BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23787_g3_i1 len=2061 path=[303:0-1279 1583:1280-1305
7543:1306-2060]

Length=2061
                                                                      Score     E

ref|XP_009786393.1|  PREDICTED: laccase-4-like                          998   0.0     
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          996   0.0     
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          994   0.0     
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          989   0.0     
gb|AAC49536.1|  diphenol oxidase                                        986   0.0     Nicotiana tabacum [American tobacco]
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             974   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          969   0.0     
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             967   0.0     
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          965   0.0     
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                962   0.0     
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          961   0.0     
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    958   0.0     
emb|CDP06511.1|  unnamed protein product                                956   0.0     
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          954   0.0     
ref|XP_004246339.1|  PREDICTED: laccase-4                               953   0.0     
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          952   0.0     
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          952   0.0     
ref|XP_006363052.1|  PREDICTED: laccase-4-like                          949   0.0     
ref|XP_004249583.1|  PREDICTED: laccase-4-like                          946   0.0     
ref|XP_002322962.2|  laccase family protein                             943   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006338994.1|  PREDICTED: laccase-4-like                          941   0.0     
gb|KHG18161.1|  Laccase-4 -like protein                                 941   0.0     
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          939   0.0     
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          938   0.0     
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          936   0.0     
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          936   0.0     
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          936   0.0     
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    935   0.0     
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          935   0.0     
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          935   0.0     
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    934   0.0     
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             934   0.0     
ref|XP_002308209.2|  laccase family protein                             933   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002308208.2|  laccase family protein                             932   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          932   0.0     
ref|XP_010101806.1|  hypothetical protein L484_023595                   926   0.0     
ref|XP_002533894.1|  laccase, putative                                  922   0.0     Ricinus communis
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     921   0.0     
ref|XP_002278638.1|  PREDICTED: laccase-4                               919   0.0     Vitis vinifera
ref|XP_002520425.1|  laccase, putative                                  917   0.0     Ricinus communis
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          916   0.0     
gb|EYU26646.1|  hypothetical protein MIMGU_mgv1a003805mg                916   0.0     
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          916   0.0     
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          915   0.0     
ref|XP_011035200.1|  PREDICTED: laccase-4                               914   0.0     
ref|XP_008239590.1|  PREDICTED: laccase-4-like                          914   0.0     
ref|XP_007205010.1|  hypothetical protein PRUPE_ppa003646mg             912   0.0     
ref|XP_004302643.1|  PREDICTED: laccase-4-like                          911   0.0     
ref|XP_009358852.1|  PREDICTED: laccase-4-like                          911   0.0     
ref|XP_008377498.1|  PREDICTED: laccase-4-like                          911   0.0     
ref|XP_008388134.1|  PREDICTED: laccase-4-like                          909   0.0     
gb|KDP46534.1|  hypothetical protein JCGZ_08506                         909   0.0     
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             907   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_003544873.2|  PREDICTED: laccase-4-like                          907   0.0     
ref|XP_003522150.1|  PREDICTED: laccase-4-like                          906   0.0     
ref|XP_003516941.1|  PREDICTED: laccase-4-like                          906   0.0     
ref|XP_003518300.1|  PREDICTED: laccase-4-like                          905   0.0     
ref|XP_009370205.1|  PREDICTED: laccase-4                               904   0.0     
gb|KHN06247.1|  Laccase-4                                               903   0.0     
ref|XP_010104683.1|  hypothetical protein L484_022066                   903   0.0     
ref|XP_003551299.1|  PREDICTED: laccase-4-like                          902   0.0     
ref|XP_010553253.1|  PREDICTED: laccase-4                               901   0.0     
ref|XP_008785423.1|  PREDICTED: laccase-22                              901   0.0     
ref|XP_004500229.1|  PREDICTED: laccase-4-like                          899   0.0     
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                    897   0.0     
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein            897   0.0     
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2               896   0.0     
ref|XP_003604619.1|  Laccase 1a                                         896   0.0     
emb|CDX74915.1|  BnaA05g06610D                                          896   0.0     
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             895   0.0     Populus trichocarpa [western balsam poplar]
emb|CDX91428.1|  BnaC04g07220D                                          894   0.0     
ref|XP_010104682.1|  hypothetical protein L484_022065                   894   0.0     
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             894   0.0     
ref|XP_007142229.1|  hypothetical protein PHAVU_008G263100g             893   0.0     
ref|XP_008355354.1|  PREDICTED: laccase-4                               892   0.0     
ref|XP_002280416.1|  PREDICTED: laccase-4                               892   0.0     Vitis vinifera
ref|XP_010256659.1|  PREDICTED: laccase-4                               892   0.0     
ref|XP_010923124.1|  PREDICTED: laccase-22                              892   0.0     
ref|XP_004490574.1|  PREDICTED: laccase-4-like                          892   0.0     
ref|XP_009143427.1|  PREDICTED: laccase-4                               890   0.0     
ref|NP_565881.1|  laccase-4                                             890   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220423.1|  PREDICTED: laccase-4                               890   0.0     
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             889   0.0     
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg             888   0.0     
ref|XP_010517091.1|  PREDICTED: laccase-4-like                          888   0.0     
ref|XP_010505418.1|  PREDICTED: laccase-4                               888   0.0     
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          887   0.0     
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             886   0.0     
ref|XP_009337309.1|  PREDICTED: laccase-4-like                          885   0.0     
ref|XP_009374280.1|  PREDICTED: laccase-4-like                          885   0.0     
ref|XP_002879726.1|  IRX12/LAC4                                         885   0.0     
ref|XP_007140382.1|  hypothetical protein PHAVU_008G107100g             885   0.0     
emb|CDX93330.1|  BnaC04g45660D                                          884   0.0     
ref|XP_003539958.2|  PREDICTED: laccase-4-like                          884   0.0     
ref|XP_009346884.1|  PREDICTED: laccase-4-like                          883   0.0     
emb|CDY18406.1|  BnaA04g21810D                                          883   0.0     
gb|KDO53232.1|  hypothetical protein CISIN_1g0093922mg                  883   0.0     
gb|KEH34185.1|  laccase/diphenol oxidase family protein                 882   0.0     
ref|XP_010509229.1|  PREDICTED: laccase-4-like                          881   0.0     
ref|XP_009141718.1|  PREDICTED: laccase-4-like                          880   0.0     
gb|AES98533.2|  laccase/diphenol oxidase family protein                 880   0.0     
ref|XP_004294236.1|  PREDICTED: laccase-4-like                          878   0.0     
ref|XP_007146741.1|  hypothetical protein PHAVU_006G065800g             873   0.0     
ref|XP_008358974.1|  PREDICTED: laccase-4-like                          872   0.0     
gb|KHN04832.1|  Laccase-4                                               870   0.0     
ref|XP_008775059.1|  PREDICTED: laccase-22-like                         867   0.0     
ref|XP_006602641.1|  PREDICTED: laccase-4-like isoform X1               866   0.0     
ref|XP_003615575.1|  Laccase 1a                                         863   0.0     
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          860   0.0     
ref|XP_010907627.1|  PREDICTED: laccase-22-like                         860   0.0     
ref|XP_008457399.1|  PREDICTED: laccase-4                               857   0.0     
ref|XP_011032153.1|  PREDICTED: laccase-4-like isoform X1               857   0.0     
ref|XP_007134763.1|  hypothetical protein PHAVU_010G0738000g            857   0.0     
ref|XP_009590412.1|  PREDICTED: laccase-4-like                          856   0.0     
ref|XP_002265173.1|  PREDICTED: laccase-4-like                          855   0.0     Vitis vinifera
gb|KDO37344.1|  hypothetical protein CISIN_1g009854mg                   853   0.0     
gb|KGN65788.1|  hypothetical protein Csa_1G528530                       853   0.0     
ref|XP_004506788.1|  PREDICTED: laccase-4-like                          853   0.0     
ref|XP_010685615.1|  PREDICTED: laccase-4                               850   0.0     
emb|CBI31539.3|  unnamed protein product                                848   0.0     
ref|XP_010543228.1|  PREDICTED: laccase-10                              847   0.0     
ref|XP_007220829.1|  hypothetical protein PRUPE_ppa027203mg             845   0.0     
emb|CDP14064.1|  unnamed protein product                                845   0.0     
gb|EPS60103.1|  laccase 1a                                              844   0.0     
ref|XP_010676357.1|  PREDICTED: laccase-4-like                          841   0.0     
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         839   0.0     
ref|XP_007009094.1|  Laccase/Diphenol oxidase family protein            838   0.0     
ref|XP_011084946.1|  PREDICTED: laccase-4-like                          837   0.0     
ref|XP_008233715.1|  PREDICTED: laccase-4-like                          835   0.0     
ref|XP_007026782.1|  Laccase/Diphenol oxidase family protein isof...    832   0.0     
ref|XP_010535416.1|  PREDICTED: laccase-16                              833   0.0     
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...    833   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EPS65618.1|  hypothetical protein M569_09159                         831   0.0     
ref|XP_006398646.1|  hypothetical protein EUTSA_v10015593mg             829   0.0     
ref|NP_195739.2|  laccase 10                                            828   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435668.1|  hypothetical protein CICLE_v10031134mg             828   0.0     
gb|KDO69098.1|  hypothetical protein CISIN_1g008799mg                   828   0.0     
ref|XP_009384856.1|  PREDICTED: laccase-22-like                         828   0.0     
ref|XP_009125430.1|  PREDICTED: laccase-10                              827   0.0     
ref|XP_009350996.1|  PREDICTED: laccase-4-like                          827   0.0     
ref|XP_010033027.1|  PREDICTED: laccase-4-like                          824   0.0     
emb|CDY48114.1|  BnaC02g03710D                                          823   0.0     
ref|XP_002873023.1|  predicted protein                                  823   0.0     
ref|XP_008392913.1|  PREDICTED: laccase-4-like                          822   0.0     
ref|XP_006287399.1|  hypothetical protein CARUB_v10000605mg             822   0.0     
ref|XP_004980096.1|  PREDICTED: laccase-22-like                         822   0.0     
emb|CDY55905.1|  BnaAnng13970D                                          821   0.0     
ref|XP_006840270.1|  hypothetical protein AMTR_s00045p00045490          820   0.0     
gb|KHG11130.1|  Laccase-4 -like protein                                 818   0.0     
gb|KDP24484.1|  hypothetical protein JCGZ_25048                         817   0.0     
ref|XP_010452014.1|  PREDICTED: laccase-10 isoform X1                   818   0.0     
gb|EYU41257.1|  hypothetical protein MIMGU_mgv1a003880mg                817   0.0     
emb|CAB69847.1|  laccase-like protein                                   817   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423919.1|  PREDICTED: laccase-10-like                         817   0.0     
ref|XP_010067496.1|  PREDICTED: laccase-4-like                          816   0.0     
ref|XP_010490598.1|  PREDICTED: laccase-10-like isoform X1              815   0.0     
ref|XP_003558760.1|  PREDICTED: laccase-22                              814   0.0     
gb|KHG28836.1|  Laccase-22                                              815   0.0     
ref|XP_009789473.1|  PREDICTED: laccase-4-like isoform X1               813   0.0     
gb|EPS61127.1|  laccase 3                                               812   0.0     
ref|XP_011080855.1|  PREDICTED: laccase-4                               812   0.0     
gb|KFK44563.1|  hypothetical protein AALP_AA1G273400                    810   0.0     
ref|XP_006663136.1|  PREDICTED: laccase-22-like                         810   0.0     
ref|XP_009120399.1|  PREDICTED: laccase-16                              809   0.0     
ref|XP_002316233.1|  hypothetical protein POPTR_0010s20050g             808   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006602642.1|  PREDICTED: laccase-4-like isoform X2               803   0.0     
ref|XP_002311202.1|  laccase family protein                             805   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011036009.1|  PREDICTED: laccase-4-like                          804   0.0     
dbj|BAJ98144.1|  predicted protein                                      803   0.0     
ref|XP_009589148.1|  PREDICTED: laccase-4-like                          802   0.0     
ref|XP_011039810.1|  PREDICTED: laccase-4-like                          802   0.0     
ref|XP_004150626.1|  PREDICTED: laccase-4-like                          800   0.0     
gb|EMT26873.1|  Laccase-22                                              802   0.0     
emb|CDX80325.1|  BnaC09g34170D                                          800   0.0     
ref|XP_009416212.1|  PREDICTED: laccase-22-like                         799   0.0     
gb|KHN24301.1|  Laccase-4                                               797   0.0     
ref|XP_003544123.1|  PREDICTED: laccase-4-like                          798   0.0     
gb|KCW52562.1|  hypothetical protein EUGRSUZ_J01941                     796   0.0     
ref|XP_004490949.1|  PREDICTED: laccase-4-like                          795   0.0     
ref|XP_006350822.1|  PREDICTED: laccase-4-like                          795   0.0     
gb|KHN20872.1|  Laccase-4                                               791   0.0     
emb|CAA74103.1|  laccase                                                790   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007141799.1|  hypothetical protein PHAVU_008G226700g             790   0.0     
emb|CAC14719.1|  laccase                                                788   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004241179.1|  PREDICTED: laccase-4-like                          788   0.0     
ref|XP_004308920.1|  PREDICTED: laccase-22-like                         784   0.0     
ref|XP_003616564.1|  Laccase                                            786   0.0     
ref|XP_009789474.1|  PREDICTED: laccase-4-like isoform X2               779   0.0     
ref|XP_010454388.1|  PREDICTED: laccase-16                              780   0.0     
ref|XP_010483503.1|  PREDICTED: laccase-16-like isoform X3              779   0.0     
ref|XP_002530417.1|  laccase, putative                                  777   0.0     Ricinus communis
ref|XP_010098906.1|  hypothetical protein L484_006544                   776   0.0     
gb|KHG17519.1|  Laccase-4 -like protein                                 774   0.0     
ref|XP_008441433.1|  PREDICTED: laccase-4-like                          776   0.0     
ref|XP_010483501.1|  PREDICTED: laccase-16-like isoform X1              775   0.0     
sp|Q1PDH6.2|LAC16_ARATH  RecName: Full=Laccase-16; AltName: Full=...    774   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443638.1|  PREDICTED: laccase-16-like                         773   0.0     
gb|KHG22893.1|  Laccase-4 -like protein                                 763   0.0     
ref|XP_006282033.1|  hypothetical protein CARUB_v10028274mg             763   0.0     
gb|AES99522.2|  laccase/diphenol oxidase family protein                 761   0.0     
ref|XP_010690098.1|  PREDICTED: laccase-4-like                          761   0.0     
gb|KGN45770.1|  hypothetical protein Csa_6G009490                       759   0.0     
gb|ACN39933.1|  unknown                                                 759   0.0     Picea sitchensis
gb|ABE66261.1|  laccase/diphenol oxidase                                758   0.0     
gb|ABK28766.1|  unknown                                                 758   0.0     
emb|CDP09155.1|  unnamed protein product                                765   0.0     
gb|EMS48198.1|  Laccase-22                                              757   0.0     
ref|XP_010543748.1|  PREDICTED: laccase-22-like                         755   0.0     
ref|XP_004138572.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     747   0.0     
ref|XP_002866298.1|  hypothetical protein ARALYDRAFT_496014             743   0.0     
gb|KFK27419.1|  hypothetical protein AALP_AA8G380300                    741   0.0     
ref|XP_010924287.1|  PREDICTED: laccase-11-like                         739   0.0     
gb|AAK37829.1|AF132125_1  laccase                                       739   0.0     Pinus taeda
gb|AAK37830.1|AF132126_1  laccase                                       739   0.0     Pinus taeda
ref|NP_200699.1|  laccase 16                                            736   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146739.1|  PREDICTED: laccase-22-like                         733   0.0     
ref|XP_006401026.1|  hypothetical protein EUTSA_v10013285mg             728   0.0     
gb|KDP41783.1|  hypothetical protein JCGZ_26801                         739   0.0     
ref|XP_010486777.1|  PREDICTED: laccase-22-like isoform X1              726   0.0     
ref|XP_010494695.1|  PREDICTED: laccase-22-like                         726   0.0     
emb|CDY01010.1|  BnaC05g41900D                                          725   0.0     
ref|XP_010486778.1|  PREDICTED: laccase-22-like isoform X2              724   0.0     
ref|XP_010464832.1|  PREDICTED: laccase-22-like                         723   0.0     
dbj|BAN10308.1|  laccase                                                723   0.0     
ref|XP_006300062.1|  hypothetical protein CARUB_v10016290mg             722   0.0     
ref|XP_003632636.1|  PREDICTED: laccase-11                              721   0.0     
ref|XP_009392410.1|  PREDICTED: laccase-11                              716   0.0     
gb|KHG01609.1|  Laccase-11 -like protein                                715   0.0     
ref|XP_009378520.1|  PREDICTED: laccase-11-like                         714   0.0     
ref|XP_008357173.1|  PREDICTED: laccase-11-like                         713   0.0     
emb|CDO97037.1|  unnamed protein product                                713   0.0     
ref|XP_004143251.1|  PREDICTED: laccase-11-like                         712   0.0     
ref|XP_002313847.2|  hypothetical protein POPTR_0009s10550g             711   0.0     Populus trichocarpa [western balsam poplar]
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   711   0.0     
ref|XP_010926015.1|  PREDICTED: laccase-11-like                         721   0.0     
ref|XP_002512915.1|  laccase, putative                                  710   0.0     Ricinus communis
ref|XP_008449246.1|  PREDICTED: laccase-11                              711   0.0     
ref|XP_009590676.1|  PREDICTED: laccase-11-like                         710   0.0     
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg             709   0.0     
ref|XP_011000403.1|  PREDICTED: laccase-11-like                         708   0.0     
ref|XP_009764219.1|  PREDICTED: laccase-11-like                         708   0.0     
ref|XP_008236999.1|  PREDICTED: laccase-11-like                         707   0.0     
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             707   0.0     
ref|XP_007046899.1|  Laccase 11                                         706   0.0     
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg             706   0.0     
ref|XP_004233973.1|  PREDICTED: laccase-11                              706   0.0     
ref|XP_004146556.1|  PREDICTED: laccase-11-like                         705   0.0     
ref|XP_002519529.1|  laccase, putative                                  704   0.0     Ricinus communis
ref|XP_011099634.1|  PREDICTED: laccase-11-like                         704   0.0     
ref|XP_008800741.1|  PREDICTED: laccase-11-like                         719   0.0     
ref|XP_004160985.1|  PREDICTED: laccase-11-like                         704   0.0     
gb|KHN36103.1|  Laccase-11                                              703   0.0     
ref|XP_009593898.1|  PREDICTED: laccase-11-like                         703   0.0     
ref|XP_002275392.1|  PREDICTED: laccase-11                              702   0.0     Vitis vinifera
ref|XP_007156958.1|  hypothetical protein PHAVU_002G031600g             702   0.0     
gb|AAC49538.1|  diphenol oxidase                                        696   0.0     Nicotiana tabacum [American tobacco]
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         702   0.0     
ref|XP_004292037.1|  PREDICTED: laccase-11-like                         702   0.0     
ref|XP_009793780.1|  PREDICTED: laccase-11-like                         702   0.0     
ref|XP_006340638.1|  PREDICTED: laccase-11-like                         701   0.0     
ref|XP_004292029.1|  PREDICTED: laccase-11-like                         701   0.0     
ref|XP_007042164.1|  Laccase 11                                         711   0.0     
ref|XP_004232420.1|  PREDICTED: laccase-11                              700   0.0     
ref|XP_009593896.1|  PREDICTED: laccase-11-like                         700   0.0     
ref|XP_009772835.1|  PREDICTED: laccase-11-like                         699   0.0     
sp|Q8RYM9.1|LAC2_ORYSJ  RecName: Full=Laccase-2; AltName: Full=Be...    699   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_011088411.1|  PREDICTED: laccase-11-like                         699   0.0     
ref|XP_006347000.1|  PREDICTED: laccase-11-like                         698   0.0     
ref|XP_010024157.1|  PREDICTED: laccase-11                              698   0.0     
gb|EAZ12812.1|  hypothetical protein OsJ_02731                          698   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004300985.1|  PREDICTED: laccase-11-like                         698   0.0     
ref|XP_004969263.1|  PREDICTED: laccase-2-like                          698   0.0     
ref|XP_004289138.1|  PREDICTED: laccase-11-like                         697   0.0     
emb|CDY62896.1|  BnaAnng18410D                                          696   0.0     
ref|XP_009125488.1|  PREDICTED: laccase-11                              696   0.0     
ref|XP_003612035.1|  Laccase-11                                         696   0.0     
ref|XP_009340732.1|  PREDICTED: laccase-11-like                         695   0.0     
ref|XP_010107530.1|  hypothetical protein L484_024383                   695   0.0     
ref|XP_009342664.1|  PREDICTED: laccase-11-like                         695   0.0     
ref|XP_006878556.1|  hypothetical protein AMTR_s00011p00235480          694   0.0     
ref|XP_007205004.1|  hypothetical protein PRUPE_ppa003572mg             694   0.0     
ref|XP_008352457.1|  PREDICTED: laccase-11-like                         694   0.0     
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   694   0.0     
ref|XP_002873085.1|  hypothetical protein ARALYDRAFT_487097             694   0.0     
ref|XP_002305436.1|  hypothetical protein POPTR_0004s16370g             692   0.0     
ref|XP_010263632.1|  PREDICTED: laccase-11-like                         705   0.0     
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   694   0.0     
gb|AES94995.2|  laccase/diphenol oxidase family protein                 693   0.0     
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         694   0.0     
ref|XP_002310245.1|  hypothetical protein POPTR_0007s13050g             693   0.0     
ref|XP_004232419.1|  PREDICTED: laccase-11-like                         692   0.0     
emb|CDY44351.1|  BnaC02g03260D                                          692   0.0     
ref|XP_010452196.1|  PREDICTED: laccase-11                              692   0.0     
gb|EYU42613.1|  hypothetical protein MIMGU_mgv1a003791mg                692   0.0     
ref|XP_006340637.1|  PREDICTED: laccase-11-like                         692   0.0     
ref|XP_008385897.1|  PREDICTED: laccase-11-like                         693   0.0     
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         692   0.0     
ref|XP_006466813.1|  PREDICTED: laccase-11-like                         692   0.0     
emb|CDX70319.1|  BnaA10g26680D                                          692   0.0     
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              692   0.0     
ref|XP_010490794.1|  PREDICTED: laccase-11-like                         692   0.0     
ref|XP_006287320.1|  hypothetical protein CARUB_v10000520mg             692   0.0     
ref|XP_006425656.1|  hypothetical protein CICLE_v10025287mg             691   0.0     
ref|NP_195946.2|  laccase 11                                            691   0.0     
emb|CAB86093.1|  laccase precursor-like                                 690   0.0     
emb|CDY10394.1|  BnaCnng02950D                                          691   0.0     
ref|XP_004512055.1|  PREDICTED: laccase-11-like                         690   0.0     
gb|KHN41966.1|  Laccase-11                                              689   0.0     
ref|XP_003516567.1|  PREDICTED: laccase-11-like                         689   0.0     
ref|XP_011025818.1|  PREDICTED: laccase-11-like                         689   0.0     
ref|XP_006398771.1|  hypothetical protein EUTSA_v10013135mg             689   0.0     
ref|XP_008338318.1|  PREDICTED: laccase-11-like                         689   0.0     
ref|XP_002266464.1|  PREDICTED: laccase-11                              689   0.0     
ref|XP_010423743.1|  PREDICTED: laccase-11-like                         689   0.0     
ref|XP_007204198.1|  hypothetical protein PRUPE_ppa003577mg             689   0.0     
ref|XP_003538856.1|  PREDICTED: laccase-11-like                         689   0.0     
emb|CBI17500.3|  unnamed protein product                                688   0.0     
ref|XP_009122722.1|  PREDICTED: laccase-11-like                         689   0.0     
ref|XP_008241697.1|  PREDICTED: laccase-11-like                         688   0.0     
gb|EYU40190.1|  hypothetical protein MIMGU_mgv1a003793mg                688   0.0     
ref|XP_010254791.1|  PREDICTED: laccase-11-like                         699   0.0     
ref|XP_010679744.1|  PREDICTED: laccase-11                              687   0.0     
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              687   0.0     
ref|XP_009371609.1|  PREDICTED: laccase-11-like                         686   0.0     
emb|CAA74101.1|  laccase                                                680   0.0     
gb|KHN14004.1|  Laccase-17                                              686   0.0     
ref|XP_003612037.1|  Laccase-11                                         686   0.0     
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         686   0.0     
ref|XP_002531562.1|  laccase, putative                                  686   0.0     
ref|XP_010543401.1|  PREDICTED: laccase-11-like                         684   0.0     
gb|KFK24777.1|  hypothetical protein AALP_AA8G023500                    684   0.0     
emb|CDP02005.1|  unnamed protein product                                683   0.0     
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             683   0.0     
ref|XP_008338086.1|  PREDICTED: laccase-11-like                         682   0.0     
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          682   0.0     
ref|XP_010558158.1|  PREDICTED: laccase-11                              679   0.0     
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          679   0.0     
ref|XP_010107320.1|  hypothetical protein L484_009454                   679   0.0     
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         678   0.0     
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         677   0.0     
ref|XP_004972357.1|  PREDICTED: laccase-2-like                          677   0.0     
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             676   0.0     
emb|CBI30529.3|  unnamed protein product                                676   0.0     
ref|XP_007156959.1|  hypothetical protein PHAVU_002G031700g             676   0.0     
gb|AAK37827.1|AF132123_1  laccase                                       677   0.0     
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         676   0.0     
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             676   0.0     
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         676   0.0     
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         676   0.0     
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              675   0.0     
ref|XP_007016607.1|  Laccase 17                                         675   0.0     
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         674   0.0     
ref|XP_002531824.1|  laccase, putative                                  674   0.0     
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          674   0.0     
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             674   0.0     
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         673   0.0     
gb|KHF97742.1|  Laccase-17 -like protein                                672   0.0     
ref|XP_006846061.1|  hypothetical protein AMTR_s00012p00061860          671   0.0     
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         672   0.0     
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270          671   0.0     
ref|XP_006424707.1|  hypothetical protein CICLE_v10028090mg             671   0.0     
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          671   0.0     
gb|KDO73032.1|  hypothetical protein CISIN_1g008109mg                   670   0.0     
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         670   0.0     
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          670   0.0     
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         670   0.0     
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             670   0.0     
emb|CAC14718.1|  laccase                                                662   0.0     
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 670   0.0     
ref|XP_006846265.1|  hypothetical protein AMTR_s00012p00245710          669   0.0     
ref|XP_008222577.1|  PREDICTED: laccase-17-like                         669   0.0     
ref|XP_008359106.1|  PREDICTED: laccase-17-like                         669   0.0     
ref|XP_007026974.1|  Laccase 17                                         668   0.0     
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   668   0.0     
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         667   0.0     
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             667   0.0     
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg             667   0.0     
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g             665   0.0     
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         665   0.0     
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         665   0.0     
ref|XP_008778578.1|  PREDICTED: laccase-10-like                         665   0.0     
ref|XP_002520232.1|  laccase, putative                                  665   0.0     
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g             665   0.0     
ref|XP_006846275.1|  hypothetical protein AMTR_s00012p00248430          665   0.0     
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   664   0.0     
ref|XP_009354529.1|  PREDICTED: laccase-17-like                         664   0.0     
gb|AAK37828.1|AF132124_1  laccase                                       664   0.0     
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             664   0.0     
gb|AAK37825.1|AF132121_1  laccase                                       663   0.0     
ref|XP_002278215.1|  PREDICTED: laccase-17                              664   0.0     
ref|XP_011077639.1|  PREDICTED: laccase-17-like                         663   0.0     
ref|XP_007026973.1|  Laccase 17                                         663   0.0     
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          663   0.0     
ref|XP_011002147.1|  PREDICTED: laccase-17-like                         663   0.0     
emb|CBI16199.3|  unnamed protein product                                662   0.0     
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      663   0.0     
ref|XP_003532290.1|  PREDICTED: laccase-17-like isoform X1              663   0.0     
ref|XP_002284473.1|  PREDICTED: laccase-17                              662   0.0     
ref|XP_004294638.1|  PREDICTED: laccase-17-like                         662   0.0     
ref|XP_004294637.1|  PREDICTED: laccase-17-like                         662   0.0     
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                662   0.0     
gb|EEC71780.1|  hypothetical protein OsI_04394                          662   0.0     
ref|XP_010256874.1|  PREDICTED: laccase-17-like                         662   0.0     
ref|XP_002299296.1|  laccase family protein                             662   0.0     
ref|XP_007026975.1|  Laccase 17                                         661   0.0     
ref|XP_010043648.1|  PREDICTED: laccase-17-like                         660   0.0     
ref|XP_011094888.1|  PREDICTED: laccase-17-like                         660   0.0     
ref|XP_008811561.1|  PREDICTED: laccase-11-like                         659   0.0     
gb|ACN34362.1|  unknown                                                 660   0.0     
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    660   0.0     
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         660   0.0     
ref|NP_001147942.1|  L-ascorbate oxidase precursor                      659   0.0     
ref|XP_008358049.1|  PREDICTED: laccase-17-like                         659   0.0     
ref|XP_004148786.1|  PREDICTED: laccase-17-like                         659   0.0     
ref|XP_008385213.1|  PREDICTED: laccase-17-like                         659   0.0     
ref|XP_009358279.1|  PREDICTED: laccase-17-like                         659   0.0     
ref|XP_002278232.1|  PREDICTED: laccase-17-like                         659   0.0     
gb|KDP35658.1|  hypothetical protein JCGZ_09096                         659   0.0     
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         658   0.0     
ref|XP_010683867.1|  PREDICTED: laccase-17-like                         657   0.0     
ref|NP_001044773.1|  Os01g0842500                                       658   0.0     
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             659   0.0     
ref|XP_010031544.1|  PREDICTED: laccase-17-like                         657   0.0     
ref|XP_007016584.1|  Laccase 17                                         657   0.0     
emb|CAN71338.1|  hypothetical protein VITISV_008643                     656   0.0     
ref|XP_008223967.1|  PREDICTED: laccase-17                              656   0.0     
ref|XP_010922297.1|  PREDICTED: laccase-17-like                         657   0.0     
ref|XP_007022468.1|  Laccase 17                                         656   0.0     
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                655   0.0     
ref|XP_008785574.1|  PREDICTED: laccase-17-like                         655   0.0     
ref|XP_010535559.1|  PREDICTED: laccase-17                              655   0.0     
emb|CAN60069.1|  hypothetical protein VITISV_012401                     655   0.0     
ref|XP_008778964.1|  PREDICTED: laccase-17-like                         655   0.0     
emb|CBI30528.3|  unnamed protein product                                694   0.0     
gb|EEC71777.1|  hypothetical protein OsI_04389                          654   0.0     
ref|NP_001044772.1|  Os01g0842400                                       654   0.0     
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          654   0.0     
gb|EAZ14115.1|  hypothetical protein OsJ_04039                          654   0.0     
ref|XP_006370270.1|  hypothetical protein POPTR_0001s41160g             654   0.0     
ref|XP_011094887.1|  PREDICTED: laccase-17-like                         654   0.0     
gb|AAK37823.1|  laccase                                                 654   0.0     
emb|CDM84967.1|  unnamed protein product                                652   0.0     
ref|XP_010264408.1|  PREDICTED: laccase-17-like                         653   0.0     
ref|XP_003564593.1|  PREDICTED: laccase-12/13-like                      652   0.0     
ref|XP_010920538.1|  PREDICTED: laccase-4-like                          652   0.0     
ref|XP_004492322.1|  PREDICTED: laccase-17-like                         652   0.0     
ref|XP_002520231.1|  laccase, putative                                  652   0.0     
gb|KHN07178.1|  Laccase-17                                              650   0.0     
gb|ABW81073.1|  unknown                                                 650   0.0     
ref|XP_002282823.1|  PREDICTED: laccase-17                              651   0.0     
gb|AES79165.2|  laccase/diphenol oxidase family protein                 651   0.0     
ref|XP_004970542.1|  PREDICTED: laccase-4-like                          651   0.0     
ref|XP_010541373.1|  PREDICTED: laccase-17                              653   0.0     
ref|XP_009416147.1|  PREDICTED: laccase-4-like                          650   0.0     
ref|XP_004492318.1|  PREDICTED: laccase-17-like                         649   0.0     
ref|NP_001055747.1|  Os05g0458600                                       649   0.0     
ref|XP_003632204.1|  PREDICTED: laccase-17                              649   0.0     
gb|KEH22816.1|  laccase/diphenol oxidase family protein                 649   0.0     
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         647   0.0     
ref|XP_010092993.1|  hypothetical protein L484_007174                   648   0.0     
ref|XP_004961859.1|  PREDICTED: laccase-12/13-like                      648   0.0     
gb|AAC04576.1|  putative high-pI laccase                                646   0.0     
ref|XP_008797558.1|  PREDICTED: laccase-11-like                         658   0.0     
emb|CDY09232.1|  BnaA02g06580D                                          647   0.0     
gb|EMT20803.1|  Laccase-4                                               647   0.0     
ref|XP_010264410.1|  PREDICTED: laccase-17-like                         647   0.0     
ref|XP_002439916.1|  hypothetical protein SORBIDRAFT_09g022510          647   0.0     
ref|XP_010690924.1|  PREDICTED: laccase-17-like                         647   0.0     
gb|KHN16226.1|  Laccase-17                                              647   0.0     
emb|CDP06596.1|  unnamed protein product                                647   0.0     
emb|CAN71891.1|  hypothetical protein VITISV_040864                     645   0.0     
emb|CDM80721.1|  unnamed protein product                                646   0.0     
ref|XP_006654510.1|  PREDICTED: laccase-12/13-like                      646   0.0     
gb|KHN36104.1|  Laccase-11                                              645   0.0     
emb|CBI31651.3|  unnamed protein product                                664   0.0     
ref|XP_002271047.2|  PREDICTED: laccase-17                              647   0.0     
ref|XP_010047833.1|  PREDICTED: laccase-17-like                         645   0.0     
emb|CBI30527.3|  unnamed protein product                                646   0.0     
gb|KHN41965.1|  Laccase-11                                              642   0.0     
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          645   0.0     
dbj|BAJ84890.1|  predicted protein                                      645   0.0     
ref|NP_001105875.1|  putative laccase precursor                         645   0.0     
ref|XP_006341009.1|  PREDICTED: laccase-17-like                         645   0.0     
dbj|BAJ99773.1|  predicted protein                                      645   0.0     
ref|XP_002282815.1|  PREDICTED: laccase-17                              645   0.0     
ref|XP_006602563.1|  PREDICTED: laccase-17-like                         645   0.0     
ref|XP_010245131.1|  PREDICTED: laccase-17-like                         645   0.0     
ref|XP_010106521.1|  hypothetical protein L484_025281                   644   0.0     
ref|XP_009774063.1|  PREDICTED: laccase-17-like                         644   0.0     
emb|CDY31581.1|  BnaA10g12900D                                          644   0.0     
ref|XP_008665185.1|  PREDICTED: laccase-4-like                          644   0.0     
ref|XP_006480875.1|  PREDICTED: laccase-17-like isoform X2              642   0.0     
ref|XP_003532315.1|  PREDICTED: laccase-17-like                         644   0.0     
ref|XP_003622947.1|  Laccase                                            643   0.0     
ref|XP_007208016.1|  hypothetical protein PRUPE_ppa003296mg             644   0.0     
ref|XP_009419259.1|  PREDICTED: laccase-4-like                          644   0.0     
ref|XP_003623041.1|  Laccase                                            644   0.0     
gb|AAB17194.1|  laccase                                                 644   0.0     
emb|CAN60348.1|  hypothetical protein VITISV_005802                     642   0.0     
ref|XP_002458746.1|  hypothetical protein SORBIDRAFT_03g039520          643   0.0     



