66%), Gaps = 7/164 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CK+I+RKP+ N    Q+CMVTA GR     PTGI + N  IS  P Y 
Sbjct  412  FIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHGRLDRRSPTGIILQNCTISGEPGYE  467

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW+ +AR +++ S+ID  IAPEGW  + G+   + CW+GEFGN G GA
Sbjct  468  KDLNK--AYLGRPWKNYARAIVMQSQIDDVIAPEGWMEWIGSNNHQSCWFGEFGNRGLGA  525

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D +KRA W G+K +  +  AD F  G+F+ GD WI  SGVPY A
Sbjct  526  DQTKRATWRGIKELTAQHAAD-FTAGRFVFGDRWIQPSGVPYVA  568



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 116/178 (65%), Gaps = 8/178 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA +FQ+C  ++RKP+ N    Q C+VTAQGR +  +P+ I I NS  +A PEY 
Sbjct  414  FIFGDAAVIFQNCTFVVRKPLDN----QQCIVTAQGRKERRQPSAIIIQNSTFTADPEYY  469

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + + S+LGRPW++ +RT+I+ S I+  I P GW P+ G + L  C+Y EF N G GA
Sbjct  470  PYRNELKSYLGRPWKEFSRTIIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGA  529

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK*VSITSL*YNVTS  134
                R KW G+K  I  + A +FAPG+F+ GD WIP++GVPY++   ++ S   NVT+
Sbjct  530  KTHDRVKWRGIK-TIKPSHAIDFAPGRFLSGDRWIPSTGVPYNSGLFTLLS---NVTT  583



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 109/161 (68%), Gaps = 5/161 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAA+FQ+C  ++RKP+ +    QSC+VTAQGR +  +P+ I I NS I+A P+Y 
Sbjct  430  FVFGDAAAIFQNCTFVVRKPLPD----QSCIVTAQGRKERRQPSAIVIQNSTITADPDYF  485

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW++++RT+I+ S ID  I PEGW  + G WGL  C+Y EF NTG  A
Sbjct  486  PVKNVNRAYLGRPWKEYSRTIIMESYIDDVIQPEGWLAWAGQWGLRTCFYTEFCNTGPAA  545

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVP  185
            + ++R  W G+K  IT+  A +F PGKF  GD WI  SGVP
Sbjct  546  NKARRVTWQGIKQ-ITRRHAAQFTPGKFFRGDEWIKLSGVP  585



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A+AVFQ+CK +IRKP+ N    Q C+VTAQGR    +P+ I I NS I+A P+  
Sbjct  415  FVFGHASAVFQNCKFLIRKPLEN----QQCIVTAQGRKMRRQPSAIVIQNSTITAHPDLF  470

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++ +RT+I+ S ID  I PEGW P+ GT+GL+ CWY EF N G G+
Sbjct  471  PERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGS  530

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              + R KW G+K  I +  A +F PG+F  G  WI  +G+PY+
Sbjct  531  SKAARVKWNGIK-TIDRQHALDFTPGRFFKGGAWIKTTGIPYT  572



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 107/164 (65%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+CK+++RKPM N    Q C+VTAQGR+Q  EPT I + N  IS+ P + 
Sbjct  407  FIFGNAAAVFQNCKILVRKPMDN----QQCIVTAQGRTQRKEPTAIILQNCAISSDPTFF  462

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+Q++RT+I+  +ID  I PEGW P+ G + L   +Y E  N G GA
Sbjct  463  PVRHINKAYLGRPWKQYSRTIIMQCQIDDLIQPEGWLPWMGDFALHTLFYAEINNRGPGA  522

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
               KR KW G+K  IT   A +F  G+FI GD WI  +GVPYS+
Sbjct  523  ATDKRVKWKGIKK-ITPQHALDFTVGRFIRGDPWIKPTGVPYSS  565



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A+AVFQ+CK +IRKP+ N    Q C+VTAQGR    +P+ I I NS I+A P+  
Sbjct  415  FVFGDASAVFQNCKFLIRKPLEN----QQCIVTAQGRKMRRQPSAIIIQNSTITAHPDLF  470

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++ +RT+I+ S ID  I PEGW P+ GT+GL+ CWY EF N G G+
Sbjct  471  PERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGS  530

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              + R KW G+K  I +  A +F PG+F  G  WI  +G+PY+
Sbjct  531  SKAARVKWNGIK-TIDRQHALDFTPGRFFKGGAWIKTTGIPYT  572



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+ G+AAAVFQ+CK++IRKP+ N    Q C+VTAQGRS+  E + + + N  I+A P Y 
Sbjct  412  FVLGDAAAVFQNCKMLIRKPLDN----QQCIVTAQGRSKRREASALILQNCTITADPSYT  467

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 I+S+LGRPW+ ++RT+I+ S ID  I P+GW P+ G +GL  C+Y E+ N G GA
Sbjct  468  PFKGQILSYLGRPWKAYSRTIIMESYIDDIIQPKGWMPWLGDFGLNTCFYAEYKNRGPGA  527

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              ++R KW G+K  IT   A EF  G+F+ GD WI  +GVPY A
Sbjct  528  STARRVKWKGIKK-ITPQHAVEFTAGRFMKGDRWIRTAGVPYVA  570



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 106/164 (65%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN A VFQ+CK+++RKPM N    Q C+VTAQGR+Q  EPT I + N  IS+ P++ 
Sbjct  410  FIFGNGAVVFQNCKILVRKPMDN----QQCIVTAQGRTQRKEPTAIILQNCAISSAPDFF  465

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   +FLGRPW+Q++RT+I+ S+ID  I PEGW P+ G + L   +Y E  N G GA
Sbjct  466  PIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGA  525

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
               KR KW G+K  IT   A +F   +FI GD WI  +GVPY++
Sbjct  526  ATDKRVKWKGIKK-ITMEHALDFTAARFIRGDPWIKPTGVPYTS  568



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 106/164 (65%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN A VFQ+CK+++RKPM N    Q C+VTAQGR+Q  EPT I + N  IS+ P++ 
Sbjct  407  FIFGNGAVVFQNCKILVRKPMDN----QQCIVTAQGRTQRKEPTAIILQNCAISSAPDFF  462

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   +FLGRPW+Q++RT+I+ S+ID  I PEGW P+ G + L   +Y E  N G GA
Sbjct  463  PIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGA  522

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
               KR KW G+K  IT   A +F   +FI GD WI  +GVPY++
Sbjct  523  ATDKRVKWKGIKK-ITMEHALDFTAARFIRGDPWIKPTGVPYTS  565



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 110/162 (68%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+AVFQ+CK+I+RKP    G+ Q+CMVTAQGR        I + N  ISA P ++
Sbjct  391  FIFGDASAVFQNCKMIVRKP----GANQACMVTAQGRKDHRGVGAIILRNCEISAEPAFI  446

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                PI ++LGRPW++++RT+I+ S+IDA I PEGW+P+ G + L   +Y E+ N G GA
Sbjct  447  NTQPPIKAYLGRPWKEYSRTIIMQSQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGA  506

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            +  +R KWAG K  I+  +A+++AP  FI  D+WI  +G+ Y
Sbjct  507  NTDRRVKWAGYKKSISPQEAEKYAPNIFIDQDSWIKKTGISY  548



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+  A+FQ+CK+++RKP    G  Q+CMVTAQGR+  +E TGI + N  I+  P+Y+
Sbjct  406  FIFGDGVALFQNCKMVVRKP----GETQACMVTAQGRTDHNEITGIFLQNCTITGEPDYM  461

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+  AR V++ S ID  IAPEGW+ + G    ++C++GE+GNTG G+
Sbjct  462  AVKDKNKAYLGRPWKNFARVVVMQSSIDEAIAPEGWTEWTGEEYHQNCFFGEYGNTGPGS  521

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            DV++R KW+ VK  +T  QA  F P +   GD WI  SGVPY
Sbjct  522  DVTQRVKWSTVKR-LTPDQAAAFTPARVFEGDKWIKPSGVPY  562



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   170 bits (431),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 110/164 (67%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++A VFQ+C +++RKP+ N    Q C+VTAQGR++  EPTGI + N  ISA  +Y+
Sbjct  382  FIFGDSAVVFQNCLILVRKPLDN----QQCIVTAQGRNERREPTGIVLQNCTISAADDYI  437

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   S+LGRPW+  +RT+I+ S+ID  I+PEGW P+ G +GL  C+Y E+GN G  +
Sbjct  438  PFKTKFKSYLGRPWKAFSRTIIMQSQIDDLISPEGWLPWMGDFGLNTCFYAEYGNRGPAS  497

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R  W G+K  IT    ++F  G+FI G  W+ ASGVPY++
Sbjct  498  ATTSRVTWRGIKQ-ITGQHVNDFTVGRFISGHLWLGASGVPYTS  540



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++AAVFQ+CK++IRKP+ N    Q+C+VTAQGR++  E T + + N  I+  P YL
Sbjct  414  FIFGDSAAVFQNCKMVIRKPLDN----QNCIVTAQGRTERREATALVLQNCTITGDPAYL  469

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                    +LGRPW++ +RT+I+NS+ID  IAPEGW P+ G + L  C+Y E  N G G+
Sbjct  470  PVKDQNKGYLGRPWKEFSRTIIMNSRIDDVIAPEGWLPWAGDFALNTCFYTEILNRGPGS  529

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
             +  R KW G+K V  + +A E+ PG+FI GD WI A+GVPY
Sbjct  530  KLDGRVKWRGIKKVPAQ-RAVEYTPGRFIRGDWWIKAAGVPY  570



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 110/164 (67%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++A VFQ+C +++RKP+ N    Q C+VTAQGR++  EPTGI + N  ISA  +Y+
Sbjct  422  FIFGDSAVVFQNCLILVRKPLDN----QQCIVTAQGRNERREPTGIVLQNCTISAADDYI  477

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   S+LGRPW+  +RT+I+ S+ID  I+PEGW P+ G +GL  C+Y E+GN G  +
Sbjct  478  PFKTKFKSYLGRPWKAFSRTIIMQSQIDDLISPEGWLPWMGDFGLNTCFYAEYGNRGPAS  537

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R  W G+K  IT    ++F  G+FI G  W+ ASGVPY++
Sbjct  538  ATTSRVTWRGIKQ-ITGQHVNDFTVGRFISGHLWLGASGVPYTS  580



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CK+I+RKP+ N    Q+CMVTAQGR     P+ + + N  IS    Y 
Sbjct  412  FIFGDAAAVFQNCKMIVRKPLEN----QACMVTAQGRLDRRSPSALILQNCTISGERGYD  467

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW+ +AR +++ S+ID  IAPEGW  + GT     CW+GEFGN G GA
Sbjct  468  KELNK--AYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFGEFGNRGVGA  525

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            ++SKR  W G+K  +T   A +F  GKFI GD WI  SGVPY A
Sbjct  526  ELSKRVTWRGMKK-LTPEHAADFTAGKFIFGDRWILPSGVPYVA  568



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+ +A FQ+CK+I+RKP+ N    Q C+VTAQGR+   +PT I I NS I A   Y 
Sbjct  435  FIFGDGSAFFQNCKIIVRKPLDN----QHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + I S+LGRPWR H+RTVI+ + ID  I P+GW P++G +G+  C+Y E+GN G GA
Sbjct  491  PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + + R  W GVK +    +A EF  GKF  GD WI   GVPY
Sbjct  551  NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIKPRGVPY  592



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+ +A FQ+CK+I+RKP+ N    Q C+VTAQGR+   +PT I I NS I A   Y 
Sbjct  431  FIFGDGSAFFQNCKIIVRKPLDN----QHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  486

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + I S+LGRPWR H+RTVI+ + ID  I P+GW P++G +G+  C+Y E+GN G GA
Sbjct  487  PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  546

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + + R  W GVK +    +A EF  GKF  GD WI   GVPY
Sbjct  547  NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIKPRGVPY  588



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 112/165 (68%), Gaps = 5/165 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA AVFQ+C L++RKP+ N    ++C+VTA+GR+  +E + I + N  I   PEY 
Sbjct  401  FIFGNARAVFQNCTLLVRKPLENQ---KACLVTAEGRTTINETSAIVLQNCRILPAPEYP  457

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWG-LEDCWYGEFGNTGKG  311
                   ++LGRPW+ ++RTVI++S +D+ + PEGW+P+  T   L+ CWY E  N G G
Sbjct  458  VNDPTYKTYLGRPWKPYSRTVIMDSHLDSLVDPEGWAPWNVTSAHLDTCWYAELNNKGPG  517

Query  310  ADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            AD+S+R  W G+K  IT  +AD+F PG+F++GD+WI   G+PY +
Sbjct  518  ADLSRRVAWPGIKK-ITVNEADDFTPGQFMVGDSWIAGKGIPYDS  561



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CK+I+RKPM N    Q+CMVTAQGR       GI + N  I A   +L
Sbjct  382  FIFGDAAAVFQNCKMIVRKPMDN----QACMVTAQGRKDHRGVGGIVMQNCQIKAEQGFL  437

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             A  PI ++LGRPW++ +RT+I+ S+ID  IAPEGWSP+ G + L+  +Y E+ N G G+
Sbjct  438  AAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGS  497

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
                R  W G +  I    A +F PG FI+GD W+  SGVPY 
Sbjct  498  ITYSRVNWKGYQKTIAPQVAAQFTPGVFIMGDEWVKLSGVPYE  540



>ref|XP_009409132.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=568

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 104/163 (64%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAV Q C + +R+P  N    Q  MVTA GR  P+EPTGI I  S I+A P+  
Sbjct  405  FIFGNAAAVLQDCDIQVRRPNPN----QKNMVTASGRDDPNEPTGIVIHRSRITAAPDLA  460

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+++ARTVI+ S+I   I PEGW  + GT+ L+  +YGE+ NTG GA
Sbjct  461  PVQGSFRTYLGRPWKEYARTVIMESEISDVIEPEGWHEWSGTFALDTLYYGEYRNTGAGA  520

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
                R +W G K + + A+A EF PG FI G +W+ A+G PYS
Sbjct  521  GTGSRVQWKGYKVITSAAEAAEFTPGSFIAGSSWLEATGFPYS  563



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 107/163 (66%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+ VFQ+CK+I+RKP    G  Q+CMVTAQGR        I + N  I A P + 
Sbjct  399  FIFGDASVVFQNCKMIVRKP----GDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFT  454

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +A  PI ++LGRPW++++RT+II S IDA I PEGW+P+ G + L   +Y E+ N G GA
Sbjct  455  SAQPPIKAYLGRPWKEYSRTIIIQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGA  514

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            ++ KR KW G K  I+  +A+++AP  FI  D WI  +G+ Y+
Sbjct  515  NIDKRVKWGGYKRNISPQEAEKYAPAHFIDQDNWIKKTGISYA  557



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+AVFQ+CK+I+RKP    G+ Q+CMVTAQGR        I + N  I A P + 
Sbjct  395  FIFGDASAVFQNCKMIVRKP----GNNQACMVTAQGRKDHRGVGAIVLRNCEIRAEPAFT  450

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +   PI ++LGRPW++++RT+I+ ++IDA I PEGW+P+ G + L   +Y E+ N G GA
Sbjct  451  STQPPIKAYLGRPWKEYSRTIIMQTQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGA  510

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            +  KR KWAG K  I+  +A+++AP  FI  D+WI  +G+ Y
Sbjct  511  NTDKRVKWAGYKRNISPQEAEKYAPNIFIDQDSWIKKTGISY  552



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AA VFQ+C +++RKPM N    Q C+VTAQGR    E TGI + N  ISA P   
Sbjct  415  FLFGDAAVVFQNCLMLVRKPMAN----QQCIVTAQGRKDRHEATGIVLHNCTISADPTLS  470

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +A +  VS+LGRPW++++RT+I+ S+ID  I  +GW P+ G +GL+ C+Y E GN G GA
Sbjct  471  SASTTTVSYLGRPWKEYSRTIIMQSQIDGLINEDGWQPWLGEFGLKTCFYTEIGNRGPGA  530

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              +KR  W G K V     A ++   +FI G TW+P +GVP++
Sbjct  531  ATTKRVTWKGYKKV-DLTHAHKYTVQQFIQGKTWLPKTGVPFT  572



>ref|XP_010661658.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Vitis vinifera]
 emb|CBI38889.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 106/163 (65%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQ+C + +RKPM    + QS M+TAQGR  P+EPTGI++  S + ++PE+ 
Sbjct  324  FIFGNAAVVFQNCDIYVRKPM----NRQSNMITAQGRDIPEEPTGISVQASRVLSSPEFT  379

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            T      SFLGRPW++++RTV + + +D  I P GW+ + G +GL   +YGE+ N+G GA
Sbjct  380  TVKGSFKSFLGRPWKRYSRTVFLETDLDGLIDPRGWTEWSGNYGLSTLYYGEYNNSGGGA  439

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
               +R KW G   +     A  F   +FI G+ WIPASGVP+S
Sbjct  440  STKERVKWPGFHVLNGTEDAMPFTVSRFIQGEKWIPASGVPFS  482



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 107/163 (66%), Gaps = 6/163 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C+ I+R+PM N    Q C+VTAQGR +  +P+ I I N    A P+Y 
Sbjct  417  FVFGDAAAVFQNCRFIVRRPMDN----QQCIVTAQGRKERRQPSAIIIQNGTFVADPDYY  472

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 + ++LGRPW++ +RT+I+ S ID  I P GW P+ G +GL  C+Y EFGN G GA
Sbjct  473  PVRFELPAYLGRPWKEFSRTIIMESFIDDLIQPRGWLPWAGDFGLRTCFYTEFGNRGPGA  532

Query  307  -DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
             + S+RAKW GVK  IT   A +F PG F  GD WI  +G+PY
Sbjct  533  VEPSRRAKWKGVKN-ITAKHARDFTPGSFFKGDWWIKRTGIPY  574



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FGNAA  FQ+CKL++RKP+ N    Q C+VTA GR    EPT +   +      P YL
Sbjct  415  FVFGNAATNFQNCKLVVRKPLDN----QQCIVTAHGRLNRKEPTALIFQSCHFMGDPAYL  470

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW++++RT+II S ID  I PEGW P+ G +GL   +Y E  N G GA
Sbjct  471  PFKAINKAYLGRPWKEYSRTIIIGSTIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGAGA  530

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D SKR KW G+K  IT   A +F P +FI GD WIPA G+PYS+
Sbjct  531  DESKRVKWRGIKH-ITPQHAADFTPRRFIDGDAWIPAKGIPYSS  573



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 109/163 (67%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG++A VFQ+C L++RKP+ N    Q+C +TA GR  P EPTG       I   P+YL
Sbjct  404  FLFGDSATVFQNCTLLVRKPLPN----QACPITAHGRQDPREPTGFVFQGCRIEGEPDYL  459

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW++++RT+I+N+ I   + P+GW P+   +GL+  +Y E  NTG G+
Sbjct  460  AVKASSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWNADFGLKTLFYSEIQNTGPGS  519

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D++ R  WAG+K + +K   D+F P KFI GD+WIPA+GVPY+
Sbjct  520  DLASRVTWAGIKKLTSK-DIDQFTPAKFIQGDSWIPATGVPYT  561



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 105/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++A V Q+CK+I+RKP+ N    Q C+VTAQGR +  E + + + N  IS  PEYL
Sbjct  522  FIFGDSATVLQNCKIIVRKPLEN----QQCIVTAQGRIERREVSALVLQNCTISGDPEYL  577

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++ +RT+I+ S+ID  IAPEGW P+ G + L   WY EFGN G GA
Sbjct  578  PVKDKNKAYLGRPWKEFSRTLIMQSQIDDIIAPEGWLPWNGDFALNTLWYAEFGNRGPGA  637

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              + R  W G+K  I  A A  F PG F+ GD WIP +GVPY+
Sbjct  638  VQTHRVTWRGIKK-INAAIARRFTPGVFLRGDDWIPKAGVPYT  679



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C++I+RKPM N    Q+CMVTAQGR       GI + N  I A  ++L
Sbjct  382  FIFGDAAAVFQNCQMIVRKPMDN----QACMVTAQGRKDHRGVGGIVMQNCQIKAEHDFL  437

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             A  PI ++LGRPW++ +RT+I+ S+ID  IAPEGWSP+ G + L+  +Y E+ N G G+
Sbjct  438  AAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGS  497

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
                R  W G +  I    A +F P  FI+GD W+  SGVPY
Sbjct  498  ITYSRVNWKGYQKTIAPQVAAQFTPAVFIMGDEWVKLSGVPY  539



>emb|CDX71786.1| BnaC08g30880D [Brassica napus]
Length=522

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 106/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +R+PM + G+    M+TAQGR  P E TGI+I NS + A+PE+ 
Sbjct  361  FIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQGRDNPHENTGISIQNSRVRASPEFE  416