>ref|XP_009786393.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=556

 Score =   998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/544 (87%), Positives = 508/544 (93%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW RI +L AC +FPA VECR+R Y F+V++KN TR+CS+KP VTVNGKFPGPT+YARED
Sbjct  3     SWVRIFILFAC-LFPAFVECRIRRYNFNVMVKNTTRLCSTKPIVTVNGKFPGPTVYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVLIRVVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  62    DTVLIRVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQSYLYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLRSTVHGA+VILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVIN+A+KSGL
Sbjct  122   FWHAHILWLRSTVHGAIVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINQAIKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGP++NC +QGGY LSV+ GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  182   APNVSDAHTINGHPGPLSNCPSQGGYTLSVDPGKSYMLRVINAALNEELFFKIAGHKMTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATY+KPFKTDTIVIAPGQTTNVIVTA+QGSG+YMV ASPFMDAP+AVDN TATATL
Sbjct  242   VEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVVASPFMDAPIAVDNATATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLAS  TTLT  PP NATPVAN+FVDSLRSLNSK++PA VP+ VDHSL FT GLGI
Sbjct  302   HYSGTLASSVTTLTNTPPKNATPVANNFVDSLRSLNSKKYPAKVPKNVDHSLFFTVGLGI  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCK GNGSRVVAS+NNVTFVMPTTALLQAHFFGIKGV+TTDFP NPP  FNYTG  
Sbjct  362   NPCPSCKQGNGSRVVASINNVTFVMPTTALLQAHFFGIKGVYTTDFPQNPPIKFNYTGKP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL TT+GTK++RL YN+TVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD
Sbjct  422   PVNLATTSGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PK FNLVDPVERNTIG+PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG
Sbjct  482   PKNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PNES
Sbjct  542   PNES  545



>ref|XP_009799024.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=557

 Score =   996 bits (2576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/544 (85%), Positives = 513/544 (94%), Gaps = 0/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R+ ++LA C+FP +VECR+RHYKF+VVMKN TR+CSSKP VTVNGKFPGPTIYARE+
Sbjct  3     SWVRLFIVLAACLFPLVVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTIYAREE  62

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++VVN+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQRGTL
Sbjct  63    DTVLVKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTL  122

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+TVHGA+VILPKLGVPYPFPKP+HEAVV+LAEWWKSDTEAVINEA+KSGL
Sbjct  123   FWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVLLAEWWKSDTEAVINEAIKSGL  182

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV+NC +QGGY+L+V+ GK Y+LRVINAALNEELFFKIAGHKMTV
Sbjct  183   APNVSDAHTINGHPGPVSNCPSQGGYKLNVDPGKTYLLRVINAALNEELFFKIAGHKMTV  242

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTNVIVTA+QGSG+YMVAASPFMDAP+AVDN TA ATL
Sbjct  243   VEVDATYVKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTAIATL  302

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GT  +   +LT+ PP NATPVAN+F+DSLRSLNSK++PANVP+ +DHSL FT GLGI
Sbjct  303   HYSGTQGNNRISLTSTPPKNATPVANTFLDSLRSLNSKKYPANVPKKIDHSLFFTVGLGI  362

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCK GNGSRVVAS+NNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG G
Sbjct  363   NPCPSCKQGNGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGTG  422

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             PANL TT GTK++RL YN TVQLVLQDTGIIAPENHPIHLHGFNF+ VGKG+GNFNPKTD
Sbjct  423   PANLATTNGTKVYRLRYNDTVQLVLQDTGIIAPENHPIHLHGFNFYLVGKGIGNFNPKTD  482

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PK FNLVDPVERNT+G+PAGGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMA+LVDNGKG
Sbjct  483   PKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAWLVDNGKG  542

Query  376   PNES  365
             PNES
Sbjct  543   PNES  546



>ref|XP_009593041.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/544 (86%), Positives = 507/544 (93%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW RI +L AC +FPA VECR+R Y F+V++KN +R+CS+KP VTVNGKFPGPT+YARED
Sbjct  3     SWVRIFILFAC-LFPAFVECRIRRYNFNVMVKNTSRLCSTKPIVTVNGKFPGPTVYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVLIRVVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  62    DTVLIRVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQSYLYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLRSTVHGA+VILPKLGVPYPFPKPDHEAVV+LAEWWKSDTEAVIN+A+KSGL
Sbjct  122   FWHAHILWLRSTVHGAIVILPKLGVPYPFPKPDHEAVVILAEWWKSDTEAVINQAIKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGP++NC +QGGY+LSV+ GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  182   APNVSDAHTINGHPGPLSNCPSQGGYKLSVDPGKSYMLRVINAALNEELFFKIAGHKMTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTNVIV A+QGSG+YMV ASPFMDAP+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTDTIVIAPGQTTNVIVAANQGSGKYMVVASPFMDAPIAVDNATATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLAS  TTLT  PP NATPVAN+FVDSLRSLNSK++PA VP+ VDHSL FT GLGI
Sbjct  302   HYSGTLASSVTTLTNTPPKNATPVANNFVDSLRSLNSKKYPAKVPKNVDHSLFFTVGLGI  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCK GNGSRVVAS+NNVTFVMPTTALLQAHFFGIKGV+TTDFP NPPF FNYTG  
Sbjct  362   NPCPSCKQGNGSRVVASINNVTFVMPTTALLQAHFFGIKGVYTTDFPQNPPFKFNYTGTP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             PANL T +GTK++RL YN+TVQLVLQDTGII+PENHPIHLHGFNFFAVGKGLGNFN K D
Sbjct  422   PANLSTMSGTKVYRLPYNATVQLVLQDTGIISPENHPIHLHGFNFFAVGKGLGNFNSKID  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PK FNLVDPVERNTIG+PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG
Sbjct  482   PKNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PNES
Sbjct  542   PNES  545



>ref|XP_009624727.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/544 (84%), Positives = 509/544 (94%), Gaps = 0/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R+ ++LA C+FP +VECR+RHYKF+VV+KN TR+CSSKP VTVNGKFPGPTIYARE 
Sbjct  3     SWIRLFIVLAACLFPLVVECRIRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTIYAREG  62

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++VVN+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQRGTL
Sbjct  63    DTVLVKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTL  122

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+TVHGA+VILPKLGVPYPFPKP+HEAVV+LAEWWKSDTEAVINEA+KSGL
Sbjct  123   FWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGL  182

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV+NC++QGGY+L+V+ GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  183   APNVSDAHTINGHPGPVSNCASQGGYKLNVDPGKTYMLRVINAALNEELFFKIAGHKMTV  242

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATY+KPFKTDTIVIAPGQTTNVIVTA+QGSG+YMVAASPFMDAP+AVDN TA ATL
Sbjct  243   VEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTAIATL  302

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GT  +   +LT+ PP NATPVAN+F+DSLRSLNSK++PA VP+ +DHSL FT GLGI
Sbjct  303   HYSGTQGNSHISLTSTPPKNATPVANTFLDSLRSLNSKKYPAKVPKKIDHSLFFTVGLGI  362

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+CK GNGSRVVAS+NNVTFVMPT ALLQAHFFGIKGVFTTDFPANPPFAFNYTG G
Sbjct  363   NPCPTCKQGNGSRVVASVNNVTFVMPTVALLQAHFFGIKGVFTTDFPANPPFAFNYTGTG  422

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL T  GTK++RL YN TVQLVLQDTGIIAPENHPIHLHGFNFF VGKG+GNFNPKTD
Sbjct  423   PTNLATMNGTKVYRLRYNDTVQLVLQDTGIIAPENHPIHLHGFNFFLVGKGIGNFNPKTD  482

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PK FNLVDPVERNT+G+PAGGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMA+LVDNGKG
Sbjct  483   PKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAWLVDNGKG  542

Query  376   PNES  365
             PNES
Sbjct  543   PNES  546



>gb|AAC49536.1| diphenol oxidase [Nicotiana tabacum]
Length=557

 Score =   986 bits (2550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/544 (84%), Positives = 507/544 (93%), Gaps = 0/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R+ ++LA C+FP +VECR+RHYKF+VVMKN TR+CSSKP VTVNGKFPGPTIYARE 
Sbjct  3     SWIRLFIVLAACLFPLVVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTIYAREG  62

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++VVN+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQRGTL
Sbjct  63    DTVLVKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTL  122

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+TVHGA+VILP LGVPYPFPKP+HEAVV+LAEWWKSDTEAVINEA+KSGL
Sbjct  123   FWHAHILWLRATVHGAIVILPNLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGL  182

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV+NC++QGGY+L+V+ GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  183   APNVSDAHTINGHPGPVSNCASQGGYKLNVDPGKTYMLRVINAALNEELFFKIAGHKMTV  242

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATY+KPFKTDTIVIAPGQTTNVIVTA+QGSG+YMVAASPFMDAP+AVDN TA ATL
Sbjct  243   VEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTAIATL  302

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GT  +   +LT+ PP NATPVAN+F+DSLRSLNSK++PA VP+ +DHSL FT GLGI
Sbjct  303   HYSGTQGNSHISLTSTPPKNATPVANTFLDSLRSLNSKKYPAKVPKKIDHSLFFTVGLGI  362

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+CK GNGSRVVAS+NNVTFVMPT ALLQAHFFG KGVFTTDFPANPPFAFNYTG G
Sbjct  363   NPCPTCKQGNGSRVVASVNNVTFVMPTVALLQAHFFGTKGVFTTDFPANPPFAFNYTGTG  422

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL T  GTK++RL YN TVQLVLQDTGIIAPENHPIHLHGFNFF VGKG+GNFNPKTD
Sbjct  423   PTNLATMNGTKVYRLRYNDTVQLVLQDTGIIAPENHPIHLHGFNFFLVGKGIGNFNPKTD  482

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PK FNLVDPVERNT+G+PAGGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMA+LVDNGKG
Sbjct  483   PKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAWLVDNGKG  542

Query  376   PNES  365
             PNES
Sbjct  543   PNES  546



>ref|XP_002322961.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
 gb|EEF04722.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
Length=557

 Score =   974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/547 (84%), Positives = 503/547 (92%), Gaps = 1/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME SWFR + LLA C+FPA+VECR+RHYKF+VVMKN TR+CSSKP VTVNG FPGPT+YA
Sbjct  1     MEYSWFRFM-LLAVCLFPAVVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGLFPGPTLYA  59

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL++VVN VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQR
Sbjct  60    REDDTVLVKVVNRVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQR  119

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHILWLR+TVHGALV+LPKLGVPYPFP P  E VVVLAEWWKSDTEAVINEALK
Sbjct  120   GTLLWHAHILWLRATVHGALVVLPKLGVPYPFPAPHKEVVVVLAEWWKSDTEAVINEALK  179

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTINGHPG V+ CS+QGG+ L V++GK YMLR+INAALNEELFFKIAGHK
Sbjct  180   SGLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVQSGKTYMLRLINAALNEELFFKIAGHK  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDATYVKPFKTDT++IAPGQTTNV+VT ++ +G+Y+VAASPFMDAP+AVDN TAT
Sbjct  240   LTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTAT  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHY+G L++ PTTLT  PP NAT +AN F +SLRSLNSK FPA VP TVDHSL FT G
Sbjct  300   ATLHYSGALSNSPTTLTIPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVG  359

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCP+CKAGNGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFPA PP  FNYT
Sbjct  360   LGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYT  419

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  P NLQTT+GTK +RL YNSTVQLV+QDTGII+PENHPIHLHGFNFFAVG+G+GN+NP
Sbjct  420   GTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNP  479

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             KTDPKKFNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN
Sbjct  480   KTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  539

Query  385   GKGPNES  365
             GKGPNES
Sbjct  540   GKGPNES  546



>ref|XP_011094977.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=558

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/545 (84%), Positives = 505/545 (93%), Gaps = 3/545 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             W R+ +L+AC + PA+V+C+VRHY+F+VVMKN TR+CS+K  VTVNGKFPGPTIYAREDD
Sbjct  4     WVRVFILVAC-LLPAVVQCKVRHYQFNVVMKNTTRLCSTKSIVTVNGKFPGPTIYAREDD  62

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TVLIRV+N VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PGHSY+YNFTITGQRGTLL
Sbjct  63    TVLIRVINRVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGHSYVYNFTITGQRGTLL  122

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+T+HGALVILPKLGVPYPFPKPDHEAVVVL EWWKSDTEAVINEALKSGLA
Sbjct  123   WHAHILWLRATLHGALVILPKLGVPYPFPKPDHEAVVVLGEWWKSDTEAVINEALKSGLA  182

Query  1453  PNVSDAHTINGHPGPVANC-STQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             PNVSDAHTINGHPGPV+NC ST GG+ L+V  GK YMLR+INAALNEELFFKIAGHK+TV
Sbjct  183   PNVSDAHTINGHPGPVSNCPSTGGGFTLNVSPGKTYMLRLINAALNEELFFKIAGHKLTV  242

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTATAT  1100
             VEVDATYVKPFKTDT++IAPGQTTNVIV ADQG+G+YM+AASPF+D P VAVDN TATAT
Sbjct  243   VEVDATYVKPFKTDTVLIAPGQTTNVIVVADQGAGKYMLAASPFLDTPIVAVDNMTATAT  302

Query  1099  LHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
             LHY+GTLAS PTT T+ P  NATPVAN+FV+SLRSLNSK++PA VPQ VDHSL FT GLG
Sbjct  303   LHYSGTLASSPTTFTSTPARNATPVANNFVNSLRSLNSKKYPAKVPQKVDHSLFFTVGLG  362

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
             INPCPSCKAGNGSR VAS+NNVTFVMPT ALLQAH   IKGVFTTDFPANPPFAFNYTG 
Sbjct  363   INPCPSCKAGNGSRAVASINNVTFVMPTIALLQAHVLKIKGVFTTDFPANPPFAFNYTGT  422

Query  739   GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKT  560
              PANL TTTGTK+++L YNSTVQ+VLQDTGIIAPENHP+HLHGFNFFAVG+GLGNFNPKT
Sbjct  423   PPANLATTTGTKVYKLPYNSTVQVVLQDTGIIAPENHPVHLHGFNFFAVGRGLGNFNPKT  482

Query  559   DPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  380
             DPK FNL+DPVERNTIG+P+GGWVAIRF ADNPGVWFMHCHLEVHTTWGLKMAFLV+NG 
Sbjct  483   DPKNFNLIDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVENGN  542

Query  379   GPNES  365
             GPNES
Sbjct  543   GPNES  547



>ref|XP_006429309.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
 ref|XP_006480970.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR42549.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
Length=555

 Score =   967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/544 (83%), Positives = 506/544 (93%), Gaps = 2/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R+++L+AC +FPA+VECRVRHYKF+VVMKN T++CSSKP VTVNGKFPGPT+YARE 
Sbjct  3     SWVRLLLLVAC-LFPALVECRVRHYKFNVVMKNSTKLCSSKPIVTVNGKFPGPTLYAREH  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++VVN+VKYNV+IHWHG+RQLRTGWADGPAYITQCPI+ GHSY+YNFTITGQRGTL
Sbjct  62    DTVLVKVVNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQSGHSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+TVHGA+VILPK GVPYPFPKP  E VVVLAEWWKSDTEAVIN+AL+SGL
Sbjct  122   LWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVVVVLAEWWKSDTEAVINQALRSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSD+HTING PGP+++CS+QGG+ L V++GK YMLR+INAALNEELFFKIAGHK+TV
Sbjct  182   APNVSDSHTINGQPGPISSCSSQGGFTLPVDSGKTYMLRIINAALNEELFFKIAGHKLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTNV+++AD+ SG+Y+VAASPFMDAP+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTDTIVIAPGQTTNVLLSADKTSGKYLVAASPFMDAPIAVDNATATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLAS  TTLT+ PP N T +AN F+DSLRSLNSK++PA VPQTVDH+LLFT GLG+
Sbjct  302   HYSGTLASSATTLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKVPQTVDHNLLFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCKAGNGSRVVAS+NNVTFVMPT ALLQAHFF I GVFTTDFP NPP  +N+TG  
Sbjct  362   NPCPSCKAGNGSRVVASINNVTFVMPTIALLQAHFFNISGVFTTDFPGNPPHTYNFTGT-  420

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NLQT+ GTK +RLAYNSTVQL+LQDTGIIAPENHP+HLHGFNFFAVGKGLGNFNPK D
Sbjct  421   PKNLQTSNGTKAYRLAYNSTVQLILQDTGIIAPENHPVHLHGFNFFAVGKGLGNFNPKKD  480

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PKKFNLVDPVERNTIG+P+GGWVAIRF ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG
Sbjct  481   PKKFNLVDPVERNTIGVPSGGWVAIRFSADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  540

Query  376   PNES  365
             PNES
Sbjct  541   PNES  544



>ref|XP_009787551.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=554

 Score =   965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/544 (85%), Positives = 497/544 (91%), Gaps = 3/544 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R  VLLAC + PA      RHYKF+VVM+NM+R+CS+KP VTVNG+FPGPTIYARED
Sbjct  3     SWLRFFVLLAC-LSPAF--GITRHYKFNVVMRNMSRLCSTKPIVTVNGRFPGPTIYARED  59

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  60    DRVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYIYNFTITGQRGTL  119

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAH+LWLRSTVHGA+V+LPK GVPYPFPKP+HEAVVVLAEWWKSDTEAVINEALKSGL
Sbjct  120   FWHAHVLWLRSTVHGAIVVLPKRGVPYPFPKPNHEAVVVLAEWWKSDTEAVINEALKSGL  179

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV+NC TQGGY LSV+ GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  180   APNVSDAHTINGHPGPVSNCPTQGGYTLSVKPGKTYMLRVINAALNEELFFKIAGHKMTV  239

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQ  G+YMVAASPFMDAP+AVDN TATATL
Sbjct  240   VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQSFGKYMVAASPFMDAPIAVDNITATATL  299

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+G L S PTTLT+ PP NAT VAN+F+D+L+SLNSK++PA VPQTVDHSL FT GLGI
Sbjct  300   HYSGALGSSPTTLTSTPPQNATSVANNFLDALKSLNSKKYPAKVPQTVDHSLFFTVGLGI  359

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+CK  NGSRVVAS+NNVTF+MPT ALLQAHFFGI GVFTTDFPANPPF FNYTG  
Sbjct  360   NPCPTCKQANGSRVVASVNNVTFIMPTVALLQAHFFGINGVFTTDFPANPPFVFNYTGTS  419

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL TT GTK++RL YN+TVQLVLQDTGIIAPENHPIHLHGFNFF VGKGLGNFN KTD
Sbjct  420   PTNLATTKGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFNFFLVGKGLGNFNSKTD  479

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PK FNL+DPVERNTIG+P+GGWVAIR+RADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG
Sbjct  480   PKNFNLIDPVERNTIGVPSGGWVAIRWRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  539

Query  376   PNES  365
              NES
Sbjct  540   SNES  543



>gb|EYU41858.1| hypothetical protein MIMGU_mgv1a003895mg [Erythranthe guttata]
Length=557

 Score =   962 bits (2487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/540 (84%), Positives = 498/540 (92%), Gaps = 1/540 (0%)
 Frame = -3

Query  1981  VVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLI  1802
             V++LA C+ P  VEC VR Y+F+VVMKN TRVCS+K  VTVNGKFPGPTIYAREDDTVLI
Sbjct  7     VLILAACLLPCFVECEVRRYQFNVVMKNTTRVCSTKSIVTVNGKFPGPTIYAREDDTVLI  66

Query  1801  RVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAH  1622
             RV+N VKYNVSIHWHG+RQLRTGW+DGPAYITQCPI+PGHSY+YNFTITGQRGTL WHAH
Sbjct  67    RVINRVKYNVSIHWHGVRQLRTGWSDGPAYITQCPIQPGHSYVYNFTITGQRGTLFWHAH  126

Query  1621  ILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVS  1442
             ILWLRSTVHGALVILPKLGVPYPFPKPDHE+VVVL EWWKSDTEAVINEALKSGLAPNVS
Sbjct  127   ILWLRSTVHGALVILPKLGVPYPFPKPDHESVVVLGEWWKSDTEAVINEALKSGLAPNVS  186

Query  1441  DAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDA  1262
             DAHTINGHPGP++NC + GG+ L+V  GK YMLR+INAALNEELFFKIAGHK+TVVEVDA
Sbjct  187   DAHTINGHPGPISNCPSTGGFSLNVSPGKNYMLRLINAALNEELFFKIAGHKLTVVEVDA  246

Query  1261  TYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTATATLHYTG  1085
             TYVKPFKTDTI+IAPGQTTNVIVTADQG+G+YMVAASPFMD P VAVDN+TATAT+HY+G
Sbjct  247   TYVKPFKTDTILIAPGQTTNVIVTADQGAGKYMVAASPFMDTPVVAVDNKTATATIHYSG  306

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
             TLA+ PT+ T  PP NATPVAN+FV+SLRSLNSK++PA VP  +DHSLLFT GLGIN CP
Sbjct  307   TLANSPTSFTATPPQNATPVANNFVNSLRSLNSKKYPAKVPMKIDHSLLFTVGLGINRCP  366

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANL  725
             SCKAGNGSRVVAS+NNVTFVMPT ALLQAH   IKGVFT+DFP NPP AFNYTGA PANL
Sbjct  367   SCKAGNGSRVVASVNNVTFVMPTVALLQAHVQNIKGVFTSDFPGNPPHAFNYTGAPPANL  426

Query  724   QTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKF  545
              TTTGTK++RL YN+TVQ+VLQDTGIIAPENHP+HLHGFNFFAVG+GLGN+NPKTDP  F
Sbjct  427   STTTGTKVYRLPYNATVQVVLQDTGIIAPENHPVHLHGFNFFAVGRGLGNYNPKTDPNNF  486

Query  544   NLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             NLVDPVERNTIG+P+GGWVAIRF ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN+S
Sbjct  487   NLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQS  546



>ref|XP_011003662.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=557

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/547 (83%), Positives = 499/547 (91%), Gaps = 1/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME SWFR + LLA C+FPA+VECR+RHYKF+VVMKN TR+CSSKP VTVNG FPGPT+YA
Sbjct  1     MEYSWFRFM-LLAVCLFPALVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGLFPGPTLYA  59

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL++VVN VKYN+SIHWHGIRQLRTGWADGPA ITQCPI+ G SY+YNFTITGQR
Sbjct  60    REDDTVLVKVVNRVKYNLSIHWHGIRQLRTGWADGPANITQCPIQTGQSYVYNFTITGQR  119

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHILWLR+TVHGA+V+LPKLGVPYPFP P  E VVVLAEWWKSDTEAVINEALK
Sbjct  120   GTLLWHAHILWLRATVHGAIVVLPKLGVPYPFPAPHKEVVVVLAEWWKSDTEAVINEALK  179

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTINGHPG V+ CS+QGG+ L V++GK YMLR+INAALNEELFFKIAGHK
Sbjct  180   SGLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVQSGKTYMLRLINAALNEELFFKIAGHK  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +T+VEVDATYVKPFKT T++IAPGQTTNV+VT ++ +G+Y+VAASPFMDAP+AVDN TAT
Sbjct  240   LTLVEVDATYVKPFKTSTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTAT  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHY+G L++ PTTLT  PP NAT +AN F +SLRSLNSK FPA VP TVDHSL FT G
Sbjct  300   ATLHYSGALSNSPTTLTVPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVG  359

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCP+CKAGNGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFPA PP  FNYT
Sbjct  360   LGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYT  419

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  P NLQTT+GTK +RL YNSTVQLV+QDTGII+PENHPIHLHGFNFFAVG G+GN+NP
Sbjct  420   GTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGGGVGNYNP  479

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             KTDPKKFNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN
Sbjct  480   KTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  539

Query  385   GKGPNES  365
             GKGPNES
Sbjct  540   GKGPNES  546



>ref|XP_007026781.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY07283.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
Length=556

 Score =   958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/544 (83%), Positives = 504/544 (93%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R +VL+AC +FP +V+C VR+YKFDVV+KN TR+CSSKP VTVNGKFPGPT+YARE 
Sbjct  3     SWVRGLVLVAC-LFPVLVDCTVRNYKFDVVLKNKTRLCSSKPIVTVNGKFPGPTLYAREG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++VVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI  G SY+YNFTITGQRGTL
Sbjct  62    DTVLVKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLRSTVHGA+VILPK GVPYPFPKP  E VV+LAEWWKSDTEAVINEALKSGL
Sbjct  122   LWHAHILWLRSTVHGAIVILPKRGVPYPFPKPHKEVVVILAEWWKSDTEAVINEALKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGH GPV++C +QGG+ L VE GK Y+LR+INAALNEELFFKIAGHK+TV
Sbjct  182   APNVSDAHTINGHTGPVSSCPSQGGFTLPVENGKTYLLRLINAALNEELFFKIAGHKLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKT T++IAPGQTTNV+V+AD+ SG+Y+VAASPFMDAP+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTKTVIIAPGQTTNVLVSADKSSGKYLVAASPFMDAPIAVDNLTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLA+ PTTLT+ PP NATPVAN+F++SLR+LNSKQ+PA VPQ++DH+L FT GLGI
Sbjct  302   HYSGTLANTPTTLTSLPPKNATPVANNFINSLRALNSKQYPALVPQSIDHNLFFTVGLGI  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+CKAGNGSR VAS+NNVTFVMPTTALLQAHFF I GVFTTDFPANPP  FNY+G  
Sbjct  362   NPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHFFNISGVFTTDFPANPPNVFNYSGTP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NLQTT GTK+FRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVG+GLGN+NPKTD
Sbjct  422   PTNLQTTNGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPKTD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P+ FNLVDPVERNTIG+P+GGWVAIRFRADNPGVWF+HCHLEVHTTWGLKMAFLVDNGKG
Sbjct  482   PQNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFLHCHLEVHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PN+S
Sbjct  542   PNQS  545



>emb|CDP06511.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/547 (83%), Positives = 498/547 (91%), Gaps = 2/547 (0%)
 Frame = -3

Query  2002  ECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAR  1823
               SW +I++L A  +FPA+V CRVRHYKFDVV+KN TR+CSSKP VTVNGKFPGPT+YAR
Sbjct  5     SSSWVQILIL-ALFLFPALVHCRVRHYKFDVVLKNFTRLCSSKPIVTVNGKFPGPTLYAR  63

Query  1822  EDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRG  1643
             EDDTVL+RVVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRG
Sbjct  64    EDDTVLVRVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRG  123

Query  1642  TLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKS  1463
             TLLWHAHILWLR+TVHGA+VILPK GV YPFPKP HE VVVL EWWKSDTEAVINEALKS
Sbjct  124   TLLWHAHILWLRATVHGAVVILPKRGVLYPFPKPHHENVVVLGEWWKSDTEAVINEALKS  183

Query  1462  GLAPNVSDAHTINGHPGPVANCST-QGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             G+APNVSDAHTINGHPG VANCS+ QGG+ LSVE GK Y+LRVINAALNEELFFKIAGH 
Sbjct  184   GMAPNVSDAHTINGHPGAVANCSSDQGGFTLSVEPGKSYLLRVINAALNEELFFKIAGHT  243

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDATYVKPFKTDTI++APGQTTNVIVTADQ +G+YMV+AS FMD+ +AVDN +AT
Sbjct  244   LTVVEVDATYVKPFKTDTILVAPGQTTNVIVTADQSAGKYMVSASTFMDSTIAVDNTSAT  303

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHY+GTL+S PTT TTAP +NATPVAN F +SLRSLNS+++PA VPQTVDHSL F   
Sbjct  304   ATLHYSGTLSSSPTTFTTAPALNATPVANKFTNSLRSLNSEKYPAQVPQTVDHSLFFVVS  363

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCP+CKA NGSRVVAS+NNVTFVMPT ALLQAHFF I GVFTTDFP NPP  FNYT
Sbjct  364   LGINPCPTCKAANGSRVVASVNNVTFVMPTVALLQAHFFNINGVFTTDFPGNPPSPFNYT  423

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  PANLQT  GTK++RL YN+TVQ+VLQDTGI+APENHPIHLHGFNFFAVG+GLGNF+P
Sbjct  424   GTPPANLQTKNGTKVYRLPYNATVQVVLQDTGIVAPENHPIHLHGFNFFAVGRGLGNFDP  483

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             KTDPKKFNLVDPVERNTIG+P GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN
Sbjct  484   KTDPKKFNLVDPVERNTIGVPTGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  543

Query  385   GKGPNES  365
             GKG NES
Sbjct  544   GKGTNES  550



>ref|XP_011077581.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=557

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/544 (83%), Positives = 496/544 (91%), Gaps = 2/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R+++LL C +FP +V+CRVRHYKF+VVMKN TR+CS+K  VTVNGKFPGPTIYARED
Sbjct  3     SWVRVLILLGC-LFPVLVQCRVRHYKFNVVMKNTTRLCSTKSIVTVNGKFPGPTIYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  62    DTVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+T+HGALVILPKLGVPYPFPKP+HE V++L EWWKSDTEAVINEALKSGL
Sbjct  122   LWHAHILWLRATLHGALVILPKLGVPYPFPKPNHERVIILGEWWKSDTEAVINEALKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV NCS+  G+ L VE GK Y+LR+INAALNEELFFKIAGH+MT+
Sbjct  182   APNVSDAHTINGHPGPVPNCSSTDGFILDVEPGKTYLLRLINAALNEELFFKIAGHRMTI  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTATAT  1100
             VEVDATYVKPFKTDTIVIAPGQTTN I+T D+  G+YMVAASPFMD P VAVDN TATAT
Sbjct  242   VEVDATYVKPFKTDTIVIAPGQTTNAILTTDRAVGKYMVAASPFMDTPVVAVDNLTATAT  301

Query  1099  LHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
             LHY+GTL+S  TT T  P  NATPVAN+F +SLRSLNS ++PA VPQ VDHSL FT GLG
Sbjct  302   LHYSGTLSSSLTTFTRPPAQNATPVANNFTNSLRSLNSNKYPAKVPQKVDHSLFFTVGLG  361

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
             INPCP+CKA NGSRVVA++NNVTFVMPT ALLQAHFF IKGVFTTDFP NPPFAFNYTG+
Sbjct  362   INPCPTCKATNGSRVVAAVNNVTFVMPTIALLQAHFFNIKGVFTTDFPGNPPFAFNYTGS  421

Query  739   GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKT  560
              PANL TT GTKL+RL YN+TVQ+VLQDTGIIAPENHPIHLHGFNFF VG+GLGNFNPKT
Sbjct  422   PPANLGTTNGTKLYRLPYNATVQVVLQDTGIIAPENHPIHLHGFNFFVVGRGLGNFNPKT  481

Query  559   DPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  380
             DPK FNLVDPVERNTIG+P+GGWVAIRF ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK
Sbjct  482   DPKTFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  541

Query  379   GPNE  368
             GPNE
Sbjct  542   GPNE  545



>ref|XP_004246339.1| PREDICTED: laccase-4 [Solanum lycopersicum]
Length=561

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/548 (82%), Positives = 499/548 (91%), Gaps = 4/548 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW    +LLA C+FP +VECRVRHYKF+VVMKN TR+CSSK  VTVNGKFPGPTIYARE 
Sbjct  3     SWICHFILLAFCLFPLVVECRVRHYKFNVVMKNTTRLCSSKSIVTVNGKFPGPTIYAREG  62

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQRGTL
Sbjct  63    DNVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTL  122

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+TVHGA+VILPKLGVPYPFPKP+HEAVV+LAEWWKSDTEAVINEA+KSGL
Sbjct  123   FWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGL  182

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV+NC  QGGY+L+VE GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  183   APNVSDAHTINGHPGPVSNCPAQGGYKLNVEQGKTYMLRVINAALNEELFFKIAGHKMTV  242

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATY+KPF+TDTIVIAPGQTTNVIV A++ SG+YMV ASPFMDAP+AVDN TA ATL
Sbjct  243   VEVDATYIKPFQTDTIVIAPGQTTNVIVNANKNSGKYMVVASPFMDAPIAVDNVTAIATL  302

Query  1096  HYTGTLASGPTTLTTA---PPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             HY+GTL++ P+T  T+   PP NATP+AN+F+D+LRSLNSK++PA VP  +DHSLLFT G
Sbjct  303   HYSGTLSNNPSTTLTSTNTPPKNATPIANNFLDALRSLNSKKYPAKVPIKIDHSLLFTVG  362

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCPSCK GNGSRVVAS+NNVTFVMPT ALLQAHF GIKGVFT DFP NPP  +NYT
Sbjct  363   LGINPCPSCKQGNGSRVVASINNVTFVMPTIALLQAHFSGIKGVFTADFPGNPPVVYNYT  422

Query  745   GAG-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
                 PAN+ TT+GTK+++L+YN TVQLVLQDTGIIAPENHPIHLHGFNF+ VGKGLGN+N
Sbjct  423   STTPPANMGTTSGTKVYKLSYNDTVQLVLQDTGIIAPENHPIHLHGFNFYQVGKGLGNYN  482

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PK DPK FNLVDPVERNT+G+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+
Sbjct  483   PKVDPKNFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVE  542

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  543   NGKGPNES  550



>ref|XP_006349470.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=556

 Score =   952 bits (2462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/544 (83%), Positives = 499/544 (92%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW RI+ L AC +FPA VECR+R Y F+V+MK  TR+CSSKP  TVNGKFPGPTIYARE 
Sbjct  3     SWLRILFLFAC-LFPAFVECRIRRYNFNVMMKTTTRLCSSKPIATVNGKFPGPTIYAREG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VL+ VVN+VKYNVSIHWHG+RQLRTGW+DGPAYITQCPI+PG +Y+YNFTITGQRGTL
Sbjct  62    DNVLVNVVNHVKYNVSIHWHGVRQLRTGWSDGPAYITQCPIQPGQNYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+T+HGA+VILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVIN+A+KSGL
Sbjct  122   FWHAHILWLRATMHGAIVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINQAIKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPG ++NC +QGGY LSV+ GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  182   APNVSDAHTINGHPGAISNCPSQGGYTLSVDPGKSYMLRVINAALNEELFFKIAGHKMTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTI+IAPGQTTNVIVTA++GSG+YMVAASPFMDAP+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTDTIIIAPGQTTNVIVTANKGSGKYMVAASPFMDAPIAVDNVTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLAS  TTLT  PP NATPVAN+F+DSLRSLNSK++PA VP+ VDHSL FT GLG+
Sbjct  302   HYSGTLASSITTLTNTPPKNATPVANNFIDSLRSLNSKKYPAKVPKKVDHSLFFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPC SCK GNGSRVVAS+NNVTFVMPT A+LQAHFFGIKGV+TTDFP NPPF FNYTG  
Sbjct  362   NPCSSCKQGNGSRVVASINNVTFVMPTVAILQAHFFGIKGVYTTDFPQNPPFKFNYTGTP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL T +GTK++ L YN+TVQLVLQDTGII+PENHPIHLHGFNFFAVGKG+GNFNPKTD
Sbjct  422   PTNLATMSGTKVYLLPYNATVQLVLQDTGIISPENHPIHLHGFNFFAVGKGIGNFNPKTD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P  FNL+DPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNGKG
Sbjct  482   PNNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PNES
Sbjct  542   PNES  545



>ref|XP_004249084.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=556

 Score =   952 bits (2461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/544 (83%), Positives = 498/544 (92%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW RI+ L AC +FPA VECR+R Y F+V+MK  TR+CSSKP  TVNGKFPGPTIYARE 
Sbjct  3     SWLRILFLFAC-LFPAFVECRIRRYNFNVMMKTTTRLCSSKPIATVNGKFPGPTIYAREG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VL+ VVN+VKYNVSIHWHG+RQLRTGW+DGPAYITQCPI+PG +Y+YNFTITGQRGTL
Sbjct  62    DNVLVNVVNHVKYNVSIHWHGVRQLRTGWSDGPAYITQCPIQPGQNYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+T+HGA+VILPKLGVPYPFPKPDHEAVV+LAEWWKSDTEAVIN+A+KSGL
Sbjct  122   FWHAHILWLRATMHGAIVILPKLGVPYPFPKPDHEAVVILAEWWKSDTEAVINQAIKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPG ++NC +QGGY LSV+ GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  182   APNVSDAHTINGHPGAISNCPSQGGYTLSVDPGKSYMLRVINAALNEELFFKIAGHKMTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTI+IAPGQTTNVIVTAD+GSG+YMVAASPFMDAP+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTDTIIIAPGQTTNVIVTADKGSGKYMVAASPFMDAPIAVDNVTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLAS  TTLT  PP NAT VAN+F+DSLRSLNSK++PA VP+ VDHSL FT GLG+
Sbjct  302   HYSGTLASSITTLTKTPPKNATTVANNFIDSLRSLNSKKYPAKVPKKVDHSLFFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPC SCK GNGSRVVAS+NNVTFVMPT A+LQAHFFGIKGV+TTDFP NPPF FNYTG  
Sbjct  362   NPCSSCKQGNGSRVVASINNVTFVMPTVAILQAHFFGIKGVYTTDFPQNPPFKFNYTGTP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL T +GTK++RL YN+TVQLVLQDTGII+PENHPIHLHGFNFFAVGKG+GNFNPK D
Sbjct  422   PTNLATMSGTKVYRLPYNATVQLVLQDTGIISPENHPIHLHGFNFFAVGKGIGNFNPKKD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P  FNL+DPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNGKG
Sbjct  482   PNNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PNES
Sbjct  542   PNES  545