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RTV + + +D  I P GW  ++G + L   +YGEF NTG GA
Sbjct  417  AVKGQFKSYLGRPWKKYSRTVFLKTDLDGLIDPRGWREWRGDFALSTLYYGEFMNTGSGA  476

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              S+R  W G   +    +A  F   +FI GD+WIP +GVP+SA
Sbjct  477  GTSRRVSWPGFHVLHGADEASPFTVSRFIQGDSWIPITGVPFSA  520



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CK+I+RKP+ N    Q+CMVTA GR     PT + + N  IS    Y 
Sbjct  413  FIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHGRLDRRSPTALILQNCTISGESGYD  468

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW+ +AR +++ S+ID  IAPEGW  + G      CW+GEFGN G GA
Sbjct  469  KELNK--AYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWTGASNHNTCWFGEFGNRGVGA  526

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            ++SKR  W G+K  +T   A +F  GKFI GD WI  SGVPY A
Sbjct  527  ELSKRVTWRGMKK-LTPEHAADFTAGKFIFGDRWILPSGVPYVA  569



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CK+I+RKP+ N    Q+CMVTA GR     P+ + + N  IS    Y 
Sbjct  415  FIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHGRLDMRSPSALILQNCTISGERGYD  470

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW   AR +++ S+ID  IAPEGW  + GT     CW+GEFGN G GA
Sbjct  471  KELNK--AYLGRPWTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGA  528

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            ++SKR  W+G+K  +T  QA +F  GKFI GD WI  SGVPY A
Sbjct  529  ELSKRVTWSGMKK-LTPEQAADFTAGKFIFGDRWILPSGVPYVA  571



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 106/162 (65%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+AVFQ+CK+I+RKP    G  Q+CMVTAQGR        I + N  I A P + 
Sbjct  399  FIFGDASAVFQNCKMIVRKP----GDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFT  454

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +   PI ++LGRPW++++RT+I+ S IDA I PEGW+P+ G + L   +Y E+ N G GA
Sbjct  455  STQPPIKAYLGRPWKEYSRTIIMQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGA  514

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            ++ KR KW G K  I+  +A+++AP  FI  D WI  +G+ Y
Sbjct  515  NIDKRVKWGGYKRNISPQEAEKYAPAHFIDQDNWIKKTGISY  556



>ref|XP_010513751.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=358

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 106/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +R+PM + G+    M+TAQGR  P   TGI+I +S + A PE+ 
Sbjct  197  FIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQGRDDPHATTGISIQHSRVRAAPEFE  252

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +D  I P GW  + G++ L   +YGEF NTG GA
Sbjct  253  AVKGRFKNYLGRPWKKYSRTVFLKTDLDGLIDPRGWREWSGSYALSTLYYGEFMNTGAGA  312

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            + ++R  W G   +  + +A  F   +FI GD+WIP +GVP+SA
Sbjct  313  ETTRRVNWPGFHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSA  356



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CK+I+RKP+ N    Q+CMVTA GR     P+ + + N  IS    Y 
Sbjct  412  FIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHGRLDMRSPSALILQNCTISGERGYD  467

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW   AR +++ S+ID  IAPEGW  + GT     CW+GEFGN G GA
Sbjct  468  KELNK--AYLGRPWTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGA  525

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            ++SKR  W+G+K  +T  QA +F  GKFI GD WI  SGVPY A
Sbjct  526  ELSKRVTWSGMKK-LTPEQAADFTAGKFIFGDRWILPSGVPYVA  568



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 108/163 (66%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A  VFQSC + +RKPM    SGQ   VTAQGR+  +E TGI+I NS+++A  +  
Sbjct  361  FIFGDAVVVFQSCNIYVRKPM----SGQQNTVTAQGRTDHNENTGISIHNSIVTAASDLR  416

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +D+ I P GW  + G++GL   +Y E+ NTG GA
Sbjct  417  PVQGSFKTYLGRPWQKYSRTVFMKTSLDSLINPAGWLEWSGSFGLSTLYYAEYMNTGAGA  476

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D SKR  W G   + + ++A +F  G F+ GD+WIPA+GVP+S
Sbjct  477  DTSKRVNWPGYHVIASSSEASKFTVGGFLSGDSWIPATGVPFS  519



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 103/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FGNAA  FQ+CKL++RKPM N    Q C+VTA GR    EPT +          P YL
Sbjct  414  FVFGNAATNFQNCKLVVRKPMDN----QQCIVTAHGRMNRKEPTALIFQGCHFMGDPAYL  469

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW+Q++RT+II S+ID  I PEGW P+ G +GL   +Y E  N G GA
Sbjct  470  PFKSINKAYLGRPWKQYSRTIIIGSQIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGPGA  529

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              +KR KW G+K  IT   A +F P +FI GD WIPA G+PYS+
Sbjct  530  VETKRVKWRGIKH-ITPQHAADFTPRRFIDGDAWIPAKGIPYSS  572



>ref|XP_008390620.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=388

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+  A+FQ+CK+++RKP    G  Q+CMVTAQGR+  +E TGI + N  I+  P+Y+
Sbjct  225  FIFGDGVALFQNCKMVVRKP----GEAQACMVTAQGRTDRNEITGIFLQNCTITGEPDYM  280

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++ AR V++ S ID  IAPEGW+ + G    ++C++GE+GN G   
Sbjct  281  AVKDKNKAYLGRPWKKFARVVVMQSSIDEAIAPEGWTEWTGEKYHQNCFFGEYGNRGPRK  340

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D+++R KW+ VK  +T  QA  F P +   GD W+  SGVPY
Sbjct  341  DMTQRVKWSTVKR-LTPDQAAAFTPARVFEGDKWVKPSGVPY  381



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 108/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR  P EPTG       I+  P+YL
Sbjct  407  FLFGDAAAVFQNCTLLVRKPLPN----QACPITAHGRQDPREPTGFVFQGCQIAGEPDYL  462

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +  +   ++LGRPW+ ++RT+I+N+ I   + P+GW P+ G +GL   +Y E  NTG G+
Sbjct  463  SVKATSKAYLGRPWKAYSRTIIMNTFIPDFVQPQGWQPWNGDFGLSTLFYSEIQNTGPGS  522

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            DV  R  WAG+K  +T     +F P +FI GD+WIPA+GVPY+
Sbjct  523  DVVNRVTWAGIKK-LTNNDLLQFTPAQFIQGDSWIPATGVPYT  564



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+  A+FQ+CK+++RKP    G  QSCMVTAQGR+  +E T I + N  I+  PEY+
Sbjct  401  FIFGDGVALFQNCKMLVRKP----GDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYM  456

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+  AR V++NS+ID  I PEGW  + G+     C+ GE+GN G  A
Sbjct  457  AVKDKNKAYLGRPWKDFARVVVMNSQIDEAIQPEGWIEWAGSQFHNTCFLGEYGNRGPRA  516

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D+++R KW  +K  +T  QA  F P K   GD WI  SGVPY
Sbjct  517  DMAQRVKWPSLKK-LTADQAATFTPAKLFEGDRWIKPSGVPY  557



>ref|XP_006433462.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46702.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=706

 Score =   163 bits (413),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 78/161 (48%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+ +A FQ+CK+I+RKP+ N    Q C+VTAQGR+   +PT I I NS I A   Y 
Sbjct  435  FIFGDGSAFFQNCKIIVRKPLDN----QHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + I S+LGRPWR H+RTVI+ + ID  I P+GW P++G +G+  C+Y E+GN G GA
Sbjct  491  PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVP  185
            + + R  W GVK +    +A EF  GKF  GD WI   G P
Sbjct  551  NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIKPRGHP  591



>ref|XP_006402549.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
 gb|ESQ44002.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
Length=519

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 106/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AVFQ+C + +R+PM + G+    M+TAQGR  P E TGI+I +S + A PE+ 
Sbjct  358  FIFGDAVAVFQNCDIFVRRPMDHQGN----MITAQGRDNPHENTGISIQHSRVRAAPEFE  413

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RTV + ++ID  I P GW  ++G + L   +YGEF NTG GA
Sbjct  414  AVKGRFKSYLGRPWKKYSRTVFLKTEIDGLIDPRGWREWRGDFALSTLYYGEFMNTGSGA  473

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              S+R  W G   +  + +A  F   +FI GD+WIP +GVP+SA
Sbjct  474  GTSRRVNWPGFHLLHGEEEASPFTVSRFIQGDSWIPITGVPFSA  517



>ref|XP_006433459.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46699.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=711

 Score =   163 bits (413),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 78/161 (48%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+ +A FQ+CK+I+RKP+ N    Q C+VTAQGR+   +PT I I NS I A   Y 
Sbjct  435  FIFGDGSAFFQNCKIIVRKPLDN----QHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + I S+LGRPWR H+RTVI+ + ID  I P+GW P++G +G+  C+Y E+GN G GA
Sbjct  491  PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVP  185
            + + R  W GVK +    +A EF  GKF  GD WI   G P
Sbjct  551  NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIKPRGHP  591



>ref|XP_009116752.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Brassica rapa]
Length=521

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 106/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+AVFQ+C + +R+PM + G+    M+TAQGR  P E TGI+I NS + A+PE+ 
Sbjct  360  FIFGDASAVFQNCDIFVRRPMDHQGN----MITAQGRDNPHENTGISIQNSRVRASPEFE  415

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RTV + + +D  I P GW  ++G + L   +YGEF NTG GA
Sbjct  416  AVKGQFKSYLGRPWKKYSRTVFLKTDLDGLIDPRGWREWRGDFALSTLYYGEFMNTGSGA  475

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              S+R  W G   +    +A  F   +FI GD+WIP +GVP+SA
Sbjct  476  GTSRRVSWPGFHVLHGADEASPFTVSRFIQGDSWIPITGVPFSA  519



>emb|CDY41145.1| BnaA09g38700D [Brassica napus]
Length=521

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 106/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+AVFQ+C + +R+PM + G+    M+TAQGR  P E TGI+I NS + A+PE+ 
Sbjct  360  FIFGDASAVFQNCDIFVRRPMDHQGN----MITAQGRDNPHENTGISIQNSRVRASPEFE  415

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RTV + + +D  I P GW  ++G + L   +YGEF NTG GA
Sbjct  416  AVKGQFKSYLGRPWKKYSRTVFLKTDLDGLIDPRGWREWRGDFALSTLYYGEFMNTGSGA  475

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              S+R  W G   +    +A  F   +FI GD+WIP +GVP+SA
Sbjct  476  GTSRRVSWPGFHVLHGADEASPFTVSRFIQGDSWIPITGVPFSA  519



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 110/164 (67%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FI G+AAAVFQ+CK+++RKP+ N    Q C +TAQGR+   EPTG  + N  I+A  +YL
Sbjct  416  FISGDAAAVFQNCKMVVRKPLEN----QRCTITAQGRNNTREPTGFVLQNCTITAEKDYL  471

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   SFLGRPW+ ++RT+++ S ID  I P+GW+P+ GT+G++ C   E+GN G GA
Sbjct  472  PVKLDSPSFLGRPWKPYSRTIVMQSSIDDIIDPKGWAPWMGTFGIDTCSLSEYGNRGPGA  531

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             ++ R  W G+   ++   A+ F  GKF+ GD+WI A+GVPY++
Sbjct  532  TLTSRVTWKGIVK-LSPQDAEAFTAGKFLEGDSWIAATGVPYTS  574



>ref|XP_006433461.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46701.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=727

 Score =   163 bits (413),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 78/161 (48%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+ +A FQ+CK+I+RKP+ N    Q C+VTAQGR+   +PT I I NS I A   Y 
Sbjct  435  FIFGDGSAFFQNCKIIVRKPLDN----QHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + I S+LGRPWR H+RTVI+ + ID  I P+GW P++G +G+  C+Y E+GN G GA
Sbjct  491  PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVP  185
            + + R  W GVK +    +A EF  GKF  GD WI   G P
Sbjct  551  NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIKPRGHP  591



>ref|XP_006433460.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46700.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=714

 Score =   163 bits (412),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 78/161 (48%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+ +A FQ+CK+I+RKP+ N    Q C+VTAQGR+   +PT I I NS I A   Y 
Sbjct  435  FIFGDGSAFFQNCKIIVRKPLDN----QHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + I S+LGRPWR H+RTVI+ + ID  I P+GW P++G +G+  C+Y E+GN G GA
Sbjct  491  PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVP  185
            + + R  W GVK +    +A EF  GKF  GD WI   G P
Sbjct  551  NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDDWIKPRGHP  591



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAA+FQSC  ++RKP+ N    Q C+VTA GR +  +P+ + I N       + +
Sbjct  412  FIFGDAAAIFQSCTFLVRKPLPN----QQCIVTAHGRKERRQPSALIIQNCSFKPHADLV  467

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   SFLGRPW++++RT+I+ S I   I PEGW P+ G WGL  C+Y E+ N G G+
Sbjct  468  PVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGWLPWAGDWGLRTCFYTEYNNYGPGS  527

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D SKR KW G+K  IT   A +F PG+F+ GD WI  +GVPY
Sbjct  528  DKSKRVKWRGIKN-ITPQHAVDFTPGRFLKGDRWIKPTGVPY  568



>emb|CAN75818.1| hypothetical protein VITISV_005130 [Vitis vinifera]
Length=485

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQ+C + +RKPM    + QS M+TAQGR  P+EPTGI++  S + ++P + 
Sbjct  324  FIFGNAAVVFQNCDIYVRKPM----NRQSNMITAQGRDIPEEPTGISVQXSRVLSSPXFT  379

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            T      SFLGRPW++++RTV + + +D  I P GW+ + G +GL   +YGE+ N+G GA
Sbjct  380  TVKGSFKSFLGRPWKRYSRTVFLETDLDGLIDPRGWTEWSGNYGLSTLYYGEYNNSGGGA  439

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
               +R KW G   +     A  F   +FI G+ WIPASGVP+S
Sbjct  440  STKERVKWPGFHVLNGXEDAMPFTVSRFIQGEKWIPASGVPFS  482



>ref|XP_010440226.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 108/164 (66%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AVFQ+C  +IR+PM N    Q C+VTAQGR    E TGI I NS I     YL
Sbjct  532  FIFGDAKAVFQNCVFVIRRPMDN----QQCIVTAQGRKDRRETTGIVIHNSRIIGDASYL  587

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   +FLGRPW++++RT+I+N++ID  I PEGW  +  T+ L   +Y E+ N G+G+
Sbjct  588  PVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGWLKWNETFALNTLYYTEYRNRGRGS  647

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              ++R KW G++  I+   A EFAPG F+ G+TWIP + +PY+A
Sbjct  648  GQARRVKWRGIRR-ISPRDAREFAPGNFLRGNTWIPQTRIPYNA  690



>ref|XP_010434900.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   162 bits (410),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A AVFQ+C  +IR+PM N    Q C+VTAQGR    E TGI I NS I     YL
Sbjct  532  FVFGDAKAVFQNCVFVIRRPMDN----QQCIVTAQGRKDRRETTGIVIHNSRIIGDASYL  587

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   +FLGRPW++++RT+I+N++ID  I PEGW  +  T+ L   +Y E+ N G+G+
Sbjct  588  PVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGWLKWNETFALNTLYYTEYRNRGRGS  647

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              ++R KW G++ +  +A A EFAPG F+ G+TWIP + +PY+A
Sbjct  648  GQARRVKWRGIRRISPRA-AREFAPGNFLRGNTWIPQTRIPYNA  690



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 106/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FGNAA V Q+C ++ RKP  N    Q  M TAQGR  P++ TGI+I N  +SAT + +
Sbjct  422  FVFGNAAVVLQNCNIMARKPSAN----QKIMYTAQGREDPNQNTGISIQNCRLSATSDLV  477

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             A S    +LGRPW+Q++RTVI+ S +D  I P GW  + G + L   +YGE+ N G GA
Sbjct  478  AAKSSFQVYLGRPWKQYSRTVILQSHLDDLIHPAGWHEWDGNFALSTLYYGEYMNRGPGA  537

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R KW G + + + ++A++F   +F+ GD+W+PA+GV Y+A
Sbjct  538  ATANRVKWGGHRVITSSSEANQFTVNQFLQGDSWLPATGVQYTA  581



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CK+I+RKP+ N    Q+CMVTA GR     P+ + + N  IS    Y 
Sbjct  413  FIFGDAAAVFQNCKMIVRKPLEN----QACMVTAHGRLDMRSPSALILQNCTISGERGYN  468

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW+ +AR +++ S+ID  IAPEGW  + GT     CW+ EFGN G GA
Sbjct  469  KELNK--AYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFSEFGNRGVGA  526

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            ++SKR  W+G+K  +T   A +F  GKF+ GD WI  SGVPY A
Sbjct  527  ELSKRVTWSGMKK-LTPEHAADFTAGKFMFGDRWILPSGVPYVA  569



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQSC L++RKP+ N    Q+C +TA GR  P E TG  +    I   P+YL
Sbjct  402  FLFGDAAAVFQSCTLLVRKPLPN----QACPITAHGRKDPRESTGFVLQGCTIVGEPDYL  457

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            T      S+LGRPW++++RT+ +N+ I   I PEGW P+ G +GLE  +Y E GNTG GA
Sbjct  458  TVKETSKSYLGRPWKEYSRTIFMNTFIPDFIPPEGWQPWLGNFGLETLFYSEVGNTGPGA  517

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            DV+KR  W G+K  +++ +  +  P ++I GD WIP  GVPY
Sbjct  518  DVTKRVTWPGIKK-LSEEEILKITPAEYIQGDAWIPGKGVPY  558



>gb|AAQ21125.1| pectinesterase [Fragaria x ananassa]
Length=193

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 104/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+A+ Q+C + +RKP     S Q   VTAQ R  P+E TGI I N  I+A P+  
Sbjct  32   FIFGDASAILQNCNIYVRKP----SSNQINTVTAQSRRDPNENTGIIIHNCRITAAPDLR  87

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++R VI+ S +D  IAP+GW P+ G++GL+  +YGE+ NTG GA
Sbjct  88   AVQGSFRTYLGRPWQKYSRVVIMKSNLDGLIAPQGWFPWSGSFGLDTLYYGEYMNTGAGA  147

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
                R KW G + + +  +A +F  G F+ GD W+P +GVP+ A
Sbjct  148  ATGGRVKWPGFRVITSATEAGKFTVGNFLAGDAWLPGTGVPFEA  191



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAA+FQ C  ++RKP+ N    Q C+VTA GR +  +P+ + I N  I A  +  
Sbjct  412  FIFGDAAAIFQGCTFLVRKPLPN----QQCIVTAHGRKERRQPSALIIQNCSIKADKDLA  467

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   SFLGRPW++++RT+I+ S I   I PEGW P+ G WGL+ C+Y E+ N G G+
Sbjct  468  PVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGWLPWAGDWGLKTCFYTEYNNYGPGS  527

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR KW G+K  IT   A +F  G+F++GD WI  +GVPY
Sbjct  528  NKSKRVKWRGIK-TITPQHALDFTAGRFVMGDRWIKPTGVPY  568



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+  A+FQ+CK+++RKP    G  Q+CMVTAQGR+  +E TGI + N  I+  P+Y+
Sbjct  406  FIFGDGVALFQNCKMVVRKP----GEAQACMVTAQGRTDRNEITGIFLQNCTITGEPDYM  461

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++ AR V++ S ID  IAPEGW+ + G    ++C++GE+GN G   
Sbjct  462  AVKDKNKAYLGRPWKKFARVVVMQSSIDEAIAPEGWTEWTGEKYHQNCFFGEYGNRGPRK  521

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D+++R KW+ VK  +T  QA  F P +   GD W+  SGVPY
Sbjct  522  DMTQRVKWSTVKR-LTPDQAAAFTPARVFEGDKWVKPSGVPY  562



>ref|XP_010449868.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 43 [Camelina sativa]
Length=691

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A AVFQ+C  +IR+PM N    Q C+VTAQGR    E TGI I NS I     YL
Sbjct  532  FVFGDAKAVFQNCVFVIRRPMDN----QQCIVTAQGRKDRRETTGIVIHNSRIIGDASYL  587

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   +FLGRPW++++RT+I+N++ID  I PEGW  +  T+ L   +Y E+ N G+G+
Sbjct  588  PVKAKNRAFLGRPWKEYSRTIIMNTEIDDVIDPEGWLKWNETFALNTLYYTEYRNRGRGS  647

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              ++R KW G++ +  +A A EF+PG F+ G+TWIP + +PY+A
Sbjct  648  GQARRVKWRGIRRISPRA-AREFSPGNFLRGNTWIPQTRIPYNA  690



>ref|XP_008800483.1| PREDICTED: pectinesterase 3-like isoform X2 [Phoenix dactylifera]
Length=262