>ref|XP_006363052.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=561

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/548 (81%), Positives = 496/548 (91%), Gaps = 4/548 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW    +LLA C+FP +VECRVRHYKF+VVMKN TR+CSSK  VTVNGKFPGPTIYARE 
Sbjct  3     SWICHFILLAFCLFPLVVECRVRHYKFNVVMKNTTRLCSSKSIVTVNGKFPGPTIYAREG  62

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VLI+VVN+VKY VSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQRGTL
Sbjct  63    DNVLIKVVNHVKYIVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTL  122

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+TVHGA+VILPKLGVPYPFPKP+HEAVV+LAEWWKSDTEAVINEA+KSGL
Sbjct  123   FWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGL  182

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV+NC +QGGY+L+VE GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  183   APNVSDAHTINGHPGPVSNCPSQGGYKLNVEPGKTYMLRVINAALNEELFFKIAGHKMTV  242

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATY+KPF+TDTIVIAPGQTTNVIV A++ SG+YMV ASPFMD+P+AVDN TA ATL
Sbjct  243   VEVDATYIKPFQTDTIVIAPGQTTNVIVNANKNSGKYMVVASPFMDSPIAVDNVTAIATL  302

Query  1096  HYTGTLASGPTTLTTA---PPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             HY+ TL + P+T  T+   PP NATP+AN+F+DSLRSLNSK++PA VP  +DHSLLFT  
Sbjct  303   HYSATLTNNPSTTLTSTNTPPKNATPIANNFLDSLRSLNSKKYPAKVPIKIDHSLLFTVS  362

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCPSCK GNGSRVVAS+NNVTFVMPT ALLQAHF GIKGVFT DFP NPPF +NYT
Sbjct  363   LGINPCPSCKQGNGSRVVASINNVTFVMPTIALLQAHFSGIKGVFTADFPGNPPFVYNYT  422

Query  745   GAG-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
                 PAN+ TT+GTK+++L+YN TVQLVLQDTGIIAPENHPIHLHGFNF+ VGKGLGN+N
Sbjct  423   NTTPPANMGTTSGTKVYKLSYNDTVQLVLQDTGIIAPENHPIHLHGFNFYQVGKGLGNYN  482

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PK DPK FNLVDPVERNT+G+P+GGWVAIRFR DNPGVWFMHCHLE+HTTWGLKMAFLVD
Sbjct  483   PKVDPKNFNLVDPVERNTVGVPSGGWVAIRFRTDNPGVWFMHCHLEIHTTWGLKMAFLVD  542

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  543   NGKGPNES  550



>ref|XP_004249583.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=557

 Score =   946 bits (2444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/548 (82%), Positives = 493/548 (90%), Gaps = 3/548 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME +W RI VLLA C FP  V    RHYKF+VVMKNM+R+CSSKP VT+NG+FPGPTIYA
Sbjct  1     MESNWLRIFVLLAFCFFP--VFGITRHYKFNVVMKNMSRLCSSKPIVTINGRFPGPTIYA  58

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             RE+D VLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQR
Sbjct  59    RENDRVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQR  118

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAHILWLR+TVHGA+VILPK GVPYPFPKP+HEAVVVL EWWKSDTEAV+NEAL 
Sbjct  119   GTLFWHAHILWLRATVHGAIVILPKRGVPYPFPKPNHEAVVVLGEWWKSDTEAVVNEALN  178

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTINGHPGPV NC ++GGY LSV  GK YMLRVINAALNEELFFKIAGHK
Sbjct  179   SGLAPNVSDAHTINGHPGPVPNCPSEGGYTLSVAPGKTYMLRVINAALNEELFFKIAGHK  238

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             MTVVEVDATYVKPFK+DTI+IAPGQTTNVI+TADQ  G+YM+ ASPFMD+P+ VDN TAT
Sbjct  239   MTVVEVDATYVKPFKSDTILIAPGQTTNVILTADQKFGKYMMIASPFMDSPITVDNVTAT  298

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHYTG L+S P TLT+APP NAT VAN+F+DSL+SLNSK++PA VP  VDHSLLFT G
Sbjct  299   ATLHYTGALSSAPMTLTSAPPQNATLVANNFIDSLKSLNSKKYPAKVPNNVDHSLLFTVG  358

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCP+C   NGSRVVAS+NNVTFVMPTTALLQAHFFGIK VFTTDFP NPPF FNYT
Sbjct  359   LGINPCPTCIPANGSRVVASINNVTFVMPTTALLQAHFFGIKNVFTTDFPGNPPFIFNYT  418

Query  745   GA-GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
                 P +L TT GTKL+RL Y++TVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN
Sbjct  419   STLPPPSLATTNGTKLYRLRYDATVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  478

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PK D K FNL+DPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVD
Sbjct  479   PKIDTKNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  538

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  539   NGKGPNES  546



>ref|XP_002322962.2| laccase family protein [Populus trichocarpa]
 gb|EEF04723.2| laccase family protein [Populus trichocarpa]
Length=564

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/547 (82%), Positives = 500/547 (91%), Gaps = 1/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME SWFR + LLA  +FPA+VECRVRHYKF+VVMKN TR+CSSKP VTVNG+FPGPT+YA
Sbjct  8     MEYSWFRFM-LLAVSLFPALVECRVRHYKFNVVMKNTTRLCSSKPVVTVNGRFPGPTLYA  66

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+ G SY+YNFTITGQR
Sbjct  67    REDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQR  126

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHILWLR+TVHGA+V+LPK GVPYPFP P  E VVVLAEWWKSDTEAVINEALK
Sbjct  127   GTLLWHAHILWLRATVHGAIVVLPKRGVPYPFPAPHKEFVVVLAEWWKSDTEAVINEALK  186

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTINGHPG V+ C +QGG+ L VE+GK YMLR+INAALNEELFFKIAGHK
Sbjct  187   SGLAPNVSDAHTINGHPGAVSACPSQGGFTLPVESGKTYMLRLINAALNEELFFKIAGHK  246

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +T+VEVDATYVKPFKTDT++IAPGQTTNV+VT ++ +G+Y+VAASPFMDAP+AVDN TAT
Sbjct  247   LTLVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTAT  306

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHY+G L+  PTTLT  PP NAT VAN F +SLRSLNSK+FPA VP TVDH+L FT G
Sbjct  307   ATLHYSGALSGTPTTLTIPPPKNATAVANQFTNSLRSLNSKRFPAKVPLTVDHNLFFTVG  366

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCP+CKAGNGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP+ PP  FNYT
Sbjct  367   LGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPSKPPHVFNYT  426

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  P NLQTT+GTK++RL YNSTV+LV+QDTGII+PENHPIHLHGFNFF VG+G+GN+NP
Sbjct  427   GTPPTNLQTTSGTKVYRLRYNSTVELVMQDTGIISPENHPIHLHGFNFFGVGRGVGNYNP  486

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             KTDPKKFNLVDPVERNTIG+P+GGWVAIRFR DNPGVWFMHCHLEVHTTWGLKMAFLVDN
Sbjct  487   KTDPKKFNLVDPVERNTIGVPSGGWVAIRFRVDNPGVWFMHCHLEVHTTWGLKMAFLVDN  546

Query  385   GKGPNES  365
             GKGPNES
Sbjct  547   GKGPNES  553



>ref|XP_006338994.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=557

 Score =   941 bits (2432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/548 (82%), Positives = 490/548 (89%), Gaps = 3/548 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME +W RI VLLA C FP  V    RHYKF+VVM+NM+ +CSSKP VTVNG+FPGPTIYA
Sbjct  1     MESNWLRIFVLLAFCFFP--VFGVTRHYKFNVVMRNMSCLCSSKPIVTVNGRFPGPTIYA  58

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDD VLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQR
Sbjct  59    REDDRVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQR  118

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAHILWLR+TVHGA+VILPK GVPYPFPKP+HEAVVVL EWWKSDTEAV NEAL 
Sbjct  119   GTLFWHAHILWLRATVHGAIVILPKRGVPYPFPKPNHEAVVVLGEWWKSDTEAVANEALN  178

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTINGHPGPV+NC +QGGYRLSV  GK YMLRVINAALNEELFFKIAGHK
Sbjct  179   SGLAPNVSDAHTINGHPGPVSNCPSQGGYRLSVAPGKTYMLRVINAALNEELFFKIAGHK  238

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             MTVVEVDATYVKPFKTDTI+IAPGQTTNV++TADQ  G+YMV ASPFMD+PV VDN TAT
Sbjct  239   MTVVEVDATYVKPFKTDTILIAPGQTTNVLLTADQNFGKYMVVASPFMDSPVTVDNVTAT  298

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHYTG L++ P TLT+APP NAT VAN+F+ SL+SLNSK++PA VP+ +DHSLLFT G
Sbjct  299   ATLHYTGALSNAPMTLTSAPPQNATSVANNFIHSLKSLNSKKYPAKVPKNIDHSLLFTVG  358

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCP+C   NG RVVAS+NNVTFVMP TALLQAHFFGIK VFT DFP NPPF FNYT
Sbjct  359   LGINPCPTCIPSNGIRVVASINNVTFVMPKTALLQAHFFGIKNVFTMDFPGNPPFVFNYT  418

Query  745   G-AGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
                 P +L T  GTKL+RL YN+TVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN
Sbjct  419   STVPPPSLATMNGTKLYRLRYNATVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  478

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTD K FNL+DPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVD
Sbjct  479   PKTDTKNFNLMDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  538

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  539   NGKGPNES  546



>gb|KHG18161.1| Laccase-4 -like protein [Gossypium arboreum]
Length=556

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/544 (84%), Positives = 498/544 (92%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             S  R++VL+A  +FP  V+C VRHYKF+VVMKN TR+CSSKP VTVNGKFPGPT+YARE 
Sbjct  3     SSIRVLVLVAV-LFPVFVDCTVRHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTLYAREG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+ G SY+YNFTITGQRGTL
Sbjct  62    DTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQSGQSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLRSTVHGA+VILPK  VPYPFPKP  E VVVLAEWWKSDTEAVINEALKSGL
Sbjct  122   LWHAHILWLRSTVHGAIVILPKRSVPYPFPKPHKEVVVVLAEWWKSDTEAVINEALKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPG V+ C +QGG+ L VE+GK Y+LR+INAALNEELFFKIAGHK+TV
Sbjct  182   APNVSDAHTINGHPGKVSGCPSQGGFSLPVESGKTYLLRLINAALNEELFFKIAGHKLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFK DT+VIAPGQTTNV+V+ADQ SG+YMVAASPFMDAPVAVDN TATATL
Sbjct  242   VEVDATYVKPFKIDTVVIAPGQTTNVLVSADQNSGKYMVAASPFMDAPVAVDNLTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTL + PT+LTT PP NAT VAN+F+DSLRSLNSKQFPA VP T+DH+L FT GLG+
Sbjct  302   HYSGTLDNTPTSLTTPPPQNATSVANNFIDSLRSLNSKQFPALVPPTIDHNLYFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+CKAGNGSRVVAS+NNVTF MPTTALLQAHFF I GVFTTDFP+ PP  FNYTG  
Sbjct  362   NPCPTCKAGNGSRVVASINNVTFTMPTTALLQAHFFNISGVFTTDFPSTPPHVFNYTGTP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NLQT  GTK+FRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGN+NPKTD
Sbjct  422   PKNLQTRNGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNYNPKTD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P+KFNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG
Sbjct  482   PQKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PN+S
Sbjct  542   PNQS  545



>ref|XP_009593274.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=554

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/544 (84%), Positives = 496/544 (91%), Gaps = 3/544 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R  VLLA  + PA      RHYKF+VVM+NM+R+CS+KP VTVNG+FPGPTIYARED
Sbjct  3     SWLRFFVLLAF-LSPAF--GITRHYKFNVVMRNMSRLCSTKPIVTVNGRFPGPTIYARED  59

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VLI+VVN+VKYNV+IHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  60    DRVLIKVVNHVKYNVTIHWHGIRQLRTGWADGPAYITQCPIQPGQSYIYNFTITGQRGTL  119

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAH+LWLRSTVHGA+V+LPK GVPYPFPKP+HEAVVVLAEWWKSDTEAVINEALKSGL
Sbjct  120   FWHAHVLWLRSTVHGAIVVLPKRGVPYPFPKPNHEAVVVLAEWWKSDTEAVINEALKSGL  179

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV+NC TQGGY LSVE GK YMLRVINAALNEELFFKIAGHKMTV
Sbjct  180   APNVSDAHTINGHPGPVSNCPTQGGYSLSVEPGKTYMLRVINAALNEELFFKIAGHKMTV  239

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQ  G+YMVAASPFMDAP+AVDN TATATL
Sbjct  240   VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQSFGKYMVAASPFMDAPIAVDNITATATL  299

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+G L + PTTLT+ PP NAT VAN+F+D+L+SLNSK++PA VPQTVDHSL FTAGLGI
Sbjct  300   HYSGALGTSPTTLTSTPPQNATSVANNFLDALKSLNSKKYPAKVPQTVDHSLFFTAGLGI  359

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+CK  NGSRVVAS+NNVTFVMPT ALLQAHFFGI GVFTTDFPANPPF FNYTG  
Sbjct  360   NPCPTCKQANGSRVVASVNNVTFVMPTVALLQAHFFGINGVFTTDFPANPPFVFNYTGTP  419

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL TT GTK++RL YN+TVQLVLQDTGIIAPENHPIHLHGFNFF VGKGLGNFN KTD
Sbjct  420   PTNLATTKGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFNFFLVGKGLGNFNSKTD  479

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PK FNL+DPVERNTIG+P+GGWVAIR+ ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG
Sbjct  480   PKNFNLIDPVERNTIGVPSGGWVAIRWLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  539

Query  376   PNES  365
             P ES
Sbjct  540   PKES  543



>ref|XP_010044089.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86095.1| hypothetical protein EUGRSUZ_B02796 [Eucalyptus grandis]
Length=556

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/544 (82%), Positives = 500/544 (92%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW +I+VL+AC + PA+VE RVR+Y F+VVMKN TR+CSSKP VTVNG FPGPT+YARED
Sbjct  3     SWLQILVLVAC-ITPAVVEGRVRNYTFNVVMKNTTRLCSSKPIVTVNGMFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL+RV N VKYNV+IHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  62    DTVLVRVSNRVKYNVTIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWWKSDTEAVI++A+KSGL
Sbjct  122   LWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVISQAIKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGP +NC +QGG+ L VE+GK+YMLR+INAALNEELFFKIAGH++T+
Sbjct  182   APNVSDAHTINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGHQLTI  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTN +++ DQ SG+YMVAASPFMD+P+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTDTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLA+  TTLT  PP NAT VAN+FV+SLRSLNSK++PA +P TVDHSLLFT GLGI
Sbjct  302   HYSGTLAATSTTLTKTPPQNATAVANNFVNSLRSLNSKRYPAKIPLTVDHSLLFTVGLGI  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCKAGNGSRVVAS+NNVTFVMPTTA+LQAHFF   GVFT+DFP NPP  FNYTG+ 
Sbjct  362   NPCPSCKAGNGSRVVASMNNVTFVMPTTAILQAHFFNKSGVFTSDFPGNPPTIFNYTGSP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P+NL+TT+GTK++RL YNSTVQLVLQDTGIIAPENHPIHLHGFNFFA+GKGLGN+NPK D
Sbjct  422   PSNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAIGKGLGNYNPKVD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
              K FNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNGKG
Sbjct  482   QKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PNES
Sbjct  542   PNES  545



>ref|XP_008449180.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=556

 Score =   936 bits (2420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/542 (82%), Positives = 497/542 (92%), Gaps = 1/542 (0%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             FR++VLLAC +FPA+VECRVRHYKFDVV+KN T++CSSK  VTVNGKFPGPTIYAREDDT
Sbjct  5     FRVLVLLAC-IFPALVECRVRHYKFDVVLKNTTKLCSSKQIVTVNGKFPGPTIYAREDDT  63

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             VLI VVN+V+YN+SIHWHG+RQLRTGWADGPAYITQCPI  G SY+YNFT+TGQRGTLLW
Sbjct  64    VLINVVNHVQYNLSIHWHGVRQLRTGWADGPAYITQCPIPSGQSYLYNFTVTGQRGTLLW  123

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHILWLR+TVHGALVILPKLGVPYPFP P+ E VVVLAEWWKSDTEAVINEALKSGLAP
Sbjct  124   HAHILWLRATVHGALVILPKLGVPYPFPAPNKEVVVVLAEWWKSDTEAVINEALKSGLAP  183

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             NVSDAHTINGH GP++ CSTQGG+ L V++G  Y+LR+INAALNEELFFKIAGHK+TVVE
Sbjct  184   NVSDAHTINGHSGPISKCSTQGGFTLPVKSGHTYLLRIINAALNEELFFKIAGHKLTVVE  243

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             VDATYVKPFKTDTIVIAPGQTTN ++TADQ SG+Y+VAASPFMD+P+AVDN TATATLHY
Sbjct  244   VDATYVKPFKTDTIVIAPGQTTNALITADQTSGKYLVAASPFMDSPIAVDNNTATATLHY  303

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             + TLA+  TTLT  PP NATPVAN+F+DSLRSLNS  +PA VP T+DH+L FT GLGINP
Sbjct  304   SDTLATTATTLTVPPPQNATPVANNFIDSLRSLNSNTYPAKVPLTIDHNLYFTVGLGINP  363

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             CP+CKAGNGSR VAS+NNVTFVMPTTALLQAH+F I GVFTTDFPANPP  FNYTG+GP+
Sbjct  364   CPTCKAGNGSRAVASINNVTFVMPTTALLQAHYFNINGVFTTDFPANPPHVFNYTGSGPS  423

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NLQTT GTKL++L +NSTV+LVLQDTGIIA ENHPIHLHGFNFF VG+G+GN++ K DPK
Sbjct  424   NLQTTRGTKLYKLKFNSTVELVLQDTGIIAAENHPIHLHGFNFFVVGRGIGNYDAKNDPK  483

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
              FNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN
Sbjct  484   SFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPN  543

Query  370   ES  365
             ES
Sbjct  544   ES  545



>ref|XP_010044090.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044092.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044093.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86096.1| hypothetical protein EUGRSUZ_B02797 [Eucalyptus grandis]
 gb|KCW86097.1| hypothetical protein EUGRSUZ_B02798 [Eucalyptus grandis]
 gb|KCW86098.1| hypothetical protein EUGRSUZ_B02799 [Eucalyptus grandis]
Length=556

 Score =   936 bits (2420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/544 (82%), Positives = 499/544 (92%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW +I+VL+AC + PA+V+ RVR+Y F+VVMKN TR+CSSKP VTVNG FPGPT+YARED
Sbjct  3     SWLQILVLVAC-ITPAVVQGRVRNYTFNVVMKNTTRLCSSKPIVTVNGMFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL+RV N VKYNV+IHWHGIRQLR+GWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  62    DTVLVRVSNRVKYNVTIHWHGIRQLRSGWADGPAYITQCPIQPGQSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWWKSDTEAVI +A+KSGL
Sbjct  122   LWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVIKQAIKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGP++NC +QGG+ L VE+GKRYMLR++NAALNEELFFKIAGH++T+
Sbjct  182   APNVSDAHTINGHPGPISNCPSQGGFTLPVESGKRYMLRIVNAALNEELFFKIAGHQLTI  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTN +++ADQ SG+Y+VAASPFMD+P+ VDN TATATL
Sbjct  242   VEVDATYVKPFKTDTIVIAPGQTTNALISADQSSGKYLVAASPFMDSPITVDNMTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLA+  TTLT  PP NAT VAN+F++SLRSLNSK +PA VP TVDH+LLFT GLGI
Sbjct  302   HYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKIYPAKVPLTVDHNLLFTVGLGI  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCKAGNGSRVVAS+NNVTFVMPTTALLQAHFF I GVFT+DFP NPP  FNYTG+ 
Sbjct  362   NPCPSCKAGNGSRVVASMNNVTFVMPTTALLQAHFFNISGVFTSDFPGNPPTTFNYTGSP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL+TT+GTK++RL YNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGN+NPK D
Sbjct  422   PTNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNYNPKVD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
              K FNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNGKG
Sbjct  482   QKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PNES
Sbjct  542   PNES  545



>ref|XP_010044087.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86093.1| hypothetical protein EUGRSUZ_B02794 [Eucalyptus grandis]
Length=556

 Score =   936 bits (2419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/544 (81%), Positives = 499/544 (92%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW +I+VL+AC + PA+VE RVR+Y F+VVMKN TR+CSSKP VTVNGKFPGPT+YARED
Sbjct  3     SWLKILVLVAC-ITPAVVEARVRNYSFNVVMKNKTRLCSSKPIVTVNGKFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VL+RV N+VKYNV+IHWHG+RQLRTGWADGPAYITQCPI+ G SY+YNFTITGQRGTL
Sbjct  62    DNVLVRVTNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWWKSDTEAVIN+A+KSGL
Sbjct  122   LWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVINQAIKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGP +NC +QGG+ L VE+GK+YMLR+INAALNEELFFKIAGH++T+
Sbjct  182   APNVSDAHTINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGHQLTI  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKT+TIVIAPGQTTN +++ DQ SG+YMVAASPFMD+P+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTNTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLA+  TTLT  PP NAT VAN+F++SLRSLNSK++PA VP TVDHSLLFT GLG+
Sbjct  302   HYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKRYPAKVPLTVDHSLLFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCKAGNGSRVVAS+NNVTFVMP+TALLQAHFF I GVFT+DFP NP   FNYTG+ 
Sbjct  362   NPCPSCKAGNGSRVVASMNNVTFVMPSTALLQAHFFNISGVFTSDFPGNPRTTFNYTGSP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P+NL+TT+GTK+FRL YNSTVQLVLQDTGIIAPENHPIHLHGFNFF VGKGLGN+NPK D
Sbjct  422   PSNLRTTSGTKVFRLHYNSTVQLVLQDTGIIAPENHPIHLHGFNFFTVGKGLGNYNPKVD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
              K FNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNGKG
Sbjct  482   QKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PNES
Sbjct  542   PNES  545



>ref|XP_011019151.1| PREDICTED: laccase-4 isoform X2 [Populus euphratica]
Length=558

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/548 (81%), Positives = 498/548 (91%), Gaps = 1/548 (0%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R + LLA C+FPA+V+CRVRHYKF+VVMKN TR+CS KP VTVNG+FPGPT+Y
Sbjct  1     MEYACWLRFI-LLAVCLFPALVQCRVRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLY  59

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQ
Sbjct  60    AREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQ  119

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTLLWHAHILWLRSTVHGA+V+LPK G+PYPFP P  E VVVLAEWWKSDTEAVINEAL
Sbjct  120   RGTLLWHAHILWLRSTVHGAIVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEAL  179

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTINGHPG V+ CS+QGG+ L V +G+ YMLR+INAALNEELFFKIAGH
Sbjct  180   KSGLAPNVSDAHTINGHPGAVSACSSQGGFTLPVRSGETYMLRLINAALNEELFFKIAGH  239

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+TVVEVDATYVKPFKTDT++IAPGQTTNV+VT ++ +G Y+VAASPFMD+P+AVDN TA
Sbjct  240   KLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGNYLVAASPFMDSPIAVDNMTA  299

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATL Y+G LA+ PTTLTT PP NAT VAN F++SLRSLNS++FPA VP  VDH+L FT 
Sbjct  300   TATLQYSGALANSPTTLTTPPPKNATAVANQFINSLRSLNSRKFPAKVPMNVDHNLFFTV  359

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPCPSCKAGNGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFPA PP  FNY
Sbjct  360   GLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNY  419

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             +G  P NLQT +GTK++RL+YNSTVQLV+QDTGII+PENHPIHLHGFNFFAVG+G+GN+N
Sbjct  420   SGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYN  479

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTD KKFNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD
Sbjct  480   PKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  539

Query  388   NGKGPNES  365
             NGKGP ES
Sbjct  540   NGKGPKES  547



>ref|XP_010044088.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86094.1| hypothetical protein EUGRSUZ_B02795 [Eucalyptus grandis]
Length=556

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/544 (81%), Positives = 498/544 (92%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW +I+VL+AC + PA+VE RVR+Y F+VVMKN TR+CSSKP VTVNG FPGPT+YARED
Sbjct  3     SWLQILVLVAC-ITPAVVEGRVRNYTFNVVMKNTTRLCSSKPIVTVNGMFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL+RV N VKYNV+IHWHGIRQLR GWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  62    DTVLVRVSNRVKYNVTIHWHGIRQLRMGWADGPAYITQCPIQPGQSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWWKSDTEAVIN+A+KSGL
Sbjct  122   LWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVINQAIKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAH INGHPGP +NC +QGG+ L VE+GK+YMLR+INAALNEELFFKIAGH++T+
Sbjct  182   APNVSDAHMINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGHQLTI  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTN +++ DQ SG+YMVAASPFMD+P+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTDTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLA+  TTLT  PP NAT VAN+FV+SLRSLNSK++PA +P TVDHSLLFT GLGI
Sbjct  302   HYSGTLAATSTTLTKTPPQNATAVANNFVNSLRSLNSKRYPAKIPLTVDHSLLFTVGLGI  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCKAGNGSRVVAS+NNVTFVMPTTA+LQAHFF   GVFT+DFP NPP  FNYTG+ 
Sbjct  362   NPCPSCKAGNGSRVVASMNNVTFVMPTTAILQAHFFNKSGVFTSDFPGNPPTIFNYTGSP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P+NL+TT+GTK++RL YNSTVQLVLQDTGIIAPENHPIHLHGFNFFA+GKGLGN+NPK D
Sbjct  422   PSNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAIGKGLGNYNPKVD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
              K FNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNGKG
Sbjct  482   QKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             P+ES
Sbjct  542   PSES  545



>ref|XP_010041000.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW44721.1| hypothetical protein EUGRSUZ_L01734 [Eucalyptus grandis]
Length=556

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/544 (81%), Positives = 499/544 (92%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW +I+VL+AC + PA+VE RVR+Y F+VVMKN TR+CSSKP VTVNGKFPGPT+YARED
Sbjct  3     SWLKILVLVAC-ITPAVVEARVRNYSFNVVMKNKTRLCSSKPIVTVNGKFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VL+RV N+VKYNV+IHWHG+RQLRTGWADGPAYITQCPI+ G SY+YNFTITGQRGTL
Sbjct  62    DNVLVRVTNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWWKSDTEAVIN+A+KSGL
Sbjct  122   LWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVINQAIKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGP +NC +QGG+ L VE+GK+YMLR+INAALNEELFFKIAGH++T+
Sbjct  182   APNVSDAHTINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGHQLTI  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKT+TIVIAPGQTTN +++ DQ SG+YMVAASPFMD+P+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTNTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLA+  TTLT  PP NAT VAN+F++SLRSLNSK++PA VP TVDHSLLFT GLG+
Sbjct  302   HYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKRYPAKVPLTVDHSLLFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCKAGNGSRVVAS+NNVTFVMP+TALLQAHFF I GVFT+DFP NP   FNYTG+ 
Sbjct  362   NPCPSCKAGNGSRVVASMNNVTFVMPSTALLQAHFFNISGVFTSDFPGNPRTTFNYTGSP  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P+NL+TT+GTK+FRL YNSTVQLVLQDTGIIAPENHPIHLHGFNFF VGKGLGN+NPK D
Sbjct  422   PSNLRTTSGTKVFRLHYNSTVQLVLQDTGIIAPENHPIHLHGFNFFTVGKGLGNYNPKVD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
              K FNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNGKG
Sbjct  482   QKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PNES
Sbjct  542   PNES  545



>ref|XP_011019150.1| PREDICTED: laccase-4 isoform X1 [Populus euphratica]
Length=559

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/548 (81%), Positives = 496/548 (91%), Gaps = 0/548 (0%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W    +LLA C+ PA+VECR+RHYKF+VVMKN TR+CS KP VTVNG+FPGPT+Y
Sbjct  1     MEYSKWLIRYMLLAVCLLPALVECRIRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQ
Sbjct  61    AREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTLLWHAHILWLRSTVHGA+V+LPK G+PYPFP P  E VVVLAEWWKSDTEAVINEAL
Sbjct  121   RGTLLWHAHILWLRSTVHGAIVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTINGHPG V+ CS+QGG+ L V +G+ YMLR+INAALNEELFFKIAGH
Sbjct  181   KSGLAPNVSDAHTINGHPGAVSACSSQGGFTLPVRSGETYMLRLINAALNEELFFKIAGH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+TVVEVDATYVKPFKTDT++IAPGQTTNV+VT ++ +G Y+VAASPFMD+P+AVDN TA
Sbjct  241   KLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGNYLVAASPFMDSPIAVDNMTA  300

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATL Y+G LA+ PTTLTT PP NAT VAN F++SLRSLNS++FPA VP  VDH+L FT 
Sbjct  301   TATLQYSGALANSPTTLTTPPPKNATAVANQFINSLRSLNSRKFPAKVPMNVDHNLFFTV  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPCPSCKAGNGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFPA PP  FNY
Sbjct  361   GLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNY  420

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             +G  P NLQT +GTK++RL+YNSTVQLV+QDTGII+PENHPIHLHGFNFFAVG+G+GN+N
Sbjct  421   SGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYN  480

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTD KKFNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD
Sbjct  481   PKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  540

Query  388   NGKGPNES  365
             NGKGP ES
Sbjct  541   NGKGPKES  548



>ref|XP_006387495.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
 gb|ERP46409.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
Length=559

 Score =   934 bits (2413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/548 (81%), Positives = 497/548 (91%), Gaps = 0/548 (0%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M   +W    +LLA C+ PA+VECR+RHYKF+VVMKN TR+CS KP VTVNG+FPGPT+Y
Sbjct  1     MEYSNWLIRFMLLAVCLLPALVECRIRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             ARE DTVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQ
Sbjct  61    AREHDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTLLWHAHILWLR+TVHGA+V+LPK G+PYPFP P  E VVVLAEWWKSDTEAVINEAL
Sbjct  121   RGTLLWHAHILWLRATVHGAMVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTINGHPG V+ CS+QGG+ L V++G+ YMLR+INAALNEELFFKIAGH
Sbjct  181   KSGLAPNVSDAHTINGHPGAVSACSSQGGFTLPVKSGETYMLRLINAALNEELFFKIAGH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+TVVEVDATYVKPFKTDT++IAPGQTTNV+VT ++ +G+Y+VAASPFMDAP+AVDN TA
Sbjct  241   KLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTA  300

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATL Y+G LA+ PTTLTT PP NAT VAN F +SLRSLNS++FPA VP  VDH+L FT 
Sbjct  301   TATLQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTV  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPCPSCKAGNGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFPA PP  FNY
Sbjct  361   GLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNY  420

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P NLQT +GTK++RL+YNSTVQLV+QDTGII+PENHPIHLHGFNFFAVG+G+GN+N
Sbjct  421   TGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYN  480

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTD KKFNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD
Sbjct  481   PKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  540

Query  388   NGKGPNES  365
             NGKGP ES
Sbjct  541   NGKGPKES  548



>ref|XP_002308209.2| laccase family protein [Populus trichocarpa]
 gb|EEE91732.2| laccase family protein [Populus trichocarpa]
Length=559

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/548 (81%), Positives = 496/548 (91%), Gaps = 0/548 (0%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M   +W    +LLA C+ PA+VECR+RHYKF+VVMKN TR+CS KP VTVNG+FPGPT+Y
Sbjct  1     MEYSNWLIRFMLLAVCLLPALVECRIRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             ARE DTVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQ
Sbjct  61    AREHDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTLLWHAHILWLR+TVHGALV+LPK G+PYPFP P  E VVVLAEWWKSDTEAVINEAL
Sbjct  121   RGTLLWHAHILWLRATVHGALVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTINGHPG V+ CS+QGG+ L V++G+ YMLR+INAALNEELFFKIAGH
Sbjct  181   KSGLAPNVSDAHTINGHPGAVSACSSQGGFTLPVKSGETYMLRLINAALNEELFFKIAGH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+TVVEVDATYVKPFKTDT++IAPGQTTNV+VT ++ +G+Y+VAASPFMDAP+AVDN TA
Sbjct  241   KLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTA  300

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATL Y+G LA+ PTTLTT PP NAT VAN F +SLRSLNS++FPA VP  VDH+L FT 
Sbjct  301   TATLQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTV  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPCPSCKAGNGSRVVAS+NNVTFVMPTTALLQAHF  I GVFTTDFPA PP  FNY
Sbjct  361   GLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFLNISGVFTTDFPAKPPHVFNY  420

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P NLQT +GTK++RL+YNSTVQLV+QDTGII+PENHPIHLHGFNFFAVG+G+GN+N
Sbjct  421   TGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYN  480

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTD KKFNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD
Sbjct  481   PKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  540

Query  388   NGKGPNES  365
             NGKGP ES
Sbjct  541   NGKGPKES  548



>ref|XP_002308208.2| laccase family protein [Populus trichocarpa]
 gb|EEE91731.2| laccase family protein [Populus trichocarpa]
Length=558

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/548 (81%), Positives = 497/548 (91%), Gaps = 1/548 (0%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R + LLA C+FPA+V+CRVRHYKF+VVMKN TR+CS KP VTVNG+FPGPT+Y
Sbjct  1     MEYACWLRFM-LLAVCLFPALVQCRVRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLY  59

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQ
Sbjct  60    AREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  119

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTLLWHAHILWLR+TVHGALV+LPK G+PYPFP P  E +VVLAEWWKSDTEAVINEAL
Sbjct  120   RGTLLWHAHILWLRATVHGALVVLPKRGIPYPFPAPHKEVLVVLAEWWKSDTEAVINEAL  179

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTINGHPG V+ CS+QGG+ L V++G+ YMLR+INAALNEELFFKIAGH
Sbjct  180   KSGLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVKSGETYMLRLINAALNEELFFKIAGH  239

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+TVVEVDATYVKPFKTDT++IAPGQTTNV+VT ++ +G+Y+VAASPFMD+P+AVDN TA
Sbjct  240   KLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDSPIAVDNMTA  299

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATL Y+G LA+ PTTLTT PP NAT VAN F +SLRSLNS++FPA VP  VDH+L FT 
Sbjct  300   TATLQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTV  359

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
              LG+NPCPSCKAGNGSRVVAS+NNVTFVMPTTALLQAHF  I GVFTTDFPA PP  FNY
Sbjct  360   SLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFLNISGVFTTDFPAKPPHVFNY  419

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P NLQT +GTK++RL+YNSTVQLV+QDTGII+PENHPIHLHGFNFFAVG+G+GN+N
Sbjct  420   TGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYN  479

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTD KKFNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD
Sbjct  480   PKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  539

Query  388   NGKGPNES  365
             NGKGP ES
Sbjct  540   NGKGPKES  547



>ref|XP_004147923.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004165325.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN54357.1| hypothetical protein Csa_4G308480 [Cucumis sativus]
Length=556

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/542 (81%), Positives = 496/542 (92%), Gaps = 1/542 (0%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             FR++VLLAC +FPA+VECRVRHYKFDVV+KN T++CSSK  VTVNGKFPGPTIYAREDDT
Sbjct  5     FRVLVLLAC-IFPALVECRVRHYKFDVVLKNTTKLCSSKQIVTVNGKFPGPTIYAREDDT  63

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             VLI VVN+V+YN+SIHWHG+RQLRTGWADGPAYITQCPI  G SY+YNFT+TGQRGTLLW
Sbjct  64    VLINVVNHVQYNLSIHWHGVRQLRTGWADGPAYITQCPIPSGQSYLYNFTVTGQRGTLLW  123

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHILWLR+TVHGALVILPKLGVPYPFP P+ E VVVLAEWWKSDTEAVINEALKSGLAP
Sbjct  124   HAHILWLRATVHGALVILPKLGVPYPFPAPNKEVVVVLAEWWKSDTEAVINEALKSGLAP  183

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             NVSDAHTINGH GP++NCSTQGG+ L V++G  Y+LR+INAALNEELFFKIAGHK+TVVE
Sbjct  184   NVSDAHTINGHSGPISNCSTQGGFTLPVKSGHTYLLRIINAALNEELFFKIAGHKLTVVE  243

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             VDATYVKPFKTDTI+IAPGQTTN ++TADQ SG+Y+VAASPFMD+P+AVDN TATATLHY
Sbjct  244   VDATYVKPFKTDTILIAPGQTTNALITADQTSGKYLVAASPFMDSPIAVDNNTATATLHY  303

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
              GTLA+   TLT  PP NATPVAN+F+DSLRSLNS  +PA VP T+DH+L FT GLGINP
Sbjct  304   AGTLATTAATLTAPPPQNATPVANNFIDSLRSLNSNTYPAKVPLTIDHNLYFTVGLGINP  363

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             CP+CKAGNGSR VAS+NNVTFVMPTTALLQAH+F I GVFTTDFPANPP  FNYTG+GP+
Sbjct  364   CPTCKAGNGSRAVASINNVTFVMPTTALLQAHYFNINGVFTTDFPANPPHVFNYTGSGPS  423

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NLQTT GTKL++L +NSTV+LVLQDTGI+  ENHPIHLHGFNFF VG+G+GN++ K DPK
Sbjct  424   NLQTTRGTKLYKLKFNSTVELVLQDTGILTAENHPIHLHGFNFFVVGRGIGNYDAKNDPK  483

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
              FNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN
Sbjct  484   SFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPN  543

Query  370   ES  365
             +S
Sbjct  544   QS  545



>ref|XP_010101806.1| hypothetical protein L484_023595 [Morus notabilis]
 gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis]
Length=558

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/545 (79%), Positives = 483/545 (89%), Gaps = 1/545 (0%)
 Frame = -3

Query  1996  SWFRI-VVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARE  1820
             SW R+ ++++A C  PA VECRVR+YKF+VV  N TR+CSSKP VT+NGKFPGPT+YARE
Sbjct  3     SWVRLFLIVVAICFSPAFVECRVRNYKFNVVTTNTTRLCSSKPIVTINGKFPGPTLYARE  62

Query  1819  DDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGT  1640
             DDTVL++VVN VKYNV+IHWHG+RQLRTGWADGPAYITQCPI PG SY+YNFTITGQRGT
Sbjct  63    DDTVLVKVVNRVKYNVTIHWHGVRQLRTGWADGPAYITQCPIPPGQSYVYNFTITGQRGT  122

Query  1639  LLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSG  1460
             LLWHAHILWLR+T+HGALVILPKLGVPYPFP P  E VVVLAEWWKSDTE VINEA+KSG
Sbjct  123   LLWHAHILWLRATIHGALVILPKLGVPYPFPAPHKEVVVVLAEWWKSDTENVINEAMKSG  182

Query  1459  LAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMT  1280
             LAPNVSDAHTING PGPV+NC+++GG+ L V+ GK Y+LR+INAALNEELFFKIAGHK+T
Sbjct  183   LAPNVSDAHTINGRPGPVSNCTSEGGFTLPVQTGKTYLLRIINAALNEELFFKIAGHKLT  242

Query  1279  VVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATAT  1100
             VVEVDATYVKPF  DTIVIAPGQTTN ++TADQ SG+Y+VAASPFMDAP+AVDN TATAT
Sbjct  243   VVEVDATYVKPFSIDTIVIAPGQTTNALITADQNSGKYLVAASPFMDAPIAVDNATATAT  302

Query  1099  LHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
             LHY GTLA+  TTLT  PP NAT VAN F + L+SLNS  FPA VP +VDH+L FT  LG
Sbjct  303   LHYAGTLANAATTLTVPPPQNATQVANKFTNGLKSLNSNTFPAKVPLSVDHNLFFTVSLG  362

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
             INPCP+CKAGNGSRVVAS+NNVTFVMPTTALLQAH+F  KGVFTTDFPANPP  FNY+G 
Sbjct  363   INPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHYFKTKGVFTTDFPANPPNVFNYSGT  422

Query  739   GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKT  560
              PA+L TT GTKL+R+ YN TVQLVLQDTGIIAPENHP+HLHGFNFF VG+G GN+NPK 
Sbjct  423   PPASLATTNGTKLYRIKYNETVQLVLQDTGIIAPENHPVHLHGFNFFVVGRGTGNYNPKK  482

Query  559   DPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  380
             D K FNLVDPVERNT+G+P+GGW AIRF ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK
Sbjct  483   DQKSFNLVDPVERNTVGVPSGGWTAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  542

Query  379   GPNES  365
             GPNES
Sbjct  543   GPNES  547



>ref|XP_002533894.1| laccase, putative [Ricinus communis]
 gb|EEF28494.1| laccase, putative [Ricinus communis]
Length=556

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/544 (79%), Positives = 484/544 (89%), Gaps = 1/544 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             S FR + LL  C  P  V+CRVR Y F+VV K  T++CSSKP VTVNGKFPGPT+YARED
Sbjct  3     SLFRFL-LLFVCFLPVFVDCRVRRYNFNVVTKTSTKLCSSKPIVTVNGKFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL+RVVN VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG +Y+YNFT+TGQRGTL
Sbjct  62    DTVLVRVVNKVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQNYVYNFTLTGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLRSTVHGA+VILPK GVPYPFPKP  E VV+LAEWWKSDTEAVINEA+KSGL
Sbjct  122   LWHAHILWLRSTVHGAIVILPKRGVPYPFPKPHKEEVVILAEWWKSDTEAVINEAMKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPG V NC +Q G+RL VE+GK Y+LR+INAALNEELFFKIAGH++TV
Sbjct  182   APNVSDAHTINGHPGAVPNCPSQSGFRLPVESGKAYLLRLINAALNEELFFKIAGHQLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VE+DA YVKP KTDT+++APGQTTNV+VTA++ SG+Y+V ASPFMDAPVAVDN+TATATL
Sbjct  242   VEIDACYVKPLKTDTVLLAPGQTTNVLVTANKNSGKYLVTASPFMDAPVAVDNRTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLAS PTT+ T PP NA+ VAN+F++SLRSLNS+++PA VP  VDH+LLFT GLGI
Sbjct  302   HYSGTLASAPTTVATPPPQNASAVANNFINSLRSLNSQKYPARVPLKVDHNLLFTVGLGI  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             N CPSCKA NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP+ PP  FN+TG+G
Sbjct  362   NACPSCKAANGSRVVASINNVTFVMPTTALLQAHFFKISGVFTTDFPSKPPHVFNFTGSG  421

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL T   TK++RL YN TVQLV+QDTG+IAPE+HPIHLHGFNFF VG+GLGN+NP TD
Sbjct  422   PKNLNTVRATKVYRLKYNDTVQLVMQDTGVIAPESHPIHLHGFNFFVVGRGLGNYNPNTD  481

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P+ FNLVDP ERNTIG+P GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG
Sbjct  482   PQNFNLVDPAERNTIGVPTGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  541

Query  376   PNES  365
             PNES
Sbjct  542   PNES  545



>ref|XP_008442464.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis melo]
Length=559

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/548 (80%), Positives = 490/548 (89%), Gaps = 1/548 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLA-CCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M  S  R  VLLA CC+ P + E  VRHYKF+VV++  TR+CSSKP VTVNG+FPGPT+Y
Sbjct  1     MGSSGVRAFVLLAFCCLLPGLAESTVRHYKFNVVLRKATRLCSSKPIVTVNGQFPGPTLY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             ARE D VLI+VVN+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQ
Sbjct  61    AREGDNVLIKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHG LVILPKLGVPYPFP P+ E V+VLAEWWKSDTEAVINEAL
Sbjct  121   RGTLFWHAHILWLRATVHGGLVILPKLGVPYPFPTPNKETVLVLAEWWKSDTEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTING PG + NC +Q G+ L V+ GK Y+LR+INAALNEELFFK+AGH
Sbjct  181   KSGLAPNVSDAHTINGLPGSIPNCPSQRGFTLPVQRGKTYLLRIINAALNEELFFKVAGH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+TVVEVDATYVKPFKTDT++IAPGQTTNV++TA+Q SG+YMVA SPFMDAPVAVDN+TA
Sbjct  241   KLTVVEVDATYVKPFKTDTVIIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTA  300

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TAT+HYTGTLA+  TT T  PP NAT +AN+F++SLRSLNSK++PANVP T+DH L FT 
Sbjct  301   TATVHYTGTLATSLTTSTNPPPQNATQIANAFINSLRSLNSKKYPANVPLTIDHHLFFTV  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLGINPCP+CKA NGSRVVAS+NNVTFVMPTTALLQAHFF  KGVFTTDFP  PP  FNY
Sbjct  361   GLGINPCPTCKAANGSRVVASINNVTFVMPTTALLQAHFFKTKGVFTTDFPXKPPHKFNY  420

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             +G GP NLQTTT TKL++L YNSTV+LVLQDTGIIAPENHPIHLHGFNFF VG+G+GNFN
Sbjct  421   SGPGPKNLQTTTATKLYKLQYNSTVELVLQDTGIIAPENHPIHLHGFNFFEVGRGIGNFN  480

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTDPKKFNLVDPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+
Sbjct  481   PKTDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVE  540

Query  388   NGKGPNES  365
             NGKGPN+S
Sbjct  541   NGKGPNQS  548



>ref|XP_002278638.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI30423.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/547 (79%), Positives = 495/547 (90%), Gaps = 2/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M+ SW R++VL+AC + PA+VECRVR Y F+VV+KN  R+C+SKP VTVNG+FPGPT+Y 
Sbjct  1     MKYSWVRVLVLVAC-LLPALVECRVRQYTFNVVLKNTNRLCASKPIVTVNGRFPGPTLYV  59

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL+RVVN+VKYNVSIHWHGIRQLRTGW+DGPAYITQCPI+ G SY+YNFT+TGQR
Sbjct  60    REDDTVLVRVVNHVKYNVSIHWHGIRQLRTGWSDGPAYITQCPIQTGQSYLYNFTVTGQR  119

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAH+LWLR+TVHGA+VILPK GVPYPFPKP  E VV+L EWWKSD EAVIN+AL 
Sbjct  120   GTLLWHAHVLWLRATVHGAIVILPKRGVPYPFPKPHKEVVVILGEWWKSDVEAVINQALS  179

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTINGHPGPV+NC +QGG+ L VEAGK Y+LR+INAALNEELFFKIAGH+
Sbjct  180   SGLAPNVSDAHTINGHPGPVSNCPSQGGFSLQVEAGKTYLLRIINAALNEELFFKIAGHQ  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             ++VVEVDA Y KPFK DT+VIAPGQTTN ++TADQ SG+Y++AASPFMD+P+AVDN TAT
Sbjct  240   LSVVEVDAVYTKPFKIDTLVIAPGQTTNALITADQSSGKYLMAASPFMDSPIAVDNLTAT  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHY+GTLAS PT+LT+ PP NAT VAN FV+SLRSLNSK++PA VP TVDHSL  T G
Sbjct  300   ATLHYSGTLASSPTSLTSPPPPNATAVANKFVNSLRSLNSKKYPAKVPLTVDHSLFITVG  359

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPC +C AGNGSR VAS+NNVTFVMPTTA+LQAH+F I GV+TTDFPANPP AFNYT
Sbjct  360   LGINPCATCVAGNGSRAVASMNNVTFVMPTTAILQAHYFNISGVYTTDFPANPPVAFNYT  419

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G+ PANLQTT GTK++R+ YNSTVQ+VLQDTGIIA ENHP+HLHGFNFFAVGKGLGN+NP
Sbjct  420   GS-PANLQTTNGTKVYRVPYNSTVQVVLQDTGIIATENHPVHLHGFNFFAVGKGLGNYNP  478

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             KTDP+ FNL+DPVERNTIG+P+GGW AIRF ADNPGVWFMHCHLEVHTTWGLKMAFLVDN
Sbjct  479   KTDPQNFNLIDPVERNTIGVPSGGWTAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDN  538

Query  385   GKGPNES  365
             GKGPN+S
Sbjct  539   GKGPNQS  545



>ref|XP_002520425.1| laccase, putative [Ricinus communis]
 gb|EEF41838.1| laccase, putative [Ricinus communis]
Length=556

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/548 (78%), Positives = 486/548 (89%), Gaps = 3/548 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R++VL+AC +FPA VEC VRHYKF+VVMK  T++CS+KP VTVNGKFPGPT+ 
Sbjct  1     MEIAPWVRVLVLVAC-LFPASVECMVRHYKFNVVMKTATKMCSTKPIVTVNGKFPGPTLV  59

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+VKYN+SIHWHGIRQ+RTGWADGPAYITQCPI+PG SY+YNFT+TGQ
Sbjct  60    AREDDTVLVKVVNHVKYNLSIHWHGIRQVRTGWADGPAYITQCPIQPGQSYVYNFTLTGQ  119

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHGA+VILPK GVPYPFP PD E V+VL+EWWKSD EAVINEAL
Sbjct  120   RGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPTPDKEEVIVLSEWWKSDVEAVINEAL  179

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTINGHPGPV  C +QGG+ L V +GK YMLR++NAALNEELFFKIAGH
Sbjct  180   KSGLAPNVSDAHTINGHPGPVPACPSQGGFTLPVHSGKTYMLRIVNAALNEELFFKIAGH  239

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             ++TVVEVDATYVKPFKTDTIVIAPGQTTNV++TA + SG+Y+VAASPFMDAP+AVDN TA
Sbjct  240   QLTVVEVDATYVKPFKTDTIVIAPGQTTNVLLTAGRSSGKYLVAASPFMDAPIAVDNVTA  299

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
              ATLHY+GTL+S  TTLT  PP NAT +A++F ++LRSLNSK++PANVP  +DHSL FT 
Sbjct  300   VATLHYSGTLSSSATTLTATPPKNATSIASNFTNALRSLNSKKYPANVPLKIDHSLFFTI  359

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPC +C   NGSRVVA +NNVTFVMPT  LLQAHFF I GVFT DFP+NPP ++NY
Sbjct  360   GLGVNPCATCV--NGSRVVADINNVTFVMPTIGLLQAHFFNISGVFTDDFPSNPPVSYNY  417

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P N QTTTGT+L+RLAYNSTVQLVLQDTG+I PENHPIHLHGFNFF VG+G+GNFN
Sbjct  418   TGTQPTNFQTTTGTRLYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFQVGRGVGNFN  477

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PK DPK FNLVDPVERNT G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VD
Sbjct  478   PKKDPKNFNLVDPVERNTAGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVD  537

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  538   NGKGPNES  545



>ref|XP_010262771.1| PREDICTED: laccase-4-like [Nelumbo nucifera]
Length=555

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/545 (79%), Positives = 489/545 (90%), Gaps = 4/545 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R++VL+A  + P++VECRVRHYKF+VV +N TR+CS+KP VTVNG+FPGPT+YARE 
Sbjct  3     SWVRLLVLVAF-LLPSLVECRVRHYKFNVVTRNFTRLCSTKPIVTVNGRFPGPTLYAREG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++VVN+V+YNV+IHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  62    DTVLVKVVNHVQYNVTIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+T+HGA+VILPK GVPYPFPKP  E VV+L EWWKSD EAVINEAL SGL
Sbjct  122   LWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVILGEWWKSDVEAVINEALGSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV  CS+Q G++L V+ GK YMLR+INAALNEELFFKIAGH++TV
Sbjct  182   APNVSDAHTINGHPGPVPGCSSQDGFQLQVDPGKTYMLRLINAALNEELFFKIAGHQLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTATAT  1100
             VEVDA Y KPFKTDT++IAPGQTTNV++TA + SG+Y+VAASPFMD P VAVDN TATAT
Sbjct  242   VEVDAVYTKPFKTDTVLIAPGQTTNVLLTAGRSSGKYLVAASPFMDTPVVAVDNMTATAT  301

Query  1099  LHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
             LHY+G+LA+  TTLT  PP NATPVA +F+DSLRSLNSKQ+PA VPQTVDHSLLF+ GLG
Sbjct  302   LHYSGSLATSATTLTNPPPQNATPVATNFMDSLRSLNSKQYPAKVPQTVDHSLLFSVGLG  361

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
             +NPC +C   NGSRVVA +NNV+FVMPTTALLQAHFF I GVFT DFPANPP A+NYTG 
Sbjct  362   VNPCSTCP--NGSRVVADINNVSFVMPTTALLQAHFFNISGVFTDDFPANPPIAYNYTGT  419

Query  739   GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKT  560
              PANLQT  GTK++RL YN TVQ+VLQDTG+IAPENHPIHLHGFNFFAVG+GLGN+NPK 
Sbjct  420   QPANLQTINGTKVYRLRYNDTVQVVLQDTGMIAPENHPIHLHGFNFFAVGRGLGNYNPKK  479

Query  559   DPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  380
             DP KFNLVDP+ERNTIG+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VDNGK
Sbjct  480   DPAKFNLVDPIERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGK  539

Query  379   GPNES  365
             G N+S
Sbjct  540   GTNQS  544



>gb|EYU26646.1| hypothetical protein MIMGU_mgv1a003805mg [Erythranthe guttata]
Length=563

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/552 (79%), Positives = 489/552 (89%), Gaps = 5/552 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M   W R+++L+  C+ P + VEC+VRHYKF+VVMKN T++CSSK  VTVNGKFPGPTIY
Sbjct  1     MGYYWVRVLILVVACLSPVLLVECKVRHYKFNVVMKNTTKLCSSKSIVTVNGKFPGPTIY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+V YN+SIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQ
Sbjct  61    AREDDTVLVKVVNHVNYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTLLWHAHILWLRSTVHGA+VILPKLGVPYPFPKP+HE V++LAEWWKSDTEAVINEAL
Sbjct  121   RGTLLWHAHILWLRSTVHGAIVILPKLGVPYPFPKPNHERVIILAEWWKSDTEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANC--STQGGYRLSVEAGKRYMLRVINAALNEELFFKIA  1295
              SGLAPNVSDAHTINGHPGPV NC  ST  G+ L V+AGK Y+LR+INAALNEELFFKIA
Sbjct  181   TSGLAPNVSDAHTINGHPGPVTNCPSSTADGFTLKVKAGKTYLLRLINAALNEELFFKIA  240

Query  1294  GHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDN  1118
             GH +TVV+VDATYVKPFKT TIVIAPGQTT  I+TAD+ +G+Y+VAAS FMD P VAVDN
Sbjct  241   GHNLTVVDVDATYVKPFKTGTIVIAPGQTTTAILTADRNTGKYIVAASTFMDTPGVAVDN  300

Query  1117  QTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLL  938
              TATATLHY+GTL++ PTT T  PP NATPVAN+FV+SLRSLNSK +PA VPQ VD SLL
Sbjct  301   TTATATLHYSGTLSTSPTTFTAPPPQNATPVANNFVNSLRSLNSKNYPAKVPQKVDRSLL  360

Query  937   FTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFA  758
             FT GLGINPC +CKAGNGSRVVA +NNVTFVMP  ALLQAH F IKGVFTTDFP NPP +
Sbjct  361   FTIGLGINPCATCKAGNGSRVVADINNVTFVMPKIALLQAHVFNIKGVFTTDFPGNPPVS  420

Query  757   FNYTGA-GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGL  581
             FNYTG   P+N  T  GTKL+R+ YN+T+Q+VLQDTGIIAPENHPIHLHGFNFF VG+GL
Sbjct  421   FNYTGGPPPSNFGTRNGTKLYRVPYNTTIQVVLQDTGIIAPENHPIHLHGFNFFVVGRGL  480

Query  580   GNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMA  401
             GNFN KTDPK+FNLVDPVERNTIG+P+GGWVAIRF ADNPGVWFMHCHLEVHTTWGLKMA
Sbjct  481   GNFNSKTDPKQFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTTWGLKMA  540

Query  400   FLVDNGKGPNES  365
             FLVDNGK PNES
Sbjct  541   FLVDNGKSPNES  552



>ref|XP_004163861.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=559

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/548 (79%), Positives = 488/548 (89%), Gaps = 1/548 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLA-CCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M  S  R  VLLA CC+   + E  VRHYKF+VV++  TR+CSSKP VTVNG+FPGPT+Y
Sbjct  1     MGSSGVRAFVLLAFCCLLSGLAESTVRHYKFNVVLRKATRLCSSKPIVTVNGQFPGPTVY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             ARE D VLI+VVN+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQ
Sbjct  61    AREGDNVLIKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHG LVILPKLGVPYPFP P+ E V+VLAEWWKSDTEAVINEAL
Sbjct  121   RGTLFWHAHILWLRATVHGGLVILPKLGVPYPFPTPNKETVLVLAEWWKSDTEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTING PG ++NC +Q G+ L V+ GK Y+LR+INAALNEELFFK+AGH
Sbjct  181   KSGLAPNVSDAHTINGLPGSISNCPSQRGFTLPVQKGKTYLLRIINAALNEELFFKVAGH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+TVVEVDATYVKPFKTDT++IAPGQTTNV++TA+Q SG+YMVA SPFMDAPVAVDN+TA
Sbjct  241   KLTVVEVDATYVKPFKTDTVLIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTA  300

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TAT+HYTGTLA+  TT T  PP NAT +AN+F +SLRSLNSK++PANVP T+DH L FT 
Sbjct  301   TATVHYTGTLATSLTTSTNPPPQNATQIANAFTNSLRSLNSKKYPANVPLTIDHHLFFTV  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLGINPCP+CKA NGSRVVAS+NNVTFVMPTTALLQ HFF  KGVFTTDFP NPP  FNY
Sbjct  361   GLGINPCPTCKAANGSRVVASINNVTFVMPTTALLQGHFFKTKGVFTTDFPGNPPHKFNY  420

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             +G GP NLQTT+ TKL++L YNSTV+LVLQDTGIIAPENHPIHLHGFNFF VG+G+GNFN
Sbjct  421   SGPGPKNLQTTSATKLYKLQYNSTVELVLQDTGIIAPENHPIHLHGFNFFEVGRGIGNFN  480

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTDP KFNLVDPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+
Sbjct  481   PKTDPTKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVE  540

Query  388   NGKGPNES  365
             NGKGPN+S
Sbjct  541   NGKGPNQS  548



>ref|XP_004137913.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN58791.1| hypothetical protein Csa_3G732490 [Cucumis sativus]
Length=559

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/548 (79%), Positives = 488/548 (89%), Gaps = 1/548 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLA-CCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M  S  R  VLLA CC+   + E  VRHYKF+VV++  TR+CSSKP VTVNG+FPGPT+Y
Sbjct  1     MGSSGVRAFVLLAFCCLLSGLAESTVRHYKFNVVLRKATRLCSSKPIVTVNGQFPGPTVY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             ARE D VLI+VVN+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQ
Sbjct  61    AREGDNVLIKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHG LVILPKLGVPYPFP P+ E V+VLAEWWKSDTEAVINEAL
Sbjct  121   RGTLFWHAHILWLRATVHGGLVILPKLGVPYPFPTPNKETVLVLAEWWKSDTEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTING PG ++NC +Q G+ L V+ GK Y+LR+INAALNEELFFK+AGH
Sbjct  181   KSGLAPNVSDAHTINGLPGSISNCPSQRGFTLPVQKGKTYLLRIINAALNEELFFKVAGH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+TVVEVDATYVKPFKTDT++IAPGQTTNV++TA+Q SG+YMVA SPFMDAPVAVDN+TA
Sbjct  241   KLTVVEVDATYVKPFKTDTVLIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTA  300

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TAT+HYTGTLA+  TT T  PP NAT +AN+F +SLRSLNSK++PANVP T+DH L FT 
Sbjct  301   TATVHYTGTLATSLTTSTNPPPQNATQIANAFTNSLRSLNSKKYPANVPLTIDHHLFFTV  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLGINPCP+CKA NGSRVVAS+NNVTFVMPTTALLQAHFF  KGVFTTDFP NPP  FNY
Sbjct  361   GLGINPCPTCKAANGSRVVASINNVTFVMPTTALLQAHFFKTKGVFTTDFPGNPPHKFNY  420

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             +G GP NLQT + TKL++L YNSTV+LVLQDTGIIAPENHPIHLHGFNFF VG+G+GNFN
Sbjct  421   SGPGPKNLQTISATKLYKLQYNSTVELVLQDTGIIAPENHPIHLHGFNFFEVGRGIGNFN  480

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTDP KFNLVDPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+
Sbjct  481   PKTDPTKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVE  540

Query  388   NGKGPNES  365
             NGKGPN+S
Sbjct  541   NGKGPNQS  548



>ref|XP_011035200.1| PREDICTED: laccase-4 [Populus euphratica]
Length=556

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/543 (79%), Positives = 479/543 (88%), Gaps = 3/543 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             W R++VL+AC +FPA VE  VRHYKF+VVMKN TR+CS KP VTVNG+FPGPT+ AREDD
Sbjct  6     WLRVLVLVAC-LFPASVESMVRHYKFNVVMKNTTRLCSEKPIVTVNGRFPGPTLVAREDD  64

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TVL++VVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+P  S++YNFTITGQRGTL 
Sbjct  65    TVLVKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPRQSFVYNFTITGQRGTLF  124

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TVHGA+VILPK GVPYPFP P  E V+VL EWWKSD EAVINEA+ SG+A
Sbjct  125   WHAHILWLRATVHGAIVILPKRGVPYPFPTPHREEVIVLGEWWKSDVEAVINEAMSSGMA  184

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAHTINGHPGPV+ CS+QGGY L V+ GK Y+LR+INAALNEELFFKIAGH++TVV
Sbjct  185   PNVSDAHTINGHPGPVSACSSQGGYNLPVQPGKTYLLRIINAALNEELFFKIAGHQLTVV  244

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDATYVKPFK DTIVIAPGQTTNV+VTA++GSG+Y+VAASPFMDAP+AVDN TATATLH
Sbjct  245   EVDATYVKPFKIDTIVIAPGQTTNVLVTANRGSGRYLVAASPFMDAPIAVDNVTATATLH  304

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTLAS  TTLT  P  NATPVA +F D+LRSLNS ++PA VP  +DHSL FT GLG+N
Sbjct  305   YSGTLASSATTLTVPPAQNATPVATNFTDALRSLNSIKYPARVPLKIDHSLFFTVGLGVN  364

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PC +C   NGSRVVA  NNVTFVMPT ALLQAHFF IKGVFT DFP NPP  FNYTG  P
Sbjct  365   PCATCV--NGSRVVADFNNVTFVMPTIALLQAHFFNIKGVFTDDFPGNPPTPFNYTGTQP  422

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N QT  GTKL+RLAYNSTVQLVLQDTG++ PENHPIHLHGFNFF VG+G+GNFNPK DP
Sbjct  423   TNFQTVNGTKLYRLAYNSTVQLVLQDTGMLTPENHPIHLHGFNFFEVGRGIGNFNPKRDP  482

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             KKFNLVDPVERNTIG+PAGGW AIRF ADNPGVWFMHCHLEVHTTWGLKMAF+VDNGKGP
Sbjct  483   KKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGP  542

Query  373   NES  365
             NES
Sbjct  543   NES  545



>ref|XP_008239590.1| PREDICTED: laccase-4-like [Prunus mume]
Length=559

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/545 (80%), Positives = 493/545 (90%), Gaps = 2/545 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             W R +VL   C+ P +VE R+RHYKF+VV+KN TR+CS+KP VT+NG+FPGPT+YAREDD
Sbjct  4     WVRFLVLFLACLLPGLVESRIRHYKFNVVLKNTTRLCSTKPIVTINGRFPGPTLYAREDD  63

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TVL++V N+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI PG SY+YNFTITGQRGTLL
Sbjct  64    TVLVKVTNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIPPGQSYVYNFTITGQRGTLL  123

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TVHGALVILPK GVPYPFP P  E  V+LAEWWKSDTEAVIN+AL SG+A
Sbjct  124   WHAHILWLRATVHGALVILPKRGVPYPFPAPHKEVNVILAEWWKSDTEAVINQALSSGIA  183

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH INGHPGPVANCS++GG+ L VE GK Y+LR+INAALNEELFFKIAGHK+T+V
Sbjct  184   PNVSDAHIINGHPGPVANCSSEGGFTLPVENGKTYLLRIINAALNEELFFKIAGHKLTIV  243

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDATYVKPFKTDTIVIAPGQTTN ++TA+Q SG+Y+VAASPFMD+P+AVDN TATATLH
Sbjct  244   EVDATYVKPFKTDTIVIAPGQTTNALITANQNSGKYLVAASPFMDSPIAVDNLTATATLH  303

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTLA+ PTTLT  PP NAT VAN+F++SL+SLNSK+FPA VP  VDH+LLFT GLGIN
Sbjct  304   YSGTLATTPTTLTNPPPQNATQVANNFINSLKSLNSKKFPAKVPLKVDHNLLFTVGLGIN  363

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PCP+CKAGNGSRVVAS+NNVTFVMPTTALLQAH F I GVFTTDFP NPP  FN++G  P
Sbjct  364   PCPTCKAGNGSRVVASVNNVTFVMPTTALLQAHVFNISGVFTTDFPGNPPNTFNFSGGPP  423

Query  733   AN--LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKT  560
             AN  + TT GTKL+RLAYNSTVQLVLQDTG IAPENHP+HLHGFNF++VG+G+GN+NPK 
Sbjct  424   ANASMATTNGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHGFNFYSVGRGVGNYNPKK  483

Query  559   DPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  380
             DPKKFNLVDPVERNT+G+P+GGW AIRF+ADNPGVWF+HCHLEVHTTWGLKMAFLVDNGK
Sbjct  484   DPKKFNLVDPVERNTVGVPSGGWAAIRFQADNPGVWFLHCHLEVHTTWGLKMAFLVDNGK  543

Query  379   GPNES  365
             GPNES
Sbjct  544   GPNES  548



>ref|XP_007205010.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
 gb|EMJ06209.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
Length=559

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/546 (79%), Positives = 493/546 (90%), Gaps = 2/546 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R +VL   C+ P +VE R+RHYKF+VV+KN TR+CS+KP VT+NG+FPGPT+YARED
Sbjct  3     SWVRFLVLFLACLLPGLVESRIRHYKFNVVLKNTTRLCSTKPIVTINGRFPGPTLYARED  62

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++V N+VKYNVSIHWHG+RQL+TGWADGPAYITQCPI PG SY+YNFTITGQRGTL
Sbjct  63    DTVLVKVTNHVKYNVSIHWHGVRQLQTGWADGPAYITQCPIPPGQSYVYNFTITGQRGTL  122

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+TVHGALVILPK GVPYPFP P  E  V+LAEWWKSDTEAVIN+AL SG+
Sbjct  123   LWHAHILWLRATVHGALVILPKRGVPYPFPAPHKEVNVILAEWWKSDTEAVINQALSSGV  182

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPG VANCS+QGG+ L VE GK Y+LR+INAALNEELFFKIAGHK+T+
Sbjct  183   APNVSDAHTINGHPGSVANCSSQGGFTLPVEKGKTYLLRIINAALNEELFFKIAGHKLTI  242

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTN ++TA+Q SG+Y+VAASPFMD+P+AVDN TATATL
Sbjct  243   VEVDATYVKPFKTDTIVIAPGQTTNALITANQNSGKYLVAASPFMDSPIAVDNLTATATL  302

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLA+ PTTLT  PP NAT VAN+F++SL+SLNSK+FPA VP  +DH+LLFT GLGI
Sbjct  303   HYSGTLATTPTTLTNPPPQNATQVANNFINSLKSLNSKKFPAKVPLKIDHNLLFTVGLGI  362

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+CKAGNGSRVVAS+NNVTFVMPTTALLQAH F I GVFTTDFP NPP  FN++G  
Sbjct  363   NPCPTCKAGNGSRVVASVNNVTFVMPTTALLQAHVFNISGVFTTDFPGNPPNTFNFSGGP  422

Query  736   PAN--LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
              AN  + TT GTKL+RLAYNSTVQLVLQDTG IAPENHP+HLHG+NF+AVG+G+GN+NPK
Sbjct  423   SANASMATTNGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHGYNFYAVGRGVGNYNPK  482

Query  562   TDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  383
              DPKKFNLVDPVERNT+G+P+GGW AIRF+ADNPGVWF+HCHLEVHTTWGLKMAFLVDNG
Sbjct  483   KDPKKFNLVDPVERNTVGVPSGGWAAIRFQADNPGVWFLHCHLEVHTTWGLKMAFLVDNG  542

Query  382   KGPNES  365
             KGPNES
Sbjct  543   KGPNES  548



>ref|XP_004302643.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/549 (80%), Positives = 497/549 (91%), Gaps = 4/549 (1%)
 Frame = -3

Query  1999  CSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARE  1820
              SW R+++LL  C+ PA+VE RVR+YKF+VV++N TR+CS+KP VT+NG+FPGPT+YARE
Sbjct  2     ASWIRVLLLLLACLLPALVESRVRNYKFNVVLRNTTRLCSTKPIVTINGRFPGPTLYARE  61

Query  1819  DDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGT  1640
             DDTVL++V N+V YNVSIHWHGIRQ+RTGW+DGPAYITQCPI  G S+ YNFTITGQRGT
Sbjct  62    DDTVLVKVTNHVTYNVSIHWHGIRQIRTGWSDGPAYITQCPIPQGQSFTYNFTITGQRGT  121

Query  1639  LLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSG  1460
             LLWHAHILWLR+TVHGALVILPK GVPYPFP P  E  VVLAEWWKSDTEAVINEALK G
Sbjct  122   LLWHAHILWLRATVHGALVILPKRGVPYPFPTPHKEVPVVLAEWWKSDTEAVINEALKGG  181

Query  1459  LAPNVSDAHTINGHPGPVA-NCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             LAPNVSDAHTINGHPG V+ NC+T GG++LSVE+GK Y+LR+INAALNEELFFKIAGHK+
Sbjct  182   LAPNVSDAHTINGHPGLVSPNCTTDGGFKLSVESGKTYLLRIINAALNEELFFKIAGHKL  241

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTAT  1106
             T+VEVDATYVKPFKTDTIVIAPGQTTN ++TA+Q SG+Y+V ASPF+D P +AVDN T+T
Sbjct  242   TIVEVDATYVKPFKTDTIVIAPGQTTNALITANQKSGKYLVTASPFLDTPGIAVDNLTST  301

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             AT+HY+GTL++ PTTLT+ PP NAT VANSF DSLRSLN+ +FPA VP  +DH+LLFT G
Sbjct  302   ATVHYSGTLSNSPTTLTSPPPQNATQVANSFTDSLRSLNTMKFPAKVPLKIDHNLLFTIG  361

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCPSCKAGNGSRVVAS+NNVTFVMPTTALLQAHFF  KGVFTTDFPANPP AFN++
Sbjct  362   LGINPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFKTKGVFTTDFPANPPNAFNFS  421

Query  745   GAGPAN--LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             G  PAN  L TT GTK++RLAYNSTVQLVLQDTGIIAPENHP+HLHGFNFFA+G+GLGN+
Sbjct  422   GGLPANSSLATTNGTKVYRLAYNSTVQLVLQDTGIIAPENHPVHLHGFNFFAIGRGLGNY  481

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             NPKTDPK FNLVDPVERNTIG+P+GGWVAIRF ADNPGVWFMHCHLEVHT+WGLKMAFLV
Sbjct  482   NPKTDPKNFNLVDPVERNTIGVPSGGWVAIRFIADNPGVWFMHCHLEVHTSWGLKMAFLV  541

Query  391   DNGKGPNES  365
             DNGKGPN+S
Sbjct  542   DNGKGPNQS  550



>ref|XP_009358852.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=559

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/544 (81%), Positives = 489/544 (90%), Gaps = 2/544 (0%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
              R +VLL  C+ PA+VE RVRHYKF+VV++N T++CSSKP VTVNGKFPGPT+YAREDD 
Sbjct  5     IRFLVLLLACVLPALVESRVRHYKFNVVLRNKTKLCSSKPIVTVNGKFPGPTLYAREDDN  64

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             VL++V N+VKYNVSIHWHGIRQLRTGW+DGPAYITQCPI PG SY+YNFTITGQRGTLLW
Sbjct  65    VLVKVTNHVKYNVSIHWHGIRQLRTGWSDGPAYITQCPIPPGQSYVYNFTITGQRGTLLW  124

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHI WLR+TVHGALVILPK GVPYPFP P  E  VVL EWWKSDTE VIN+ALKSG+AP
Sbjct  125   HAHINWLRATVHGALVILPKRGVPYPFPAPHKEVNVVLGEWWKSDTETVINQALKSGIAP  184

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             NVSDAHTINGHPG V NCS++GG+ L VE+GK Y+LR+INAALNEELFFKIAGH +T+VE
Sbjct  185   NVSDAHTINGHPGVVPNCSSEGGFTLPVESGKTYLLRIINAALNEELFFKIAGHNLTIVE  244

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             VDATYVKPFKTDTIVIAPGQTTN +VTA+Q SG+YM+AASPFMD+P+AVDN TATATLHY
Sbjct  245   VDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMMAASPFMDSPIAVDNLTATATLHY  304