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q C + +R+P  N    Q  MVTA GR  P+EPTGIAI  S I+A P+  
Sbjct  99   FIFGNAATVLQDCDIQVRRPNAN----QKNMVTADGRDDPNEPTGIAIHRSRITAAPDLE  154

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   S+LGRPW++++R VI+ S+I   I P GW  + G +GL+  +YGE+ NTG GA
Sbjct  155  PVKSSFRSYLGRPWKEYSRAVIMESEISDVIDPAGWHEWNGPFGLDTLYYGEYKNTGAGA  214

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              + R KW G + +    +A +FAPG  + G  W+ ++G PYS
Sbjct  215  GTADRVKWKGYRVLTDVQEAKQFAPGNLLGGSNWLDSTGFPYS  257



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+  A+FQ+CK+++RKP    G  QSCMVTAQGR+  +E T I + N  I+  PEY+
Sbjct  400  FIFGDGVALFQNCKMLVRKP----GDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYM  455

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+  AR V++ S+ID  I PEGW  + G+     C+ GE+GN G  A
Sbjct  456  AVKDKNKAYLGRPWKDFARVVVMQSQIDEAIQPEGWIEWAGSMFHNTCFLGEYGNKGPRA  515

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D+++R KW  +K  +T  QA  F P K   GD WI  SGVPY
Sbjct  516  DMAQRVKWPSLKK-LTADQAATFTPAKLFEGDRWIKPSGVPY  556



>gb|KEH15723.1| pectinesterase [Medicago truncatula]
Length=228

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA  V Q+C + +RKPM    S Q   VTAQGR+ P+E TGI I N  I+A+ +  
Sbjct  67   FIFGNAVTVLQNCNIFVRKPM----SNQQNTVTAQGRTDPNENTGIVIHNCRITASSDLK  122

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + + ++LGRPW++++RTV++ S +D  I  EGW+P+ G + L   +YGE+ N G GA
Sbjct  123  AIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGA  182

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            +   R KW G   +   + A +F+ G F+ GD+WI  SGVP+ A
Sbjct  183  NTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDA  226



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 107/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA VFQ+C + +RKPM    SGQ   VTAQGR+ P+E TGI+I +S ++A  +  
Sbjct  354  FIFGDAAVVFQNCDMYVRKPM----SGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLK  409

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +D+ I P GW  + G + L   +YGE+ NTG GA
Sbjct  410  PVQGSFQTYLGRPWQKYSRTVYMKTSLDSLIDPAGWLEWNGDFALSTLYYGEYMNTGAGA  469

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D S+R  W G   + + A A +F  G F+ G +WIPA+GVPY++
Sbjct  470  DTSRRVNWPGYHVITSAAVASQFTVGNFLSGGSWIPATGVPYTS  513



>ref|XP_009764218.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nicotiana sylvestris]
Length=491

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 102/162 (63%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +++PM      QS M+TAQGR   +E TGIAILNS +S + E+ 
Sbjct  330  FIFGDAAAVFQNCDIFVKRPM----GHQSNMITAQGRDDSNENTGIAILNSRVSPSSEFS  385

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV I + +D  I P+GW  + G + L   +YGE+ NTG GA
Sbjct  386  AVKGSFQNYLGRPWKKYSRTVFIKTDLDGLIHPQGWKEWSGNFALSTLYYGEYMNTGSGA  445

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D   R  W G   +    +A  F    FI G++WIPASGVPY
Sbjct  446  DTGNRVNWPGFHVLRDANEASPFTVRNFIQGESWIPASGVPY  487



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 108/164 (66%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A AVFQ+C+ ++R+PM N    Q C+VTAQGR    E TGI I  S I   P YL
Sbjct  426  FVFGDAKAVFQNCQFVVRRPMEN----QQCIVTAQGRKDRRETTGIVIHKSRIMGDPTYL  481

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW++++RTVI+NS ID  I PEGW  +  T+ L+  +Y E+ NTG G+
Sbjct  482  PVKTKNRAYLGRPWKEYSRTVIMNSLIDDIIDPEGWMKWNETFALDTLYYAEYQNTGPGS  541

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D + R +W G++  ++ + A ++ P  F+ G+TWIP + VPY+A
Sbjct  542  DQAGRVRWNGIQH-LSDSAATQYTPDNFLRGNTWIPKTRVPYAA  584



>ref|XP_008361835.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=233

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKP     SGQ  M+TAQGR+ P++ TGI I  S I AT +  
Sbjct  72   FIFGNAAVVLQNCDIHARKP----NSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQ  127

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             +     +FLGRPW++++RTVI+ S I   I P GW  + GT+ L   +YGE+ NTG GA
Sbjct  128  ASKGSFKTFLGRPWKEYSRTVIMQSSITDIIDPVGWHEWSGTFALNTLFYGEYANTGAGA  187

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              SKR  W G K + +  +A  + PG+FI G +W+ ++G P++
Sbjct  188  GTSKRVTWKGFKVITSTTEAQAYTPGRFIAGGSWLSSTGFPFA  230



>ref|XP_002876579.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52838.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 105/164 (64%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AVFQ+C + +R+PM + G+    M+TAQGR  P   +GI+I +S I A PE+ 
Sbjct  359  FIFGDATAVFQNCDIFVRRPMDHQGN----MITAQGRDDPHSNSGISIQHSRIRAAPEFE  414

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RTV++ + ID  I P GW  + G++ L   +YGEF NTG GA
Sbjct  415  AVKGRFKSYLGRPWKKYSRTVLLKTDIDELIDPRGWREWSGSYALSTLYYGEFMNTGAGA  474

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              S+R  W G   +  + +A  F   +FI GD+WIP +GVP+SA
Sbjct  475  GTSRRVNWPGFHVLRGQEEASPFTVSRFIQGDSWIPITGVPFSA  518



>emb|CDX70179.1| BnaA10g25280D [Brassica napus]
Length=598

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  RKPM+N    Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  434  FIFGNAAAVFQNCNIYARKPMVN----QKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  489

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+P ++FLGRPW+ ++RTV I S I   I P GW  + GT GL+   YGE+ N G GA
Sbjct  490  ADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPVGWLEWNGTTGLDTISYGEYDNFGPGA  549

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W G   ++  AQA  F    F LGDTW+P + +P+
Sbjct  550  NTSKRVQWVGY-SLLNLAQAMNFTVYNFTLGDTWLPQTDIPF  590



>ref|XP_009628695.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nicotiana tomentosiformis]
Length=490

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 103/162 (64%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +++PM      QS M+TAQGR   +E TGI ILNS ++ + E+ 
Sbjct  331  FIFGDAAAVFQNCDIFVKRPM----DHQSNMITAQGRDDSNENTGIVILNSRVAPSSEFS  386

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                  +++LGRPW++++RTV I + +D  I P+GW  + G + L   +YGE+ NTG GA
Sbjct  387  AVKGSFMNYLGRPWKKYSRTVFIKTDLDGLIHPKGWKEWSGNFALSTLYYGEYMNTGSGA  446

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D+  R  W G   +    +A  F    FI G++WIPASGVPY
Sbjct  447  DIGNRVNWPGFHVLRDANEASPFTVRNFIQGESWIPASGVPY  488



>ref|XP_006369079.1| pectinesterase family protein, partial [Populus trichocarpa]
 gb|ERP65648.1| pectinesterase family protein, partial [Populus trichocarpa]
Length=229

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ C +  R+P     SGQ  MVTAQGR+ P++ TGI I  S I AT + L
Sbjct  68   FIFGNAAAVFQDCDIHARRP----DSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLL  123

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTVI+ S I   I P GW  + GT+ L   +Y E+ N+G GA
Sbjct  124  PVQSSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWHEWSGTFALSTLFYAEYQNSGSGA  183

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R  W G K + +  +A  FAPG FI G +W+ ++  P+S
Sbjct  184  GTSSRVTWEGYKVITSATEAQAFAPGNFIAGSSWLGSTSFPFS  226



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 107/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  R+PM N    Q+ +VTAQGR+ P++ TGI+I NS I A+ + +
Sbjct  366  FIFGNAAVVLQNCMIFARRPMDN----QNNVVTAQGRTDPNQNTGISIHNSRIMASSDLV  421

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   +FLGRPW+Q++RTV + S ID  + P GW  + G + L+  +YGE+ N G G+
Sbjct  422  PVLSSFKTFLGRPWKQYSRTVYLTSYIDTLVDPAGWMEWSGNFALDTLYYGEYKNYGPGS  481

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R  W G + +   ++A +F  GKFI GD+W+PA+GVP+ +
Sbjct  482  STANRVNWGGYRVITKSSEASQFTVGKFISGDSWLPATGVPFKS  525



>ref|XP_010040919.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Eucalyptus grandis]
Length=230

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 107/165 (65%), Gaps = 4/165 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+A V Q C +  RKP+    SGQ   VTAQGR+ P + TGI+I +  I A  + +
Sbjct  67   FIFGNSAVVLQKCNIYARKPL----SGQHNFVTAQGRTSPYQNTGISIHDCKIGAASDSV  122

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   +FLGRPW+Q++RTV++ S +D  I P GWSP+ G + L+  +YGE+ N+G GA
Sbjct  123  PLESKPTTFLGRPWKQYSRTVVMQSLLDGSIHPLGWSPWSGDFALKTLFYGEYRNSGPGA  182

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK  173
             +++R +WA   G +T AQA  F   +FI G+ W+P++GV + ++
Sbjct  183  PITRRVQWASYHGSLTPAQAQPFTVAQFISGNLWLPSTGVSFDSR  227



>emb|CDX80933.1| BnaC03g01870D [Brassica napus]
Length=352

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  RKPM      Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  188  FIFGNAAAVFQNCNIYARKPM----EHQKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  243

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+P ++FLGRPW+ ++RTV I S I   I P GW  + GT GL+   YGE+ N G GA
Sbjct  244  ADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPVGWLEWNGTTGLDTISYGEYDNFGPGA  303

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W+G   ++  AQA  F    F LGDTW+P + +P+
Sbjct  304  NTSKRVQWSGYS-LLNLAQAMNFTVYNFTLGDTWLPQTDIPF  344



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 108/163 (66%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A  VFQ+C + +RKPM    +GQ   VTAQGR+     TGI+I +SV++A P+  
Sbjct  354  FIFGDATVVFQNCNIYVRKPM----TGQKNTVTAQGRTDERTDTGISIHDSVVTAAPDLK  409

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTV + + +D+ I P GW  + G + L+  +YGE+ NTG GA
Sbjct  410  PVQSSFQTYLGRPWKKYSRTVYMKTFLDSLIDPAGWLEWDGDFALKTLYYGEYMNTGAGA  469

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D S+R  W G   + + A+A +F  G F+ G++WIPA+GVPY+
Sbjct  470  DTSQRVTWPGYHVITSAAEASQFTVGNFLSGNSWIPATGVPYT  512



>ref|XP_009122545.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 47 
[Brassica rapa]
Length=640

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  RKPM+N    Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  476  FIFGNAAAVFQNCNIYARKPMVN----QKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  531

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+P ++FLGRPW+ ++RTV I S I   I P GW  + GT GL+   YGE+ N G GA
Sbjct  532  ADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPVGWLEWNGTTGLDTISYGEYDNFGPGA  591

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W G   ++  AQA  F    F LGDTW+P + +P+
Sbjct  592  NTSKRVQWVGY-SLLNLAQAMNFTVYNFTLGDTWLPQTDIPF  632



>ref|XP_009142158.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Brassica rapa]
 emb|CDY30378.1| BnaA04g24790D [Brassica napus]
Length=516

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 108/164 (66%), Gaps = 13/164 (8%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            +IFGN+AAVFQSC ++ RKP+    SGQ+  VTAQGRS P + TGI+I N  I+A     
Sbjct  362  YIFGNSAAVFQSCNIVARKPL----SGQTNFVTAQGRSNPGQNTGISIQNCKITAQS---  414

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV++ S +D  I P GWSP+ G +GL+  +YGEFGN+G G+
Sbjct  415  ------TTYLGRPWKEYSRTVVMQSFLDGSIHPSGWSPWSGGFGLKTLFYGEFGNSGPGS  468

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             VS R KWAG    +T  +A+ F    FI G  W+P++GV + +
Sbjct  469  SVSGRVKWAGYHSSLTVKEAEGFTVANFIGGTMWLPSTGVSFDS  512



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 6/164 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AVFQ+CKL++RKP    G  Q CMVTAQGR++   P         +S+ P Y 
Sbjct  419  FIFGDAQAVFQNCKLMVRKP----GPNQQCMVTAQGRTEEKGPGAFIFEGCTVSSEPGYK  474

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW+++++T+ + S ID  IAP+GW+ +QG + L+  +Y EF N G GA
Sbjct  475  AVKAKNPAYLGRPWKEYSKTIFMYSNIDDTIAPKGWTEWQGNFALDTLYYAEFENKGAGA  534

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGK-FILGDTWIPASGVPYS  179
            D S+R KW G+K  ++  +AD F P K F+ GD WIP SGVPY+
Sbjct  535  DKSQRVKWKGIK-TLSAQEADGFTPAKLFVSGDKWIPESGVPYA  577



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 107/164 (65%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR  P E TG       I+  P+YL
Sbjct  405  FLFGDAAAVFQNCTLLVRKPLPN----QACPITAHGRKDPRESTGFVFQGCTIAGEPDYL  460

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+I+N+ I   + P+GW P+QG +GL+  +Y E  NTG GA
Sbjct  461  AVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWQGDFGLKTLFYSEVQNTGPGA  520

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             V+ R  WAG+K  ++     +F P ++I GDTW+P  GVPY++
Sbjct  521  TVANRVTWAGIK-TLSDEDILKFTPAQYIQGDTWVPGKGVPYTS  563



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+  A+FQ+C++++RKP    G  QSCMVTAQGR+  +E T I + N  I+  P+Y+
Sbjct  406  FIFGDGVAMFQNCRMVVRKP----GDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYM  461

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+  AR V+I S+ID  IAPEGW+ + G      C+  E GN G GA
Sbjct  462  AVKDKNKAYLGRPWKGFARVVVIQSQIDDAIAPEGWTEWTGEKFHTSCFVAESGNRGAGA  521

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D+SKR KW  +K  +T  QA  F P +   GD W+  SGVPY
Sbjct  522  DMSKRVKWQTLKK-LTPEQAAAFTPARLFEGDKWVKPSGVPY  562



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 109/162 (67%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++  +FQ+C  I+RKPM N    Q+CMVTAQGR  P     I I NS I+A P +L
Sbjct  380  FIFGDSLCLFQNCVFIVRKPMDN----QACMVTAQGRVDPRSVGAIVIQNSHITAEPAFL  435

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +    I ++LGRPW++ +RT+I+ S+ID  I+P+GWSP+ G + L+  +YGE+ N G G+
Sbjct  436  STKPAIDAYLGRPWKELSRTIIMQSEIDGFISPKGWSPWMGNFALDTLYYGEYQNRGAGS  495

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D++ R  W G++  +T+ +A+E+  G    GD WI +SGVPY
Sbjct  496  DLANRVTWKGIQH-MTQQKAEEWTGGAAFRGDEWITSSGVPY  536



>ref|XP_006292970.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
 gb|EOA25868.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
Length=527

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 105/164 (64%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +R+PM + G+    M+TAQGR  P   TGI+I +S + A PE+ 
Sbjct  366  FIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQGRDDPHANTGISIQHSRVRAAPEFE  421

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +D  I P GW  + G + L   +YGEF NTG GA
Sbjct  422  AVKGQFKNYLGRPWKKYSRTVFLKTDLDGLIDPRGWREWSGGYALSTLYYGEFMNTGTGA  481

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              S+R  W G   +  + +A  F+  +FI GD+WIP +GVP+SA
Sbjct  482  GTSRRVNWPGFHVLRDEGEASPFSVSRFIQGDSWIPITGVPFSA  525



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 108/164 (66%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+A V Q+C +  RKPM     GQ C+VTAQGR+ P++ TGI+I NS + AT +  
Sbjct  270  FIFGNSAVVLQNCMIYARKPM----QGQQCVVTAQGRTDPNQNTGISIHNSRVMATDDLK  325

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 + ++LGRPW++++RTV + S +D+ + P GW  + G + L   +YGEF N+G G+
Sbjct  326  PVIKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGLGS  385

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R KW G + + + ++A +F  G FI G++W+P +GVP++A
Sbjct  386  STANRVKWKGYRVITSASEAAKFTVGSFISGNSWLPGTGVPFTA  429



>gb|KFK37147.1| hypothetical protein AALP_AA4G219300 [Arabis alpina]
Length=489

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 106/164 (65%), Gaps = 13/164 (8%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQSC ++ RKP+     GQ   VTAQGR  P + TGI+I+N  I+A     
Sbjct  335  FIFGNAAVVFQSCNMVARKPL----PGQKNFVTAQGRVDPGQNTGISIINCRITA-----  385

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                  +++LGRPW+ ++RTV++ S +   I P GWSP+ G +GL   +YGEF NTG G+
Sbjct  386  ----ETLTYLGRPWKAYSRTVVMQSYLGGEIHPSGWSPWSGGFGLNTLFYGEFMNTGPGS  441

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             VS R KW+G    +T  +A++F   KFI GDTW+P++G+ + +
Sbjct  442  SVSGRVKWSGYHSALTVTEAEKFTVAKFIDGDTWLPSTGISFDS  485



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 109/163 (67%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA++FQ+C LI+RKP    G GQ+CMVTAQGR+     + I + N  IS  P+Y+
Sbjct  381  FIFGDAASIFQNCMLIVRKP----GPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYI  436

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +      ++LGRPW+Q AR++I+ S+ID  I PEG++P  GT G++  +  EFGN G GA
Sbjct  437  SVKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGA  496

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D ++R  W G+K  I   +A+++ P  ++  +TWI +S VPYS
Sbjct  497  DTNRRVAWKGIKK-IDINEANKWTPRVYLESETWISSSDVPYS  538



>gb|AAP04164.1| putative pectinesterase [Arabidopsis thaliana]
 dbj|BAF00482.1| pectinesterase like protein [Arabidopsis thaliana]
Length=519

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 104/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +R+PM + G+    M+TAQGR  P   +GI+I +S I A PE+ 
Sbjct  358  FIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQGRDDPHTNSGISIQHSRIRAAPEFE  413

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RTV + + ID  I P GW  + G++ L   +YGEF NTG GA
Sbjct  414  AVKGRFKSYLGRPWKKYSRTVFLKTDIDELIDPRGWREWSGSYALSTLYYGEFMNTGAGA  473

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
               +R  W G   +  + +A  F   +FI GD+WIP +GVP+SA
Sbjct  474  GTGRRVNWPGFHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSA  517



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 102/163 (63%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+CKL+IRKP+ + G    C++TAQ R    EPTG  + N  I A P Y 
Sbjct  426  FIFGNAAAVFQNCKLVIRKPLEDEG----CVITAQARQHVREPTGFILQNCTIMADPLYY  481

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   +FLG PW++ +RT+I+ S +   IAPEGW P+ GT+G   C++ E+ N G GA
Sbjct  482  PLRLKSKAFLGHPWKKFSRTIIMQSFLPDSIAPEGWKPWMGTFGQSSCFFSEYENRGPGA  541

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             +  R KW G+K  IT  QAD F P KF  G+ WI  +GVPY 
Sbjct  542  ALLGRVKWHGIKK-ITPQQADGFTPSKFYQGNHWIIPTGVPYE  583



>ref|NP_191632.2| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
 sp|Q84R10.2|PME36_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
36; Includes: RecName: Full=Pectinesterase inhibitor 36; AltName: 
Full=Pectin methylesterase inhibitor 36; Includes: RecName: 
Full=Pectinesterase 36; Short=PE 36; AltName: Full=Pectin 
methylesterase 36; Short=AtPME36; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE80101.1| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
Length=519

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 104/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +R+PM + G+    M+TAQGR  P   +GI+I +S I A PE+ 
Sbjct  358  FIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQGRDDPHTNSGISIQHSRIRAAPEFE  413

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RTV + + ID  I P GW  + G++ L   +YGEF NTG GA
Sbjct  414  AVKGRFKSYLGRPWKKYSRTVFLKTDIDELIDPRGWREWSGSYALSTLYYGEFMNTGAGA  473

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
               +R  W G   +  + +A  F   +FI GD+WIP +GVP+SA
Sbjct  474  GTGRRVNWPGFHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSA  517



>ref|XP_002511680.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50349.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=472

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A  VFQ+C + +R+PM      Q+  +TAQGR  P+E TGI+I  S + A+P+++
Sbjct  311  FIFGDAPVVFQNCDIFVRRPM----DHQANFITAQGRDDPNENTGISIQRSRVRASPDFM  366

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             A + I SFLGRPW++++RTV + + +D  I P GW  + G + L   +Y E+ NTG GA
Sbjct  367  VAKNKIRSFLGRPWKKYSRTVFMQTDLDGLIDPMGWGAWHGDFALSTLFYAEYMNTGNGA  426

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
              S+R KW G   + +  QA  F   +FI G++WIPA+GVP+
Sbjct  427  STSRRVKWPGFHVLSSPQQASPFTVTRFIQGESWIPATGVPF  468



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 109/163 (67%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA++FQ+C LI+RKP    G GQ+CMVTAQGR+     + I + N  IS  P+Y+
Sbjct  397  FIFGDAASIFQNCMLIVRKP----GPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYI  452

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +      ++LGRPW+Q AR++I+ S+ID  I PEG++P  GT G++  +  EFGN G GA
Sbjct  453  SVKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGA  512

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D ++R  W G+K  I   +A+++ P  ++  +TWI +S VPYS
Sbjct  513  DTNRRVAWKGIKK-IDINEANKWTPRVYLESETWISSSDVPYS  554



>ref|XP_010932734.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ C + +RKPM    +GQ+  VTAQGR+ PDE TGI I +SV++A P+  
Sbjct  353  FIFGDAAAVFQQCNIYVRKPM----TGQANTVTAQGRATPDENTGIIIHDSVVTAAPDLK  408

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGT-WGLEDCWYGEFGNTGKG  311
                   ++LGRPWR+++RTV + + +D+ I P GW  +  + + L   +YGE+ NTG G
Sbjct  409  PVQGSFQTYLGRPWREYSRTVFMKTSLDSVIDPAGWLQWNASGFYLSTLYYGEYMNTGAG  468

Query  310  ADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            A+   R KW G   + + ++A  F  G F+ GD+WIPA+GVPY
Sbjct  469  ANTGGRVKWPGYHVITSASEASNFTVGSFLGGDSWIPATGVPY  511



>emb|CDY11323.1| BnaA03g01590D [Brassica napus]
Length=593

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  RKPM      Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  429  FIFGNAAAVFQNCNIYARKPM----EHQKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  484

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+P ++FLGRPW+ ++RTV I S I   I P+GW  + GT GL+   YGE+ N G GA
Sbjct  485  ADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPDGWLEWNGTTGLDTISYGEYDNFGPGA  544

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W+G   ++  AQA  F    F LGDTW+P + +P+
Sbjct  545  NTSKRVQWSGY-SLLNLAQAMNFTVYNFTLGDTWLPQTDIPF  585



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 105/164 (64%), Gaps = 9/164 (5%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CK+I+RKP    G  QSCMVTAQGR    EPTGI + N  IS    + 
Sbjct  408  FIFGDAAAVFQNCKMIVRKP----GPNQSCMVTAQGRLDKREPTGIVLQNCTISGEKGFD  463

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             A +  +++LGRPW+ ++RT+++ S+ID  I P GW  + GT   E  W+GEF N G GA
Sbjct  464  AATT--MAYLGRPWKMYSRTIVMQSQIDNVINPLGWMEWTGTTNHETSWFGEFSNRGLGA  521

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              ++R KW  +    T  +A  FAPG  +LGD WI  SGVPY A
Sbjct  522  ATNQRVKWYKLA---TPEEAGAFAPGSILLGDKWIMPSGVPYVA  562



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+   V Q+C +++RKPM N    QSCM+TAQGR+   E TG+ + N  I   PEY+
Sbjct  410  FIFGDGKVVLQNCNIVVRKPMKN----QSCMITAQGRTDVRESTGLVLHNCHIMGEPEYI  465

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++ +RT+I+ + ID  I P GW P+ G + L   +Y EF NTG G+
Sbjct  466  PVKSINKAYLGRPWKEFSRTIIMRTNIDNVIDPAGWLPWDGDFALSTLYYAEFENTGPGS  525

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D S+R KW G+K +  K QA  F P +F+ G+ WIP + VPY
Sbjct  526  DQSQRVKWPGIKKLSPK-QALRFTPARFLRGNLWIPPNRVPY  566



>emb|CDY71928.1| BnaCnng75130D, partial [Brassica napus]
Length=371

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 108/162 (67%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++ A+FQ+C +++RKPM     GQ CMVTAQGR+   EPT I + N  I   P YL
Sbjct  210  FIFGDSIAIFQNCNIVVRKPM----GGQGCMVTAQGRTDVREPTAIVLHNCRIIGEPAYL  265

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW++ ART+++ + I   I P GWS + G + L+  +Y E+ N+G G+
Sbjct  266  PVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGWSAWSGDFALKTLFYAEYENSGPGS  325

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + ++R KW G++  IT+ QA  FAPG+F+ G +WIP +GVPY
Sbjct  326  NKAQRVKWPGIQR-ITRPQALGFAPGRFLSGGSWIPQTGVPY  366



>ref|XP_009130852.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 47 
[Brassica rapa]
Length=593

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  RKPM      Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  429  FIFGNAAAVFQNCNIYARKPM----EHQKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  484

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+P ++FLGRPW+ ++RTV I S I   I P+GW  + GT GL+   YGE+ N G GA
Sbjct  485  ADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPDGWLEWNGTTGLDTISYGEYDNFGPGA  544

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W+G   ++  AQA  F    F LGDTW+P + +P+
Sbjct  545  NTSKRVQWSGY-SLLNLAQAMNFTVYNFTLGDTWLPQTDIPF  585



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+   V Q C +++RKPM     GQSCM+TAQGR+   E TG+ + N  I+  PEY+
Sbjct  409  FIFGDGKVVLQKCNIVVRKPM----KGQSCMITAQGRTDERESTGLVLDNCHITGEPEYI  464

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW+Q +RT+I+ + ID  + P GW P+ G++ L   +Y E+ N G G+
Sbjct  465  PVKSINKAYLGRPWKQFSRTIIMRTTIDDVVDPAGWLPWNGSFALNTLYYAEYENNGPGS  524

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D S+R KW G+K +  K QA  F P +F+ G+ WIP + VPY
Sbjct  525  DQSQRVKWPGIKKLSPK-QALRFTPARFLRGNLWIPPTRVPY  565



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 105/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++ A FQ+CK I+RKPM N    Q+CMVTAQGR  P     I I N  I+A P +L
Sbjct  421  FIFGDSLAYFQNCKFIVRKPMEN----QACMVTAQGRVDPRSVGAIVIQNGDITAEPAFL  476

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                PI ++LGRPW++ +RT+I+ + I   IAPEGWSP+ G + L+ C+YGE+ N G G+
Sbjct  477  ATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGS  536

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             ++KR  W G+K  IT   A  +  G    GD WI +SGVPY+
Sbjct  537  GLAKRVTWKGIKK-ITPEIALSWTAGLAFKGDDWIKSSGVPYN  578



>emb|CDX98808.1| BnaC09g50270D [Brassica napus]
Length=578

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  RKPM+N    Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  414  FIFGNAAAVFQNCNIYARKPMVN----QKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  469

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+P ++FLGRPW+ ++RTV I S I   I P GW  + GT GL+   YGE+ N G GA
Sbjct  470  ADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPVGWLEWNGTTGLDTISYGEYDNFGPGA  529

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W G   ++  AQA  F    F LGDTW+P + +P+
Sbjct  530  NTSKRVQWPGY-SLLNLAQAMIFTVYNFTLGDTWLPQTDIPF  570



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 108/164 (66%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA V Q+C + +RKPM    SGQ   VTAQGR+ P+E TGI+I +S ++A  +  
Sbjct  355  FIFGDAAVVLQNCNMHVRKPM----SGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLK  410

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +D+ I P GW  + G + L   +YGE+ NTG GA
Sbjct  411  PVQGSFETYLGRPWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGPGA  470

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D S+R KW G   + + A+A +F  G F+ G++WIPA+ VP+++
Sbjct  471  DTSQRVKWPGYHVITSAAEASKFTVGNFLSGNSWIPATEVPFTS  514



>gb|AAQ21126.1| pectinesterase [Fragaria x ananassa]
Length=209

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 99/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKP     SGQ  M+TAQGR+ P++ TGI I  S I AT +  
Sbjct  48   FIFGNAAVVLQNCDIHARKP----NSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQ  103

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTVI+ S I   I P GW  + GT+ L+  +Y E+ NTG GA
Sbjct  104  AVKGSFKTYLGRPWKEYSRTVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGAGA  163

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R  W G K + +  +A  F PG FI G +W+ A+G P++
Sbjct  164  STSNRVTWKGYKVITSATEAQAFTPGNFIAGGSWLSATGFPFT  206



>ref|XP_011046483.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Populus euphratica]
Length=569

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 104/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C L  RKPM+N    Q    TAQGR+ P++ TGI+I N  I A P+  
Sbjct  408  FIFGNAAAVFQNCNLYARKPMLN----QKNAFTAQGRTDPNQNTGISIHNCTIEAAPDLA  463

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +  ++FLGRPW++++RTVI+ S I   I P GW  + GT GL+  +YGEF N G GA
Sbjct  464  MDRNSTLNFLGRPWKEYSRTVIMQSYIGELIQPVGWLEWNGTVGLDTIYYGEFQNYGPGA  523

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            + S+R +W G   ++   QA  F    F +GDTW+P + VP+S
Sbjct  524  NTSRRVQWPGF-NLMNTTQAVNFTVYNFTMGDTWLPYTDVPFS  565



>ref|XP_006361902.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25-like 
[Solanum tuberosum]
Length=564

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 102/163 (63%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+FQ+C L  RKPM      Q  + TAQGRS P++ TGI+I N  I A P+  
Sbjct  404  FIFGNAAAIFQNCNLFARKPM----PDQKNIFTAQGRSDPNQNTGISIQNCTIQAAPDLA  459

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+  +SFLGRPW  ++RTVI+ S I   I P GW  + GT+GL+  +YGEF N G GA
Sbjct  460  QDPNLTLSFLGRPWHNYSRTVIMQSYIGDVITPVGWLEWNGTYGLDTLYYGEFENYGPGA  519

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            + + R +W G   ++   QA  F    F +GDTW+P + VP+S
Sbjct  520  NTTMRVQWPGY-SLMNALQAMNFTVYNFTMGDTWLPYTNVPFS  561



>ref|XP_006361900.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25-like 
[Solanum tuberosum]
Length=566

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 103/163 (63%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+FQ+C L  RKPM +    Q  + TAQGRS P++ TGI+I N  I A P+  
Sbjct  406  FIFGNAAAIFQNCNLFARKPMPD----QKNIFTAQGRSDPNQNTGISIQNCTIQAAPDLA  461

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+  +SFLGRPW  ++RTVI+ S I   I P GW  + GT+GL+  +YGEF N G GA
Sbjct  462  QDPNLTLSFLGRPWHNYSRTVIMQSYIGDVITPVGWLEWNGTYGLDTLYYGEFENYGPGA  521

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            + + R +W G   ++   QA  F    F +GDTW+P + VP+S
Sbjct  522  NTTMRVQWPGY-SLMNALQAMNFTVYNFTMGDTWLPYTNVPFS  563



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 107/164 (65%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++  + Q+CK+++RKPM    +GQSCMVTAQGRS   EPTGI + N  I   P Y+
Sbjct  399  FIFGDSQCILQNCKIVVRKPM----AGQSCMVTAQGRSDVREPTGIVVHNCHIVGDPAYI  454

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW++ +RT++I + +D  I P GW P+ G + L+  +Y E  N G GA
Sbjct  455  PVRTASKAYLGRPWKEFSRTIVIKTTVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGA  514

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            + ++R KW G+K  +T  QA  +   +F+ G+TWIP + VPY+A
Sbjct  515  NQAQRVKWPGIKK-LTHEQALSYTCDRFLSGNTWIPRTQVPYTA  557



>gb|KEH21378.1| pectinesterase [Medicago truncatula]
Length=372

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA  V Q+C + +RKPM N    Q   VTAQGR+ P+E TGI I N  I+A+ +  
Sbjct  211  FIFGNAVTVLQNCNIFVRKPMSN----QQNTVTAQGRTDPNENTGIVIHNCRITASSDLK  266

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + + ++LGRPW++++RTV++ S +D  I  EGW+P+ G + L   +YGE+ N G GA
Sbjct  267  AIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGA  326

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            +   R KW G   +   + A +F+ G F+ GD+WI  SGVP+ A
Sbjct  327  NTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDA  370



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 100/162 (62%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+  A+FQ+C++++RKP    G  QSCMVTAQGR+  +E T I + N  I+  P+Y+
Sbjct  407  FIFGDGVAMFQNCRMVVRKP----GDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYM  462

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+  AR V+I S+ID  IAPEGW+ + G      C+  E GN G GA
Sbjct  463  AVKDKNKAYLGRPWKGFARVVVIQSQIDNAIAPEGWTEWTGEKFHTSCFVAESGNRGAGA  522

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D+SKR KW  +   +T  QA  F P +   GD W+  SGVPY
Sbjct  523  DMSKRVKWQTLMK-LTPEQAAAFTPARLFEGDKWVKPSGVPY  563



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 108/164 (66%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+A V Q+C +  RKPM     GQ C+VTAQGR+ P++ TGI+I NS + AT +  
Sbjct  359  FIFGNSAVVLQNCMIYARKPM----QGQQCVVTAQGRTDPNQNTGISIHNSRVMATDDLK  414

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 + ++LGRPW++++RTV + S +D+ + P GW  + G + L   +YGEF N+G G+
Sbjct  415  PVIKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGPGS  474

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R KW G + + + ++A +F  G FI G++W+P +GVP++A
Sbjct  475  STANRVKWKGYRVITSASEAAKFTVGSFIAGNSWLPGTGVPFTA  518



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKP     SGQ  MVTAQGR+ P++ TGI I  S I AT +  
Sbjct  426  FIFGNAAVVLQNCDIHARKP----NSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQ  481

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   +FLGRPW++++RTVI+ S I   I P GW  + GT+ L+  +YGE+ NTG GA
Sbjct  482  AVKGSFKTFLGRPWKEYSRTVIMQSAISDIIDPAGWHEWSGTFALDTLFYGEYANTGAGA  541

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             +S R  W G K + +  +A  F PG FI G +W+ ++G P+S
Sbjct  542  GISNRVTWKGFKVITSATEAQTFTPGSFIAGGSWLSSTGFPFS  584



>ref|XP_006853048.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
 gb|ERN14515.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
Length=532

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQ+C L  R PM    + Q+ + TAQGR+ P++ TG +ILN  ++A+ ++ 
Sbjct  369  FIFGNAAVVFQNCNLYARMPM----ASQNNVFTAQGRTDPNQNTGTSILNCSVTASSDFA  424

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S + S+LGRPW++++RTV + S ID+ I   GW P+ G + L   +YGEF N+G GA
Sbjct  425  WNSSSVNSYLGRPWKEYSRTVYMKSFIDSLIDSSGWLPWSGDFALNTLYYGEFNNSGPGA  484

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D SKR  W G   ++    A  F    FI+GD W+PA+ V + A
Sbjct  485  DTSKRVSWPGYHAIMNVTDAGNFTVSNFIMGDVWLPATSVEFHA  528



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 100/164 (61%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA  VFQ+C + +RKPM    SGQ   VTAQ R+ P+E TGI I NS ++A  +  
Sbjct  382  FIFGNAVVVFQNCNIYVRKPM----SGQKNTVTAQARTDPNENTGIIIHNSRVTAASDLR  437

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RTVI+ S +D  I P GW P+ G + L   +Y E+ N+G GA
Sbjct  438  PVQGSFKSYLGRPWQEYSRTVILKSNLDGLIDPAGWLPWSGNFALSTLYYAEYMNSGSGA  497

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
                R KW G   +     A +F  G F+ GD+WIPA+GVP+ +
Sbjct  498  STGDRVKWPGYHVITKVTDAGKFTVGNFLAGDSWIPATGVPFDS  541



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 110/164 (67%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AV Q+C + +RKPM    SGQ   +TAQGR+ P+E TGI+I NS ++A  +  
Sbjct  371  FIFGDAVAVLQNCNIYVRKPM----SGQRNTLTAQGRTDPNENTGISIHNSRVTAASDLR  426

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +D+ I P+GW  + G++ L   +YGE+ NTG GA
Sbjct  427  PLQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPDGWLEWSGSFALSTLYYGEYMNTGVGA  486

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              S+R KW G   V++ + A +F  G F+ GDTWIPA+GVP+++
Sbjct  487  STSQRVKWPGFH-VMSASDAGKFTVGNFLGGDTWIPATGVPFTS  529



>ref|XP_010919483.1| PREDICTED: pectinesterase 2-like [Elaeis guineensis]
Length=522

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 105/164 (64%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  R+P      G++ ++TAQGR+ P++ TGI I +S IS   E L
Sbjct  361  FIFGNAAVVLQNCNIFARRPR----QGEANVITAQGRTDPNQNTGIVIHSSTISPAAELL  416

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 + S+LGRPW+Q++RTV + + ID+ I P GW PF G + L   +Y EFGNTG G+
Sbjct  417  AVRGTVSSYLGRPWQQYSRTVYLRNSIDSIIDPAGWLPFNGNFALNTLYYAEFGNTGPGS  476

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             +S R +W G   +   A   +F+ G+FI G  WIP++GVP++A
Sbjct  477  TLSGRVRWLGYHVISRPALVRQFSVGRFIAGRQWIPSTGVPFNA  520



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQSC +  R P       ++  +TAQGR+ P++ TGI+ILNS ++A  +  
Sbjct  99   FIFGNAAVVFQSCNIYARNP-----PNKTNTITAQGRTDPNQNTGISILNSRVTAASDLK  153

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S + ++LGRPW++++RTV + + +D  I P GW P+ G + L   +YGE+ NTG G+
Sbjct  154  PVQSSVKTYLGRPWKEYSRTVFMKTFLDGLINPAGWMPWSGNFALNTLYYGEYANTGPGS  213

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              +KR  W G   + +  +A +F  G FI G +W+PA+ VP+++
Sbjct  214  STAKRVNWKGYHVITSATEASKFTVGNFIAGSSWLPATNVPFTS  257



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A++VFQSCK+I+RKPM N    Q+CMVTAQGR        I + N  I A  E++
Sbjct  390  FIFGDASSVFQSCKMIVRKPMAN----QACMVTAQGRKDRRGVGAIVMQNCEIRAEHEFI  445

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +    I ++LGRPW++ +RT+I+ S ID  I P+GWS + G + L   +Y E+ N G GA
Sbjct  446  STQPTIKAYLGRPWKEFSRTIIMQSLIDGFIDPQGWSVWAGDFALHTLFYAEYENRGIGA  505

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            + + R  W G K  I K  A  FAPG FIL D W+  SGVPY +
Sbjct  506  NSNNRVNWRGYKKNIGKEIAAGFAPGVFILADEWVRLSGVPYES  549



>ref|XP_004231267.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Solanum lycopersicum]
Length=560

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 104/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+FQ+C L  RKPM +    Q  + TAQGRS P++ TGI+I N  I A P+  
Sbjct  400  FIFGNAAAIFQNCNLFARKPMPD----QKNIFTAQGRSDPNQNTGISIQNCTIQAAPDLA  455

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+  +SFLGRPW  ++RTVI+ S +   I P GW  + GT+GL+  +YGEF N G GA
Sbjct  456  QDPNLTLSFLGRPWHNYSRTVIMQSYLGDVITPVGWLEWNGTYGLDTLYYGEFENYGPGA  515

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            + + R +W G   ++  +QA  F    F +GDTW+P + VP+S
Sbjct  516  NTTMRVQWPGY-SLMNASQAMNFTVYNFTMGDTWLPYTNVPFS  557



>gb|AAR03544.1| pectin methylesterase isoform 1 [Fragaria x ananassa]
Length=224

 Score =   150 bits (379),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 99/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKP     SGQ  M+TAQGR+ P++ TGI I  S I AT +  
Sbjct  63   FIFGNAAVVLQNCDIHARKP----NSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQ  118

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTVI+ S I   I P GW  + GT+ L+  +Y E+ NTG GA
Sbjct  119  AVKGSFKTYLGRPWKEYSRTVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGAGA  178

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R  W G K + +  +A  F PG FI G +W+ A+G P++
Sbjct  179  STSNRVTWKGYKVITSATEAQAFTPGNFIAGGSWLSATGFPFT  221



>ref|XP_003630894.1| Pectinesterase [Medicago truncatula]
Length=326

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 104/165 (63%), Gaps = 4/165 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA  V Q+C + +RKPM    S Q   VTAQGR+ P+E TGI I N  I+A+ +  
Sbjct  148  FIFGNAVTVLQNCNIFVRKPM----SNQQNTVTAQGRTDPNENTGIVIHNCRITASSDLK  203