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             TGTLAS PTTLT+ PP NAT VANSF++SL++LNS +FPA VP  +DH+LLFT GLGINP
Sbjct  305   TGTLASTPTTLTSPPPQNATQVANSFINSLKALNSNKFPAKVPLKIDHNLLFTVGLGINP  364

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             CPSCKAGNGSRVVAS+NNVTFVMPTTALLQAHFF   GVFTTDFP NPP AFNY+G  PA
Sbjct  365   CPSCKAGNGSRVVASVNNVTFVMPTTALLQAHFFNKSGVFTTDFPGNPPMAFNYSGGPPA  424

Query  730   N--LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             N  L TT GT+L+RLAYNSTVQLVLQDTG IAPENHPIHLHG+NFF+VG+G+GN+NPKTD
Sbjct  425   NSSLATTNGTRLYRLAYNSTVQLVLQDTGTIAPENHPIHLHGYNFFSVGRGVGNYNPKTD  484

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PKKFNLVDPVERNT  +P+GGW AIRF ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG
Sbjct  485   PKKFNLVDPVERNTANVPSGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  544

Query  376   PNES  365
             PN+S
Sbjct  545   PNQS  548



>ref|XP_008377498.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/546 (81%), Positives = 493/546 (90%), Gaps = 2/546 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             S  R +VL   C+ PA+VE RVRHYKF+VV++N T++CSSKP VTVNG+FPGPT+YARED
Sbjct  3     SSIRFLVLFLACILPALVESRVRHYKFNVVLRNSTKLCSSKPIVTVNGQFPGPTLYARED  62

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++V N+VKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPG SY+YNFTITGQRGTL
Sbjct  63    DTVLVKVTNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGQSYVYNFTITGQRGTL  122

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+TVHGAL++LPK GVPYPFP P  E  VVLAEWWKSDTEAVIN+ALKSGL
Sbjct  123   LWHAHILWLRATVHGALIVLPKRGVPYPFPAPHKEVPVVLAEWWKSDTEAVINQALKSGL  182

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGPV NCS+QGG+ L VE GK Y+LR+INAALNEELFFKIAGH +T+
Sbjct  183   APNVSDAHTINGHPGPVPNCSSQGGFTLPVENGKTYLLRIINAALNEELFFKIAGHILTI  242

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTN +VTA+Q SG+YM++ASPFMD+P+AVDN TATATL
Sbjct  243   VEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMLSASPFMDSPIAVDNLTATATL  302

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HYTGTLA+ PTTLT+ PP NAT VANSF++SL++LNSK+FPA VP  +DH+LLFT GLGI
Sbjct  303   HYTGTLATTPTTLTSPPPQNATQVANSFINSLKALNSKKFPAKVPLKIDHNLLFTVGLGI  362

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             N CPSCKA NGSRVVAS+NNVTFVMPTTALLQAHFF   GVFTTDFP NPP AFN++G  
Sbjct  363   NSCPSCKAANGSRVVASVNNVTFVMPTTALLQAHFFNKSGVFTTDFPGNPPTAFNFSGGL  422

Query  736   PAN--LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
             PAN  L TT GTKL+RLAYNSTVQLVLQDTG IAPENHP+HLHGFNFF+VG+G+GN+NPK
Sbjct  423   PANASLATTRGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHGFNFFSVGRGIGNYNPK  482

Query  562   TDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  383
             TDPKKFNLVDPVERNT  +P GGWVAIRF ADNPGVWFMHCHLEVHTTWGLKMAFLVDNG
Sbjct  483   TDPKKFNLVDPVERNTANVPTGGWVAIRFIADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  542

Query  382   KGPNES  365
             KGPN+S
Sbjct  543   KGPNQS  548



>ref|XP_008388134.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/544 (81%), Positives = 484/544 (89%), Gaps = 2/544 (0%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
              R  VL   C+ PA+VE RVRHYKF+VV++N T++CSSKP VTVNGKFPGPT+YAREDDT
Sbjct  5     IRFJVLFLACVLPALVESRVRHYKFNVVLRNKTKLCSSKPIVTVNGKFPGPTLYAREDDT  64

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             VL++V N+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI  G SY+YNFTITGQRGTLLW
Sbjct  65    VLVKVTNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQRGTLLW  124

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHILWLR+TVHGALVILPK GVPYPFP P  E  VVL EWWKSDTE VIN+ALKSG+AP
Sbjct  125   HAHILWLRATVHGALVILPKRGVPYPFPAPHKEVNVVLGEWWKSDTETVINQALKSGIAP  184

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             NVSDAHTINGHPG V NCS+QGG+ L VE+GK Y+LR+INAALNEELFFKIAGH +T+VE
Sbjct  185   NVSDAHTINGHPGVVPNCSSQGGFTLPVESGKTYLLRIINAALNEELFFKIAGHNLTIVE  244

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             VDATYVKPFKTDTIVIAPGQTTN +VTA+Q SG+YMVAASPFMD+P+AVDN TATATLHY
Sbjct  245   VDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMVAASPFMDSPIAVDNLTATATLHY  304

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             TGTLAS PTTLT+ PP NAT VANSF++SL++LNS  FPA VP  +DH+LLFT GLGINP
Sbjct  305   TGTLASTPTTLTSPPPQNATQVANSFINSLKALNSNNFPAKVPLKIDHNLLFTVGLGINP  364

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             CPSCKAGNGSRVV S+NNV+FVMPTTALLQAH F   GVFTTDFP NPP AFNY+G  PA
Sbjct  365   CPSCKAGNGSRVVGSVNNVSFVMPTTALLQAHVFNKSGVFTTDFPGNPPTAFNYSGGPPA  424

Query  730   N--LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             N  L TT GTKL+RLAYNSTVQLVLQDTG IAPENHPIHLHGFNFF VG+G+GN+NPKTD
Sbjct  425   NASLATTNGTKLYRLAYNSTVQLVLQDTGTIAPENHPIHLHGFNFFCVGRGVGNYNPKTD  484

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PKKFNLVDPVERNT  IP+GGW AIRF ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG
Sbjct  485   PKKFNLVDPVERNTANIPSGGWTAIRFVADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  544

Query  376   PNES  365
             PN+S
Sbjct  545   PNQS  548



>gb|KDP46534.1| hypothetical protein JCGZ_08506 [Jatropha curcas]
Length=563

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/540 (79%), Positives = 479/540 (89%), Gaps = 3/540 (1%)
 Frame = -3

Query  1984  IVVLLACC-MFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             I+V +AC  MFPA V+C VRHYKF+VVMK  TR+CSSKP VTVNGKFPGPTI AREDDTV
Sbjct  14    ILVAMACLIMFPASVDCLVRHYKFNVVMKKATRLCSSKPIVTVNGKFPGPTIVAREDDTV  73

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFT+TGQRGTLLWH
Sbjct  74    LVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYLYNFTVTGQRGTLLWH  133

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AHILWLR+TVHGA+VILPK GVPYPFP P  E V+VL EWWKSD EAV+NEA+KSG APN
Sbjct  134   AHILWLRATVHGAIVILPKRGVPYPFPTPHKEEVIVLGEWWKSDVEAVVNEAMKSGGAPN  193

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAHTINGHPGPV  C +QGG+ L VE+GK YMLR+INAALNEELFFKIA HK+TVVEV
Sbjct  194   VSDAHTINGHPGPVPACPSQGGFNLPVESGKTYMLRIINAALNEELFFKIACHKLTVVEV  253

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYT  1088
             DATYVKPFKTDTIVIAPGQTTNV++TAD+ SG+Y+VAASPFMDAP+AVDN TA+ATLHY+
Sbjct  254   DATYVKPFKTDTIVIAPGQTTNVLLTADRTSGKYLVAASPFMDAPIAVDNVTASATLHYS  313

Query  1087  GTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPC  908
             G L+S  T LT  PP NATP+A +F +SLRSLNSK++PANVP  +DH L FT GLG+NPC
Sbjct  314   GALSSAATILTVPPPQNATPIAATFANSLRSLNSKKYPANVPLKIDHFLFFTIGLGVNPC  373

Query  907   PSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPAN  728
              +C  GN  RVVA +NNVTFVMPT +LLQAHFF I GVFT DFP NPP  FNYTG  P+N
Sbjct  374   ATCATGN--RVVADINNVTFVMPTISLLQAHFFNISGVFTDDFPGNPPVQFNYTGTQPSN  431

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             +QT  GT+L+RLAYNSTVQ+VLQDTG+IAPENHPIHLHGFNFF VG+G+GNFNPK DPKK
Sbjct  432   VQTNNGTRLYRLAYNSTVQIVLQDTGMIAPENHPIHLHGFNFFEVGRGVGNFNPKKDPKK  491

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             FNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VDNGKGPNE
Sbjct  492   FNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNE  551



>ref|XP_002314124.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
 gb|EEE88079.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
Length=556

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/548 (78%), Positives = 481/548 (88%), Gaps = 3/548 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R++VL+AC +FPA VE  VRHYKF+VVMKN T++CS+KP VTVNG+FPGPT+ 
Sbjct  1     MDMAPWIRVLVLVAC-LFPASVESMVRHYKFNVVMKNSTKLCSTKPIVTVNGQFPGPTLV  59

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG S++YNFTITGQ
Sbjct  60    AREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSFVYNFTITGQ  119

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTLLWHAHILWLR+TVHGA+VILPK GVPYPFP P  E V++L EWWKSD EAVINEA 
Sbjct  120   RGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPTPRKEKVIILGEWWKSDVEAVINEAT  179

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSG+APNVSDAHTINGHPGPV+ CS+ GGY LSV  GK YMLR+INAALNEELFFKIAGH
Sbjct  180   KSGIAPNVSDAHTINGHPGPVSACSSHGGYNLSVHPGKTYMLRIINAALNEELFFKIAGH  239

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             ++TVVEVDATYVKPFK DT+VIAPGQTTNV+VTA++GSGQY+VAASPFMDAP+AVDN TA
Sbjct  240   QLTVVEVDATYVKPFKIDTVVIAPGQTTNVLVTANRGSGQYLVAASPFMDAPIAVDNVTA  299

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATLHY+GTLAS  TTLT  P  NATPVA +F ++LRSLNS ++PA VP  +DHSL FT 
Sbjct  300   TATLHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARVPLKIDHSLFFTV  359

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPC +C   NGSRVVA +NNVTFVMPT ALLQAH F I GVFT DFPANPP  FNY
Sbjct  360   GLGVNPCATCI--NGSRVVADINNVTFVMPTIALLQAHVFNISGVFTDDFPANPPTPFNY  417

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P N QT  GTKL+RLAYN+TVQLVLQDTG++ PENHP+HLHGFNFF VG+G+GNF+
Sbjct  418   TGTQPTNFQTVKGTKLYRLAYNNTVQLVLQDTGMLTPENHPVHLHGFNFFEVGRGVGNFD  477

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             P  DPKKFNLVDPVERNTIG+PAGGW AIRF ADNPGVWFMHCHLEVHTTWGLKMAF+VD
Sbjct  478   PNKDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVD  537

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  538   NGKGPNES  545



>ref|XP_003544873.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN40048.1| Laccase-4 [Glycine soja]
Length=557

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/548 (76%), Positives = 483/548 (88%), Gaps = 3/548 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M   W RI++L+A CM P  VE  VRHYKF+VV+KN+TR+CS+KP VTVNGKFPGPTIYA
Sbjct  1     MAMMWIRIILLVAACMLPLSVEAMVRHYKFNVVVKNVTRLCSTKPIVTVNGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL++VVN+VKYNVSIHWHG+RQL+TGWADGPAYITQCPI+PG +++YNFT+TGQR
Sbjct  61    REDDTVLVKVVNHVKYNVSIHWHGVRQLQTGWADGPAYITQCPIQPGQAFVYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAHILWLRSTVHGALVILPKLGVPYPFPKP  E V++L+EWWKSDTEAVINEALK
Sbjct  121   GTLWWHAHILWLRSTVHGALVILPKLGVPYPFPKPHTEKVIILSEWWKSDTEAVINEALK  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SG APNVSDAHTINGHPG V NC++QGGY+L V+ G  Y+LR+INAALNEELFFKIAGH+
Sbjct  181   SGSAPNVSDAHTINGHPGSVQNCASQGGYKLQVQPGNTYLLRIINAALNEELFFKIAGHQ  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA Y KPFKTDTIVIAPGQTTNV++ A++ +G+Y+VAA+PFMD+P+ VDN TAT
Sbjct  241   LTVVEVDAVYTKPFKTDTIVIAPGQTTNVLLKANRAAGKYLVAATPFMDSPITVDNVTAT  300

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHYTG+L S  TTLT+ PP NATPVA +F DSLRSLNSK++PA VPQ VDHSL FT  
Sbjct  301   ATLHYTGSLGSTITTLTSLPPKNATPVATNFTDSLRSLNSKKYPARVPQKVDHSLFFTVS  360

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LG+NPCP+C   NGS+VVA++NNVTFVMP  +LLQAHFF I GVFT DFP  PP  +++T
Sbjct  361   LGVNPCPTC--ANGSKVVAAINNVTFVMPKVSLLQAHFFNISGVFTDDFPGKPPVVYDFT  418

Query  745   GA-GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             G   P NL+T  GT+++RLAYNSTVQLVLQDTG+I PENHPIHLHGFNFF VG+G GNFN
Sbjct  419   GTQQPTNLRTNRGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQGNFN  478

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PK D KKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VD
Sbjct  479   PKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVD  538

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  539   NGKGPNES  546



>ref|XP_003522150.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN02155.1| Laccase-4 [Glycine soja]
Length=557

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/547 (78%), Positives = 488/547 (89%), Gaps = 1/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M+  W R+V+L+AC + PA+VECRVRHYKF VV K   R+CSSK  VT+NGKFPGPT+YA
Sbjct  1     MDSHWVRMVLLIAC-ILPALVECRVRHYKFHVVSKQTNRLCSSKSIVTINGKFPGPTLYA  59

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL++V+N V +NV+IHWHG+RQLRTGWADGPAY+TQCPI+PG +Y+YNFT+TGQR
Sbjct  60    REDDTVLVKVINQVNHNVTIHWHGVRQLRTGWADGPAYVTQCPIQPGQTYLYNFTLTGQR  119

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLL+HAH+ WLRST+HGALVILPK GVPYPFPKPD E VVVL EWWKSDTEA+INEALK
Sbjct  120   GTLLYHAHVNWLRSTLHGALVILPKRGVPYPFPKPDDELVVVLGEWWKSDTEAIINEALK  179

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTING PG V NCSTQ  Y L VE+GK Y+LR+INAALNEELFFKIAGHK
Sbjct  180   SGLAPNVSDAHTINGLPGAVTNCSTQDVYNLPVESGKTYLLRIINAALNEELFFKIAGHK  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDATYVKPFK +TI+IAPGQTTNV++ ADQ  G+Y+VAASPFMDAP+AVDN TAT
Sbjct  240   LTVVEVDATYVKPFKIETILIAPGQTTNVLLNADQKFGKYLVAASPFMDAPIAVDNLTAT  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHYTGTLA+ PT LTT PP N+T +AN+F+ SLR LNSK++P NVP TVDHSL FT G
Sbjct  300   ATLHYTGTLAATPTILTTPPPKNSTQIANNFISSLRGLNSKKYPVNVPLTVDHSLFFTVG  359

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGI+PCPSCKA NGSRVVA++NNVTF+MPT ALLQAH+F IKGVFTTDFPANPP  FNY+
Sbjct  360   LGISPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTTDFPANPPHLFNYS  419

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G GPANL T TGTK++R+ +N+TVQ+VLQDTGIIAPENHP+HLHGFNFF VG+G+GNFNP
Sbjct  420   GPGPANLNTETGTKVYRVPFNATVQVVLQDTGIIAPENHPVHLHGFNFFVVGRGVGNFNP  479

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             K DPK FNLVDPVERNTIG+PAGGW A RFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN
Sbjct  480   KIDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  539

Query  385   GKGPNES  365
             GKGP +S
Sbjct  540   GKGPKQS  546



>ref|XP_003516941.1| PREDICTED: laccase-4-like [Glycine max]
Length=557

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/547 (79%), Positives = 488/547 (89%), Gaps = 1/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M   W R+++L+AC + PA+VECR RHYKF VV K   R+CSSK  VT+NGKFPGPT+YA
Sbjct  1     MYSHWVRLMLLIAC-ILPALVECRERHYKFHVVSKQTNRLCSSKSIVTINGKFPGPTLYA  59

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL++V+N V +NV+IHWHG+RQLRTGWADGPAY+TQCPI+PG +Y+YNFT+TGQR
Sbjct  60    REDDTVLVKVINQVNHNVTIHWHGVRQLRTGWADGPAYVTQCPIQPGQTYVYNFTLTGQR  119

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLL+HAH+ WLRST++GALVILPK GVPYPFPKPD E VVVL EWWKSDTEAVINEALK
Sbjct  120   GTLLYHAHVNWLRSTLYGALVILPKRGVPYPFPKPDDELVVVLGEWWKSDTEAVINEALK  179

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTING PG V NCSTQ  Y L VE+GK Y+LR++NAALNEELFFKIAGHK
Sbjct  180   SGLAPNVSDAHTINGLPGTVTNCSTQDVYNLPVESGKTYLLRIVNAALNEELFFKIAGHK  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDATYVKPFK +TIVIAPGQTTNV++ A+Q SG+Y+VAASPFMDAPVAVDN TAT
Sbjct  240   LTVVEVDATYVKPFKIETIVIAPGQTTNVLLNANQKSGKYLVAASPFMDAPVAVDNLTAT  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHYTGTLA+ PT LTT PP NAT +AN+F+ SLR LNSK++P NVP TVDHSL+FT G
Sbjct  300   ATLHYTGTLAATPTILTTPPPKNATQIANNFISSLRGLNSKKYPVNVPLTVDHSLIFTVG  359

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCPSCKA NGSRVVA++NNVTF+MPT ALLQAH+F IKGVFTTDFPANPP  FNY+
Sbjct  360   LGINPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTTDFPANPPHVFNYS  419

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G GPANL T TGTK++RL +N+TVQ+VLQDTGIIAPENHP+HLHGFNFF VG+G+GNFNP
Sbjct  420   GPGPANLNTETGTKVYRLPFNATVQVVLQDTGIIAPENHPVHLHGFNFFVVGRGVGNFNP  479

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             K DPK FNLVDPVERNTIG+PAGGW A RFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN
Sbjct  480   KIDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  539

Query  385   GKGPNES  365
             GKGP +S
Sbjct  540   GKGPKQS  546



>ref|XP_003518300.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN46170.1| Laccase-4 [Glycine soja]
Length=557

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/548 (76%), Positives = 483/548 (88%), Gaps = 3/548 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M   W R++++LA CM P  VE  VRHYKF+VV+KN+TR+CS+KP VTVNGKFPGPTIYA
Sbjct  1     MAMMWIRVILILAACMLPLSVEAMVRHYKFNVVVKNVTRLCSTKPIVTVNGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL++VVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG +++YNFT+TGQR
Sbjct  61    REDDTVLVKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQAFVYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAHILWLRSTVHGALVILPKLGVPYPFPKP  E V++L+EWWKSDTEAVINEALK
Sbjct  121   GTLWWHAHILWLRSTVHGALVILPKLGVPYPFPKPHTEKVIILSEWWKSDTEAVINEALK  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTINGHPG V NC++QGGY L V+ G  Y+LR+INAALNEELFFKIAGH+
Sbjct  181   SGLAPNVSDAHTINGHPGSVQNCASQGGYELQVQPGNTYLLRIINAALNEELFFKIAGHQ  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA Y KPFKTDTIVIAPGQTT+V++ A++ +G+Y+VAA+PFMD+P+AVDN TAT
Sbjct  241   LTVVEVDAVYTKPFKTDTIVIAPGQTTSVLLKANRAAGKYLVAATPFMDSPIAVDNVTAT  300

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHYTG+L S  TTLT+ PP NATPVA +F DSLRSLNSK++PA VPQ VDHSL FT  
Sbjct  301   ATLHYTGSLGSTITTLTSLPPKNATPVATNFTDSLRSLNSKKYPARVPQKVDHSLFFTIS  360

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LG+NPCP+C   NGS+VVA++NNVTFVMP  +LLQAHFF I GVF  DFP  PP  +++T
Sbjct  361   LGVNPCPTCV--NGSKVVAAINNVTFVMPKVSLLQAHFFNISGVFIDDFPGKPPVVYDFT  418

Query  745   GA-GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             G   P NL+T  GT+++RLAYNSTVQLVLQDTG+I PENHP+HLHGFNFF VG+G GNFN
Sbjct  419   GTQQPTNLRTNRGTRVYRLAYNSTVQLVLQDTGMITPENHPLHLHGFNFFVVGRGQGNFN  478

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PK D KKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VD
Sbjct  479   PKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVD  538

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  539   NGKGPNES  546



>ref|XP_009370205.1| PREDICTED: laccase-4 [Pyrus x bretschneideri]
Length=559

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/546 (81%), Positives = 492/546 (90%), Gaps = 2/546 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             S  R +VL   C+ PA+VE RVRHYKF+VV++N T++CSSKP VTVNG+FPGPT+YARED
Sbjct  3     SSIRFLVLFLACILPALVESRVRHYKFNVVLRNSTKLCSSKPIVTVNGQFPGPTLYARED  62

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++V N+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI PG SY+YNFTITGQRGTL
Sbjct  63    DTVLVKVTNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIPPGQSYVYNFTITGQRGTL  122

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+TVHGAL++LPK GVPYPFP P  E  VVLAEWWKSDTEAVIN+ALKSGL
Sbjct  123   LWHAHILWLRATVHGALIVLPKRGVPYPFPAPHKEVPVVLAEWWKSDTEAVINQALKSGL  182

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPG V NCS+QGG+ L V+ GK Y+LR+INAALNEELFFKIAGH +T+
Sbjct  183   APNVSDAHTINGHPGLVPNCSSQGGFTLPVKNGKTYLLRIINAALNEELFFKIAGHNLTI  242

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTDTIVIAPGQTTN +VTA+Q SG+YMVAASPFMD+P+AVDN TATATL
Sbjct  243   VEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMVAASPFMDSPIAVDNLTATATL  302

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HYTGTLA+ PTTLT+APP NAT VANSF++SL++LNSK+FPA VP  +DH+LLFT GLGI
Sbjct  303   HYTGTLATTPTTLTSAPPQNATQVANSFINSLKALNSKKFPAKVPLKIDHNLLFTVGLGI  362

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             N CPSCKA NGSRVVAS+NNVTFVMPTTALLQAHFF   GVFTTDFP NPP AFN++G  
Sbjct  363   NSCPSCKAANGSRVVASVNNVTFVMPTTALLQAHFFNKSGVFTTDFPGNPPTAFNFSGGL  422

Query  736   PAN--LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
             PAN  L TT+GTKL+RLAYNSTVQLVLQDTG IAPENHP+HLHGFNFF+VG+G+GN+N K
Sbjct  423   PANASLATTSGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHGFNFFSVGRGIGNYNSK  482

Query  562   TDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  383
             TDPKKFNLVDPVERNT  +P GGWVAIRF ADNPGVWFMHCHLEVHTTWGLKMAFLVDNG
Sbjct  483   TDPKKFNLVDPVERNTANVPTGGWVAIRFIADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  542

Query  382   KGPNES  365
             KGPN+S
Sbjct  543   KGPNQS  548



>gb|KHN06247.1| Laccase-4 [Glycine soja]
Length=556

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/547 (76%), Positives = 479/547 (88%), Gaps = 2/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M     RI++L+A C+ P  VE  VRHYKF+VV+KN TR+CS+KP VTVNGKFPGP IYA
Sbjct  1     MAAFGIRIMLLMAACLLPLSVEAMVRHYKFNVVLKNATRLCSTKPIVTVNGKFPGPNIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL++VVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG +++YNFT+TGQR
Sbjct  61    REDDTVLVKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQAFIYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAHILWLR+TVHGALVILPKLGVPYPFPKP+ E V++L+EWWKSDTEAVINEALK
Sbjct  121   GTLWWHAHILWLRATVHGALVILPKLGVPYPFPKPNMEQVMILSEWWKSDTEAVINEALK  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTINGHPGPV  C++Q G++L V+ G  Y+LR+INAALNEELFFKIAGH+
Sbjct  181   SGLAPNVSDAHTINGHPGPVQGCASQEGFKLDVQPGNTYLLRIINAALNEELFFKIAGHE  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA Y KPFKTDTIVIAPGQTTNV++T    +G+Y+VAASPFMDAP+AVDN+TAT
Sbjct  241   LTVVEVDAVYTKPFKTDTIVIAPGQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTAT  300

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHY+GTL S  TTLT+ PP NATP+A SF DSLRSLNSK++PA VP  +DH+LLFT  
Sbjct  301   ATLHYSGTLGSTITTLTSMPPKNATPLATSFTDSLRSLNSKKYPARVPLKIDHNLLFTVS  360

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPC +C   N SRVVA +NNVTFVMP  +LLQAHFF IKGVFT DFP NPP  +N+T
Sbjct  361   LGINPCATCV--NNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVVYNFT  418

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  P+NL+T  GT+++RLAYNSTVQLVLQDTG+I PENHPIHLHGFNFF VG+G  NFNP
Sbjct  419   GTQPSNLRTMKGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQRNFNP  478

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
               DPKKFNLVDPVERNT+G+PAGGW AIRFR DNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  479   TKDPKKFNLVDPVERNTVGVPAGGWTAIRFRTDNPGVWFMHCHLEIHTTWGLKMAFVVDN  538

Query  385   GKGPNES  365
             GKGPNES
Sbjct  539   GKGPNES  545



>ref|XP_010104683.1| hypothetical protein L484_022066 [Morus notabilis]
 gb|EXC01489.1| hypothetical protein L484_022066 [Morus notabilis]
Length=556

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/548 (77%), Positives = 476/548 (87%), Gaps = 3/548 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+ +L+AC +FPA V+C VRHYKF+VV+KN T++CSSKP VTVNGKFPGPTIY
Sbjct  1     MEMVPWVRVFILVAC-LFPASVDCMVRHYKFNVVLKNTTKLCSSKPIVTVNGKFPGPTIY  59

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDT+LI+VVN+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQ
Sbjct  60    AREDDTLLIKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  119

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHGA+VILPK GVPYPFP P+ E V+VL EWWKSD E+VIN+AL
Sbjct  120   RGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPTPNKEEVIVLGEWWKSDVESVINQAL  179

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTING PGPV+NC +QGG+ L VE+G+ YMLR++NAALNEELFFKIAGH
Sbjct  180   KSGLAPNVSDAHTINGQPGPVSNCPSQGGFTLPVESGQTYMLRIVNAALNEELFFKIAGH  239

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+ VVEVDA Y KPFKTDTIVIAPGQTTN ++TADQ +G+Y V ASP+MDAP+AVDN+TA
Sbjct  240   KLAVVEVDAVYTKPFKTDTIVIAPGQTTNALLTADQNAGKYSVLASPYMDAPIAVDNKTA  299

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATLHY+GTL+S  T LT  PP NAT +A  F +SLRSLNSK++PA VP  +DHSLLFT 
Sbjct  300   TATLHYSGTLSSSRTILTAPPPQNATSIATKFTNSLRSLNSKKYPARVPLKIDHSLLFTI  359

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPC +C   NGSRVVA +NNVTFVMP  ALLQAHFF I GVFT DFP  PP  FNY
Sbjct  360   GLGVNPCKTCV--NGSRVVADINNVTFVMPNIALLQAHFFNISGVFTDDFPGKPPVPFNY  417

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P+N  TT GT+L+RLAY STVQLVLQDTG+I PENHPIHLHGFNFF VGKGLGNFN
Sbjct  418   TGTQPSNFATTQGTRLYRLAYKSTVQLVLQDTGMITPENHPIHLHGFNFFVVGKGLGNFN  477

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             P  D K FNLVDPVERNTIG+P+GGW AIRF+ADNPGVWFMHCHLEVHTTWGLKMAF+VD
Sbjct  478   PNKDQKNFNLVDPVERNTIGVPSGGWTAIRFKADNPGVWFMHCHLEVHTTWGLKMAFVVD  537

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  538   NGKGPNES  545



>ref|XP_003551299.1| PREDICTED: laccase-4-like [Glycine max]
Length=556

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/547 (76%), Positives = 480/547 (88%), Gaps = 2/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M     RI++L+A C+ P  VE  VRHYKF+VV+KN TR+CS+KP VTVNGKFPGPTIYA
Sbjct  1     MAAFGIRIMLLMAACLLPLSVEAMVRHYKFNVVLKNATRLCSTKPIVTVNGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVL++VVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG +++YNFT+TGQR
Sbjct  61    REDDTVLVKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQAFIYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAHILWLR+TVHGALVILPKLGVPYPFPKP+ E V++L+EWWKSDTEAVINEALK
Sbjct  121   GTLWWHAHILWLRATVHGALVILPKLGVPYPFPKPNMEQVMILSEWWKSDTEAVINEALK  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVS+AHTINGHPGPV  C++Q G++L V+ G  Y+LR+INAALNEELFFKIAGH+
Sbjct  181   SGLAPNVSNAHTINGHPGPVQGCASQEGFKLDVQPGNTYLLRIINAALNEELFFKIAGHE  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA Y KPFKTDTIVIAPGQTTNV++T    +G+Y+VAASPFMDAP+AVDN+TAT
Sbjct  241   LTVVEVDAVYTKPFKTDTIVIAPGQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTAT  300

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHY+GTL S  TTLT+ PP NATP+A SF DSLRSLNSK++PA VP  +DH+LLFT  
Sbjct  301   ATLHYSGTLGSTITTLTSMPPKNATPLATSFTDSLRSLNSKKYPARVPLKIDHNLLFTVS  360

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPC +C   N SRVVA +NNVTFVMP  +LLQAHFF IKGVFT DFP NPP  +N+T
Sbjct  361   LGINPCATCV--NNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVVYNFT  418

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  P+NL+T  GT+++RLAYNSTVQLVLQDTG+I PENHPIHLHGFNFF VG+G  NFNP
Sbjct  419   GTQPSNLRTMKGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQRNFNP  478

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
               DPKKFNLVDPVERNT+G+PAGGW AIRFR DNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  479   TKDPKKFNLVDPVERNTVGVPAGGWTAIRFRTDNPGVWFMHCHLEIHTTWGLKMAFVVDN  538

Query  385   GKGPNES  365
             GKGPNES
Sbjct  539   GKGPNES  545



>ref|XP_010553253.1| PREDICTED: laccase-4 [Tarenaya hassleriana]
Length=559

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/540 (76%), Positives = 482/540 (89%), Gaps = 0/540 (0%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             +V++   C++P++ E  VRHYKF++VMKN TR+CSSKP VTVNG++PGPTIYAREDDT+L
Sbjct  9     LVLVSFFCVYPSLTEGLVRHYKFNIVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLL  68

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             I+VVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG  Y+YN+T+TGQRGTL WHA
Sbjct  69    IKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQVYVYNYTLTGQRGTLWWHA  128

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             HILWLR+TVHGALVILPK GVPYPFPKPDHE  +VL+EWWKSDTE VINEALKSGLAPNV
Sbjct  129   HILWLRATVHGALVILPKRGVPYPFPKPDHEKAIVLSEWWKSDTENVINEALKSGLAPNV  188

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTINGH GPV +C +  GY+LSVE G+ Y+LR++NAALNEELFFK+AGH +TVVEVD
Sbjct  189   SDAHTINGHSGPVKSCPSSMGYKLSVERGETYLLRLVNAALNEELFFKVAGHSLTVVEVD  248

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A YVKPFKTDT++IAPGQTTNV++TA + +G+Y+V  SPFMDAP+AVDN TATAT+HY+G
Sbjct  249   ALYVKPFKTDTVLIAPGQTTNVLLTASKSAGKYLVTVSPFMDAPIAVDNVTATATVHYSG  308

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
             TL+S  T LT  PP N+T ++N+F +SLRSLNSK++PA VP+ VDH L FT GLG+NPCP
Sbjct  309   TLSSSATVLTLPPPQNSTAISNNFTNSLRSLNSKKYPALVPKEVDHHLFFTVGLGVNPCP  368

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANL  725
             +CKA NGSRVVAS+NNVTF MPTTALLQAH+F I GVFTTDFP NPP  +NYTG+ PANL
Sbjct  369   TCKAANGSRVVASINNVTFTMPTTALLQAHYFNISGVFTTDFPKNPPHVYNYTGSPPANL  428

Query  724   QTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKF  545
              T  GT+L++L YN+TV++VLQDTGII+PENHP+HLHGFNFF VG+G+GNFNPK DPK F
Sbjct  429   ATEKGTRLYKLPYNATVEVVLQDTGIISPENHPVHLHGFNFFQVGRGIGNFNPKKDPKSF  488

Query  544   NLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             NL DPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPNES
Sbjct  489   NLDDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNES  548



>ref|XP_008785423.1| PREDICTED: laccase-22 [Phoenix dactylifera]
Length=554

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/544 (76%), Positives = 480/544 (88%), Gaps = 3/544 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             S+ R +VL A C+ P +V+ R RHYKF+VVMKN TR+CS+KP VTVNG+FPGPT+YARE 
Sbjct  3     SFIRALVL-AACLLPVLVDGRTRHYKFNVVMKNATRLCSTKPIVTVNGRFPGPTLYAREG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VL++VVN+VKYNV+IHWHG+RQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  62    DNVLVKVVNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQPGSSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR TVHGA+VILPKL VPYPFP P  E V++L EWWKSDTEAVIN+ALKSGL
Sbjct  122   FWHAHILWLRVTVHGAIVILPKLHVPYPFPTPHKEEVIILGEWWKSDTEAVINQALKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGP++ C    G++L V++G+ YMLR++NAALNEELFF++AGH+MTV
Sbjct  182   APNVSDAHTINGHPGPMSACPASKGFQLKVDSGRTYMLRIVNAALNEELFFRVAGHQMTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATY KPFKTDTI+I PGQTTNV++TADQG+G+Y+V ASPFMD+P+AVDNQTA A +
Sbjct  242   VEVDATYTKPFKTDTILITPGQTTNVLLTADQGAGRYLVTASPFMDSPIAVDNQTAMAVV  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HYT T+A+   T    PP NATPVA++F+DSLRSLNSKQ+PA VP TVDHSLLFT GLG+
Sbjct  302   HYTNTVAASALTAIKPPPQNATPVASNFIDSLRSLNSKQYPARVPSTVDHSLLFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+C   NGSRVVA +NNV+F MPTTA+LQAH+F + GVFT DFP  PP AFNYTG+G
Sbjct  362   NPCPTCV--NGSRVVADMNNVSFTMPTTAILQAHYFNVSGVFTDDFPGKPPIAFNYTGSG  419

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL T TGT+++RL +NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVG+GLGN+NPK  
Sbjct  420   PRNLGTMTGTRVYRLPFNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPKRS  479

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P KFNLVDPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VDNGKG
Sbjct  480   PSKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKG  539

Query  376   PNES  365
             PNES
Sbjct  540   PNES  543



>ref|XP_004500229.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=556

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/547 (76%), Positives = 475/547 (87%), Gaps = 2/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M     RI++L+  C+ P   E  VRHYKF+VVMKN TR+CS+KP VTVNGKFPGPTIYA
Sbjct  1     MATPHIRIILLMVACLLPLYAEAIVRHYKFNVVMKNATRLCSTKPIVTVNGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDD VLI+VVN+VKYNVSIHWHG++QLRTGWADGPAYITQCPI+ G +Y+YNFT+TGQR
Sbjct  61    REDDNVLIKVVNHVKYNVSIHWHGVKQLRTGWADGPAYITQCPIQSGQTYLYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAH+LWLR+TVHGALVILPKLGVPYPFPKP  E V+VL EWWKSDTEA+INEALK
Sbjct  121   GTLWWHAHVLWLRATVHGALVILPKLGVPYPFPKPHMEQVIVLGEWWKSDTEAIINEALK  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPN+SDAHTINGHPGP+  CS QGG+ L VE    Y+LR++NAALNEELFFK+A H+
Sbjct  181   SGLAPNISDAHTINGHPGPIQGCSPQGGFSLEVEPKNTYLLRIVNAALNEELFFKVASHQ  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDATYVKPF+TDTIVIAPGQTTNV++TA   +G+Y+VAASPFMDAP+ VDN+TAT
Sbjct  241   LTVVEVDATYVKPFQTDTIVIAPGQTTNVLLTAKHTTGKYLVAASPFMDAPIVVDNKTAT  300