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + + ++LGRPW++++RTV++ S +D  I  EGW+P+ G + L   +YGE+ N G GA
Sbjct  204  AIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGA  263

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK  173
            +   R KW G   +   + A +F+ G F+ GD+WI  SGVP+ A+
Sbjct  264  NTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDAE  308



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 109/164 (66%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAV Q CK+  R+PM+     Q  +VTAQGR+ P++ TGI+I NS + A+P+ +
Sbjct  369  FIFGNAAAVLQDCKIYARRPMVK----QKNVVTAQGRTDPNQNTGISIHNSRVMASPDLV  424

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   SFLGRPW+ ++RTV + + ID+ I P GW  + G++ L+  +YGE+ N+G G+
Sbjct  425  PVLGSFRSFLGRPWKLYSRTVYMQTYIDSLIDPVGWLEWDGSFALDTLYYGEYRNSGPGS  484

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            + ++R  W+G + +   ++A  F    FI G +W+PA+GVP++A
Sbjct  485  NTTRRVNWSGYRVITNASEASTFTVANFIAGQSWLPATGVPFTA  528



>ref|XP_010684811.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 102/164 (62%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+ QSC + +RKPM N    Q   +TAQGRS P+E TGI I +S+I A  +  
Sbjct  376  FIFGNAAAILQSCNIYVRKPMNN----QMNTITAQGRSDPNENTGIVIHDSIIKAAQDLK  431

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   +FLGRPWR ++RT+I+ S ID  +   GW+P+ G + L+  +YGE+ N G GA
Sbjct  432  PVQGSFQTFLGRPWRMYSRTMIMKSHIDGLVDIAGWAPWSGDFALKTLYYGEYMNYGPGA  491

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D   R KW G   + +   A++F    F+ GD WIP +GVP+++
Sbjct  492  DTHGRVKWPGYHAIKSPVDAEKFTVRNFLTGDEWIPGTGVPFTS  535



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR  P E TG  +    I+  P+YL
Sbjct  341  FLFGDAAAVFQNCTLLVRKPLPN----QACPITAHGRKDPRESTGFVLQGCTIAGEPDYL  396

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            T      S+LGRPW++++RT+ +N+ I   I PEGW P+ G + L+  +Y E  NTG GA
Sbjct  397  TVKETSKSYLGRPWKEYSRTIFMNTFIPDFIPPEGWQPWLGNFALDTLFYSEVRNTGPGA  456

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
             V+KR  W G+K  +++ +  +F P ++I GD WIP  GVPY
Sbjct  457  GVTKRVTWPGIKK-LSEEEILKFTPAEYIQGDAWIPGKGVPY  497



>ref|XP_007045218.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY01050.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=520

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 103/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AV Q+C + IRKPM    S Q   VTAQGR+  +E TGI I NS ++A+ +  
Sbjct  360  FIFGDAVAVLQNCNIYIRKPM----SNQRNTVTAQGRTDANENTGIIIHNSRVTASSDLR  415

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   S+LGRPW++++RTV + S +D  I  EGW P+ G++ L   +Y E  NTG GA
Sbjct  416  GVQGSFKSYLGRPWQKYSRTVFMKSVLDGVITAEGWLPWSGSFALSTLYYAEHMNTGAGA  475

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D S R KW G   VI+ A+A +F  G F+ GD WIP +GVP+ A
Sbjct  476  DTSGRVKWGGYH-VISAAEAGKFTVGNFLAGDAWIPGTGVPFDA  518



>gb|KFK24938.1| hypothetical protein AALP_AA8G044700 [Arabis alpina]
Length=602

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ C +  RKPM N    Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  438  FIFGNAAAVFQKCNIYARKPMAN----QKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  493

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+P ++FLGRPW+ ++RTV I S I   + P GW  + GT GL+   YGE+ N G GA
Sbjct  494  ADPNPAMTFLGRPWKPYSRTVYIQSYISDVVQPVGWLEWNGTTGLDTISYGEYDNFGPGA  553

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W+G   ++  AQA  F    F LGDTW+P + +P+
Sbjct  554  NTSKRVQWSGY-SLLNLAQAMNFTVYNFTLGDTWLPQTDIPF  594



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+   V Q C +++RKPM     GQSCM+TAQGR+   E TG+ + N  I+  PEY+
Sbjct  409  FIFGDGKVVLQKCNIVVRKPM----KGQSCMITAQGRTNERESTGLVLDNCHITGEPEYI  464

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW+Q +RT+I+ + I+  + P GW P+ G++ L   +Y E+ N G G+
Sbjct  465  PVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEYENNGLGS  524

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D S+R KW G+K +  K QA  F P +F+ G+ WIP + VPY
Sbjct  525  DQSQRVKWPGIKKLSPK-QALRFTPARFLRGNLWIPPTRVPY  565



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 108/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA++FQ+C LI+RKP    G GQ+CMVTAQGR+     + I + N  IS  P+Y+
Sbjct  397  FIFGDAASIFQNCMLIVRKP----GPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYI  452

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+Q AR++I+ S+ID  I PEG++P  GT G++  +  EFGN G GA
Sbjct  453  PVKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGA  512

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D ++R  W G+K  I   +A+++ P  ++  +TWI +S VPYS
Sbjct  513  DTNRRVAWKGIKK-IDINEANKWTPRVYLESETWISSSDVPYS  554



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKP     SGQ  MVTAQGR+ P++ TGI I  S I AT +  
Sbjct  426  FIFGNAAVVLQNCDIHARKP----NSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQ  481

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   +FLGRPW++++RTVI+ S I   I P GW  + GT+ L+  +YGE+ NTG GA
Sbjct  482  AVKGSFKTFLGRPWKEYSRTVIMQSSISDIIDPAGWHEWSGTFALDTLFYGEYANTGAGA  541

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R  W G K + +  +A  F PG FI G +W+ ++G P+S
Sbjct  542  GTSNRVTWKGFKVITSATEAQTFTPGSFIAGGSWLSSTGFPFS  584



>emb|CBI27741.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAV Q C +  R+P     SGQ  MVTAQGR  P++ TGI I    I AT +  
Sbjct  205  FIFGNAAAVLQDCDIHARRP----NSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLK  260

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTV++ + I   I P GW P+ G + L+  +Y E+ NTG GA
Sbjct  261  PVQSSFPTYLGRPWKEYSRTVVMQTSISDVINPAGWYPWNGNFALDTLFYAEYQNTGAGA  320

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D SKR  W G K + + ++A  F  G FI G +W+P++G P+S
Sbjct  321  DTSKRVNWKGFKVITSASEAQAFTAGSFIGGSSWLPSTGFPFS  363



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 104/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++ A FQ+CK I+RKPM N    Q+CMVTAQGR  P     I I N  I+A P +L
Sbjct  404  FIFGDSLAYFQNCKFIVRKPMDN----QACMVTAQGRVDPRSVGAIVIQNGDITAEPAFL  459

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                PI ++LGRPW++ +RT+I+ + I   IAPEGWSP+ G + L+ C+YGE+ N G G+
Sbjct  460  ATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGS  519

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             ++KR  W G+K  IT   A  +  G    GD WI  +GVPY+
Sbjct  520  GLAKRVTWKGIKK-ITPEIALSWTAGLAFKGDDWIKTAGVPYN  561



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 104/163 (64%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FGN+A V QSC L  R+P+    + QS + TAQGR+ P++ TGI+I    ++A  +  
Sbjct  65   FVFGNSAVVLQSCNLYARRPL----ASQSNIYTAQGRTDPNQNTGISIQKCKVAAASDLA  120

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW+Q++RTV + S++D+ + P+GW  + GT+ L+  +YGE+ NTG GA
Sbjct  121  AVQTSFRTYLGRPWKQYSRTVYLQSELDSVVDPKGWLEWDGTFALDTLYYGEYQNTGAGA  180

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G + + + ++A  F  G FI GD W+  + +P+S
Sbjct  181  STSNRVKWKGYRVISSSSEASTFTVGSFIDGDVWLAGTSIPFS  223



>ref|XP_008796891.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=465

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 104/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQ+C +  R+P      G+S ++TAQGR+ P++ TGI I +S I    E L
Sbjct  304  FIFGNAAVVFQNCNIFARRPR----RGESNVITAQGRTDPNQNTGIVIHSSAIRPAAELL  359

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 + S+LGRPW+Q++RTV + S ID  I P GW PF+G + L   +Y EFGNTG G+
Sbjct  360  PVRRTVRSYLGRPWKQYSRTVYLRSYIDGIIDPAGWLPFRGNFALSTLYYAEFGNTGPGS  419

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             +S+R +W G   +   +   +F+ G+FI G  WI ++GVP+ A
Sbjct  420  RMSRRVRWPGYHVIKRPSLVRQFSVGRFIAGRKWIRSTGVPFIA  463



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q C + +R+P  N    Q  MVTA GR  P+EPTGIAI  S I+A P+  
Sbjct  422  FIFGNAATVLQDCDIQVRRPNAN----QKNMVTADGRDDPNEPTGIAIHRSRITAAPDLE  477

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   S+LGRPW++++R VI+ S+I   I P GW  + G +GL+  +YGE+ NTG GA
Sbjct  478  PVKSSFRSYLGRPWKEYSRAVIMESEISDVIDPAGWHEWNGPFGLDTLYYGEYKNTGAGA  537

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              + R KW G + +    +A +FAPG  + G  W+ ++G PYS
Sbjct  538  GTADRVKWKGYRVLTDVQEAKQFAPGNLLGGSNWLDSTGFPYS  580



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 103/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKP     SGQ  MVTAQGR+ P++ TGI I  S I AT +  
Sbjct  424  FIFGNAAVVLQNCDIHARKP----DSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQ  479

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             + S   +FLGRPW++++RTVI+ S I   I P GW  + GT+ L+  +YGE+ NTG GA
Sbjct  480  ASKSSFKTFLGRPWKEYSRTVIMQSSITDIIDPAGWHEWSGTFALDTLFYGEYANTGAGA  539

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              + R  W G K + +  +A+ + PG FI G +W+ ++G P+S
Sbjct  540  GTANRVTWKGFKVITSPTEAEAYTPGNFIAGGSWLSSTGFPFS  582



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 108/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA  FQ+C  ++RKP+ N    Q+C+VTAQGR +  +PTGI I NS   A P+Y 
Sbjct  435  FIFGDAAVFFQNCTFVVRKPLEN----QNCIVTAQGRMERHQPTGIIIHNSKFEADPDYY  490

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW+++++T+I+ S+I   I PEGW P++G +GL+  +YGE+ N G GA
Sbjct  491  PVRNKNKAYLGRPWKEYSKTIIMESEIGDLIQPEGWLPWEGNFGLDTSYYGEYNNFGDGA  550

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             ++ R KW GVK ++ + +A++F P      D WI  SG+PY 
Sbjct  551  RLTNRVKWRGVKTIV-RTRAEKFMPPILYENDDWIRDSGIPYD  592



>emb|CDY57858.1| BnaC08g47740D [Brassica napus]
Length=468

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 106/164 (65%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+A AVFQ+C+ +IR+PM N    Q C+VTAQGR    E TGI I NS I+    Y 
Sbjct  309  FVFGDAKAVFQNCEFVIRRPMDN----QQCIVTAQGRKDRRETTGIVIHNSRITGDATYR  364

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   +FLGRPW++++RT+I+N+ ID  I PEGW  +  T+ L+  +Y E+ N G+G+
Sbjct  365  PVKDKNRAFLGRPWKEYSRTIIMNTDIDDVIDPEGWLKWNETFALKTLFYSEYRNRGRGS  424

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              ++R +W G++  I+  QA  FAPG+F+ G+ WI    +PY+A
Sbjct  425  GQARRVRWRGIQR-ISARQARGFAPGEFLRGNAWITKRRIPYNA  467



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 108/164 (66%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKPM    SGQ   +TAQGR+ P++ TGI+I +S + A P++ 
Sbjct  358  FIFGNAAVVLQNCMIYARKPM----SGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFK  413

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            ++   + +FLGRPW++++RTV + S +D  + P GW  + G + L+  +YGE+ N G GA
Sbjct  414  SSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGA  473

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              S+R KW G + + + ++A +F    FI G +W+PA+ VP++A
Sbjct  474  PTSRRVKWGGYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTA  517



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP++N    Q+C +TA GR  P E TG  +    I   P+YL
Sbjct  401  FLFGDAAAVFQNCTLLVRKPLLN----QACPITAHGRKDPRESTGFVLQGCTIVGEPDYL  456

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+I+N+ I   I PEGW P+ G +GL   +Y E  NTG GA
Sbjct  457  AVKENSKAYLGRPWKEYSRTIIMNTFIPDFIPPEGWQPWLGDFGLNTLFYSEVQNTGPGA  516

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
             ++KR  W G+K  +++ +   F P ++I GD WIP  GVPY
Sbjct  517  PITKRVTWPGIKK-LSEEEILTFTPAQYIQGDAWIPGKGVPY  557



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 105/164 (64%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA V Q+C + +RKPM    SGQ   VTAQGR+ P+E TGI+I +S ++A  E  
Sbjct  354  FIFGDAAVVLQNCSMYVRKPM----SGQKNTVTAQGRTDPNENTGISIHDSAVTAASELK  409

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +D  I P GW  + G + L   +YGE+ NTG GA
Sbjct  410  PVQGSFKTYLGRPWKKYSRTVFMKTSLDCLIDPAGWLEWSGNFALSTLYYGEYMNTGAGA  469

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D S+R KW G   + +  +A +F    F+ G++WIPA+GV +++
Sbjct  470  DTSQRVKWPGYHVITSATEASKFTVANFLSGNSWIPATGVAFTS  513



>ref|XP_006838619.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
 gb|ERN01188.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
Length=520

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA AVFQ+C + +R+PM    S Q   +TAQGRS P++ TGI+I NS ISA P+  
Sbjct  359  FIFGNAIAVFQNCNIFVRRPM----SQQKNTITAQGRSDPNQNTGISIHNSRISAAPDLS  414

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++HART+ +   +D  I P GW  +   + L   +YGE+ NTG G+
Sbjct  415  PVQGSFATYLGRPWQKHARTIFLKCFLDDLINPAGWLEWSENFALSTLYYGEYRNTGPGS  474

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            +  KR KW G   + + ++A +F+ G F+ G +WIPA+GVP++
Sbjct  475  NTGKRVKWNGYHFITSPSEASKFSVGSFLDGGSWIPATGVPFT  517



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 110/164 (67%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  R P       ++  VTAQGRS P++ TGI+I N  ++A  +  
Sbjct  389  FIFGNAAVVLQNCNIFARDP-----PNKTNTVTAQGRSDPNQNTGISIHNCRVTAASDLK  443

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             + + + ++LGRPW+Q++RTV++ + +D+ I P+GW P+ GT+ L+  +YGE+ NTG G+
Sbjct  444  ASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALKTLYYGEYLNTGPGS  503

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R KW G + + + A+A +F P  FI G++W+PA+ VP+++
Sbjct  504  STANRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATNVPFTS  547



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 105/163 (64%), Gaps = 7/163 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSV-ISATPEY  491
            FIFG+A A+FQ C+L++R+PM +    Q+CMVTAQGR +     G+ +L    I A P +
Sbjct  422  FIFGDAVAIFQKCRLVVRQPMDD----QACMVTAQGR-KDQRSVGVTVLQGCDIVADPAF  476

Query  490  LTAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKG  311
            L    P+ ++LGRPW++++RT+++ S ID  IAPEGWSP+ G + L   +YGE+ N G G
Sbjct  477  LAVKPPLDAYLGRPWKEYSRTIVMQSNIDGFIAPEGWSPWMGNYALSTLYYGEYQNRGAG  536

Query  310  ADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + +S R  W G+K  IT A A  F PG     DTW+  SG+PY
Sbjct  537  SGLSGRVTWKGIKK-ITPAIAQSFTPGVVYKNDTWVSTSGIPY  578



>ref|XP_010469150.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=533

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 106/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +R+PM + G+    ++TAQGR  P   TGI+I +S + A PE+ 
Sbjct  372  FIFGDAAAVFQNCDIFVRRPMDHQGN----VITAQGRDDPHATTGISIQHSRVRAAPEFE  427

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +D  I P GW  + G++ L   +YGEF NTG GA
Sbjct  428  AVKGRFKNYLGRPWKKYSRTVFLKTDLDGLIDPRGWREWSGSFALLTLYYGEFMNTGAGA  487

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            + S+R  W G   +  + +A  F   +FI GD+WIP +GVP+SA
Sbjct  488  ETSRRVGWPGFHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSA  531



>ref|XP_004231159.2| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 36 [Solanum lycopersicum]
Length=502

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 101/162 (62%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+AVFQ+C + +++PM      QS M+TAQG    +E TGI ILNS +S++ E+ 
Sbjct  341  FIFGDASAVFQNCDIFVKRPM----DSQSNMITAQGXDDSNENTGIVILNSRVSSSSEFT  396

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV I + +D  I P+GW  + G + L   +Y E+ NTG GA
Sbjct  397  AVKDSFKNYLGRPWKKYSRTVFIKTDLDGLIDPKGWKEWSGDFALSTLYYAEYMNTGSGA  456

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            +   R  W G   +    +A +F    FI G++WIPASGVPY
Sbjct  457  NTGNRVNWPGFHVLHDANEASQFTVRNFIQGESWIPASGVPY  498



>sp|P83218.1|PME_DAUCA RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Daucus carota]
Length=319

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q C +  R+P    GSGQ  MVTAQGR+ P++ TGI I  S I AT +  
Sbjct  158  FIFGNAAVVLQDCDIHARRP----GSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQ  213

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTV++ S I   I P GW P+ G + L+  +YGE+ NTG GA
Sbjct  214  PVQSSFPTYLGRPWKEYSRTVVMQSSITNVINPAGWFPWDGNFALDTLYYGEYQNTGAGA  273

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R  W G K + +  +A  F PG FI G +W+ A+  P+S
Sbjct  274  ATSGRVTWKGFKVITSSTEAQGFTPGSFIAGGSWLKATTFPFS  316



>ref|XP_008344546.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 47 
[Malus domestica]
Length=241

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQSC L  RKPM N    Q    TAQGR+ P++ TGI+I N  I A P+  
Sbjct  75   FIFGNAAAVFQSCNLYARKPMPN----QKNAFTAQGRTDPNQNTGISIHNCTIEAAPDLA  130

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +  ++FLGRPW+  +RTVI+ S I + I+  GW  + GT GL+  +YGEF N G GA
Sbjct  131  ADLNSTLNFLGRPWKVFSRTVIMQSYIGSLISSVGWLEWNGTVGLDTLFYGEFQNHGPGA  190

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + +KR +W G   ++   QA  F    F LGDTW+P + +P+
Sbjct  191  NTTKRVQWPGYS-LMNATQALNFTVSNFTLGDTWLPDTDIPF  231



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 103/162 (64%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            +IFGN  ++FQ+CK++IRKPM+N    Q+ +VTAQGR    E + I +    ISA P  +
Sbjct  429  YIFGNGESIFQNCKMVIRKPMVN----QANIVTAQGRKTEREVSAIVLQGCTISADPSLV  484

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   S+LGRPW++ +RT+I+ + ID  I+P+GW P+ G +GL+ C+Y EF N G GA
Sbjct  485  PEKNVFKSYLGRPWKEFSRTIIMETDIDDSISPDGWMPWMGDFGLQTCYYAEFNNRGPGA  544

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
             ++ R KW G+K  +T  QA E+    +I  D W+   G+PY
Sbjct  545  VLTNRVKWPGIKTPLTPEQAQEYTAAPYIQADDWVKPLGIPY  586



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP++N    Q+C +TA GR  P E TG  +    I   P+YL
Sbjct  402  FLFGDAAAVFQNCTLLVRKPLLN----QACPITAHGRKDPRESTGFVLQGCTIVGEPDYL  457

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+I+N+ I   + PEGW P+ G +GL   +Y E  NTG GA
Sbjct  458  AVKEQSKTYLGRPWKEYSRTIIMNTFIPDFVPPEGWQPWLGEFGLNTLFYSEVQNTGPGA  517

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
             ++KR  W G+K  ++  +  +F P ++I GD WIP  GVPY
Sbjct  518  AITKRVTWPGIKK-LSDEEILKFTPAQYIQGDAWIPGKGVPY  558



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 110/164 (67%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  R P       ++  VTAQGR+ P++ TGI+I N  I+A  +  
Sbjct  365  FIFGNAAVVLQNCNIFARDP-----PNKTNTVTAQGRTDPNQNTGISIHNCRITAASDLK  419

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             + + + ++LGRPW+Q++RTV++ + +D+ I P+GW P+ GT+ L+  +YGE+ NTG G+
Sbjct  420  ASKNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALKTLYYGEYLNTGPGS  479

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R KW G + + + A+A +F P  FI G++W+PA+ VP+++
Sbjct  480  STANRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATNVPFTS  523



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 108/168 (64%), Gaps = 8/168 (5%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+CKLI+RKP    G GQ+CMVTAQGR+ P     + + N  I A PE+L
Sbjct  387  FVFGDAAAVFQNCKLIVRKP----GDGQNCMVTAQGRTTPASKGALVMQNCEIKAEPEFL  442

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGT-WGLEDCWYGEFGNTGKG  311
                PI +FLGRPW++++RT+I+ S ID  I P GW+P+  T +G+  CWY E+ N G G
Sbjct  443  ATKPPIKAFLGRPWKEYSRTIIMQSYIDGFIDPTGWAPWNTTEFGIHTCWYAEYQNRGPG  502

Query  310  ADVSKR-AKWAGVKGVITKAQADEFAPGKFI--LGDTWIPASGVPYSA  176
            A + KR + W G +  I+   A+ F  G FI     +++P + +PY A
Sbjct  503  ASLDKRISHWRGYQKGISGDVANSFTAGLFINPTDSSFLPKADIPYEA  550



>pdb|1GQ8|A Chain A, Pectin Methylesterase From Carrot
Length=319

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q C +  R+P    GSGQ  MVTAQGR+ P++ TGI I  S I AT +  
Sbjct  158  FIFGNAAVVLQDCDIHARRP----GSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQ  213

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTV++ S I   I P GW P+ G + L+  +YGE+ NTG GA
Sbjct  214  PVQSSFPTYLGRPWKEYSRTVVMQSSITNVINPAGWFPWDGNFALDTLYYGEYQNTGAGA  273

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R  W G K + +  +A  F PG FI G +W+ A+  P+S
Sbjct  274  ATSGRVTWKGFKVITSSTEAQGFTPGSFIAGGSWLKATTFPFS  316



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA  V Q+C + +RKPM    S Q   VTAQGR+ P+E TGI I N  I+A+ +  
Sbjct  380  FIFGNAVTVLQNCNIFVRKPM----SNQKNTVTAQGRTDPNENTGIVIHNCRITASSDLK  435

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               + + ++LGRPW++++RTV++ S +D  I  EGW+P+ G + L   +YGE+ N G GA
Sbjct  436  AIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGA  495

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            +   R KW G   +   + A +F+ G F+ GD+WI  SGVP+ A
Sbjct  496  NTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDA  539



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 102/164 (62%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQ+C L  RKP+ N    Q  M TAQGR  P++ TGI+I N  ++A  +  
Sbjct  433  FIFGNAAVVFQNCNLYARKPLEN----QQIMYTAQGRQDPNQNTGISIHNCRVTADSDMA  488

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTV + S +D  I P GW  +  T+ L   +YGE+ NTG GA
Sbjct  489  AVKSSFKTYLGRPWKEYSRTVFLQSYLDDLIHPAGWLEWNETFALSTLYYGEYMNTGPGA  548

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R  W G + + +  +A +F   +FI GDTW+P++GV YS+
Sbjct  549  GTANRVNWPGYRVITSATEASQFTVNQFIEGDTWLPSTGVEYSS  592



>ref|XP_010096538.1| Pectinesterase 1 [Morus notabilis]
 gb|EXB64658.1| Pectinesterase 1 [Morus notabilis]
Length=233

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAV Q C +  R+P     SGQ  MVTAQGR+ P++ TGI I  S I AT +  
Sbjct  72   FIFGNAAAVLQDCDIHARRP----NSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLK  127

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTV++ S I   I P GW  + G++ L    Y E+ NTG GA
Sbjct  128  PVQSSFPTYLGRPWKEYSRTVVMQSDISNVIVPAGWHEWSGSFALNTLVYREYQNTGAGA  187

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D SKR  W G K +   ++A ++  G FI G +W+ A+G P+S
Sbjct  188  DTSKRVTWKGYKVITGASEAQQYTAGNFIAGGSWLRATGFPFS  230



>ref|XP_009600658.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Nicotiana tomentosiformis]
Length=566

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 105/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C L  RKP+ +    Q  + TAQGRS P++ TGI+I N  I A P+  
Sbjct  406  FIFGNAAAVFQNCNLFARKPLPD----QKNIFTAQGRSDPNQNTGISIQNCTIQAAPDLA  461

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +  +SFLGRPW  ++RTVI+ S I   IAP GW  + GT GL+  +YGEF N G GA
Sbjct  462  QDMNLTLSFLGRPWHNYSRTVIMQSYIGDVIAPVGWLEWNGTNGLDTLYYGEFENYGPGA  521

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            + +KR +W G   ++  +QA  F    F +GDTW+P++ VP+S
Sbjct  522  NTTKRVEWPGYY-LMNASQAMNFTVYNFTMGDTWLPSTNVPFS  563



>ref|XP_010548770.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=572

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 107/162 (66%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FGNAAAVFQSC +  R P+     GQ   +TAQGR+ P++ TGI+I N  I  + E +
Sbjct  409  FVFGNAAAVFQSCNIFPRLPL----QGQFNAITAQGRTDPNQNTGISIQNCTIKPSTELV  464

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +   P+ ++LGRPW++++RTV + + +D  I P+GW+ + G + L+  +Y EF NTG G+
Sbjct  465  SGNFPVQTYLGRPWKEYSRTVYLQNFMDGLIDPKGWTEWMGDFALKTLYYAEFKNTGPGS  524

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D + R  W G   ++ + +A+ F   KFI+GD+W+P +GVP+
Sbjct  525  DTTNRVTWPGYHVIVNEDEAESFTVSKFIVGDSWLPVTGVPF  566



>ref|XP_006347998.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Solanum tuberosum]
Length=495

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 101/162 (62%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+AVFQ+C + +++PM      QS M+TAQGR   +E TGI ILNS +S++ E+ 
Sbjct  334  FIFGDASAVFQNCDIFVKRPM----DYQSNMITAQGRDDSNENTGIVILNSRVSSSSEFT  389

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV I + +D  I P+GW  + G + L   +Y E+ NTG GA
Sbjct  390  AVKDSFKNYLGRPWKKYSRTVFIKTDLDGLIDPKGWKEWSGDFALSTLYYAEYMNTGSGA  449

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            +   R  W G   +    +A  F    FI G++WIPASGVPY
Sbjct  450  NTGNRVNWPGFHVLRDANEASPFTVTNFIQGESWIPASGVPY  491



>gb|KEH29120.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=489

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AA V Q+C + IRKPM    S QS  +TAQGR  P++PTGI+I N  +    ++ 
Sbjct  328  FIFGDAAVVLQNCDIFIRKPM----SHQSNFITAQGRDDPNKPTGISIQNCRVRPDSDFS  383

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 I SFLGRPW++++RTV I S +D  I P+GW  ++G + L   +YGE+ NTG GA
Sbjct  384  MVKDSIKSFLGRPWKKYSRTVFIKSDLDGLIHPKGWGEWEGNFALSTLYYGEYMNTGNGA  443

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVP  185
                R  W G   + +  +A +F   +F+ G+ WI ASGVP
Sbjct  444  STQNRVNWPGFHVLKSSDEASQFTVSRFLQGEHWISASGVP  484



>ref|XP_010271266.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=532

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FI+G+A AV Q+C + +RKPM    SGQ   VTAQGR+ P+E TGI+I NS+++AT +  
Sbjct  372  FIWGDAVAVLQNCNIYVRKPM----SGQKNTVTAQGRTDPNENTGISIHNSLVTATSDLK  427

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +D+ I PEGW  + G + L   +YGEF NTG GA
Sbjct  428  AVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPEGWLEWSGNFALSTLYYGEFLNTGPGA  487

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KWAG   V+ KA A +F    F+ G +WI A+GVP++
Sbjct  488  STSGRVKWAGFH-VMNKADAQKFTVESFLGGSSWIAAAGVPFT  529



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A  V Q+C +++RKPM     GQSCM+TAQGR+   E +G+ + N  I+  P YL
Sbjct  411  FIFGDAKVVLQNCNIVVRKPM----KGQSCMITAQGRTDVRESSGLVLQNCHITGEPAYL  466

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++ +RT+I+ + ID  I P GW P+ G + L   +Y E+ N G G+
Sbjct  467  PVKSINKAYLGRPWKEFSRTIIMGTTIDNIIDPAGWLPWNGDFALNTLYYAEYENNGPGS  526

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D ++R KW G+K  I+  QA  F P +F+ G+ WIP + VPY
Sbjct  527  DQAQRVKWPGIKK-ISPKQARRFTPARFLRGNLWIPPNRVPY  567



>ref|XP_010423511.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 47 
[Camelina sativa]
Length=626

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+FQ+C +  RKPM N    Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  462  FIFGNAAAIFQNCNIYARKPMAN----QKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  517

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              PS  ++FLGRPW+ ++RTV I S I   I P GW  + GT GL+   YGE+ N G GA
Sbjct  518  ADPSSTMTFLGRPWKPYSRTVYIQSYISDVIQPVGWLEWNGTTGLDTISYGEYDNFGPGA  577

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W+G   ++  A+A  F    F LGDTW+P + +P+
Sbjct  578  NTSKRVQWSGY-SLLNLAEAMNFTVYNFTLGDTWLPQTDIPF  618



>ref|XP_010264200.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=516

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQ+C +  RKP           VTAQGRS P++ TGI I NS I+A  +  
Sbjct  356  FIFGNAAVVFQNCNMFARKP-----KNSIVTVTAQGRSDPNQNTGIVIHNSRITAASDLK  410

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S + ++LGRPWRQ++RTV++ + +D+ I P GW P+ G++ L   +YGE+ NTG G+
Sbjct  411  PVQSSVKTYLGRPWRQYSRTVVLKTFLDSLIQPAGWLPWSGSFALSTLYYGEYQNTGPGS  470

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R KW G   + +  +A +F  G FI+G  W+PA+ VP+++
Sbjct  471  STANRVKWGGYHVITSVTEASKFTVGSFIVGGAWLPATNVPFTS  514



>emb|CDY56347.1| BnaCnng30140D [Brassica napus]
Length=517

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 106/164 (65%), Gaps = 13/164 (8%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            +IFGN+AAV QSC ++ RKP+    SGQ+  VTAQGRS P + TGI+I N  I+A     
Sbjct  363  YIFGNSAAVLQSCNIVARKPL----SGQTNFVTAQGRSNPGQNTGISIQNCKITAQS---  415

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV++ S +D  I P GWSP+ G +GL+  +Y EFGN+G G+
Sbjct  416  ------TTYLGRPWKEYSRTVVMQSFLDGSIHPSGWSPWSGGFGLKTLFYAEFGNSGPGS  469

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             VS R KWAG    +T  +A+ F    FI G  W+P++GV + +
Sbjct  470  SVSGRVKWAGYHSSLTVKEAEGFTVANFIGGTMWLPSTGVSFDS  513



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR  P EPTG       I+  P+YL
Sbjct  406  FVFGDAAAVFQNCTLLVRKPLPN----QACPITAHGRQDPREPTGYVFQGCTIAGEPDYL  461

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+I+NS I   + P+GW P+ G +GL+  +Y E  N G GA
Sbjct  462  AVKQTSKAYLGRPWKEYSRTIIMNSFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNIGPGA  521

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
             ++ R  WAG+K  ++  +  +FAP +FI  D W+P  GVPY
Sbjct  522  ALASRVTWAGIK-TLSNEEILKFAPAEFIQSDAWVPGKGVPY  562



>ref|XP_006388348.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
 gb|ERP47262.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
Length=579

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ C +  R+P     SGQ  MVTAQGR+ P++ TGI I  S I AT + L
Sbjct  418  FIFGNAAAVFQDCDIHARRP----DSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLL  473

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTVI+ S I   I P GW  + GT+ L   +Y E+ N+G GA
Sbjct  474  PVQSSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWHEWSGTFALSTLFYAEYQNSGSGA  533

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R  W G K + +  +A  FAPG FI G +W+ ++  P+S
Sbjct  534  GTSSRVTWEGYKVITSATEAQAFAPGNFIAGSSWLGSTSFPFS  576



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 103/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+A VFQSC L  R+P+ N    QS + TAQGR  P++ TGI+I    ++A  + L
Sbjct  265  FIFGNSAVVFQSCNLYARRPLPN----QSNVYTAQGREDPNQNTGISIQKCKVAAASDLL  320

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW+Q++RTV + S++D+ + P GW  + G + L+  +YGE+ NTG GA
Sbjct  321  AVQSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGA  380

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G + + + ++A  F  G FI GD W+  + VP++
Sbjct  381  STSNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGTSVPFT  423



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FGNA ++FQ+C+ I+RKPM N    Q+CMVTAQGR Q +    I I N  I A   ++
Sbjct  376  FVFGNALSIFQNCQFIVRKPMAN----QACMVTAQGRDQRNSNGAIVIQNGEIRAEQAFI  431

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             A   + ++LGRPW+Q + T+I++S I   I+P+GW+P+ G++ L+ C+Y E+ N G G+
Sbjct  432  NAKPKVQAYLGRPWKQFSTTIIMSSYIGGSISPQGWAPWAGSFALDTCYYAEYRNRGPGS  491

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + S+R KW G+K +  +  A  +APGK    D WI  +GVPY
Sbjct  492  NTSQRVKWKGIKHIDPQTAA-RYAPGKAYGDDQWIRRAGVPY  532



>gb|AFK42744.1| unknown [Lotus japonicus]
Length=260

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 97/163 (60%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+A VFQ C +  R+P     SGQ  MVTAQGR  P++ TGI I    I AT +  
Sbjct  99   FIFGNSAVVFQDCDIHARRP----NSGQKNMVTAQGRLDPNQNTGIVIQKCRIGATKDLE  154

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   +FLGRPW+ ++RTVI+ S I   I P GW  + G + L   +YGE+ NTG GA
Sbjct  155  AVKSSFPTFLGRPWKDYSRTVIMQSSITDVIDPAGWHEWNGNFALNTLFYGEYLNTGPGA  214

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S+R  W G K + + ++A  F P  FI G TW+ ++G P+S
Sbjct  215  ATSRRVNWKGFKVITSASEAQAFTPANFIAGSTWLSSTGFPFS  257



>ref|XP_002873178.1| hypothetical protein ARALYDRAFT_487284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49437.1| hypothetical protein ARALYDRAFT_487284 [Arabidopsis lyrata subsp. 
lyrata]
Length=616

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+FQ+C +  RKPM N    Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  452  FIFGNAAAIFQNCNIYARKPMAN----QKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  507

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+  ++FLGRPW+ ++RTV I S I   + P GW  + GT GL+   YGE+ N G GA
Sbjct  508  ADPNSTMTFLGRPWKPYSRTVYIQSYISDVVQPVGWLEWNGTTGLDTISYGEYDNFGPGA  567

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D SKR +W+G   ++  A+A  F    F LGDTW+P + +P+
Sbjct  568  DTSKRVQWSGY-SLLNLAEAMNFTVYNFTLGDTWLPQTDIPF  608



>ref|XP_006398954.1| hypothetical protein EUTSA_v10013020mg [Eutrema salsugineum]
 gb|ESQ40407.1| hypothetical protein EUTSA_v10013020mg [Eutrema salsugineum]
Length=602

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+FQ+C +  RKPM      Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  438  FIFGNAAAIFQNCNIYARKPM----PKQKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  493

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P+P ++FLGRPW+ ++RTV I S I   I P GW  + GT GL+   YGE+ N G GA
Sbjct  494  ADPNPAMTFLGRPWKPYSRTVYIQSYISDAIQPVGWLEWNGTTGLDTISYGEYDNFGPGA  553

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W+G   ++  AQA  F    F LGDTW+P + +P+
Sbjct  554  NTSKRVQWSGY-SLLNLAQAMNFTVYNFTLGDTWLPQTDIPF  594



>ref|XP_008812365.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=521

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 104/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN A V Q+C +  R+P      G+S ++TAQGR+ P++ TGI I +S I    E L
Sbjct  360  FIFGNGAVVLQNCNIFARRPR----PGESNVITAQGRTDPNQNTGIVIHSSAILPAAELL  415

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 + S+LGRPW+Q++RTV + S +DA I P GW PF G + L   +Y EFGNTG G+
Sbjct  416  PVRGTVRSYLGRPWQQYSRTVYLRSSMDAIIDPAGWLPFNGNFALNTLYYAEFGNTGPGS  475

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             +S+R  W G   +   +   +F+ G+FI G TWIP++GVP++A
Sbjct  476  ALSRRVTWPGYHVIKRPSLVRQFSVGRFIAGRTWIPSTGVPFNA  519



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 107/165 (65%), Gaps = 6/165 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA A+ Q+C L++RKP+ N    Q+C+VTA GR+  +E +   I  S + A PEY 
Sbjct  402  FIFGNARALIQNCTLLVRKPLDN----QACVVTANGRTLSNETSAFVIHGSRVVAAPEYP  457

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWG-LEDCWYGEFGNTGKG  311
                 I SFLGRPW+++++T+ + S+I+  I+PEGWSP+  T   L+ CWY E GN G G
Sbjct  458  VDDKRIQSFLGRPWKEYSKTIFMASEIEGFISPEGWSPWDNTADHLDTCWYAEVGNRGPG  517

Query  310  ADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            AD++ R KW G+K  IT A+A +FAP  ++    WI   G+P+ +
Sbjct  518  ADLTNRVKWPGIKN-ITMAEAAQFAPTMYMDSGHWIEGKGIPFDS  561



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+   V Q C +++RKPM      QSCM+TAQGR+   E TG+ + N  I+  PEY+
Sbjct  409  FIFGDGKVVLQKCNIVVRKPM----KSQSCMITAQGRTDERESTGLVLDNCHITGEPEYI  464

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW+Q +RT+I+ + I+  + P GW P+ G++ L   +Y E+ N G G+
Sbjct  465  PVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEYENNGLGS  524

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D S+R KW G+K +  K QA  F P +F+ G+ WIP + VPY
Sbjct  525  DQSQRVKWPGIKKLSPK-QALRFTPARFLRGNLWIPPTRVPY  565



>ref|XP_008795770.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 41 [Phoenix dactylifera]
Length=576

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 99/164 (60%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            +IFGNAA VFQ+C +  R PM     GQS  +TAQGR+ P++ TG  + +  I A  +  
Sbjct  415  YIFGNAAVVFQNCNIYSRLPM----QGQSNTITAQGRTDPNQNTGTTVQDCNIRAAADLA  470

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                  +++LGRPW+ ++RTVI+ S +D+ I P GW P+ G + L   +Y EF NTG G+
Sbjct  471  ADSGSTITYLGRPWKNYSRTVIMESFMDSSIDPRGWMPWDGDFALSTLYYAEFNNTGPGS  530

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            D S R  W G+  VI    A  F    FILGD W+P +GVPYS+
Sbjct  531  DTSNRVTWPGLH-VINSTDASNFTVSNFILGDNWLPQTGVPYSS  573



>ref|XP_004297462.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Fragaria vesca subsp. vesca]
Length=548

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A+A+ Q+C + +RKP     S Q   VTAQ R  P+E TGI I N  I+A P+  
Sbjct  387  FIFGDASAILQNCNIYVRKP----SSNQINTVTAQSRRDPNENTGIIIHNCRITAAPDLR  442

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++R VI+ S +D  I P+GW P+ G++GL+  +YGE+ NTG GA
Sbjct  443  AVQGSFRTYLGRPWQKYSRVVIMKSNLDGLIEPQGWFPWSGSFGLDTLYYGEYMNTGAGA  502

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
                R KW G + + +  +A +F  G F+ GD W+P +GVP+ A
Sbjct  503  ATGGRVKWPGFRVITSATEAGKFTVGNFLAGDAWLPGTGVPFEA  546



>ref|XP_006649104.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 35-like 
[Oryza brachyantha]
Length=482

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 104/164 (63%), Gaps = 8/164 (5%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAV Q C +  R+P    G GQ   VTAQGRS P++ TGI+I    I+A P+  
Sbjct  325  FIFGNAAAVIQGCDIRARRP----GPGQQDTVTAQGRSDPNQNTGISIHRCRIAAAPDLG  380

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             AP     +LGRPWR+++RTV++++ +D  IAP GW  + G +GL   +YGE+GNTG GA
Sbjct  381  GAPV----YLGRPWRRYSRTVVMDTALDRSIAPAGWLEWSGQFGLATLYYGEYGNTGPGA  436

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
               +R  W GV   ++ + A  F    FI+GD W+P +GV Y++
Sbjct  437  VTRRRVTWGGVHSRMSTSDATRFTVANFIVGDAWLPGTGVAYTS  480