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             AT+HY+GTL S  TTLT+ PP NATP+A +F DSLRSLNSK++PA VP  +DH+LLFT  
Sbjct  301   ATIHYSGTLGSTITTLTSLPPKNATPLATTFTDSLRSLNSKKYPAKVPLKIDHNLLFTVS  360

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCP+C   N SRVVA++NNVTFVMP  ALLQAHFF IKGVF+ DFP NPP  +N+T
Sbjct  361   LGINPCPTCV--NNSRVVAAINNVTFVMPKIALLQAHFFNIKGVFSEDFPGNPPIVYNFT  418

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  P N  TT GT+L++LAYNSTVQLVLQDTG+I PENHPIHLHGFNFF VG+G GN+NP
Sbjct  419   GTQPTNFGTTKGTRLYKLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQGNYNP  478

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             + D KKFNLVDPVERNTIG+PAGGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  479   RKDAKKFNLVDPVERNTIGVPAGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDN  538

Query  385   GKGPNES  365
             GKGPNES
Sbjct  539   GKGPNES  545



>gb|KFK36706.1| hypothetical protein AALP_AA4G158700 [Arabis alpina]
Length=560

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/543 (76%), Positives = 478/543 (88%), Gaps = 1/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +V     +FP   EC VRHYKF+VVMKN+TR+CSSKPTVTVNG++PGPTIYAREDD
Sbjct  8     WFLFLVSF-FSVFPPPSECMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDD  66

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCPI+PG +Y YN+T+TGQRGTL 
Sbjct  67    TLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQAYTYNYTLTGQRGTLW  126

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAH+LWLR+TV+GALVILPK GVPYPFPKP+HE V+VL EWWKSDTE VINEALKSGLA
Sbjct  127   WHAHVLWLRATVYGALVILPKRGVPYPFPKPNHEKVIVLGEWWKSDTENVINEALKSGLA  186

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSD+H ING PG   NC +  GY+LSVE GK Y+LR++NAALNEELFFK+AGH  TVV
Sbjct  187   PNVSDSHMINGRPGLAKNCPSDQGYKLSVENGKTYLLRIVNAALNEELFFKVAGHLFTVV  246

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFK DT++IAPGQTTNV++TA + +G+Y+VAASPFMDAP+AVDN TATATLH
Sbjct  247   EVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVAASPFMDAPIAVDNVTATATLH  306

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PT LT  PP NAT +AN+F +SLRSLNSK++PA VP T+DH LLFT GLG+N
Sbjct  307   YSGTLSSSPTILTLPPPQNATSIANNFTNSLRSLNSKKYPAIVPTTIDHHLLFTVGLGLN  366

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PCP+CKAGNGSRVVAS+NNVTF+MP TALL AH+F I GVFTTDFP NPP  FNY+G   
Sbjct  367   PCPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSV  426

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+IAPENHP+HLHGFNFF VG+GLGNFNPK DP
Sbjct  427   TNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPVHLHGFNFFEVGRGLGNFNPKKDP  486

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
               FNLVDPVERNT+G+P+GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  487   NNFNLVDPVERNTVGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  546

Query  373   NES  365
             N+S
Sbjct  547   NQS  549



>ref|XP_007016183.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY33802.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=557

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/548 (78%), Positives = 481/548 (88%), Gaps = 2/548 (0%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+++ LAC +FPA VEC VRHYKF+VV++N TR+CSSKP VTVNG++PGPT+ 
Sbjct  1     MEMAPWIRVLMFLACLLFPASVECMVRHYKFNVVLENTTRLCSSKPIVTVNGRYPGPTLV  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+VKYN+SIHWHGIRQ+RTGWADGP YITQCPI+PG +++YNFTITGQ
Sbjct  61    AREDDTVLVKVVNHVKYNLSIHWHGIRQIRTGWADGPGYITQCPIQPGQNFVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHGA+VILPK GVPYPFPKP  E  ++L EWWKSD EAVINEAL
Sbjct  121   RGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEETIILGEWWKSDVEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSG+APNVSDAHTINGHPGPV++C TQGGY L V+ GK YMLR+INAALNEELFFKIAGH
Sbjct  181   KSGMAPNVSDAHTINGHPGPVSSCPTQGGYTLRVKPGKTYMLRIINAALNEELFFKIAGH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
              +TVVEVDATYVKPFKT+TIVI PGQTTNV++TA +G+G+Y+VAASPFMDAP+ VDN TA
Sbjct  241   LLTVVEVDATYVKPFKTETIVITPGQTTNVLLTAHRGAGKYLVAASPFMDAPIVVDNVTA  300

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATLHY+G+L S  TTLT+ PP NAT VA +F ++LRSLNSKQ+PANVP  +DHSLLFT 
Sbjct  301   TATLHYSGSLTSTATTLTSLPPKNATSVATNFTNALRSLNSKQYPANVPLKIDHSLLFTV  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLGINPCPSC   NGSRVVAS+NNVTFVMP  +LLQAHFF I GVFTTDFP NPP  FNY
Sbjct  361   GLGINPCPSCV--NGSRVVASINNVTFVMPKISLLQAHFFNISGVFTTDFPGNPPVPFNY  418

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             T     N QT  GTKL+RLAYNSTVQLVLQDTG+I PENHP+HLHGFNFF VG+GLGNFN
Sbjct  419   TSTQLTNFQTKQGTKLYRLAYNSTVQLVLQDTGMITPENHPLHLHGFNFFEVGRGLGNFN  478

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PK D KKFNLVDPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VD
Sbjct  479   PKKDTKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVD  538

Query  388   NGKGPNES  365
             NG GPNE+
Sbjct  539   NGNGPNET  546



>ref|XP_011032154.1| PREDICTED: laccase-4-like isoform X2 [Populus euphratica]
Length=556

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/548 (78%), Positives = 478/548 (87%), Gaps = 4/548 (1%)
 Frame = -3

Query  2005  MECS-WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             ME + W R++VL+AC +FPA VE  VRHYKF+VVMKN T++CS+KP VTVNG+FPGPT+ 
Sbjct  1     MEIALWIRVLVLVAC-LFPASVESMVRHYKFNVVMKNSTKLCSTKPIVTVNGQFPGPTLV  59

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQ
Sbjct  60    AREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  119

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHGA+VILPK GVPYPFP P  E V+VL EWWKSD EAVINEA 
Sbjct  120   RGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPTPRKEKVIVLGEWWKSDVEAVINEAT  179

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSG+APNVSDAHTINGHPGPV+ CS+ GGY L+V  GK YM R+INAALNEELFFKIAGH
Sbjct  180   KSGMAPNVSDAHTINGHPGPVSACSSHGGYNLTVHPGKTYMFRIINAALNEELFFKIAGH  239

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             ++TVVEVDA YVKPFK DT+VIAPGQTTNV++TA++GSG+Y+VAASPFMDAP+AVDN TA
Sbjct  240   QLTVVEVDAAYVKPFKIDTVVIAPGQTTNVLLTANRGSGKYLVAASPFMDAPIAVDNVTA  299

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TA LHY+GTLAS  TTLT  P  NATPVA +F ++LRSLNS ++PA VP  +D SL FT 
Sbjct  300   TAILHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARVPLKIDRSLFFTV  359

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPC +C   NGSRVVA +NNVTFVMPT ALLQAH F I GVFT DFPANPP  FNY
Sbjct  360   GLGVNPCATCI--NGSRVVADINNVTFVMPTIALLQAHVFNISGVFTDDFPANPPTPFNY  417

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P N QT  GTKL+RLAYN+TVQLVLQDTG++ PENHPIHLHGFNFF VG+G+GNF+
Sbjct  418   TGTQPTNFQTVNGTKLYRLAYNNTVQLVLQDTGMLTPENHPIHLHGFNFFEVGRGVGNFD  477

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             P  DPKKFNLVDPVERNTIG+PAGGW AIRF ADNPGVWFMHCHLEVHTTWGLKMAF+VD
Sbjct  478   PNKDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVD  537

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  538   NGKGPNES  545



>ref|XP_003604619.1| Laccase 1a [Medicago truncatula]
 gb|AES86816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=557

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/545 (79%), Positives = 489/545 (90%), Gaps = 2/545 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R V+LL CC+FPA+VEC+VRHYKF VV KN +R+CSSK  VTVNGKFPGPT+YARED
Sbjct  3     SWIR-VLLLICCIFPALVECKVRHYKFHVVAKNTSRLCSSKAIVTVNGKFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTV+++V N V  N++IHWHGIRQLRTGWADGPAYITQCPI+PGHSY YNFTITGQRGTL
Sbjct  62    DTVIVKVRNQVNNNITIHWHGIRQLRTGWADGPAYITQCPIQPGHSYTYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAH+ WLRSTVHGA+VILPK GVPYPFPKPD E V+VL EWWKSDTEAVINEALKSGL
Sbjct  122   LWHAHVNWLRSTVHGAIVILPKKGVPYPFPKPDDELVLVLGEWWKSDTEAVINEALKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTING PG VANCSTQ  Y+L VE+GK Y+LR+INAALNEELFFKIAGHK+TV
Sbjct  182   APNVSDAHTINGLPGTVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIAGHKLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATY KPF+ +TIVIAPGQTTNV++ A+Q SG+Y+VAASPFMDAPVAVDN TATATL
Sbjct  242   VEVDATYTKPFQIETIVIAPGQTTNVLLKANQKSGKYLVAASPFMDAPVAVDNLTATATL  301

Query  1096  HYTG-TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
             HY+G TL + PT LTT PP NAT +AN+F++SL+ LNSK++P NVP  +DHSL FT GLG
Sbjct  302   HYSGTTLTNTPTFLTTPPPTNATQIANNFLNSLKGLNSKKYPVNVPLKIDHSLFFTVGLG  361

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
             +NPCPSCKAGNGSRVVA++NNVTFVMPTTALLQAH+F IK VFT DFP NPP  +N+TGA
Sbjct  362   VNPCPSCKAGNGSRVVAAINNVTFVMPTTALLQAHYFNIKNVFTADFPPNPPHIYNFTGA  421

Query  739   GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKT  560
             GP NL TT+GTKL++L++N TVQLV+QDTGIIAPE+HP+HLHGFNFF VG+G+GN++ K 
Sbjct  422   GPKNLNTTSGTKLYKLSFNDTVQLVMQDTGIIAPESHPVHLHGFNFFVVGRGVGNYDSKN  481

Query  559   DPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  380
             D KKFNLVDPVERNT+G+PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK
Sbjct  482   DSKKFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  541

Query  379   GPNES  365
             GP +S
Sbjct  542   GPKQS  546



>emb|CDX74915.1| BnaA05g06610D [Brassica napus]
Length=558

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/543 (77%), Positives = 477/543 (88%), Gaps = 2/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +V     +FPA  E  VRHYKF+VVMKN+TR+CSSKPTVTVNG++PGPTIYAREDD
Sbjct  7     WFLFLVSF-LSVFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCP++PG  Y YN+T+TGQRGTL 
Sbjct  66    TLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TVHGA+VILPK GVPYPFPKPDHE V+VLAEWWKSDTE VINEALKSGLA
Sbjct  126   WHAHILWLRATVHGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH INGH GPV NC +QG Y+LSV  GK Y+LR++NAALNEELFFK+AGH  TVV
Sbjct  186   PNVSDAHMINGHSGPVNNCPSQG-YKLSVTNGKTYLLRLVNAALNEELFFKVAGHLFTVV  244

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFKTDT++IAPGQTTNV++T  + +G+Y+V ASPFMD+P+AVDN TATAT+H
Sbjct  245   EVDAVYVKPFKTDTVLIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATATVH  304

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PTTLT  PP NAT +AN+F +SLRSLNSK++PA VP T+DH L FT GLG+N
Sbjct  305   YSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLN  364

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PCP+CKAGNGSRVVAS+NNVTF MP TALL AH+F I GVFTTDFP NPP  FNY+G   
Sbjct  365   PCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSV  424

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+IAPENHPIHLHGFNFF VG+GLGNFN K DP
Sbjct  425   TNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGFNFFEVGRGLGNFNAKKDP  484

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
               FNLVDPVERNTIG+P+GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  485   SNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  544

Query  373   NES  365
             N+S
Sbjct  545   NQS  547



>ref|XP_002299828.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
 gb|EEE84633.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
Length=557

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/543 (79%), Positives = 479/543 (88%), Gaps = 3/543 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             W R++VL+AC +FPA VE  VRHYKF+VVMKN TR+CS KP VTVNG+FPGPT+ AREDD
Sbjct  7     WLRVLVLVAC-LFPASVESMVRHYKFNVVMKNTTRLCSEKPIVTVNGRFPGPTLVAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TVL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCP++PG +++YNFTITGQRGTLL
Sbjct  66    TVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPLQPGQNFVYNFTITGQRGTLL  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TVHGA+VILPK GVPYPFP P  E V+VL EWWKSD EAVINEA+ SG A
Sbjct  126   WHAHILWLRATVHGAIVILPKRGVPYPFPTPHREEVIVLGEWWKSDVEAVINEAMNSGRA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAHTINGHPGPV+ CS+QGGY L V  GK YMLR+INAALNEELFFKIAGH++TVV
Sbjct  186   PNVSDAHTINGHPGPVSGCSSQGGYNLPVRPGKTYMLRIINAALNEELFFKIAGHQLTVV  245

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDATYVKPFK DTIVIAPGQTTNV+VTA++GSG+Y+VAASPFMDAP+AVDN TATATLH
Sbjct  246   EVDATYVKPFKIDTIVIAPGQTTNVLVTANRGSGKYLVAASPFMDAPIAVDNVTATATLH  305

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTLAS  TTLT  P  NATPVA +F D+LRSLNS ++PA VP  +DHSL FT GLG+N
Sbjct  306   YSGTLASTTTTLTVPPAQNATPVATNFTDALRSLNSIKYPARVPLKIDHSLFFTIGLGVN  365

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PC +C   NG+RVVA +NNVTFVMPT ALLQAHFF IKGVFT DFP NPP  FNYTG  P
Sbjct  366   PCATCV--NGNRVVADINNVTFVMPTIALLQAHFFNIKGVFTDDFPGNPPTPFNYTGTQP  423

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N QT  GTKL+RLAYNSTVQLVLQDTG++ PENHP+HLHGFNFF VG+G+GNFNPK DP
Sbjct  424   KNFQTVNGTKLYRLAYNSTVQLVLQDTGMLTPENHPVHLHGFNFFEVGRGIGNFNPKRDP  483

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             KKFNL DPVERNTIG+PAGGW AIRF ADNPGVWFMHCHLEVHTTWGLKMAF+VDNGKGP
Sbjct  484   KKFNLADPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGP  543

Query  373   NES  365
             NES
Sbjct  544   NES  546



>emb|CDX91428.1| BnaC04g07220D [Brassica napus]
Length=558

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/543 (77%), Positives = 476/543 (88%), Gaps = 2/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +V     +FPA  E  VRHYKF+VVMKN+TR+CSSKPTVTVNG++PGPTIYAREDD
Sbjct  7     WFLFLVSF-LSVFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCP++PG  Y YN+T+TGQRGTL 
Sbjct  66    TLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TVHGA+VILPK GVPYPFPKPDHE V+VLAEWWKSDTE VINEALKSGLA
Sbjct  126   WHAHILWLRATVHGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
              NVSDAH INGH GPV NC +QG Y+LSV  GK Y+LR++NAALNEELFFK+AGH  TVV
Sbjct  186   SNVSDAHMINGHSGPVNNCPSQG-YKLSVTNGKTYLLRLVNAALNEELFFKVAGHLFTVV  244

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFKTDTI+IAPGQTTNV++T  + +G+Y+V ASPFMD+P+AVDN TATAT+H
Sbjct  245   EVDAVYVKPFKTDTILIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATATVH  304

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PTTLT  PP NAT +AN+F +SLRSLNSK++PA VP T+DH L FT GLG+N
Sbjct  305   YSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLN  364

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PCP+CKAGNGSRVVAS+NNVTF MP TALL AH+F I GVFTTDFP NPP  FNY+G   
Sbjct  365   PCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSV  424

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+IAPENHPIHLHGFNFF VG+GLGNFN K DP
Sbjct  425   TNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGFNFFEVGRGLGNFNAKKDP  484

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
               FNLVDPVERNTIG+P+GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  485   SNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  544

Query  373   NES  365
             N+S
Sbjct  545   NQS  547



>ref|XP_010104682.1| hypothetical protein L484_022065 [Morus notabilis]
 gb|EXC01488.1| hypothetical protein L484_022065 [Morus notabilis]
Length=556

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/548 (76%), Positives = 477/548 (87%), Gaps = 3/548 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+++L+AC +FPA VEC VRHYKF+VV+KN T++CSSK  VTVNGKFPGPTIY
Sbjct  1     MEMVPWVRVLILVAC-LFPASVECMVRHYKFNVVLKNSTKLCSSKQIVTVNGKFPGPTIY  59

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDT+L++VVN+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+PG  ++YNFTITGQ
Sbjct  60    AREDDTLLVKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQQFVYNFTITGQ  119

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHGA+VILPK GVPYPFP+P  E V+VL EWWKSD EAVINEAL
Sbjct  120   RGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPRPHKEKVLVLGEWWKSDVEAVINEAL  179

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTING PGPV+ C++QGG+ L V A K Y+LR++NAALNEELFFKIAGH
Sbjct  180   KSGLAPNVSDAHTINGQPGPVSGCTSQGGFTLPVGASKTYLLRIVNAALNEELFFKIAGH  239

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             ++TVVEVDA Y KPFKT T++IAPGQTTNV++ AD+ +G+Y+VAA+PFMDAP+AVDN+TA
Sbjct  240   QLTVVEVDAVYTKPFKTGTVIIAPGQTTNVLLNADRKAGRYLVAATPFMDAPIAVDNKTA  299

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATLHY+GTL+S  T LT  PP NAT +A +F  SLRSLNSK++PA VP  +DHSLLFT 
Sbjct  300   TATLHYSGTLSSSRTILTALPPQNATSIATNFTSSLRSLNSKKYPARVPLKIDHSLLFTI  359

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPC +C   NGSRVVA +NNVTFVMP  ALLQAHFF I GVFT DFP  PP  FNY
Sbjct  360   GLGVNPCKTCV--NGSRVVADINNVTFVMPNIALLQAHFFNISGVFTDDFPGKPPVPFNY  417

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P+N  TT GT+L+RLAYNSTVQLVLQDTG+I PENHPIHLHGFNFF VGKGLGNF+
Sbjct  418   TGTQPSNFATTQGTRLYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGKGLGNFH  477

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             P  DPK FNLVDPVERNTIG+P+GGW AIRF+ADNPGVWFMHCHLEVHTTWGLKMAF+VD
Sbjct  478   PNKDPKNFNLVDPVERNTIGVPSGGWTAIRFKADNPGVWFMHCHLEVHTTWGLKMAFVVD  537

Query  388   NGKGPNES  365
             NGKGPNE+
Sbjct  538   NGKGPNET  545



>ref|XP_006293932.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
 gb|EOA26830.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
Length=558

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/543 (77%), Positives = 477/543 (88%), Gaps = 2/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +V     +FPA  E  VRHYKF+VVMKN TR+CSSKP VTVNG++PGPTIYAREDD
Sbjct  7     WFLFLVTF-MSVFPAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL 
Sbjct  66    TLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWWKSDTE VINEALKSGLA
Sbjct  126   WHAHILWLRATVNGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTEDVINEALKSGLA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH INGHPGPV NC +QG Y+LSVE GK Y+LR+INAALNEELFFK+AGH  TVV
Sbjct  186   PNVSDAHMINGHPGPVKNCPSQG-YKLSVENGKTYLLRLINAALNEELFFKVAGHIFTVV  244

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFK DT++IAPGQTTNV++TA + +G+++V ASPFMDAP+AVDN TATAT+H
Sbjct  245   EVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKFLVTASPFMDAPIAVDNVTATATVH  304

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PT LT  PP NAT VAN+F +SLRSLNSK++PA VP T+DH LLFT GLG+N
Sbjct  305   YSGTLSSSPTVLTLPPPQNATSVANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLN  364

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
              CP+CKAGNGSRVVAS+NNVTF+MP TALL AH+F   GVFTTDFP NPP  FNY+G   
Sbjct  365   ACPTCKAGNGSRVVASINNVTFIMPKTALLSAHYFNKSGVFTTDFPKNPPHVFNYSGGSV  424

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+I+PENHP+HLHGFNFF VG+GLGNFN KTDP
Sbjct  425   TNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFNFFQVGRGLGNFNSKTDP  484

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
               FNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  485   NNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  544

Query  373   NES  365
             N+S
Sbjct  545   NQS  547



>ref|XP_007142229.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
 gb|ESW14223.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
Length=555

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/544 (76%), Positives = 479/544 (88%), Gaps = 3/544 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             W +I++LLA CM P  VE  VRHYKF+VV+KN+TR+CS+KP VTVNGKFPGPTIYAREDD
Sbjct  3     WIKIILLLAACMLPLSVEAMVRHYKFNVVVKNVTRLCSTKPIVTVNGKFPGPTIYAREDD  62

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TVL++VVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG  ++YNFT+TGQRGTL 
Sbjct  63    TVLVKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQVFVYNFTLTGQRGTLW  122

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLRST+HGALVILPKLGVPYPFPKP+ E V++L+EWWKSDTEA+I EALKSGLA
Sbjct  123   WHAHILWLRSTLHGALVILPKLGVPYPFPKPNAEKVILLSEWWKSDTEAIIKEALKSGLA  182

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAHTINGH G V  C++QG Y+L V+AG  Y+LR+INAALNEELFFKIAGH++TVV
Sbjct  183   PNVSDAHTINGHTGSVQQCASQGVYKLEVDAGNTYLLRIINAALNEELFFKIAGHQLTVV  242

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA Y KP KT+TIVIAPGQTTNV++ A++ +G+Y+VAA+PFMD+P+AVDN TATATLH
Sbjct  243   EVDAVYTKPLKTNTIVIAPGQTTNVLLKANRATGKYLVAATPFMDSPIAVDNVTATATLH  302

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+G+L+S  TTLT+ PP NATPVA +F DSLRSLNSK +PA VP  VDH+L FT  LG+N
Sbjct  303   YSGSLSSTITTLTSLPPKNATPVATTFTDSLRSLNSKNYPARVPTKVDHNLFFTVSLGVN  362

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA-G  737
             PCP+C   NGSRVVA++NNVTFVMP  +LLQAHFF I GVFT DFP  P   +++TG   
Sbjct  363   PCPTCV--NGSRVVAAINNVTFVMPKISLLQAHFFNISGVFTDDFPRKPSVVYDFTGTQQ  420

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             PANL+T  GT+++RLAYNSTVQLVLQDTG+I PENHP+HLHGFNFF VG+G GNFNPK D
Sbjct  421   PANLRTNRGTRVYRLAYNSTVQLVLQDTGMITPENHPVHLHGFNFFVVGRGQGNFNPKRD  480

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
              KKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNGKG
Sbjct  481   TKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKG  540

Query  376   PNES  365
             PNES
Sbjct  541   PNES  544



>ref|XP_008355354.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008355361.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008363414.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/549 (77%), Positives = 470/549 (86%), Gaps = 3/549 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+ +L+AC  FP  VEC VRHYKF+VV KN++R+CSSKP VTVNG++PGPTIY
Sbjct  1     MAMVLWIRVXLLVACLCFPVSVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG  Y+YNFTITGQ
Sbjct  61    AREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHGALVILPK GVPYPFP P  E VV+L EWWKSDTEAVINEAL
Sbjct  121   RGTLWWHAHILWLRATVHGALVILPKHGVPYPFPAPRKELVVILGEWWKSDTEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPN+SDAHTINGHPGP++ C +QGG +L V  GK YMLR+INAALNEELFFKIA H
Sbjct  181   KSGLAPNISDAHTINGHPGPLSTCQSQGGLKLPVRPGKTYMLRIINAALNEELFFKIANH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQT  1112
             K+TVVEVDA Y KPFKTDTI+IAPGQTTNV+VT + GSG+Y+VAASPFMD P + VDN+T
Sbjct  241   KLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVTTNLGSGKYLVAASPFMDNPTIVVDNKT  300

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             ATATLHY GTL S  T LT  PP NAT VA +F +SLRSLNS +FPA VP  +DHSLLFT
Sbjct  301   ATATLHYIGTLQSTKTILTAPPPQNATTVATNFTNSLRSLNSIRFPARVPLKIDHSLLFT  360

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
              GLG++ C SC   NG+RVVA +NNVTFVMP  ALLQAHFF I GVFT DFP NP   +N
Sbjct  361   VGLGLHTCASCT--NGNRVVADINNVTFVMPEIALLQAHFFNISGVFTDDFPGNPLNPYN  418

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG  P NLQT  GT+L+RLAYNSTVQLVLQDTG+IAPE HP+HLHGFNFF VG+GLGNF
Sbjct  419   YTGTQPTNLQTRKGTRLYRLAYNSTVQLVLQDTGMIAPETHPVHLHGFNFFEVGRGLGNF  478

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             NP  DPKKFNLVDPVERNTIG+P+ GW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+V
Sbjct  479   NPMKDPKKFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVV  538

Query  391   DNGKGPNES  365
             DNGKGPNES
Sbjct  539   DNGKGPNES  547



>ref|XP_002280416.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI16002.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/544 (78%), Positives = 480/544 (88%), Gaps = 3/544 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
              W R+++L+A  +FP +V+CR RHYKF+VV++  TR+CSSKP VTVNG FPGPTI+ARED
Sbjct  3     QWIRVLLLVAS-LFPILVDCRTRHYKFNVVLRKATRLCSSKPIVTVNGNFPGPTIHARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTL
Sbjct  62    DTVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYIYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+TVHGALVILPKLGVPYPFP P  EAVV+L EWWKSD EAVINEA+KSGL
Sbjct  122   LWHAHILWLRATVHGALVILPKLGVPYPFPTPYKEAVVILGEWWKSDVEAVINEAMKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGP ++CS QGG+ L V+ GK YMLR+INAALNEELF KIAGH +TV
Sbjct  182   APNVSDAHTINGHPGPFSSCSLQGGFTLPVDPGKTYMLRIINAALNEELFLKIAGHHLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATY KPF TDT++IAPGQTTNV++TA  G+G+Y+V AS FMD+P+AVDN TATAT+
Sbjct  242   VEVDATYTKPFSTDTVLIAPGQTTNVLLTAGLGAGKYLVTASSFMDSPIAVDNMTATATV  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
              Y+GTL+S PTT+T  PP NAT VA  F DSLRSLNSK++PA VP   DHSLLFT GLGI
Sbjct  302   QYSGTLSSTPTTITNPPPQNATSVATKFTDSLRSLNSKKYPARVPLATDHSLLFTVGLGI  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPC +C   NG +VVA++NNVTFVMPTTALLQAH+F +KGV+T DFP NPP AFNYTG  
Sbjct  362   NPCATCV--NGGKVVANINNVTFVMPTTALLQAHYFKMKGVYTDDFPGNPPIAFNYTGTQ  419

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P N QT  GT+L+RLAYNSTVQLVLQDTG+IAPE HP+HLHGFNFF +G+GLGN+NPK D
Sbjct  420   PTNFQTMNGTRLYRLAYNSTVQLVLQDTGMIAPERHPVHLHGFNFFVIGRGLGNYNPKKD  479

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             PKKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VDNGKG
Sbjct  480   PKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKG  539

Query  376   PNES  365
             PNES
Sbjct  540   PNES  543



>ref|XP_010256659.1| PREDICTED: laccase-4 [Nelumbo nucifera]
Length=554

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/527 (80%), Positives = 472/527 (90%), Gaps = 2/527 (0%)
 Frame = -3

Query  1945  VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSI  1766
             VECR+RHYKF+VVMKN TR+CS+KP VTVNG+FPGPT+YAREDDTVL++VVN+V+YNV+I
Sbjct  19    VECRIRHYKFNVVMKNTTRLCSTKPIVTVNGRFPGPTLYAREDDTVLVKVVNHVQYNVTI  78

Query  1765  HWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGAL  1586
             HWHGIRQLRTGWADGPAYITQCPI+PG SY+YNFTITGQRGTLLWHAHILWLR+T+HGA+
Sbjct  79    HWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRATLHGAI  138

Query  1585  VILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPV  1406
             VILPK GVPYPFP P  E VV+L EWWKSD EAVINEAL SGLAPNVSDAHTING PGPV
Sbjct  139   VILPKHGVPYPFPTPHKEVVVILGEWWKSDVEAVINEALNSGLAPNVSDAHTINGQPGPV  198

Query  1405  ANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIV  1226
               C +Q G+ L VE GK YMLR+INAALNEELFFKIAGHK+TVVEVDA Y KPFKTDTIV
Sbjct  199   PTCPSQSGFNLKVEPGKTYMLRIINAALNEELFFKIAGHKLTVVEVDAVYTKPFKTDTIV  258

Query  1225  IAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAP  1046
             IAPGQTTNV++   +GSG+Y+VAASPFMD+P+AVDN TATATLHY+GTLA+  TTLT  P
Sbjct  259   IAPGQTTNVLLETGRGSGKYLVAASPFMDSPIAVDNMTATATLHYSGTLATSATTLTNPP  318

Query  1045  PMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVAS  866
             P NATPVA++F+DSLRSLNSK++P  VP TVDHSLLFT GLG+NPC +C   NG RV+A 
Sbjct  319   PQNATPVASNFIDSLRSLNSKEYPVKVPLTVDHSLLFTVGLGVNPCSTCP--NGIRVIAD  376

Query  865   LNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAY  686
             +NNV+FVMPTTALLQAH+  I GVFT DFPANPP +FNYTG  PANLQT  GTKL+RL Y
Sbjct  377   INNVSFVMPTTALLQAHYLNISGVFTDDFPANPPISFNYTGTQPANLQTMNGTKLYRLRY  436

Query  685   NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGI  506
             N TVQLVLQDTG+IAPENHP+HLHGFNFFAVG+GLGN+NPKTDP KFNLVDP+ERNTIG+
Sbjct  437   NDTVQLVLQDTGMIAPENHPVHLHGFNFFAVGRGLGNYNPKTDPAKFNLVDPIERNTIGV  496

Query  505   PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             P+GGW  IRFRADNPGVWFMHCHLEVHTTWGLKMAF+VDNGKGPNES
Sbjct  497   PSGGWTVIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNES  543



>ref|XP_010923124.1| PREDICTED: laccase-22 [Elaeis guineensis]
Length=554

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/544 (77%), Positives = 485/544 (89%), Gaps = 3/544 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             S+ R +VL+AC + P +V+ R RHYKF+VVMKN TR+CS+KP VTVNG+FPGPT+YARE 
Sbjct  3     SFIRALVLVAC-LLPVVVDGRTRHYKFNVVMKNATRLCSTKPIVTVNGRFPGPTLYAREG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VL++VVN+VKYNV+IHWHG+RQLRTGWADGPAYITQCPI+PG++Y+YNFTITGQRGTL
Sbjct  62    DNVLVKVVNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQPGNNYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR TVHGA+VILPKL VPYPFP P  E V++L EWWKSDTEAVINEALKSGL
Sbjct  122   FWHAHILWLRVTVHGAIVILPKLHVPYPFPTPHKEEVIILGEWWKSDTEAVINEALKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAH INGHPGP++ C    G++L V++GK YMLR+INAALNEELFFK+AGH++TV
Sbjct  182   APNVSDAHVINGHPGPMSTCPASKGFQLKVDSGKTYMLRIINAALNEELFFKVAGHQLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATY KPFKTDTI+I PGQTTNV++TAD+G+G+Y+V ASPFMD+P+AVDNQTA AT+
Sbjct  242   VEVDATYTKPFKTDTILITPGQTTNVLLTADRGAGRYLVTASPFMDSPIAVDNQTAMATV  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HYT T+++   T T  PP NATPVA++F+DSLRSLNSK++PA VP TVDHSLLFT GLG+
Sbjct  302   HYTNTVSTTVLTTTKPPPQNATPVASNFIDSLRSLNSKKYPARVPLTVDHSLLFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+C   NGSRVVA +NNVTF MPTTA+LQAH+F I GVFT DFP  PP AFNY+G+G
Sbjct  362   NPCPTCV--NGSRVVADVNNVTFSMPTTAILQAHYFNISGVFTADFPGKPPIAFNYSGSG  419

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P+NL T TGT+++RL +NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVG+GLGN+NPKT 
Sbjct  420   PSNLGTMTGTRVYRLPFNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPKTS  479

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P KFNLVDPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VDNGKG
Sbjct  480   PSKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKG  539

Query  376   PNES  365
             PNES
Sbjct  540   PNES  543



>ref|XP_004490574.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=570

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/549 (76%), Positives = 481/549 (88%), Gaps = 3/549 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLAC-CMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTI  1832
             +M   W RI++LLA  C+ P  VE  VRHYKF+VVMKN TR+CS+KP VT+NG FPGPTI
Sbjct  13    IMGMMWIRIILLLAAYCLLPLSVEAIVRHYKFNVVMKNATRLCSTKPIVTINGNFPGPTI  72

Query  1831  YAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITG  1652
             YAREDDT+L++VVN+VKYNVSIHWHGI+QLR+GWADGPAYITQCPI+PG  Y+YNFT+TG
Sbjct  73    YAREDDTILVKVVNHVKYNVSIHWHGIKQLRSGWADGPAYITQCPIQPGQVYVYNFTLTG  132

Query  1651  QRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEA  1472
             QRGTL WHAHILWLR+TVHGA+VILPKLGVPYPFP+P  E VV+L+EWWKSDTE VINEA
Sbjct  133   QRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPRPHMEQVVILSEWWKSDTEVVINEA  192

Query  1471  LKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAG  1292
             LKSGLAPNVSDAHTINGHPGP  +C++Q G++L VEAGK Y+LR+INAALNE+LFFKIAG
Sbjct  193   LKSGLAPNVSDAHTINGHPGPTQHCASQEGFKLQVEAGKTYLLRIINAALNEDLFFKIAG  252

Query  1291  HKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQT  1112
             HK+ VVEVDA+Y KPFKTDTI+IAPGQTTNV+V A+  +G+YMVAAS FMDAP+A+DN T
Sbjct  253   HKLIVVEVDASYTKPFKTDTILIAPGQTTNVLVKANHLAGKYMVAASTFMDAPIAIDNVT  312

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             ATATLHYTG+L S  TTLT+ PP NAT +AN+F +SL+SLNS ++PA VP+ VDHSLLFT
Sbjct  313   ATATLHYTGSLGSTITTLTSLPPRNATFLANNFTNSLKSLNSPKYPARVPKKVDHSLLFT  372

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
               LG+NPC +C   NG RVVA++NNVTFVMP  +LLQAHFF I GVFT DFP  PP  ++
Sbjct  373   ISLGVNPCATCV--NGGRVVAAINNVTFVMPKISLLQAHFFNISGVFTDDFPEKPPRVYD  430

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             +TG  P+NL+T  GT+++RLAYNSTVQLVLQDTG+IAPENHPIHLHGFNFF VGKG GNF
Sbjct  431   FTGKQPSNLRTNKGTRVYRLAYNSTVQLVLQDTGMIAPENHPIHLHGFNFFVVGKGKGNF  490

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             N K DPKKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+V
Sbjct  491   NSKKDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVV  550

Query  391   DNGKGPNES  365
             DNGKGPNES
Sbjct  551   DNGKGPNES  559



>ref|XP_009143427.1| PREDICTED: laccase-4 [Brassica rapa]
Length=561

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/546 (76%), Positives = 477/546 (87%), Gaps = 5/546 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +V     MFPA  E  VRHYKF+VVMKN+TR+CSSKPTVTVNG++PGPTIYAREDD
Sbjct  7     WFLFLVSF-LSMFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCP++PG  Y YN+T+TGQRGTL 
Sbjct  66    TLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TVHGA+VILPK GVPYPFPKPDHE V+VLAEWWKSDTE VINEALKSGLA
Sbjct  126   WHAHILWLRATVHGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH INGH GPV NC +QG Y+LSV  GK Y+LR++NAALNEELFFK+AGH  TVV
Sbjct  186   PNVSDAHMINGHSGPVNNCPSQG-YKLSVTNGKTYLLRLVNAALNEELFFKVAGHLFTVV  244

Query  1273  EVDATYVKPFKT---DTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATA  1103
             EVDA +VKPFKT   DT++IAPGQTTNV++T  + +G+Y+V ASPFMD+P+AVDN TATA
Sbjct  245   EVDAVFVKPFKTATTDTVLIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATA  304