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ C +  R+P     SGQ  M+TAQGR+ P++ TGI I    I AT +  
Sbjct  450  FIFGNAAAVFQDCDIHARRP----NSGQKNMLTAQGRTDPNQNTGIVIQKCRIGATSDLQ  505

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTV++ + I   I P GW  + G++ L   +YGE+ NTG GA
Sbjct  506  AVISSFKTYLGRPWKEYSRTVVMQTSITNVIDPAGWHEWSGSFALSTLYYGEYQNTGAGA  565

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              SKR  W G K + + ++A  F PG FI G +W+ ++G PYS
Sbjct  566  GTSKRVTWKGFKVITSASEAQGFTPGTFIAGSSWLGSTGFPYS  608



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 104/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            +IFG+A + FQ+CK+++RKPM     GQSCMVTAQGR+   E TGI + N  I   P Y+
Sbjct  411  YIFGDAKSFFQNCKMVVRKPM----GGQSCMVTAQGRTDKRESTGIILHNCRIMGDPAYI  466

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++ +RT+I+ + ID  I P+GW  + G + L+   YGE+ N G G+
Sbjct  467  PVKSTNKAYLGRPWKEFSRTIIMRTTIDDIIDPKGWLEWNGNFALDTLEYGEYENNGSGS  526

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
                R KW G+K  ++  QA +F  G+F+ G+TWIP   VPY+
Sbjct  527  GQEMRVKWPGIKK-LSARQALQFTAGRFLRGNTWIPRRRVPYT  568



>ref|XP_010544635.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Tarenaya hassleriana]
Length=486

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +R+PM +    Q+ M+TAQGR  P   TGI+I  S +   PE  
Sbjct  325  FIFGDAAAVFQNCDIFVRRPMDH----QANMITAQGRDNPHTNTGISIQESRVRPAPELE  380

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   S+LGRPW++++RTV + + +D  I P GW+ + G + L   +YGE+ NTG GA
Sbjct  381  VMKSRFRSYLGRPWKKYSRTVFMKTDLDGLIHPNGWTEWSGAFALSTLYYGEYMNTGAGA  440

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
               +R KW G   +    +A  F+  +FI G++WIPA+GVP+ A
Sbjct  441  RTDERVKWPGFHVLRGSEEASPFSVSRFIQGESWIPATGVPFHA  484



>ref|XP_007160398.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
 gb|ESW32392.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
Length=517

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A +V Q+C + +RKPM    S Q   VTAQGR+ P+E TGI I N VI+A  +  
Sbjct  357  FIFGDAVSVLQNCNIYVRKPM----SNQQNSVTAQGRTDPNENTGIIIHNCVITAAGDLK  412

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV++ S +D  I P GWS + G + L   +YGE+ NTG GA
Sbjct  413  AVQGSFRTYLGRPWQKYSRTVVMKSALDGLINPAGWSEWSGNFALSTLYYGEYANTGAGA  472

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
                R KW G + V++ + A +F  G+F+ G +WIP SGVP+ A
Sbjct  473  STGGRVKWGGFR-VMSSSDAVKFTVGEFLAGGSWIPGSGVPFDA  515



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 107/164 (65%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKPM    SGQ   +TAQGR+ P++ TGI+I +S + A P++ 
Sbjct  358  FIFGNAAVVLQNCMIYARKPM----SGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFK  413

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            ++   + +FLGRPW++++RTV + S +D  + P GW  + G + L+  +YGE+ N G GA
Sbjct  414  SSVGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGA  473

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              S R KW G + + + ++A +F    FI G +W+PA+ VP++A
Sbjct  474  PTSGRVKWGGYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTA  517



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 107/164 (65%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++  + Q+CK+++RKPM    +GQSCMVTAQGRS   EPTGI + N  I   P Y+
Sbjct  400  FIFGDSQCILQNCKIVVRKPM----AGQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYI  455

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW++ +RT+++ + +D  I P GW P+ G + L+  +Y E  N G GA
Sbjct  456  PVRTASKAYLGRPWKEFSRTIVMKTIVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGA  515

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            + ++R KW G+K  +T  QA  +   +F+ G+TWIP + VPY+A
Sbjct  516  NQAQRVKWPGIKK-LTPEQALSYTGDRFLSGNTWIPRTQVPYTA  558



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 106/165 (64%), Gaps = 5/165 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+A V Q C++++RKP+ N    Q  +VTA GR    EPT I + +  I A P   
Sbjct  415  FIFGNSAVVLQKCRIVVRKPLEN----QQNIVTAHGRKDRREPTAIILQSCRIVADPLLF  470

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   S+LGRPW++++RT+I+ + ID  I P+GW P+ G + L+ C+Y E+ N G GA
Sbjct  471  PVRNTTRSYLGRPWKEYSRTIIMQTLIDDLINPDGWLPWSGDFALKTCFYAEYNNRGPGA  530

Query  307  DVSKRAKWAGVK-GVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             +++R KW G+K  ++T  +A +F  G+FI GD+WI  +GVPY +
Sbjct  531  VLTQRVKWRGIKTSIMTPEKAQQFTAGRFIRGDSWIKPTGVPYDS  575



>emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=579

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ C    R+P     SGQ  MVTAQGR+ P++ TGI I  S I AT + L
Sbjct  418  FIFGNAAAVFQDCDYHARRP----DSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLL  473

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTVI+ S I   I P GW  + G++ L   +Y E+ N+G GA
Sbjct  474  PVQSSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWHEWSGSFALSTLFYAEYQNSGAGA  533

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G K + +  +A  FAPG FI G +W+ ++  P+S
Sbjct  534  GTSSRVKWEGYKVITSATEAQAFAPGNFIAGSSWLGSTSFPFS  576



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAV Q C +  R+P     SGQ  MVTAQGR  P++ TGI I    I AT +  
Sbjct  417  FIFGNAAAVLQDCDIHARRP----NSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLK  472

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTV++ + I   I P GW P+ G + L+  +Y E+ NTG GA
Sbjct  473  PVQSSFPTYLGRPWKEYSRTVVMQTSISDVINPAGWYPWNGNFALDTLFYAEYQNTGAGA  532

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D SKR  W G K + + ++A  F  G FI G +W+P++G P+S
Sbjct  533  DTSKRVNWKGFKVITSASEAQAFTAGSFIGGSSWLPSTGFPFS  575



>gb|KDO36003.1| hypothetical protein CISIN_1g029714mg [Citrus sinensis]
Length=189

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAV Q+C +  RKP     SGQ  MVTAQGR+ P++ TGI I  S I AT +  
Sbjct  28   FIFGNAAAVLQNCDIHARKP----NSGQKNMVTAQGRADPNQNTGIVIQKSRIGATSDLK  83

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTVI+ S I   I P GW  + G + L   +YGE  N G GA
Sbjct  84   PVQGSFPTYLGRPWKEYSRTVIMQSSITDVIHPAGWHEWDGNFALNTLFYGEHQNAGAGA  143

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G + + +  +A  F PG FI G +W+ ++G P+S
Sbjct  144  GTSGRVKWKGFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFS  186



>ref|NP_196116.1| putative pectinesterase/pectinesterase inhibitor 47 [Arabidopsis 
thaliana]
 sp|Q9FF77.1|PME47_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
47; Includes: RecName: Full=Pectinesterase inhibitor 47; AltName: 
Full=Pectin methylesterase inhibitor 47; Includes: RecName: 
Full=Pectinesterase 47; Short=PE 47; AltName: Full=Pectin 
methylesterase 47; Short=AtPME47; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB11519.1| pectinesterase [Arabidopsis thaliana]
 gb|AED90810.1| putative pectinesterase/pectinesterase inhibitor 47 [Arabidopsis 
thaliana]
Length=624

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+FQ+C +  RKPM N    Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  460  FIFGNAAAIFQNCNIYARKPMAN----QKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  515

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              P   ++FLGRPW+ ++RTV I S I   + P GW  + GT GL+   YGE+ N G GA
Sbjct  516  ADPKSTMTFLGRPWKPYSRTVYIQSYISDVVQPVGWLEWNGTTGLDTISYGEYDNFGPGA  575

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D SKR +W+G   ++   QA  F    F LGDTW+P + +P+
Sbjct  576  DTSKRVQWSGY-SLLNLVQAMNFTVYNFTLGDTWLPQTDIPF  616



>ref|XP_010069353.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=537

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 107/165 (65%), Gaps = 4/165 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+A V Q C +  RKP+    SGQ   VTAQGR+ P + TGI+I +  I A  + +
Sbjct  374  FIFGNSAVVLQKCNIYARKPL----SGQHNFVTAQGRTSPYQNTGISIHDCKIGAASDSV  429

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   +FLGRPW+Q++RTV++ S +D  I P GWSP+ G + L+  +YGE+ N+G GA
Sbjct  430  PLESKPTTFLGRPWKQYSRTVVMQSLLDGSIHPLGWSPWSGDFALKTLFYGEYRNSGPGA  489

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSAK  173
             +++R +WA   G +T AQA  F   +FI G+ W+P++GV + ++
Sbjct  490  PITRRVQWASYHGSLTPAQAQPFTVAQFISGNLWLPSTGVSFDSR  534



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 102/165 (62%), Gaps = 7/165 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L +RKPM      Q C+VTAQGR+   +PTG+   N  I A   Y 
Sbjct  405  FVFGDAAAVFQNCTLAVRKPM----KEQHCIVTAQGRTDARQPTGLVFQNCSIVADESYN  460

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 + ++LGRPW+Q++RT+I+ S ID  I PEGW  +  T+  E  +Y EF N G G+
Sbjct  461  EVKGEVKTYLGRPWKQYSRTIIMESNIDDLIQPEGWLEWNKTFAFETLFYTEFNNKGSGS  520

Query  307  DVSKRAKWAGVKGV-ITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R +W+GVK + I + Q   F    FI  D WIP++GVPY++
Sbjct  521  SKTDRVRWSGVKELPIERVQ--RFTTSSFIDADLWIPSTGVPYTS  563



>ref|XP_010452398.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 47 
[Camelina sativa]
Length=626

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+FQ+C +  RKPM N    Q   VTA GR+ P++ TGI+I+N  I A P+  
Sbjct  462  FIFGNAAAIFQNCNIYARKPMAN----QKNAVTAHGRTDPNQKTGISIINCTIGAAPDLA  517

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
              PS  ++FLGRPW+ ++RTV I S I   + P GW  + GT GL+   YGE+ N G GA
Sbjct  518  ADPSSTMTFLGRPWKPYSRTVYIQSYISDVVQPVGWLEWNGTTGLDTISYGEYDNFGPGA  577

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + SKR +W+G   ++  A+A  F    F LGDTW+P + +P+
Sbjct  578  NTSKRVQWSGY-SLLNLAEAMNFTVYNFTLGDTWLPQTDIPF  618



>ref|XP_009760201.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Nicotiana sylvestris]
Length=570

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 104/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA+FQ+C +  RKPM +    Q  + TAQGRS P++ TGI+I N  I A P+  
Sbjct  410  FIFGNAAAIFQNCNMFARKPMPD----QKNIFTAQGRSDPNQNTGISIQNCTIQAAPDLA  465

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +  +SFLGRPW  ++RTVI+ S I   IAP GW  + GT GL+  +YGEF N G GA
Sbjct  466  QEMNGTLSFLGRPWHNYSRTVIMQSYIGDVIAPVGWLEWNGTNGLDTLYYGEFENYGPGA  525

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            + + R +W G   ++  +QA  F    F +GDTW+P++ VP+S
Sbjct  526  NTTTRVQWPGYN-LMNASQAMNFTVYNFTMGDTWLPSTNVPFS  567



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 104/165 (63%), Gaps = 6/165 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A AV Q+C + +R+PM    +GQ   VTAQGR  P+E TGI I NS + AT +  
Sbjct  368  FIFGDAVAVLQNCNIYVRRPM----NGQKNTVTAQGRKDPNENTGIVIHNSNVMATSDMR  423

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+ + S +D  I P GW P+ G + L   +YGE+ NTG GA
Sbjct  424  PVQGSFKTYLGRPWQKYSRTLFMKSNLDGLIDPAGWLPWSGNFALSTLYYGEYMNTGSGA  483

Query  307  DVSKRAKWAGVKGVITKA-QADEFAPGKFILGDTWIPASGVPYSA  176
              ++R  W G   VITKA  A +F  G F+ GD+WIP +GVP+ +
Sbjct  484  STARRVNWPGYH-VITKATDAGKFTVGNFLAGDSWIPGTGVPFDS  527



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A  + Q+CK+++RKP       QSCMVTAQGRS   EPTGI + N  I   P Y+
Sbjct  405  FIFGDAKCILQNCKIVVRKP----KRSQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYI  460

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPWRQ +RT+I+ + ID  I P GW  +QG   L+  +Y E  N G G+
Sbjct  461  PVKSRNKAYLGRPWRQFSRTIIMKTTIDDVIDPAGWLLWQGESALKTLFYAEHLNIGPGS  520

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            + ++R KW G+K  ++  +A  F   +F+LGDTWIP + VPY+A
Sbjct  521  NQAQRVKWPGLKK-LSPEEALMFTGNRFLLGDTWIPQTHVPYTA  563



>ref|XP_006828613.1| hypothetical protein AMTR_s00129p00074780 [Amborella trichopoda]
 gb|ERM96029.1| hypothetical protein AMTR_s00129p00074780 [Amborella trichopoda]
Length=671

 Score =   154 bits (388),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 75/164 (46%), Positives = 104/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQSC L  RKPM    S Q    TAQGR  P++ TG +I N  I+A  + +
Sbjct  508  FIFGNAAAVFQSCNLYARKPM----SDQRITYTAQGRKDPNQNTGFSIHNCKITAASDLV  563

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S I ++LGRPW++ +RTVI+ S +D  I P GW  + G + L+  +YGE+ N G GA
Sbjct  564  PVKSSIPTYLGRPWQEFSRTVIMQSFLDDLIRPAGWLEWSGNFALKSLYYGEYMNKGPGA  623

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             +S R +W G KG +T   A +F   +FI G++W+PA+GV + +
Sbjct  624  GLSDRVRWPGYKGELTVDDATKFTVAQFISGNSWLPATGVSFDS  667



>gb|ABE67980.1| pectin methylesterase, partial [Citrus bergamia]
Length=229

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 99/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAV Q+C +  RKP     SGQ  MVTAQGR+ P++ TGI I  S I AT +  
Sbjct  68   FIFGNAAAVLQNCDIHARKP----NSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLK  123

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTVI+ S I   I P GW  + G + L   +YGE  N+G GA
Sbjct  124  PVQGSFPTYLGRPWKEYSRTVIMQSSITDLIHPAGWHEWDGNFALNTLFYGEHQNSGAGA  183

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G + + +  +A  F PG FI G +W+ ++G P+S
Sbjct  184  GTSGRVKWKGFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFS  226



>ref|XP_008340373.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=573

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKP     SGQ  M+TAQGR+ P++ TGI I  S I AT +  
Sbjct  412  FIFGNAAVVLQNCDIHARKP----NSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQ  467

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
             +     +FLGRPW++++RTVI+ S I   I P GW  + GT+ L   +YGE+ NTG GA
Sbjct  468  ASKGSFKTFLGRPWKEYSRTVIMQSSITDIIDPVGWHEWSGTFALNTLFYGEYANTGAGA  527

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              SKR  W G K + +  +A  + PG FI G +W+ ++G P++
Sbjct  528  GTSKRVTWKGFKVITSTTEAQAYTPGXFIAGGSWLSSTGFPFA  570



>emb|CDO97787.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 99/163 (61%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN AAVFQ C +  R P    GSGQ  MVTAQGR  P++ TGI I    I AT +  
Sbjct  99   FIFGNGAAVFQDCDIHARLP----GSGQKNMVTAQGRIDPNQNTGIVIQKCRIGATSDLR  154

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   +FLGRPW++++RTV++ S +   I P GW  + G + L   +Y E+ NTG GA
Sbjct  155  PVQQNFPTFLGRPWKEYSRTVVMQSTVTDVIDPAGWHEWNGNFALSTLFYAEYQNTGAGA  214

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G K + + A+A  F PG+FI G++W+ A+G P++
Sbjct  215  GTSGRVKWKGYKVITSAAEAQAFTPGRFIDGNSWLGATGFPFA  257



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 105/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR  P E TG  +    I+   +YL
Sbjct  216  FLFGDAAAVFQNCTLLVRKPLAN----QACPITAHGRKDPRESTGFVLQGCTIAGEADYL  271

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+++++T+I+ + I   I  EGWSP+QG +GL+  +Y E  NTG GA
Sbjct  272  AVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGA  331

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             V+ R  W G+K  +++ +  E+ P K+I GD WIP  GVPY+
Sbjct  332  AVANRVTWQGIKK-LSEEEIVEYTPAKYIQGDDWIPGKGVPYT  373



>ref|XP_007213952.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
 gb|EMJ15151.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
Length=555

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQ+CKL+ RKPM    +GQ+ MVTAQGR  P++ TG +I    I A+ +  
Sbjct  394  FIFGNAAVVFQNCKLVARKPM----TGQNNMVTAQGRIDPNQNTGTSIQKCDIIASSDLE  449

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 I S+LGRPW++++RTV++ SKI   I P GWS + G + L+  +YGE+ N+G GA
Sbjct  450  PVKGTIRSYLGRPWKEYSRTVVMQSKIGDHIDPSGWSIWSGDFALKTLYYGEYANSGAGA  509

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              SKR KWAG   + +  +A  F   + I G +W+ ++GV Y+
Sbjct  510  GTSKRVKWAGYHVITSPTEAQTFTVAQLIQGGSWLKSTGVAYT  552



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 99/162 (61%), Gaps = 4/162 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA  VFQ+C + +R+ M N    Q  ++TAQGR +     G  ILN  I   PE+ 
Sbjct  393  FIFGNAQVVFQNCLIQVRRCMDN----QQNIITAQGRKEKHSAGGTVILNCTIEPHPEFK  448

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 + +FLGRPW++++RT+ I S+I   I P+GW P+ G +GL  C+Y E  N G G+
Sbjct  449  EHAGRLRTFLGRPWKEYSRTLYIQSEIGGFIDPQGWLPWLGDFGLNTCYYAEVDNHGPGS  508

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            D+SKRAKW GVK V  +    ++   KFI G TWIP  GVPY
Sbjct  509  DMSKRAKWRGVKTVTYQQAQQKYTIEKFIQGQTWIPKYGVPY  550



>ref|XP_010938361.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Elaeis guineensis]
Length=575

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 98/163 (60%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            +IFGNAA VFQ+C +  R PM     GQS  VTAQGR+ P++ TG  I    I A P+  
Sbjct  414  YIFGNAAVVFQNCNIYSRLPM----QGQSNTVTAQGRTDPNQNTGTVIQECNIVAAPDLA  469

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +     +++LGRPW+ ++RTVI+ S +D+ I P+GW P+ G + L   +Y EF NTG G+
Sbjct  470  SDGGSTITYLGRPWKNYSRTVIMESFMDSSIDPKGWMPWDGDFALSTLYYAEFNNTGPGS  529

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D   R  W G   VI    A  F    FILGD W+P +GVPYS
Sbjct  530  DTRNRVTWPGFH-VINSTDASNFTVSNFILGDDWLPQAGVPYS  571



>ref|XP_002315399.2| hypothetical protein POPTR_0010s25400g [Populus trichocarpa]
 gb|EEF01570.2| hypothetical protein POPTR_0010s25400g [Populus trichocarpa]
Length=574

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 105/168 (63%), Gaps = 10/168 (6%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C L  RKPM+N    Q    TAQGR+ P++ TGI+I N  I A P+  
Sbjct  408  FIFGNAAAVFQNCNLYARKPMLN----QKNAFTAQGRTDPNQNTGISIHNCTIEAAPDLA  463

Query  487  -----TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGN  323
                 T  +  ++FLGRPW++++RTVI+ S I   I P GW  + GT GL+  +YGEF N
Sbjct  464  MDRNSTDSNLTLNFLGRPWKEYSRTVIMQSYIGELIQPVGWLEWNGTVGLDTIYYGEFQN  523

Query  322  TGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             G GA+ S+R +W G   ++   QA  F    F +GDTW+P + VP+S
Sbjct  524  YGPGANTSRRVQWPGF-NLMNATQAVNFTVYNFTMGDTWLPYTDVPFS  570



>ref|XP_010523198.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 38 
[Tarenaya hassleriana]
Length=495

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 103/164 (63%), Gaps = 7/164 (4%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAA FQ+C++  RKP+  NG      +TA  R  PDEPTGI I NSVISA P+ L
Sbjct  334  FIFGNAAAYFQNCRIFARKPL--NGMNA---ITAHARVSPDEPTGIVIHNSVISAAPDLL  388