Query  1102  TLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
             T+HY+GTL+S PTTLT  PP NAT +AN+F +SLRSLNSK++PA VP T+DH L FT GL
Sbjct  305   TVHYSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGL  364

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG  743
             G+NPCP+CKAGNGSRVVAS+NNVTF MP TALL AH+F I GVFTTDFP NPP  FNY+G
Sbjct  365   GLNPCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSG  424

Query  742   AGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
                 N+ T TGT+L++L YN+TVQLVLQDTG+IAPENHPIHLHGFNFF VG+GLGNFN K
Sbjct  425   GSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGFNFFEVGRGLGNFNAK  484

Query  562   TDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  383
              DP  FNLVDPVERNTIG+P+GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NG
Sbjct  485   KDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  544

Query  382   KGPNES  365
             KGPN+S
Sbjct  545   KGPNQS  550



>ref|NP_565881.1| laccase-4 [Arabidopsis thaliana]
 sp|O80434.2|LAC4_ARATH RecName: Full=Laccase-4; AltName: Full=Benzenediol:oxygen oxidoreductase 
4; AltName: Full=Diphenol oxidase 4; AltName: Full=Protein 
IRREGULAR XYLEM 12; AltName: Full=Urishiol oxidase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96573.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL36080.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL38363.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAC27158.2| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAM47955.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AEC09487.1| laccase-4 [Arabidopsis thaliana]
Length=558

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/543 (76%), Positives = 477/543 (88%), Gaps = 2/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +V     +FPA  E  VRHYKF+VVMKN+TR+CSSKPTVTVNG++PGPTIYAREDD
Sbjct  7     WFLFLVSF-FSVFPAPSESMVRHYKFNVVMKNVTRLCSSKPTVTVNGRYPGPTIYAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL 
Sbjct  66    TLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TV+GALVILPK GVPYPFPKPD+E V+VL EWWKSDTE +INEALKSGLA
Sbjct  126   WHAHILWLRATVYGALVILPKRGVPYPFPKPDNEKVIVLGEWWKSDTENIINEALKSGLA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSD+H INGHPGPV NC +QG Y+LSVE GK Y+LR++NAALNEELFFK+AGH  TVV
Sbjct  186   PNVSDSHMINGHPGPVRNCPSQG-YKLSVENGKTYLLRLVNAALNEELFFKVAGHIFTVV  244

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFKTDT++IAPGQTTNV++TA + +G+Y+V ASPFMDAP+AVDN TATAT+H
Sbjct  245   EVDAVYVKPFKTDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVH  304

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PT LT  PP NAT +AN+F +SLRSLNSK++PA VP T+DH L FT GLG+N
Sbjct  305   YSGTLSSSPTILTLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLN  364

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
              CP+CKAGNGSRVVAS+NNVTF+MP TALL AH+F   GVFTTDFP NPP  FNY+G   
Sbjct  365   ACPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNTSGVFTTDFPKNPPHVFNYSGGSV  424

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+IAPENHP+HLHGFNFF VG+GLGNFN   DP
Sbjct  425   TNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPVHLHGFNFFEVGRGLGNFNSTKDP  484

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             K FNLVDPVERNTIG+P+GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  485   KNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  544

Query  373   NES  365
             N+S
Sbjct  545   NQS  547



>ref|XP_008220423.1| PREDICTED: laccase-4 [Prunus mume]
Length=558

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/549 (76%), Positives = 474/549 (86%), Gaps = 3/549 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M      R +VL+AC +FPA VEC VRHYKF+VV K  +R+CSSKP VTVNG++PGPTIY
Sbjct  1     METVPLIRALVLVACLLFPASVECMVRHYKFNVVQKKTSRLCSSKPIVTVNGRYPGPTIY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFT+TGQ
Sbjct  61    AREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTVTGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHGALVILPKLGVPYPFP P  E VV+L EWWKSD E+VIN+AL
Sbjct  121   RGTLWWHAHILWLRATVHGALVILPKLGVPYPFPAPQKEVVVILGEWWKSDVESVINQAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSG APNVSDAHTINGHPGP++ CS+QGG++L V  GK YMLR+INAALNEELFFKIA H
Sbjct  181   KSGSAPNVSDAHTINGHPGPLSTCSSQGGFKLPVRPGKTYMLRIINAALNEELFFKIANH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQT  1112
             K+TVVEVDA Y KPFKTDT++IAPGQTTNV+++ + G+G+Y+VAASPFMD P + VDN+T
Sbjct  241   KLTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLSTNHGTGKYLVAASPFMDNPTILVDNKT  300

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             ATATLHY GTL S  TTLT  PP NAT VA  F +SLRSLNS +FPA VP  +DHSLLFT
Sbjct  301   ATATLHYMGTLESTRTTLTAPPPQNATLVATKFTNSLRSLNSVKFPARVPLKIDHSLLFT  360

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
              GLG++ C SC   NG+R+VA +NNVTFVMP  +LLQAHFF I GVFT DFP NP   +N
Sbjct  361   VGLGLHTCASC--ANGNRLVADINNVTFVMPKISLLQAHFFNISGVFTDDFPGNPLNPYN  418

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG  P N+QT  GT+L+RLAYNSTVQLVLQDTG+IAPENHP+HLHGFNFF VG+GLGNF
Sbjct  419   YTGPQPTNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENHPVHLHGFNFFEVGRGLGNF  478

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             NPK DPK+FNL+DPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+V
Sbjct  479   NPKKDPKRFNLIDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVV  538

Query  391   DNGKGPNES  365
             DNGKGPNES
Sbjct  539   DNGKGPNES  547



>ref|XP_006425016.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
 ref|XP_006488481.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR38256.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
Length=557

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/549 (76%), Positives = 479/549 (87%), Gaps = 4/549 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+++L+AC +FPA V+C VR YKF+VVMKN TR+CS+KP VTVNG FPGPTI 
Sbjct  1     MEVVRWIRVLLLVAC-LFPASVQCMVREYKFNVVMKNATRLCSTKPIVTVNGYFPGPTIV  59

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+VKYNVSIHWHG+RQLRT WADGPAYITQCPI+PG +Y+YNFT+ GQ
Sbjct  60    AREDDTVLVKVVNHVKYNVSIHWHGVRQLRTCWADGPAYITQCPIQPGQNYIYNFTLAGQ  119

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHGA+VILPK GVPYPFPKP  E  V+L+EWWKSD EAVINEAL
Sbjct  120   RGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVTVILSEWWKSDVEAVINEAL  179

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTINGHPGP+++C +QGG++L VE+GK YMLR+INAALNEELFFKIAGH
Sbjct  180   KSGLAPNVSDAHTINGHPGPLSSCPSQGGFKLPVESGKTYMLRLINAALNEELFFKIAGH  239

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQT  1112
             K+TVVEVDA YVKPF T+T++IAPGQTTNV+++A   +G+Y+VAASPF+D P + VDN+T
Sbjct  240   KLTVVEVDAAYVKPFNTETVLIAPGQTTNVLLSAAHATGKYLVAASPFLDTPAILVDNKT  299

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             ATAT+HY+GTL S  TTLT  PP NATPVA +F  SLRSLNSK++PA VP  +DHSL FT
Sbjct  300   ATATVHYSGTLGSTATTLTVPPPRNATPVAANFTASLRSLNSKKYPARVPLKIDHSLFFT  359

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
              GLGINPC +C   NGSRVVA +NNVTFVMPT +LLQAHFF I GVFT DFP NPP  +N
Sbjct  360   IGLGINPCATCV--NGSRVVADINNVTFVMPTISLLQAHFFKIGGVFTDDFPGNPPVTYN  417

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             +TG  PAN QT  GT+++RL YNSTVQLVLQDTG+IAPENHP+HLHGFNFF VG+GLGNF
Sbjct  418   FTGTQPANFQTNNGTRIYRLPYNSTVQLVLQDTGMIAPENHPLHLHGFNFFEVGRGLGNF  477

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             N K DPKKFNLVDPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+V
Sbjct  478   NSKKDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFIV  537

Query  391   DNGKGPNES  365
             DNGKGPNES
Sbjct  538   DNGKGPNES  546



>ref|XP_007207096.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
 gb|EMJ08295.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
Length=558

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/543 (77%), Positives = 473/543 (87%), Gaps = 3/543 (1%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
              R +VL+AC +FPA VEC VRHYKF+VV K  +R+CSSKP VTVNG++PGPTIYAREDDT
Sbjct  7     IRALVLVACLLFPASVECMVRHYKFNVVQKKTSRLCSSKPIVTVNGRYPGPTIYAREDDT  66

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             VLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQRGTL W
Sbjct  67    VLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLWW  126

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHILWLR+T+HGALVILPKLGVPYPFP P  E VV+L EWWKSD E+VIN+ALKSG AP
Sbjct  127   HAHILWLRATLHGALVILPKLGVPYPFPAPQKEVVVILGEWWKSDVESVINQALKSGSAP  186

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             NVSDAHTINGH GP++ CS+QGG++L V  GK YMLR+INAALNEELFFKIA HK+TVVE
Sbjct  187   NVSDAHTINGHSGPLSTCSSQGGFKLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVE  246

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTATATLH  1094
             VDA Y KPFKTDT++IAPGQTTNV+++ + G+G+Y+VAASPFMD P + VDN+TATATLH
Sbjct  247   VDAVYTKPFKTDTVLIAPGQTTNVLLSTNHGTGKYLVAASPFMDNPTILVDNKTATATLH  306

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             YTGT  S  TTLT  PP NAT VA  F +SLRSLNS +FPA VP  +DHSLLFT GLG++
Sbjct  307   YTGTPESTRTTLTAPPPQNATLVATKFTNSLRSLNSVKFPARVPLKIDHSLLFTVGLGLH  366

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
              C SC   NG+RVVA +NNVTFVMP  +LLQAHFF I GVFT DFP NP   +NYTG  P
Sbjct  367   TCASC--ANGNRVVADINNVTFVMPKISLLQAHFFNISGVFTDDFPGNPLNPYNYTGPQP  424

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+QT  GT+L+RLAYNSTVQLVLQDTG+IAPENHP+HLHGFNFF VG+GLGNFNPKTDP
Sbjct  425   TNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENHPVHLHGFNFFEVGRGLGNFNPKTDP  484

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             K+FNL+DPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VDNGKGP
Sbjct  485   KRFNLIDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGP  544

Query  373   NES  365
             NES
Sbjct  545   NES  547



>ref|XP_010517091.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/543 (76%), Positives = 474/543 (87%), Gaps = 2/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +V     +FPA  E  VRHYKF+VVMKN TR+CSSKP VTVNG++PGPTIYAREDD
Sbjct  7     WFLFLVAF-FSVFPAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL 
Sbjct  66    TLLIKVVNHVKYNVSIHWHGVRQIRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWWKSDTE +INEALKSGLA
Sbjct  126   WHAHILWLRATVNGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTEDIINEALKSGLA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH INGHPGPV NC +QG Y+L VE GK Y+LR+INAALNEELFFK+AGH  TVV
Sbjct  186   PNVSDAHMINGHPGPVKNCPSQG-YKLPVENGKTYLLRLINAALNEELFFKVAGHLFTVV  244

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFK DT++IAPGQTTNV++TA + +G+Y+V ASPFMDAP+AVDN TATAT+H
Sbjct  245   EVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVH  304

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PT  T  PP NAT +AN+F +SLRSLNSK++PA VP T+DH LLFT GLG+N
Sbjct  305   YSGTLSSSPTVRTLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLN  364

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PCP+CKAGNGSRVVAS+NNVTFVMP TALL AH+F   GVFTTDFP NPP  FNY+G   
Sbjct  365   PCPTCKAGNGSRVVASINNVTFVMPKTALLSAHYFKKSGVFTTDFPKNPPHVFNYSGGSV  424

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+I+PENHP+HLHGFNFF VG+GLGNFN   DP
Sbjct  425   TNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFNFFQVGRGLGNFNSTKDP  484

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
               FNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  485   NNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  544

Query  373   NES  365
             N+S
Sbjct  545   NQS  547



>ref|XP_010505418.1| PREDICTED: laccase-4 [Camelina sativa]
Length=558

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/543 (76%), Positives = 474/543 (87%), Gaps = 2/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +V     +FPA  E  VRHYKF+VVMKN TR+CSSKP VTVNG++PGPTIYAREDD
Sbjct  7     WFLFLVAF-FSVFPAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL 
Sbjct  66    TLLIKVVNHVKYNVSIHWHGVRQIRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWWKSDTE +INEALKSGLA
Sbjct  126   WHAHILWLRATVNGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTEDIINEALKSGLA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH INGHPGPV NC +QG Y+LSVE GK Y+LR+INAALNEELFFK+AGH  TVV
Sbjct  186   PNVSDAHMINGHPGPVKNCPSQG-YKLSVENGKTYLLRLINAALNEELFFKVAGHLFTVV  244

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFK DT++IAPGQTTNV++TA + +G+Y+V ASPFMDAP+AVDN TATAT+H
Sbjct  245   EVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVH  304

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PT  T  PP NAT +AN+F +SLRSLNSK++PA VP T+DH LLFT GLG+N
Sbjct  305   YSGTLSSSPTVRTLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLN  364

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
              CP+CKAGNGSRVVAS+NNVTFVMP TALL AH+F   GVFTTDFP NPP  FNY+G   
Sbjct  365   ACPTCKAGNGSRVVASINNVTFVMPKTALLSAHYFNKSGVFTTDFPKNPPHVFNYSGGSV  424

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+I+PENHP+HLHGFNFF +G+GLGNFN   DP
Sbjct  425   TNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFNFFQIGRGLGNFNSTKDP  484

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
               FNLVDPVERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  485   NNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  544

Query  373   NES  365
             N+S
Sbjct  545   NQS  547



>ref|XP_010529771.1| PREDICTED: laccase-4-like [Tarenaya hassleriana]
Length=559

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/533 (77%), Positives = 475/533 (89%), Gaps = 0/533 (0%)
 Frame = -3

Query  1963  CMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYV  1784
             C+FP   E  VRHYKF+VVMKN TR+CSSK  VTVNG++PGPTIYAREDDT+LI+VVN+V
Sbjct  16    CVFPFPTESLVRHYKFNVVMKNTTRLCSSKQIVTVNGRYPGPTIYAREDDTLLIKVVNHV  75

Query  1783  KYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRS  1604
             KYNVSIHWHG+RQLRTGWADGPAYITQCPI+PG  Y+YN+T+TGQRGTL WHAHILWLR+
Sbjct  76    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQVYVYNYTLTGQRGTLWWHAHILWLRA  135

Query  1603  TVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  1424
             TVHGALVILPK G+PYPFPKPD+E V+VL+EWWKSDTE VINEALKSGLAPNVSDAHTIN
Sbjct  136   TVHGALVILPKRGIPYPFPKPDNEKVIVLSEWWKSDTENVINEALKSGLAPNVSDAHTIN  195

Query  1423  GHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPF  1244
             GHPG + +CS+  GY+LSVE+GK Y+LR+INAALNEELFFK+AGH +TVVEVDA YVKPF
Sbjct  196   GHPGLIKSCSSSQGYKLSVESGKIYLLRLINAALNEELFFKVAGHVLTVVEVDAVYVKPF  255

Query  1243  KTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPT  1064
             KTDT++IAPGQTTNV++TA + +G+++V  SPFMD+P+AVDN TATAT+HY+GTL+S PT
Sbjct  256   KTDTVLIAPGQTTNVLLTAVKPAGKFLVTVSPFMDSPIAVDNVTATATVHYSGTLSSSPT  315

Query  1063  TLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNG  884
              LT  PP N+T +A++F  SLRSLNS ++PA VP+ +DH L FT GLGINPCP+CK  NG
Sbjct  316   VLTLPPPQNSTAMADAFTSSLRSLNSVKYPALVPKKIDHHLFFTVGLGINPCPTCKPANG  375

Query  883   SRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTK  704
             SRVVAS+NNVTF MPTTALLQAH+F + GVFTTDFP NPP  FNYTGA PANL T  GT+
Sbjct  376   SRVVASINNVTFSMPTTALLQAHYFNVNGVFTTDFPKNPPHVFNYTGAPPANLATDKGTR  435

Query  703   LFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVE  524
             L++L YN+TV+LVLQDT +I+PENHP+HLHGFNFF VG+GLGNFNP  DPK+FNL DPVE
Sbjct  436   LYKLPYNATVELVLQDTVVISPENHPLHLHGFNFFQVGRGLGNFNPNKDPKRFNLDDPVE  495

Query  523   RNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             RNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPNES
Sbjct  496   RNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNES  548



>ref|XP_006411009.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
 gb|ESQ52462.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
Length=557

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/526 (78%), Positives = 469/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1942  ECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIH  1763
             E  VRHYKF+VVMKN TR+CSSKP VTVNG++PGPTIYAREDDT+LI+VVN+VKYN+SIH
Sbjct  22    ESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKYNISIH  81

Query  1762  WHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALV  1583
             WHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL WHAHILWLR+TV+GA+V
Sbjct  82    WHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATVYGAIV  141

Query  1582  ILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVA  1403
             ILPK GVPYPFPKPDHE V+VL EWWKSDTE VINEA+KSGLAPNVSDAH INGHPGPV 
Sbjct  142   ILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEAIKSGLAPNVSDAHMINGHPGPVK  201

Query  1402  NCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVI  1223
             NC +QG Y+LSVE GK Y+LR++NAALNEELFFK+AGH  TVVEVDA YVKPFK DT++I
Sbjct  202   NCPSQG-YKLSVENGKTYLLRLVNAALNEELFFKVAGHIFTVVEVDAVYVKPFKIDTVLI  260

Query  1222  APGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPP  1043
             APGQTTNV++TA + +G+Y+V ASPFMDAPVAVDN TATAT+HY+GTL+S PTTLT  PP
Sbjct  261   APGQTTNVLLTASKSAGKYLVTASPFMDAPVAVDNVTATATVHYSGTLSSSPTTLTLPPP  320

Query  1042  MNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASL  863
              NAT VAN+F +SLRSLNSK++PA VP T+DH L FT GLG+N CP+CKAGNGSRVVAS+
Sbjct  321   QNATSVANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNSCPTCKAGNGSRVVASI  380

Query  862   NNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYN  683
             NNVTF+MP TALL AH+F I GVFTTDFP NPP  FNY+G    N+ T TGT+L++L YN
Sbjct  381   NNVTFIMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYN  440

Query  682   STVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIP  503
             +TVQLVLQDTG+IAPENHPIHLHG+NFF VG+GLGNF+PK DP  FNLVDPVERNT+G+P
Sbjct  441   ATVQLVLQDTGVIAPENHPIHLHGYNFFEVGRGLGNFDPKKDPNNFNLVDPVERNTVGVP  500

Query  502   AGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             +GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN+S
Sbjct  501   SGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQS  546



>ref|XP_009337309.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/549 (76%), Positives = 469/549 (85%), Gaps = 3/549 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+V+L+AC  FPA VEC VRHYKF+VV KN++R+CSSKP VTVNG++PGPTIY
Sbjct  1     MAMVQWIRVVLLVACLCFPASVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+ KYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG  Y+YNFTITGQ
Sbjct  61    AREDDTVLVKVVNHAKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+T+HGALV+LPKLGVPYPFP P  E VV+L EWWKSDTE VI +AL
Sbjct  121   RGTLWWHAHILWLRATIHGALVVLPKLGVPYPFPAPQKEVVVILGEWWKSDTERVIRQAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTINGH GP++ C +QGG +L V  GK YMLR+INAALNEELFFKIA H
Sbjct  181   KSGLAPNVSDAHTINGHTGPISTCQSQGGIKLPVRPGKTYMLRIINAALNEELFFKIANH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQT  1112
             K+TVVEVDA Y KPFKTDTI+IAPGQTTNV+V+ + GSG+Y+VAASPFMD P + VDN+T
Sbjct  241   KLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKT  300

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             ATATLHY GTL S  T LT  PP NAT VA +F +SLRSLNS QFPA VP  +DHSLLFT
Sbjct  301   ATATLHYIGTLESTTTILTFPPPQNATLVATNFTNSLRSLNSIQFPARVPLKIDHSLLFT  360

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
              GLG++ C SC   NG+RVVA +NNVTFVMP   LLQAHFF I GVFT DFP NP   +N
Sbjct  361   VGLGLHTCASC--ANGNRVVADINNVTFVMPKIGLLQAHFFNISGVFTDDFPGNPLNPYN  418

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG  P N+QT  GT+L+RLAYN+TVQLVLQ TG++APE HP+HLHGFNF+ VG+GLGNF
Sbjct  419   YTGTQPTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETHPVHLHGFNFYEVGRGLGNF  478

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             NPKTDPK+FNLVDPVERNTIG+P+ GW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+V
Sbjct  479   NPKTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVV  538

Query  391   DNGKGPNES  365
             DNGKGPNES
Sbjct  539   DNGKGPNES  547



>ref|XP_009374280.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/549 (77%), Positives = 469/549 (85%), Gaps = 3/549 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+V+L+AC  FP  VEC VRHYKF+VV KN++R+CSSKP VTVNG++PGPTIY
Sbjct  1     MAMVPWIRVVLLVACLCFPVSVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+P   Y+YNFTITGQ
Sbjct  61    AREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPDQQYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+TVHGALVILPKLGVPYPFP P  E VV+L EWWKSDTEAVINEAL
Sbjct  121   RGTLWWHAHILWLRATVHGALVILPKLGVPYPFPAPQKELVVILGEWWKSDTEAVINEAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             +SGLAPNVSDAHTINGHPGP++ C  QGG +L V  GK YMLR+INAALNEELFFKIA H
Sbjct  181   RSGLAPNVSDAHTINGHPGPLSTCQPQGGLKLPVRPGKTYMLRIINAALNEELFFKIANH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQT  1112
             K+TVVEVDA Y KPFKTDTI+IAPGQTTNV+VT + GSG+++VAASPFMD P + VDN+T
Sbjct  241   KLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVTTNLGSGKFLVAASPFMDNPTIVVDNKT  300

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             ATATLHY GTL S  T LT  PP NAT VA +F +SL+SLNS +FPA VP  VDHSLLFT
Sbjct  301   ATATLHYIGTLQSTKTILTAPPPQNATIVATNFTNSLKSLNSIRFPARVPLKVDHSLLFT  360

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
               LG++ C SC   NG+RVVA +NNVTFVMP  ALLQAHFF I GVFT DFP NP   +N
Sbjct  361   VSLGLHTCASCT--NGNRVVADINNVTFVMPKIALLQAHFFNISGVFTDDFPGNPLNPYN  418

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG  P NLQT  GT+L+RLAYNSTVQLVLQ TG+IAPE HP+HLHGFNFF VG+GLGNF
Sbjct  419   YTGTQPTNLQTRKGTRLYRLAYNSTVQLVLQGTGMIAPETHPVHLHGFNFFEVGRGLGNF  478

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             NPK DPKKFNLVDPVERNTIG+P+ GW AIRF+ADNPG+WFMHCHLEVHTTWGLKMAF+V
Sbjct  479   NPKKDPKKFNLVDPVERNTIGVPSNGWTAIRFKADNPGIWFMHCHLEVHTTWGLKMAFVV  538

Query  391   DNGKGPNES  365
             DNGKGPNES
Sbjct  539   DNGKGPNES  547



>ref|XP_002879726.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55985.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/543 (76%), Positives = 474/543 (87%), Gaps = 2/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  ++     +FPA  E  +RHYKF+VVMKN TR+CSSKP VTVNG++PGPTIYAREDD
Sbjct  6     WFLFLISF-FFVFPAPSESIIRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDD  64

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYN+SIHWHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL 
Sbjct  65    TLLIKVVNHVKYNLSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLW  124

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TV+GALVILPK GVPYPFPKPDHE V+VL EWWKSDTE +INEALKSGLA
Sbjct  125   WHAHILWLRATVYGALVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENIINEALKSGLA  184

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH INGHPGPV NC +QG Y+LSVE GK Y+LR++NAALNEELFFK+AGH  TVV
Sbjct  185   PNVSDAHMINGHPGPVKNCPSQG-YKLSVENGKTYLLRLVNAALNEELFFKVAGHIFTVV  243

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFKTDT++IAPGQTTNV++TA + +G+Y+V ASPFMDAP+AVDN TATAT+H
Sbjct  244   EVDAVYVKPFKTDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVH  303

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PT LT  PP NAT +AN+F  SLRSLNSK++PA VP T+DH L FT GLG+N
Sbjct  304   YSGTLSSSPTILTLPPPQNATSIANNFTKSLRSLNSKKYPALVPTTIDHHLFFTVGLGLN  363

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
              CP+CKAGNGSRVVAS+NNVTF+MP TALL AH+F   GVFTTDFP NPP  FNY+G   
Sbjct  364   ACPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNTSGVFTTDFPKNPPHVFNYSGGSV  423

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+I+PENHP+HLHGFNFF VG+GLGNFN   DP
Sbjct  424   TNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPVHLHGFNFFEVGRGLGNFNSTKDP  483

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             K FNL+DPVERNTIG+P+GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  484   KNFNLIDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  543

Query  373   NES  365
             N+S
Sbjct  544   NQS  546



>ref|XP_007140382.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
 gb|ESW12376.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
Length=560

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/548 (77%), Positives = 480/548 (88%), Gaps = 5/548 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R+++ +AC + PA+VEC+VRHYKF+VV+KN TR+CSSKP VTVNGKFPGPT+YARED
Sbjct  3     SWVRVLLFIAC-IVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++V N V +NV+IHWHG+RQ+RTGWADGPAYITQCPI PG SY+YNFT+TGQRGTL
Sbjct  62    DTVLVKVRNLVNHNVTIHWHGVRQIRTGWADGPAYITQCPILPGQSYLYNFTLTGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAH+ WLRST+HGA+VILPK GVPYPFPKP  E VV+L EWWKSDTE VINEALKSGL
Sbjct  122   LWHAHVNWLRSTLHGAIVILPKHGVPYPFPKPVKELVVILGEWWKSDTEDVINEALKSGL  181

Query  1456  APNVSDAHTINGHPGP--VANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             APNVSDAHTING PG   VANCSTQ  Y+L VE+GK Y+LR+INAALNEE FFKIAGH  
Sbjct  182   APNVSDAHTINGLPGIVFVANCSTQDVYKLPVESGKTYLLRIINAALNEETFFKIAGHLF  241

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTAT  1106
             TVVEVDA+YVKPFKTDT++IAPGQTTN ++T DQ SG+Y + AS FMD+P VAVDN TAT
Sbjct  242   TVVEVDASYVKPFKTDTLLIAPGQTTNALLTTDQNSGKYTIVASTFMDSPVVAVDNLTAT  301

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHYTGTLA+ PT L T PP NAT VAN+F  SL+SLNSK++PANVP TVDHSLLFT G
Sbjct  302   ATLHYTGTLATTPTVLITPPPRNATQVANNFTKSLKSLNSKKYPANVPLTVDHSLLFTVG  361

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCPSC AGNGSRVVA++NNVTFVMPTTALLQAH+F  +GVFTTDFP NPP  +NYT
Sbjct  362   LGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNTQGVFTTDFPGNPPQVYNYT  421

Query  745   GA-GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
                  A+ QTT GTK++RLA+NSTVQ+VLQDTG+IA E+HPIHLHGFNFF VG G+GN++
Sbjct  422   ATPRAASSQTTNGTKVYRLAFNSTVQVVLQDTGVIALESHPIHLHGFNFFVVGSGVGNYD  481

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTD   FNLVDPVERNTIG+P GGW+A+RFRADNPGVWF+HCH EVHTTWGLKMAFLVD
Sbjct  482   PKTDGSNFNLVDPVERNTIGVPTGGWIALRFRADNPGVWFLHCHFEVHTTWGLKMAFLVD  541

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  542   NGKGPNES  549



>emb|CDX93330.1| BnaC04g45660D [Brassica napus]
Length=560

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/544 (76%), Positives = 472/544 (87%), Gaps = 2/544 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPA-IVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             WF  +      +FPA   E  VRHYKF+VVMKN+TR+CSSKPTVTVNG++PGPTIYARED
Sbjct  7     WFLFLASF-LSVFPAPSSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYARED  65

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DT+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL
Sbjct  66    DTLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTL  125

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWWKSDTE VINEALKSGL
Sbjct  126   WWHAHILWLRATVYGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEALKSGL  185

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAH ING PG   NCS+  GY+LSV+ GK Y+LR++NAALNEELFFK+AGH  TV
Sbjct  186   APNVSDAHMINGRPGLAKNCSSDQGYKLSVKNGKTYLLRLVNAALNEELFFKVAGHLFTV  245

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDA YVKPFK DTIVIAPGQTTNV++TA + +G+Y+V ASPFMD+P+AVDN TATAT+
Sbjct  246   VEVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATV  305

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTL+S PT LT  PP NAT VA +F +SLRSLNSK++PA VP T+DH L FT GLG+
Sbjct  306   HYSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGL  365

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+CKAGNGSRVVAS+NNVTFVMP  ALL AH+F I GVFT DFP NPP  FNY+G  
Sbjct  366   NPCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTPDFPKNPPHVFNYSGGS  425

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
               N+ T TGT+L++L YN+TVQLVLQDTGIIAPENHPIHLHG+NFF VG+GLGNFNPK D
Sbjct  426   VTNMATETGTRLYKLPYNATVQLVLQDTGIIAPENHPIHLHGYNFFEVGRGLGNFNPKKD  485

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P  FNLVDPVERNTIG+P+GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKG
Sbjct  486   PNNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKG  545

Query  376   PNES  365
             PN+S
Sbjct  546   PNQS  549



>ref|XP_003539958.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN07789.1| Laccase-4 [Glycine soja]
Length=556

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/527 (78%), Positives = 464/527 (88%), Gaps = 2/527 (0%)
 Frame = -3

Query  1945  VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSI  1766
             VE  VRHYKF+VV KN TR+ S+KP VT+NGKFPGPTIYAREDDTVL++VVN VKYNVSI
Sbjct  21    VEAMVRHYKFNVVQKNTTRLGSTKPIVTINGKFPGPTIYAREDDTVLVKVVNQVKYNVSI  80

Query  1765  HWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGAL  1586
             HWHG+RQLRTGWADGPAYITQCPI P  +Y+YNFT+TGQRGTL WHAHILWLR+TVHGAL
Sbjct  81    HWHGVRQLRTGWADGPAYITQCPILPSQAYVYNFTLTGQRGTLWWHAHILWLRATVHGAL  140

Query  1585  VILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPV  1406
             VILPKLGVPYPFPKP+ E V++L+EWWKSDTEAVINEALKSGLAPN SDAHTINGHPGP+
Sbjct  141   VILPKLGVPYPFPKPNMEQVIILSEWWKSDTEAVINEALKSGLAPNASDAHTINGHPGPI  200

Query  1405  ANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIV  1226
                ++QGGY+L V+ GK Y+LR+INAALNEELFFKIAGH++TVVEVDA Y KP KTDTIV
Sbjct  201   QGYASQGGYKLDVQPGKTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPLKTDTIV  260

Query  1225  IAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAP  1046
             IAPGQTTNV++T    +G+Y+VAASPFMDAP+AVDN+TATATLHY GTL S  TTLT+ P
Sbjct  261   IAPGQTTNVLLTTKHATGKYLVAASPFMDAPIAVDNKTATATLHYLGTLGSTITTLTSMP  320

Query  1045  PMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVAS  866
             P NATPVA +F+DSLRSLNSK+ PA VP  +DH+LLFT  LG+NPC +C   N SRVVA 
Sbjct  321   PKNATPVATTFIDSLRSLNSKEHPARVPLKIDHNLLFTVSLGVNPCATCV--NNSRVVAD  378

Query  865   LNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAY  686
             +NNVTFVMP  +LLQAHFF IKGVFT DFP NPP  +N+TG  P+NL+T  GT+++RLAY
Sbjct  379   INNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVVYNFTGTQPSNLKTMKGTRVYRLAY  438

Query  685   NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGI  506
             NSTVQLVLQDTG+I PENHPIHLHGFNFF VG+G GNFNP  DPKKFNLVDPVERNT+G+
Sbjct  439   NSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQGNFNPTKDPKKFNLVDPVERNTVGV  498

Query  505   PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             PAGGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNGKGPNES
Sbjct  499   PAGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNES  545



>ref|XP_009346884.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/549 (76%), Positives = 468/549 (85%), Gaps = 3/549 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+V+L+AC  FPA VEC VRHYKF+VV KN++R+CSSKP VTVNG++PGPTIY
Sbjct  1     MAMVQWIRVVLLVACLCFPASVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+ KYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG  Y+YNFTITGQ
Sbjct  61    AREDDTVLVKVVNHAKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+T+HGALV+LPKLGVPYPFP P  E VV+L EWWKSDTE VI +AL
Sbjct  121   RGTLWWHAHILWLRATIHGALVVLPKLGVPYPFPAPQKEVVVILGEWWKSDTERVIRQAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             K GLAPNVSDAHTINGH GP++ C +QGG +L V  GK YMLR+INAALNEELFFKIA H
Sbjct  181   KFGLAPNVSDAHTINGHTGPISTCQSQGGIKLPVRPGKTYMLRIINAALNEELFFKIANH  240

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQT  1112
             K+TVVEVDA Y KPFKTDTI+IAPGQTTNV+V+ + GSG+Y+VAASPFMD P + VDN+T
Sbjct  241   KLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKT  300

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             ATATLHY GTL S  T LT  PP NAT VA +F +SLRSLNS QFPA VP  +DHSLLFT
Sbjct  301   ATATLHYIGTLESTTTILTFPPPQNATLVATNFTNSLRSLNSIQFPARVPLKIDHSLLFT  360

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
              GLG++ C SC   NG+RVVA +NNVTFVMP   LLQAHFF I GVFT DFP NP   +N
Sbjct  361   VGLGLHTCASC--ANGNRVVADINNVTFVMPKIGLLQAHFFNISGVFTDDFPGNPLNPYN  418

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG  P N+QT  GT+L+RLAYN+TVQLVLQ TG++APE HP+HLHGFNFF VG+GLGNF
Sbjct  419   YTGTQPTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETHPVHLHGFNFFEVGRGLGNF  478

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             NPKTDPK+FNLVDPVERNTIG+P+ GW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+V
Sbjct  479   NPKTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVV  538

Query  391   DNGKGPNES  365
             DNGKGPNES
Sbjct  539   DNGKGPNES  547



>emb|CDY18406.1| BnaA04g21810D [Brassica napus]
Length=559

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/543 (76%), Positives = 470/543 (87%), Gaps = 1/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +      +FPA  E  VRHYKF+VVMKN+TR+CSSKPTVTVNG++PGPTIYAREDD
Sbjct  7     WFLFLASF-LSVFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL 
Sbjct  66    TLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWWKSDTE VINEALKSGLA
Sbjct  126   WHAHILWLRATVYGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEALKSGLA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH ING PG   NC +  GY+LSV+ GK Y+LRV+NAALNEELFFK+AGH  TVV
Sbjct  186   PNVSDAHMINGRPGLAKNCPSDQGYKLSVKNGKTYLLRVVNAALNEELFFKVAGHLFTVV  245

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFK DTIVIAPGQTTNV++TA + +G+Y+V ASPFMD+P+AVDN TATAT+H
Sbjct  246   EVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATVH  305

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PT LT  PP NAT VA +F +SLRSLNSK++PA VP T+DH L FT GLG+N
Sbjct  306   YSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLN  365

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PCP+CKAGNGSRVVAS+NNVTFVMP  ALL AH+F I GVFT DFP  PP  FNY+G   
Sbjct  366   PCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTPDFPKIPPHVFNYSGGSL  425

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+IAPENHPIHLHG+NFF VG+GLGNFNPK DP
Sbjct  426   TNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGYNFFEVGRGLGNFNPKKDP  485

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
               FNLVDPVERNTIG+P+GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  486   NNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  545

Query  373   NES  365
             N+S
Sbjct  546   NQS  548



>gb|KDO53232.1| hypothetical protein CISIN_1g0093922mg, partial [Citrus sinensis]
Length=506