Query  487  TAPS-PIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWG-LEDCWYGEFGNTGK  314
             +P   + ++LGRPWR ++RTVI+NS +D+ I P+GW P+      L   +Y E+ NTG 
Sbjct  389  KSPRGSVTTYLGRPWRPYSRTVILNSYLDSLIDPKGWLPWDSNHTVLTTLYYAEYNNTGP  448

Query  313  GADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
             +  SKR  W G   +   A+A  F+  KF  G +W+PA+ VP+
Sbjct  449  ASGTSKRVTWPGFHAITDYAEARRFSLSKFFRGVSWLPATNVPF  492



>ref|XP_010910890.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Elaeis guineensis]
Length=578

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            +IFGNAA +FQ+C +  R PM     GQS  +TAQGR+ P++ TG AI    I A P+  
Sbjct  417  YIFGNAAVMFQNCNIYSRLPM----QGQSNTITAQGRTDPNQNTGTAIQYCNIVAAPDLA  472

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                  +++LGRPW+ ++RTVI+ S +D+ I P+GW P+ G + L   +Y EF NTG G+
Sbjct  473  ADSGSTITYLGRPWKNYSRTVIMESFMDSLIDPKGWMPWDGDFALSTLYYAEFNNTGPGS  532

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            D S R  W G   VI    A  F    FILGD W+P +GVPYS
Sbjct  533  DTSNRVTWPGFH-VIGSTDASNFTVSNFILGDNWLPQTGVPYS  574



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG++AAVFQ C L++RKPM N    Q C+VTAQGR    +PTGI I N    A PE  
Sbjct  385  FIFGDSAAVFQGCTLVVRKPMDN----QQCIVTAQGRKDVRQPTGIVIQNCSFVADPELY  440

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 I+S+LGRPW++++RT+I+ S +D  I P+GW  +  T+ LE  +Y EF N G  A
Sbjct  441  PVRHKILSYLGRPWKEYSRTIIMESFLDDFIQPDGWMKWNETFALETLFYTEFNNRGPAA  500

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
               KR KW GVK  +  ++   F PG+F+ G+ WIP + VPY+A
Sbjct  501  PKMKRVKWPGVKE-LPPSRVQRFTPGEFLDGNRWIPPTQVPYAA  543



>ref|XP_010069351.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=537

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 105/164 (64%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+  VFQ C +  RKP+    SGQ   VTAQGR+ P + TGI+I +  I A  + +
Sbjct  374  FIFGNSVVVFQKCNIYARKPL----SGQHNFVTAQGRTSPYQNTGISIHDCKIGAASDSV  429

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   +FLGRPW+Q++RT+++ S +D  I P GWSP+ G + L+  +YGE+ N+G GA
Sbjct  430  PLESKPTTFLGRPWKQYSRTIVMQSLLDGSIHPLGWSPWSGDFALKTLFYGEYRNSGPGA  489

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             ++ R +WA   G +T AQA  F   +FI G+ W+P++GV + +
Sbjct  490  RIAGRVQWASYHGSLTSAQAQRFTVAQFISGNLWLPSTGVSFDS  533



>emb|CBI35795.3| unnamed protein product [Vitis vinifera]
Length=670

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ C +  R+P     SGQ  M+TAQGR+ P++ TGI I    I AT +  
Sbjct  99   FIFGNAAAVFQDCDIHARRP----NSGQKNMLTAQGRTDPNQNTGIVIQKCRIGATSDLQ  154

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW++++RTV++ + I   I P GW  + G++ L   +YGE+ NTG GA
Sbjct  155  AVISSFKTYLGRPWKEYSRTVVMQTSITNVIDPAGWHEWSGSFALSTLYYGEYQNTGAGA  214

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              SKR  W G K + + ++A  F PG FI G +W+ ++G PYS
Sbjct  215  GTSKRVTWKGFKVITSASEAQGFTPGTFIAGSSWLGSTGFPYS  257


 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 99/165 (60%), Gaps = 10/165 (6%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA VFQ+CK+  R+PM    S Q   +TAQG+  P++ TGI+I    ISA    L
Sbjct  513  FIFGNAAVVFQACKIQPRQPM----SNQFNTITAQGKKDPNQNTGISIQKCSISALNT-L  567

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSP-FQGTWGLEDCWYGEFGNTGKG  311
            TAP+    +LGRPW+ ++ T+++ S I + + P+GW+    G       +Y EF NTG G
Sbjct  568  TAPT----YLGRPWKAYSTTIVMQSNIGSFLNPKGWTEWVTGVDPPSTIFYAEFQNTGPG  623

Query  310  ADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
            A + +R KWAG    IT+ +A +F  G FI G +W+  S V + A
Sbjct  624  ATLDQRVKWAGFMTNITEDEAAKFTVGTFIQGASWLSESSVTFDA  668



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            +IFG+A + FQ+C +++RKPM     GQSCMVTAQGR+   E TGI + N  I+  P Y+
Sbjct  410  YIFGDAKSFFQNCNMVVRKPM----GGQSCMVTAQGRTDKRETTGIVLHNCRITGDPAYI  465

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+Q +RT+I+ + I+  I P+GW  + G + L+   Y EF N G G+
Sbjct  466  PVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFALDTLEYAEFENKGPGS  525

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + + R KW G+K   T  QA EF  GKF+ G TWIP + VPY
Sbjct  526  NQATRVKWPGIKK-FTPRQAGEFTAGKFLQGGTWIPQTQVPY  566



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+A ++FQ+C +++RKPM     GQSC+VTAQGR+   E TGI + N  I+  P Y+
Sbjct  406  FIFGDAKSLFQNCNIVVRKPM----GGQSCIVTAQGRTDVRESTGIVLHNCRITGEPAYI  461

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +   ++LGRPW+  +RT+++ + ID  I P GW P+ G + L   +Y E+ N+G G+
Sbjct  462  PVKAVNKAYLGRPWKVFSRTIVMMTNIDNVIDPAGWLPWDGDFALNTLYYAEYQNSGPGS  521

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            + ++R  WAG+K  I+  QA +F P +F+ G+ WIP + VPY+
Sbjct  522  NQAQRVNWAGIKN-ISPRQALKFTPARFLRGNLWIPQTHVPYT  563



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 106/163 (65%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR+ P E TG  +    I+   +YL
Sbjct  401  FLFGDAAAVFQNCTLLVRKPLAN----QACPITAHGRTDPRESTGFVLQGCTIAGEADYL  456

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+++++T+I+ + I   I  EGWSP+QG +GL+  +Y E  NTG GA
Sbjct  457  AVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGA  516

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             V+ R  W G+K  +++ +  E+ P K+I GD WIP  GVPY+
Sbjct  517  AVANRVTWPGIKK-LSEEEIVEYTPAKYIQGDDWIPGKGVPYT  558



>dbj|BAK06157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1147

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 75/161 (47%), Positives = 101/161 (63%), Gaps = 5/161 (3%)
 Frame = -2

Query  667   FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
             FIFGN+AAVFQ+C + +RKPM N G+    MVTA GR+ P+ PTGI +    I       
Sbjct  985   FIFGNSAAVFQNCLMTVRKPMDNQGN----MVTAHGRTDPNMPTGIVLQGCKIVPEDALF  1040

Query  487   TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                + I S+LGRPW+++ARTV++ S I   I PEGWS + G  GL+  +Y E+ NTG GA
Sbjct  1041  PVRTTIPSYLGRPWKEYARTVVMESTIGDLIKPEGWSEWMGDLGLKTLYYAEYANTGPGA  1100

Query  307   DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVP  185
               SKR  W G + VI +A+A +F  G FI G +W+  +G P
Sbjct  1101  GTSKRVAWPGYR-VIGQAEATKFTAGVFIDGMSWLKNTGTP  1140



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR  P E TG       I+  P+YL
Sbjct  405  FLFGDAAAVFQNCTLLVRKPLPN----QACPITAHGRKDPREVTGFVFQGCTIAGEPDYL  460

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+I+N+ I   + P+GW P+ G +GL+  +Y E  NTG G+
Sbjct  461  AVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGS  520

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             ++ R  WAG+K  ++     +F P ++I GDTW+P  GVPY+
Sbjct  521  ALANRVTWAGIK-TLSDEDILKFTPAQYIQGDTWVPGKGVPYT  562



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  R+P     SGQ  MVTAQGR+ P++ TGI I    I AT +  
Sbjct  421  FIFGNAAAVFQNCDIHARRP----NSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQ  476

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +  S   ++LGRPW++++RTV++ S I   I P GW  +  ++ L   +YGE+ NTG GA
Sbjct  477  SVTSNFPTYLGRPWKEYSRTVVMQSVISDVIHPAGWHEWSESFALRTLFYGEYQNTGAGA  536

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G K + + ++A  ++PG+FI G +W+ ++G P+S
Sbjct  537  GTSGRVKWEGYKVITSASEAQAYSPGRFIAGGSWLSSTGFPFS  579



>ref|XP_010057972.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNA  VFQ+C L+ RKPM    SGQS MVTAQGR+ P++ TGI+I +  ++A+ + +
Sbjct  388  FIFGNAGVVFQNCNLVARKPM----SGQSNMVTAQGRTDPNQNTGISIQSCNMTASSDLV  443

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 I S+LGRPW++++RTV++ S I   I P GWS + G + L+  +YGE+ N G GA
Sbjct  444  PVKGSIKSYLGRPWKEYSRTVVMQSNIGDHIDPTGWSVWSGDFALKTLYYGEYMNKGPGA  503

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              SKR  W G   + +  +A +F   + I G TW+ +SGV Y+
Sbjct  504  GTSKRVNWPGYHVITSATEAKKFTVAELIQGGTWLKSSGVSYT  546



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            +IFG+A + FQ+C +++RKPM     GQSCMVTAQGR+   E TGI + N  I+  P Y+
Sbjct  423  YIFGDAKSFFQNCNMVVRKPM----GGQSCMVTAQGRTDKRETTGIVLHNCRITGDPAYI  478

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+Q +RT+I+ + I+  I P+GW  + G + L+   Y EF N G G+
Sbjct  479  PVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFALDTLEYAEFENKGPGS  538

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPY  182
            + + R KW G+K   T  QA EF  GKF+ G TWIP + VPY
Sbjct  539  NQATRVKWPGIKK-FTPRQAGEFTAGKFLQGGTWIPQTQVPY  579



>ref|XP_006645812.1| PREDICTED: pectinesterase 2-like [Oryza brachyantha]
Length=406

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+A VFQSC L  R+P+ N    QS   TAQGR  P++ TGI+I    ++A  +  
Sbjct  245  FIFGNSAVVFQSCNLYARRPLPN----QSNAYTAQGREDPNQNTGISIQKCKVAAASDLA  300

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   ++LGRPW+Q++RTV + S++D+ + P GW  + G + L+  +YGE+ NTG GA
Sbjct  301  AVQSSFKTYLGRPWKQYSRTVFMQSQLDSVVNPAGWLEWNGNFALDTLYYGEYQNTGDGA  360

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              + R KW G + + + ++A  F  G FI GD W+  + VP+S
Sbjct  361  STANRVKWKGYRVITSSSEASTFTVGSFIDGDVWLAGTSVPFS  403



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN AAVFQ C +  R+P    GSGQ  MVTAQGR+ P++ TGI I    I AT +  
Sbjct  422  FIFGNGAAVFQDCDIHARRP----GSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLR  477

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTVI+ S I   I P GW  + G + L+  +YGE+ NTG GA
Sbjct  478  PVQKSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWHEWNGNFALDTLFYGEYANTGAGA  537

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G K + +  +A  + PG+FI G +W+ ++G P+S
Sbjct  538  PTSGRVKWKGHKVITSSTEAQAYTPGRFIAGGSWLSSTGFPFS  580



>ref|XP_008436965.1| PREDICTED: pectinesterase 2-like [Cucumis melo]
Length=519

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 105/164 (64%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+C +  RKPM     GQ C+VTAQGR+ P++ TGI+I NS + A  +  
Sbjct  358  FIFGNAAVVLQNCMIYARKPM----QGQQCVVTAQGRTDPNQNTGISIHNSRVMAADDLK  413

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                 + ++LGRPW++++RTV + S +++ + P GW  + G + L   +YGEF N G G+
Sbjct  414  PVIKSVRTYLGRPWKEYSRTVYLQSFMESLVNPAGWLEWSGNFALNTLYYGEFKNYGPGS  473

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              + R KW G + + +  +A +F  G FI G++W+P +GVP++A
Sbjct  474  STANRVKWKGYRVITSANEAAKFTVGNFIAGNSWLPGTGVPFTA  517



>ref|XP_010413524.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=533

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 104/164 (63%), Gaps = 4/164 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+C + +R+PM + G+    M+TAQGR  P   TGI+I +S + A PE+ 
Sbjct  372  FIFGDAAAVFQNCDIFVRRPMDHQGN----MITAQGRDDPHATTGISIQHSRVRAAPEFE  427

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV + + +   I P GW    G++ L   +YGEF NTG GA
Sbjct  428  AVKGRFKNYLGRPWKKYSRTVFLKTDLAGLIDPRGWREGSGSYALSTLYYGEFMNTGAGA  487

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
              ++R  W G   +  + +A  F+  +FI GD+WIP +GVP++A
Sbjct  488  GTTRRVNWPGFHVLRGEEEASPFSVSRFIQGDSWIPITGVPFAA  531



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 105/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR  P E TG  +    I+   +YL
Sbjct  401  FLFGDAAAVFQNCTLLVRKPLAN----QACPITAHGRKDPRESTGFVLQGCTIAGEADYL  456

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW+++++T+I+ + I   I  EGWSP+QG +GL+  +Y E  NTG GA
Sbjct  457  AVKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGA  516

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             V+ R  W G+K  +++ +  E+ P K+I GD WIP  GVPY+
Sbjct  517  AVANRVTWQGIKK-LSEEEIVEYTPAKYIQGDDWIPGKGVPYT  558



>gb|ABK94644.1| unknown [Populus trichocarpa]
Length=327

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAA V Q+CKL+ RKPM    SGQ  MVTAQGR+ P++ TG +I    I A+ +  
Sbjct  166  FIFGNAAVVLQNCKLVPRKPM----SGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLT  221

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               S   SFLGRPW++++RTV++ S I   I P GWS + G + L+  +YGE+ N G GA
Sbjct  222  PVKSSFKSFLGRPWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGA  281

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              SKR  WAG   + +  +A +F   + I G  W+ ++GV Y+
Sbjct  282  GTSKRVNWAGYHVITSANEAKKFTVAELIQGGVWLKSTGVSYT  324



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR  P E TG       I+  P+YL
Sbjct  405  FLFGDAAAVFQNCTLLVRKPLPN----QACPITAHGRKDPRESTGFVFQGCTIAGEPDYL  460

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+I+N+ I   + P+GW P+ G +GL+  +Y E  NTG G+
Sbjct  461  AVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGS  520

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             ++ R  WAG+K  +++    +F P ++I GD WIP  GVPY+
Sbjct  521  ALANRVTWAGIK-TLSEEDILKFTPAQYIQGDDWIPGKGVPYT  562



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 102/161 (63%), Gaps = 4/161 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAV Q C +  R+P    G GQ  MVTAQGR+ P++ TGI I  S I AT +  
Sbjct  432  FIFGNAAAVLQDCDIHARRP----GPGQKNMVTAQGRTDPNQNTGIVIHKSRIGATSDLK  487

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
            +      ++LGRPW++++RTVI+   I   I+P GW  + G + L+  +YGE+ NTG GA
Sbjct  488  SVQKNFPTYLGRPWKEYSRTVIMQCSIADVISPTGWHEWNGNFALDTLFYGEYENTGAGA  547

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVP  185
              S+R KW G K + +  +A ++ P KFI G++W+ ++G P
Sbjct  548  GTSERVKWKGFKVITSATEAQDYTPNKFIAGNSWLSSTGFP  588



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 103/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  RKP     SGQ  MVTAQGR+ P++ TGI I    I AT +  
Sbjct  421  FIFGNAAAVFQNCDIHARKP----NSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQ  476

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV++ S I   I P GW  + G++ L+  +Y E+ NTG GA
Sbjct  477  PVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGA  536

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G K + + ++A  F PG+FI G +W+ ++G P++
Sbjct  537  STSARVKWGGYKVITSASEAQAFTPGRFIAGGSWLSSTGFPFA  579



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 103/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  RKP     SGQ  MVTAQGR+ P++ TGI I    I AT +  
Sbjct  421  FIFGNAAAVFQNCDIHARKP----NSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQ  476

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV++ S I   I P GW  + G++ L+  +Y E+ NTG GA
Sbjct  477  PVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGA  536

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G K + + ++A  F PG+FI G +W+ ++G P++
Sbjct  537  STSARVKWGGYKVITSASEAQAFTPGRFIAGGSWLSSTGFPFA  579



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            F+FG+AAAVFQ+C L++RKP+ N    Q+C +TA GR  P E TG       I+  P+YL
Sbjct  405  FLFGDAAAVFQNCTLLVRKPLPN----QACPITAHGRKDPRESTGFVFQGCTIAGEPDYL  460

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RT+I+N+ I   + P+GW P+ G +GL+  +Y E  NTG G+
Sbjct  461  AVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGS  520

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
             ++ R  WAG+K  +++    +F P ++I GD WIP  GVPY+
Sbjct  521  ALANRVTWAGIK-TLSEEDILKFTPAQYIQGDDWIPGKGVPYT  562



>ref|XP_002515774.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF46613.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=571

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 103/163 (63%), Gaps = 5/163 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+AAVFQSC L  RKP+ N    Q    TAQGR+ P++ TGI+I N  I A P+  
Sbjct  407  FIFGNSAAVFQSCNLYARKPLPN----QKNAFTAQGRTDPNQNTGISIHNCTIEAAPDLA  462

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
               +  ++FLGRPW+Q++RTV + S I   I+P GW  + GT GL+  +YGEF N G GA
Sbjct  463  MDLNSTLNFLGRPWKQYSRTVFMQSYIGDLISPVGWLEWNGTVGLDTLYYGEFENYGPGA  522

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
            + S R +W G   ++  +QA  F    F +GDTW+P + +P+S
Sbjct  523  NTSMRVQWPGY-NLMNVSQAANFTVYNFTMGDTWLPETDIPFS  564



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 103/163 (63%), Gaps = 4/163 (2%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGNAAAVFQ+C +  RKP     SGQ  MVTAQGR+ P++ TGI I    I AT +  
Sbjct  421  FIFGNAAAVFQNCDIHARKP----NSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQ  476

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV++ S I   I P GW  + G++ L+  +Y E+ NTG GA
Sbjct  477  PVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGA  536

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYS  179
              S R KW G K + + ++A  F PG+FI G +W+ ++G P++
Sbjct  537  STSARVKWGGYKVITSASEAQAFTPGRFIAGGSWLSSTGFPFA  579



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 106/164 (65%), Gaps = 5/164 (3%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFG+AAAVFQ+CK+++RKP+ N    Q+C+VTAQGR++  E TG  + N  I+A PEY 
Sbjct  406  FIFGDAAAVFQNCKIVVRKPLEN----QNCVVTAQGRNESREATGFVLQNCNITADPEYY  461

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                   ++LGRPW++++RTV +  +ID  I P+GW P+ G++ L+   Y E+ N G G+
Sbjct  462  PVRFENKAYLGRPWKEYSRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGS  521

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
                R  W G+K  ++   A  F   KFI GD WIPA+GV Y++
Sbjct  522  VTKDRVTWKGIKK-LSAQDAAAFTVAKFIGGDLWIPATGVSYAS  564



>ref|XP_006411580.1| hypothetical protein EUTSA_v10016522mg [Eutrema salsugineum]
 gb|ESQ53033.1| hypothetical protein EUTSA_v10016522mg [Eutrema salsugineum]
Length=520

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 104/164 (63%), Gaps = 13/164 (8%)
 Frame = -2

Query  667  FIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTAQGRSQPDEPTGIAILNSVISATPEYL  488
            FIFGN+A VFQSC ++ RKP+     GQ   VTAQGR   D+ TGI+I N  I+A     
Sbjct  366  FIFGNSAVVFQSCNIVARKPL----PGQRNFVTAQGRRHRDQNTGISIQNCKITAQS---  418

Query  487  TAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGA  308
                  ++FLGRPW++++RTV++ S +D  I P GWSP+ G++GL   +YGEF N+G G+
Sbjct  419  ------MTFLGRPWKEYSRTVVMQSFLDGSIHPSGWSPWSGSFGLNTLFYGEFENSGPGS  472

Query  307  DVSKRAKWAGVKGVITKAQADEFAPGKFILGDTWIPASGVPYSA  176
             VS R KW+G    +T  +A+ F    FI G  W+P++GV + +
Sbjct  473  SVSGRVKWSGYHSSLTVKEAERFTVAGFIDGAMWLPSTGVSFDS  516



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 984917279386