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/506 (81%), Positives = 467/506 (92%), Gaps = 2/506 (0%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R+++L+AC +FPA+VECRVRHYKF+VVMKN T++CSSKP VTVN KFPGPT+YARE 
Sbjct  3     SWVRLLLLVAC-LFPALVECRVRHYKFNVVMKNSTKLCSSKPIVTVNRKFPGPTLYAREH  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++VVN+VKYNV+IHWHG+RQLRTGWADGPAYITQCPI+ GHSY+YNFTITGQRGTL
Sbjct  62    DTVLVKVVNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQSGHSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLR+TVHGA+VILPK GVPYPFPKP  E VVVLAEWWKSDTEAVIN+AL+SGL
Sbjct  122   LWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVVVVLAEWWKSDTEAVINQALQSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSD+HTING PGP+++CS+QGG+ L V++GK YMLR+INAALNEELFFKIAGHK+TV
Sbjct  182   APNVSDSHTINGQPGPISSCSSQGGFTLPVDSGKTYMLRIINAALNEELFFKIAGHKLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFKTD IVIAPGQTTNV+++AD+ SG+Y+VAASPFMDAP+AVDN TATATL
Sbjct  242   VEVDATYVKPFKTDNIVIAPGQTTNVLLSADKTSGKYLVAASPFMDAPIAVDNVTATATL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLAS  TTLT+ PP N T +AN F+DSLRSLNSK++PA VPQTVDH+LLFT GLG+
Sbjct  302   HYSGTLASSATTLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKVPQTVDHNLLFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCPSCKAGNGSRVVAS+NNVTFVMPT ALLQAHFF I GVFTTDFP NPP  +N+TG  
Sbjct  362   NPCPSCKAGNGSRVVASINNVTFVMPTIALLQAHFFNISGVFTTDFPGNPPHTYNFTGT-  420

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NLQT+ GTK +RLAYNSTVQL+LQDTGIIAPENHP+HLHGFNFFAVGKGLGNFNPK D
Sbjct  421   PKNLQTSNGTKAYRLAYNSTVQLILQDTGIIAPENHPVHLHGFNFFAVGKGLGNFNPKKD  480

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIR  479
             PKKFNLVDPVERNTIG+P+GGWVAIR
Sbjct  481   PKKFNLVDPVERNTIGVPSGGWVAIR  506



>gb|KEH34185.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=556

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/547 (76%), Positives = 474/547 (87%), Gaps = 2/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M    FRI++LL  C+ P  V+  VRHYKF+VVMKN TR+CS+KP VTVNGKFPGPTIYA
Sbjct  1     MAAEGFRIILLLVACLLPLSVDAMVRHYKFNVVMKNATRLCSTKPIVTVNGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDD VLI+VVN+VKYNVSIHWHG++QLRTGWADGPAYITQCPI+PG +Y+YNFT+TGQR
Sbjct  61    REDDNVLIKVVNHVKYNVSIHWHGVKQLRTGWADGPAYITQCPIQPGQTYLYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E V++L EWWKSDTEA+INEALK
Sbjct  121   GTLWWHAHVLWLRATVHGAIVILPKLGVPYPFPKPHMEQVILLGEWWKSDTEAIINEALK  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPN SDAHTINGHPGPV  C++QGG+ L V+    Y+LR+INAALNEELFFKIA H+
Sbjct  181   SGLAPNTSDAHTINGHPGPVQGCASQGGFSLEVQPKNTYLLRIINAALNEELFFKIANHQ  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDATYVKPFKTDTIVIAPGQTTNV+VTA    G ++VAASPFMDAP+ VDN+TAT
Sbjct  241   LTVVEVDATYVKPFKTDTIVIAPGQTTNVLVTAKHKIGNFLVAASPFMDAPIVVDNKTAT  300

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHY+GTL S  TTLT+ PP NAT VAN+F DSLRSLNSK+FPA VP  +DH+LLFT  
Sbjct  301   ATLHYSGTLGSSLTTLTSLPPTNATSVANTFTDSLRSLNSKKFPAKVPLKIDHNLLFTVS  360

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LG+NPC +C   N SRVVA +NNVTFVMP  ALLQAHFF IKGVFT DFP NPP  +N+T
Sbjct  361   LGVNPCATCV--NNSRVVADINNVTFVMPKIALLQAHFFKIKGVFTDDFPGNPPVVYNFT  418

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G+   NL TT GT+L+RLAYNSTVQLVLQDTG++ PENHPIHLHGFNFF VG+G GNF+ 
Sbjct  419   GSQVTNLATTKGTRLYRLAYNSTVQLVLQDTGMLTPENHPIHLHGFNFFVVGRGQGNFDS  478

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             K D KKFNLVDPVERNT+G+PAGGW AIRF+ADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  479   KKDVKKFNLVDPVERNTVGVPAGGWTAIRFKADNPGVWFMHCHLEIHTTWGLKMAFVVDN  538

Query  385   GKGPNES  365
             GKGPNES
Sbjct  539   GKGPNES  545



>ref|XP_010509229.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/530 (77%), Positives = 467/530 (88%), Gaps = 1/530 (0%)
 Frame = -3

Query  1954  PAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYN  1775
             PA  E  VRHYKF+VVMKN TR+CSSKP VTVNG++PGPTIYAREDDT+LI+VVN+VKYN
Sbjct  19    PAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKYN  78

Query  1774  VSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVH  1595
             VSIHWHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL WHAHILWLR+TV+
Sbjct  79    VSIHWHGVRQIRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATVN  138

Query  1594  GALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHP  1415
             GA+VILPK GVPYPFPK DHE V+VL EWWKSDTE +INEALKSGLAPNVSDAH INGHP
Sbjct  139   GAIVILPKRGVPYPFPKADHEKVIVLGEWWKSDTEDIINEALKSGLAPNVSDAHMINGHP  198

Query  1414  GPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTD  1235
             GPV NC +QG Y+LSVE GK Y+LR+INAALNEELFFK+AGH  TVVEVDA YVKPFK D
Sbjct  199   GPVKNCPSQG-YKLSVENGKTYLLRLINAALNEELFFKVAGHLFTVVEVDAVYVKPFKID  257

Query  1234  TIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLT  1055
             T++IAPGQTTNV++TA + +G+Y+V ASPFMDAP+AVDN TATAT+HY+GTL+S PT  T
Sbjct  258   TVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTVRT  317

Query  1054  TAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRV  875
               PP NAT +AN+F +SLRSLNSK++PA VP T+DH LLFT GLG+N CP+CKAGNGSRV
Sbjct  318   LPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLNACPTCKAGNGSRV  377

Query  874   VASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFR  695
             VAS+NNVTFVMP TALL AH+F   GVFTTDFP NPP  FNY+G    N+ T TGT+L++
Sbjct  378   VASINNVTFVMPKTALLSAHYFNKSGVFTTDFPKNPPHVFNYSGGSVKNMATETGTRLYK  437

Query  694   LAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNT  515
             L YN+TVQLVLQDTG+I+PENHP+HLHGFNFF VG+GLGNFN   DP  FNLVDPVERNT
Sbjct  438   LPYNATVQLVLQDTGVISPENHPLHLHGFNFFQVGRGLGNFNSTKDPNNFNLVDPVERNT  497

Query  514   IGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             IG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN+S
Sbjct  498   IGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQS  547



>ref|XP_009141718.1| PREDICTED: laccase-4-like [Brassica rapa]
Length=559

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/543 (76%), Positives = 469/543 (86%), Gaps = 1/543 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  +      +FPA  E  VRHYKF+VVMKN+TR+CSSKPTVTVNG++PGPTIYAREDD
Sbjct  7     WFLFLASF-LSVFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+LI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCPI+PG  Y YN+T+TGQRGTL 
Sbjct  66    TLLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWWKSDTE VINEALKSGLA
Sbjct  126   WHAHILWLRATVYGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEALKSGLA  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH ING PG   NC +  GY+LSV+ GK Y+LRV+NAALNEELFFK+AGH  TVV
Sbjct  186   PNVSDAHMINGRPGLAKNCPSDQGYKLSVKNGKTYLLRVVNAALNEELFFKVAGHLFTVV  245

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKPFK DTIVIAPGQTTNV++TA + +G+Y+V ASPFMD+P+AVDN TATAT+H
Sbjct  246   EVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATVH  305

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL+S PT LT  PP NAT VA +F +SLRSLNSK++PA VP T+DH L FT GLG+N
Sbjct  306   YSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLN  365

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PCP+CKAGNGSRVVAS+NNVTFVMP  ALL AH+F I GVFT DFP  PP  FNY+G   
Sbjct  366   PCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTPDFPKIPPHVFNYSGGSL  425

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+ T TGT+L++L YN+TVQLVLQDTG+IAPENHPIHLHG+NFF VG+GLGNFNPK DP
Sbjct  426   TNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGYNFFEVGRGLGNFNPKKDP  485

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
               F LVDPVERNTIG+P+GGWV IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  486   NNFYLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  545

Query  373   NES  365
             N+S
Sbjct  546   NQS  548



>gb|AES98533.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=558

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/543 (75%), Positives = 471/543 (87%), Gaps = 4/543 (1%)
 Frame = -3

Query  1987  RIVVLLAC-CMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             RI+ LLA  C+ P  V+  VRHYKF+VVMKN TR+CS+KP VT+NG FPGPTIYAREDDT
Sbjct  7     RIIFLLAAYCLLPLSVDAMVRHYKFNVVMKNATRLCSTKPIVTINGNFPGPTIYAREDDT  66

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             VL++VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG  YMYNFT+TGQRGTL W
Sbjct  67    VLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQVYMYNFTLTGQRGTLWW  126

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHILWLR+TVHGA+VILPKLGVPYPFP+P  E V++L+EWWKSDTEA+INEALKSGLAP
Sbjct  127   HAHILWLRATVHGAIVILPKLGVPYPFPRPHMEQVIILSEWWKSDTEAIINEALKSGLAP  186

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             NVSDAHTINGHPGPV +C++Q G++  VE GK Y+LR+INAALNE+LFFKIAGHK TVVE
Sbjct  187   NVSDAHTINGHPGPVQHCASQEGFKFQVEPGKTYLLRIINAALNEDLFFKIAGHKFTVVE  246

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             VDA Y KPFKTDTIVI PGQTTNV++  +  SG+YMVAAS FMDAP+A+DN TATATLHY
Sbjct  247   VDAAYTKPFKTDTIVITPGQTTNVLLKTNHASGKYMVAASTFMDAPIAIDNVTATATLHY  306

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
               TL S  TTLT+ PP+N+T +ANSF DSL+SLNS ++PA VP+ +DHSL FT  LG+NP
Sbjct  307   PNTLGSTITTLTSLPPINSTKIANSFTDSLKSLNSHKYPARVPKKIDHSLFFTVSLGVNP  366

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG-AGP  734
             C +C   NGSRVVA++NNVTFVMP  +LLQAHFF I G+FT DFP  P   +++TG   P
Sbjct  367   CATCP--NGSRVVAAINNVTFVMPKISLLQAHFFNISGIFTDDFPRKPEIVYDFTGNKQP  424

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
             +N +T  GT+++RLAYNSTVQL+LQDTG+IAPENHPIHLHGFNFF VGKG GNFNPK D 
Sbjct  425   SNFRTNKGTRVYRLAYNSTVQLILQDTGMIAPENHPIHLHGFNFFVVGKGQGNFNPKKDT  484

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             KKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNGKGP
Sbjct  485   KKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGP  544

Query  373   NES  365
             NES
Sbjct  545   NES  547



>ref|XP_004294236.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/552 (75%), Positives = 472/552 (86%), Gaps = 6/552 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLAC--CMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPT  1835
             M    WFR ++L+AC  C+FPA  EC  RHYKF+VV+K  +R+CSSKP VT+NGK+PGPT
Sbjct  1     MEMVLWFRALLLVACISCLFPAPAECLERHYKFNVVLKKTSRLCSSKPIVTINGKYPGPT  60

Query  1834  IYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTIT  1655
             IYAREDDTVL++VVN+VKYNVSIHWHGIRQLR GWADGPAYITQCPI+PG  Y+YNFT+T
Sbjct  61    IYAREDDTVLVKVVNHVKYNVSIHWHGIRQLRNGWADGPAYITQCPIQPGQQYVYNFTVT  120

Query  1654  GQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINE  1475
             GQRGTL WHAHILWLR+TV+GALV+LPKLGVPYPFP P  E VV+L EWWKSD EAVINE
Sbjct  121   GQRGTLWWHAHILWLRATVYGALVVLPKLGVPYPFPAPKKEVVVILGEWWKSDVEAVINE  180

Query  1474  ALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIA  1295
             ALKSG APNVSDAHTINGHPGP++ CS+QGGY+L V+ G  Y+LR+INAALN+ELFFK+A
Sbjct  181   ALKSGAAPNVSDAHTINGHPGPLSLCSSQGGYKLPVQPGHTYLLRIINAALNDELFFKVA  240

Query  1294  GHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDN  1118
              HK+TVVEVDA Y KPF+T TI+IAPGQTTNV++TAD+ +G+Y+VAASPFMD P VAVDN
Sbjct  241   NHKLTVVEVDAVYTKPFETTTILIAPGQTTNVLLTADRSTGKYLVAASPFMDNPTVAVDN  300

Query  1117  QTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLL  938
             +TATATLHY G+LAS  T LT  PP NAT +A SF  SLRSLNS  +PA VP  +DHSL+
Sbjct  301   KTATATLHYRGSLASTNTILTVPPPQNATRLATSFTKSLRSLNSDTYPAKVPLKIDHSLM  360

Query  937   FTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFA  758
             FT  LG+  CPSC   NG+RVVA LNNVTFVMP  +LLQAH F I GVFT DFP NP   
Sbjct  361   FTVSLGLQTCPSC--ANGNRVVADLNNVTFVMPKISLLQAHVFNISGVFTDDFPGNPLMP  418

Query  757   FNYTGA-GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGL  581
             +NYTGA  P N+QT  GT+L+RLAYNSTVQLVLQDTG+IAPENHP+HLHGFNFF VG+GL
Sbjct  419   YNYTGAQQPTNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENHPVHLHGFNFFEVGRGL  478

Query  580   GNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMA  401
             GNFN KTDPK FNL+DPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMA
Sbjct  479   GNFNSKTDPKIFNLIDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMA  538

Query  400   FLVDNGKGPNES  365
             F+VDNGKGPNES
Sbjct  539   FVVDNGKGPNES  550



>ref|XP_007146741.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
 gb|ESW18735.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
Length=556

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/547 (77%), Positives = 479/547 (88%), Gaps = 2/547 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M     RIV+LLA  + P  VE  VRHYKF+VV+KN TR+CS+KP VTVNGKFPGPTIYA
Sbjct  1     MAAFGIRIVLLLAAFLLPLSVEAMVRHYKFNVVLKNATRLCSTKPIVTVNGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTVLI+VVN+VKYNVSIHWHG+RQ+RTGWADGPAYITQCPI+PG +Y+YNFT+TGQR
Sbjct  61    REDDTVLIKVVNHVKYNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQAYVYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAHILWLR+T+HGALVILPKLGVPYPFPKP+ E V++L+EWWKSDTEAVINEALK
Sbjct  121   GTLWWHAHILWLRATLHGALVILPKLGVPYPFPKPNMEQVIILSEWWKSDTEAVINEALK  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAHTINGHPGPV  C++Q G++L V+ G  Y+LR+INAALNEELFFKIAGH+
Sbjct  181   SGLAPNVSDAHTINGHPGPVQGCASQEGFKLDVQPGNTYLLRIINAALNEELFFKIAGHE  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA Y KPFKTDTIVI PGQTTNV++TA   +G+Y+VAASPFMDAP+AVDN+TAT
Sbjct  241   LTVVEVDAVYTKPFKTDTIVITPGQTTNVLLTAKHAAGKYLVAASPFMDAPIAVDNKTAT  300

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHY+GTL+S  TTLT+ PP N+T +A SF DSLRSLNSK++PA VP  +D +LLFT  
Sbjct  301   ATLHYSGTLSSSLTTLTSLPPKNSTILATSFTDSLRSLNSKKYPARVPLKIDRNLLFTVS  360

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPC +C   N SRVVA +NNVTFVMP  +LLQAHFF IKGVFT DFP NPP  +N+T
Sbjct  361   LGINPCATCV--NNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVFYNFT  418

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  P+NL T  GT+L+RLAYNSTVQLVLQDTG++ PENHPIHLHGFNFF VG+G GNFNP
Sbjct  419   GTQPSNLNTVNGTRLYRLAYNSTVQLVLQDTGMLTPENHPIHLHGFNFFVVGRGQGNFNP  478

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
               DPKKFNLVDPVERNT+G+PAGGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  479   TKDPKKFNLVDPVERNTVGVPAGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDN  538

Query  385   GKGPNES  365
             GKGPNES
Sbjct  539   GKGPNES  545



>ref|XP_008358974.1| PREDICTED: laccase-4-like [Malus domestica]
Length=557

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/549 (75%), Positives = 466/549 (85%), Gaps = 4/549 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+V+L+AC  FPA VEC VRHYKF+VV KN++R+CSSKP VTVNG++PGPTIY
Sbjct  1     MAMVQWIRVVLLVACLCFPASVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTVL++VVN+ KYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG  Y+YNFTITGQ
Sbjct  61    AREDDTVLVKVVNHAKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHILWLR+T+HGALV+LPKLGVPYPFP P  E VV+L EWWKSDTE VI +AL
Sbjct  121   RGTLWWHAHILWLRATIHGALVVLPKLGVPYPFPAPQKEVVVILGEWWKSDTERVIRQAL  180

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTING+PGP++ C +QGG  L V  GK YMLR+INAALNEELFFKIA H
Sbjct  181   KSGLAPNVSDAHTINGYPGPISTCQSQGGL-LPVRPGKTYMLRIINAALNEELFFKIANH  239

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQT  1112
             K+TVVEVDA Y KPFKTDT +IAPGQTTNV+V+ + GSG+Y+VAASPFMD P + VDN+T
Sbjct  240   KLTVVEVDAVYTKPFKTDTXLIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKT  299

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             ATATLHY GTL S  T LT+ PP NAT VA +F +SLRSLNS +FPA VP  +DHSLLFT
Sbjct  300   ATATLHYIGTLESTRTILTSPPPQNATLVATNFTNSLRSLNSIRFPARVPLKIDHSLLFT  359

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
              GLG++ C SC   NG RVVA +NNVTFVMP  ALLQAHFF   GVFT DFP NP   +N
Sbjct  360   VGLGLHTCDSC--ANGIRVVADINNVTFVMPKIALLQAHFFNXSGVFTDDFPGNPLNPYN  417

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG    N+QT  GT+L+RLAYN+TVQLVLQ TG++APE HP+HLHGFNFF VG+GLGNF
Sbjct  418   YTGTQQTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETHPVHLHGFNFFEVGRGLGNF  477

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             NP TDPK+FNLVDPVERNTIG+P+ GW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+V
Sbjct  478   NPNTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVV  537

Query  391   DNGKGPNES  365
             DNGKGPNES
Sbjct  538   DNGKGPNES  546



>gb|KHN04832.1| Laccase-4 [Glycine soja]
Length=524

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/538 (76%), Positives = 462/538 (86%), Gaps = 25/538 (5%)
 Frame = -3

Query  1978  VLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             +LL  C+ PA+VECRVRHYKF VV K   R+CSSK  VT+NGKFPGPT+YAREDDTVL++
Sbjct  1     MLLIACILPALVECRVRHYKFHVVSKQTNRLCSSKSIVTINGKFPGPTLYAREDDTVLVK  60

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             V+N V +NV+IHWHG+RQLRTGWADGPAY+TQCPI+PG +Y+YNFT+TGQRGTLL+HAH+
Sbjct  61    VINQVNHNVTIHWHGVRQLRTGWADGPAYVTQCPIQPGQTYVYNFTLTGQRGTLLYHAHV  120

Query  1618  LWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSD  1439
              WLRST++GALVILPK GVPYPFPKPD E VVVL EWWKSDTEAVINEALKSGLAPNVSD
Sbjct  121   NWLRSTLYGALVILPKRGVPYPFPKPDDELVVVLGEWWKSDTEAVINEALKSGLAPNVSD  180

Query  1438  AHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDAT  1259
             AHTING PG V NCSTQ  Y L VE+GK Y+LR++NAALNEELFFKIAGHK+TVVEVDAT
Sbjct  181   AHTINGLPGTVTNCSTQDVYNLPVESGKTYLLRIVNAALNEELFFKIAGHKLTVVEVDAT  240

Query  1258  YVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTL  1079
             YVKPFK +TIVIAPGQTTNV++ A+Q SG+Y+VAASPFMDAPVAV               
Sbjct  241   YVKPFKIETIVIAPGQTTNVLLNANQKSGKYLVAASPFMDAPVAV---------------  285

Query  1078  ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSC  899
                       PP NAT +AN+F+ SLR LNSK++P NVP TVDHSL+FT GLGINPCPSC
Sbjct  286   ----------PPKNATQIANNFISSLRGLNSKKYPVNVPLTVDHSLIFTVGLGINPCPSC  335

Query  898   KAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQT  719
             KA NGSRVVA++NNVTF+MPT ALLQAH+F IKGVFTTDFPANPP  FNY+G GPANL T
Sbjct  336   KAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTTDFPANPPHVFNYSGPGPANLNT  395

Query  718   TTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNL  539
              TGTK++RL +N+TVQ+VLQDTGIIAPENHP+HLHGFNFF VG+G+GNFNPK DPK FNL
Sbjct  396   ETGTKVYRLPFNATVQVVLQDTGIIAPENHPVHLHGFNFFVVGRGVGNFNPKIDPKNFNL  455

Query  538   VDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             VDPVERNTIG+PAGGW A RFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP +S
Sbjct  456   VDPVERNTIGVPAGGWTAFRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKQS  513



>ref|XP_008775059.1| PREDICTED: laccase-22-like [Phoenix dactylifera]
Length=554

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/544 (74%), Positives = 475/544 (87%), Gaps = 3/544 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             S+ R ++L+A  M P + + R R YKF+V +K +TR+C SKP VTVNG+FPGPT+YA E 
Sbjct  3     SYVRALLLVAI-MLPVLADGRTRKYKFNVAVKKVTRLCYSKPIVTVNGRFPGPTLYAEEG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VL+ VVN VKYNV+IHWHG+RQ+RTGWADGPAYITQCPI+PGHSY+YNFTITGQRGTL
Sbjct  62    DNVLVEVVNNVKYNVTIHWHGVRQIRTGWADGPAYITQCPIQPGHSYVYNFTITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+TVHGA+V+LPK  VPYPFP P  E V++L EWWKSDTEAVINEALKSGL
Sbjct  122   FWHAHILWLRATVHGAIVVLPKPNVPYPFPAPQKEEVIILGEWWKSDTEAVINEALKSGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAH INGHPGP+++C T  G++L+V++GK Y+LR++NAALNEELFFK+AGH++TV
Sbjct  182   APNVSDAHIINGHPGPMSDCPTSKGFQLTVDSGKTYLLRIVNAALNEELFFKVAGHQLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDA Y KPFKTDTI+I PGQTTNV++TADQG+G Y+V ASPFMD+P+AVDN+TA AT+
Sbjct  242   VEVDACYTKPFKTDTILITPGQTTNVLLTADQGAGSYLVTASPFMDSPIAVDNKTAMATV  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HYT ++A+   T T  PP NATPVA+ F+DSLRSLNS+Q+PA VP TVDHSLLFT GLG+
Sbjct  302   HYTNSVATADLTTTNPPPQNATPVASKFIDSLRSLNSEQYPARVPLTVDHSLLFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+C   NGSRVVA +NNV+F MPTTA+LQAH+F I GVF  DFP  PP AFNYTG G
Sbjct  362   NPCPTCV--NGSRVVADMNNVSFTMPTTAILQAHYFNISGVFADDFPGKPPIAFNYTGGG  419

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P N+QT +GT+++RLA+NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVG+GLGN+NP T 
Sbjct  420   PKNMQTMSGTRVYRLAFNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPNTS  479

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P KFNLVDPVERNTIG+P+GGW AIRF+ADNPGVWFMHCHLEVHTTWGLKMAF+VDNG+G
Sbjct  480   PSKFNLVDPVERNTIGVPSGGWTAIRFQADNPGVWFMHCHLEVHTTWGLKMAFVVDNGEG  539

Query  376   PNES  365
             PNES
Sbjct  540   PNES  543



>ref|XP_006602641.1| PREDICTED: laccase-4-like isoform X1 [Glycine max]
Length=560

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/548 (78%), Positives = 479/548 (87%), Gaps = 5/548 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R++ L+AC + PA+VEC+VRHYKF+VV+KN TR+CSSKP VTVNGKFPGPT+YARED
Sbjct  3     SWVRMLFLIAC-IVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++V N V +NV+IHWHG+RQLRTGWADGPAYITQCPI  G SY+YNFT+TGQRGTL
Sbjct  62    DTVLVKVNNLVNHNVTIHWHGVRQLRTGWADGPAYITQCPILSGQSYLYNFTLTGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAH+ WLRST+HGA+VILPK GVPYPFPKPD E VV+L EWWKSDTE VINEALKSGL
Sbjct  122   LWHAHVNWLRSTLHGAIVILPKRGVPYPFPKPDKELVVILGEWWKSDTEDVINEALKSGL  181

Query  1456  APNVSDAHTINGHPG--PVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             APNVSDAHTING PG   VANCSTQ  Y+L VE+GK Y+LR+INAALNEELFFKIAGH  
Sbjct  182   APNVSDAHTINGLPGIVSVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIAGHPF  241

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTAT  1106
             TVVEVDA+YVKPFKTDT+ IAPGQTTN ++TADQ SG+Y + AS FMD+P VAVDN TAT
Sbjct  242   TVVEVDASYVKPFKTDTLSIAPGQTTNALLTADQNSGKYTIVASTFMDSPVVAVDNLTAT  301

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHYTGTLA+ PT LTT PP NAT VAN+F +SL+SLNSK++PA VPQ VDHSLL T G
Sbjct  302   ATLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLLTVG  361

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCPSC AGNGSRVVA++NNVTFVMPTTALLQAH+F IKGVFTTDFP NP   +NYT
Sbjct  362   LGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVFTTDFPGNPSHVYNYT  421

Query  745   GAGPANL-QTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
                PA   QTT GTK +RLA+NSTVQ+VLQDTG+IAPE+HP+HLHGFNFF VG G+GN++
Sbjct  422   ATPPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPESHPVHLHGFNFFVVGSGVGNYD  481

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PKTD   FNL DPVERNTIG+P GGWVA RFRADNPGVWF+HCH EVHTTWGLKMAFLVD
Sbjct  482   PKTDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGVWFLHCHFEVHTTWGLKMAFLVD  541

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  542   NGKGPNES  549



>ref|XP_003615575.1| Laccase 1a [Medicago truncatula]
Length=593

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/578 (71%), Positives = 471/578 (81%), Gaps = 39/578 (7%)
 Frame = -3

Query  1987  RIVVLLAC-CMFPAIVECRVRHYKFD----------------------------------  1913
             RI+ LLA  C+ P  V+  VRHYKF+                                  
Sbjct  7     RIIFLLAAYCLLPLSVDAMVRHYKFNMLHVMHLDFIFVLVDSYIYFMTIKVDNVLLLLLI  66

Query  1912  -VVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRT  1736
              VVMKN TR+CS+KP VT+NG FPGPTIYAREDDTVL++VVN+VKYNVSIHWHGIRQLRT
Sbjct  67    QVVMKNATRLCSTKPIVTINGNFPGPTIYAREDDTVLVKVVNHVKYNVSIHWHGIRQLRT  126

Query  1735  GWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPY  1556
             GWADGPAYITQCPI+PG  YMYNFT+TGQRGTL WHAHILWLR+TVHGA+VILPKLGVPY
Sbjct  127   GWADGPAYITQCPIQPGQVYMYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPY  186

Query  1555  PFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYR  1376
             PFP+P  E V++L+EWWKSDTEA+INEALKSGLAPNVSDAHTINGHPGPV +C++Q G++
Sbjct  187   PFPRPHMEQVIILSEWWKSDTEAIINEALKSGLAPNVSDAHTINGHPGPVQHCASQEGFK  246

Query  1375  LSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVI  1196
               VE GK Y+LR+INAALNE+LFFKIAGHK TVVEVDA Y KPFKTDTIVI PGQTTNV+
Sbjct  247   FQVEPGKTYLLRIINAALNEDLFFKIAGHKFTVVEVDAAYTKPFKTDTIVITPGQTTNVL  306

Query  1195  VTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANS  1016
             +  +  SG+YMVAAS FMDAP+A+DN TATATLHY  TL S  TTLT+ PP+N+T +ANS
Sbjct  307   LKTNHASGKYMVAASTFMDAPIAIDNVTATATLHYPNTLGSTITTLTSLPPINSTKIANS  366

Query  1015  FVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPT  836
             F DSL+SLNS ++PA VP+ +DHSL FT  LG+NPC +C   NGSRVVA++NNVTFVMP 
Sbjct  367   FTDSLKSLNSHKYPARVPKKIDHSLFFTVSLGVNPCATCP--NGSRVVAAINNVTFVMPK  424

Query  835   TALLQAHFFGIKGVFTTDFPANPPFAFNYTG-AGPANLQTTTGTKLFRLAYNSTVQLVLQ  659
              +LLQAHFF I G+FT DFP  P   +++TG   P+N +T  GT+++RLAYNSTVQL+LQ
Sbjct  425   ISLLQAHFFNISGIFTDDFPRKPEIVYDFTGNKQPSNFRTNKGTRVYRLAYNSTVQLILQ  484

Query  658   DTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIR  479
             DTG+IAPENHPIHLHGFNFF VGKG GNFNPK D KKFNLVDPVERNT+G+P+GGW AIR
Sbjct  485   DTGMIAPENHPIHLHGFNFFVVGKGQGNFNPKKDTKKFNLVDPVERNTVGVPSGGWTAIR  544

Query  478   FRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             FRADNPGVWFMHCHLE+HTTWGLKMAF+VDNGKGPNES
Sbjct  545   FRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNES  582



>ref|XP_010037723.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW49475.1| hypothetical protein EUGRSUZ_K02996 [Eucalyptus grandis]
Length=562

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/533 (75%), Positives = 465/533 (87%), Gaps = 3/533 (1%)
 Frame = -3

Query  1954  PAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYN  1775
             PA+VECRVRHYKF+VVMKNMTR+CS+KP VTVNGK PGPT+YARE D VL++V N+VKYN
Sbjct  19    PAMVECRVRHYKFNVVMKNMTRLCSTKPIVTVNGKLPGPTLYAREGDNVLVKVANHVKYN  78

Query  1774  VSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVH  1595
             V+IHWHG+RQLRTGWADGPAYITQCPI+ G +++YNFTITGQRGTLLWHAHILWLR T+H
Sbjct  79    VTIHWHGVRQLRTGWADGPAYITQCPIQTGQNFIYNFTITGQRGTLLWHAHILWLRVTLH  138

Query  1594  GALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHP  1415
             GA+VILPK GVPYPFPKP  E V++LAEWWKSDTE VIN+A+  GLAPNVSDAHTINGHP
Sbjct  139   GAIVILPKRGVPYPFPKPSKEYVIILAEWWKSDTETVINQAMSQGLAPNVSDAHTINGHP  198

Query  1414  GPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTD  1235
             GPV  C ++  Y L VE+GK Y+LR++NAALNEELFFKIA H +TVVEVDATYVKPF+TD
Sbjct  199   GPVPGCPSERSYTLPVESGKTYLLRIVNAALNEELFFKIAQHNLTVVEVDATYVKPFQTD  258

Query  1234  TIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLHYTGTLASGPTTL  1058
             TI+I PGQTTNV++T +Q +G+Y++ AS FM+ A VA+DN TA+A +HY+GTLAS  T L
Sbjct  259   TILITPGQTTNVLLTTNQNAGKYLITASTFMETAIVAIDNVTASAAVHYSGTLASASTVL  318

Query  1057  TTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSR  878
             T  PP NA+ VANSF ++LRSLNSK++PA VP+TVDH+L FT GLG+NPCP+C AGNGSR
Sbjct  319   TKPPPQNASAVANSFNNALRSLNSKKYPAKVPKTVDHNLFFTMGLGVNPCPTCTAGNGSR  378

Query  877   VVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPAN--LQTTTGTK  704
             VVA++NN++FVMPT ALLQAH F I GVFTTDFP NPP  +NYT   P N  + T  GTK
Sbjct  379   VVAAVNNISFVMPTIALLQAHVFNISGVFTTDFPGNPPTTYNYTATPPQNASVPTMNGTK  438

Query  703   LFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVE  524
             ++RL YN+TVQLVLQDTGIIAPE HPIHLHGFNFF VGKG+GN++PK DPKKFNLVDPVE
Sbjct  439   VYRLPYNATVQLVLQDTGIIAPETHPIHLHGFNFFGVGKGVGNYDPKKDPKKFNLVDPVE  498

Query  523   RNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             RNTIGIP+GGW+AIRF ADNPGVWF+HCHLEVHTTWGLKMAFLVDNGKGP E+
Sbjct  499   RNTIGIPSGGWIAIRFTADNPGVWFLHCHLEVHTTWGLKMAFLVDNGKGPKET  551



>ref|XP_010907627.1| PREDICTED: laccase-22-like [Elaeis guineensis]
Length=554

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/544 (74%), Positives = 473/544 (87%), Gaps = 3/544 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             S+ R +VL+A  + P +V+ R RHY F+VVMK  TR+CS+KP VTVNG+FPGPT+YARE 
Sbjct  3     SYIRALVLVAI-LLPVLVDGRTRHYTFNVVMKTATRLCSTKPIVTVNGRFPGPTLYAREG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VL+ V+N VKYNV+IHWHG+RQLRTGWADGPAYITQCPI+PG+SY YNF ITGQRGTL
Sbjct  62    DNVLVNVINQVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQPGNSYAYNFIITGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR TVHGA+VILPKL VPYPFP P  E V++L EWWK+DTEAVIN+ALK+GL
Sbjct  122   FWHAHILWLRVTVHGAIVILPKLNVPYPFPAPYKEEVIILGEWWKADTEAVINQALKTGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAH INGHPGP+++C T  G++L V++G+ YMLR+INAALNEELFFK+AGH+MTV
Sbjct  182   APNVSDAHIINGHPGPMSDCPTSKGFQLEVKSGETYMLRIINAALNEELFFKVAGHQMTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDA+Y KP+KTDTI+I PGQTTNV++TAD+ +G+Y+V AS FMD+P+AVDNQTA AT+
Sbjct  242   VEVDASYTKPYKTDTILITPGQTTNVLLTADREAGRYLVTASTFMDSPIAVDNQTAMATV  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HYT TL++   T T  PP NATPVA++F+DSLRSLNS+Q+PA VP TVDHSLLFT GLG+
Sbjct  302   HYTNTLSTSILTTTDPPPQNATPVASNFIDSLRSLNSEQYPARVPLTVDHSLLFTVGLGV  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+C   NGSRVVA +NNV+F MPTTA+LQAH+F I GVFT DFP  PP  FNYTG+G
Sbjct  362   NPCPTCV--NGSRVVADMNNVSFTMPTTAILQAHYFNISGVFTDDFPGKPPIDFNYTGSG  419

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL T TGT+++RL +NS+VQ+VLQDTGIIAPENHP+HLHGFNFFAVG+GLGN+NP T 
Sbjct  420   PKNLGTMTGTRVYRLPFNSSVQVVLQDTGIIAPENHPLHLHGFNFFAVGRGLGNYNPNTS  479

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P KFNLVDPVERNTIG+P+GGW AIRF ADNPGVWFMHCHLEVHTTWGLKMAF+VDNG G
Sbjct  480   PYKFNLVDPVERNTIGVPSGGWTAIRFSADNPGVWFMHCHLEVHTTWGLKMAFVVDNGIG  539

Query  376   PNES  365
             P+ES
Sbjct  540   PDES  543



>ref|XP_008457399.1| PREDICTED: laccase-4 [Cucumis melo]
Length=562

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/554 (73%), Positives = 470/554 (85%), Gaps = 10/554 (2%)
 Frame = -3

Query  2005  MECSWF------RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFP  1844
             M   WF       ++ ++ C M P  VEC VRHYKF+VVM+ +TR+CSSKP VT+NGKFP
Sbjct  1     MAALWFIRGGLAAVLAVVFCFMSPPPVECLVRHYKFNVVMRKVTRLCSSKPIVTINGKFP  60

Query  1843  GPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNF  1664
             GPTIYAREDDTVL++VVN+V YNVSIHWHGIRQLRTGWADGPAYITQCP++ G SY+YNF
Sbjct  61    GPTIYAREDDTVLVKVVNHVPYNVSIHWHGIRQLRTGWADGPAYITQCPLQTGQSYVYNF  120

Query  1663  TITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAV  1484
             TITGQRGTL WHAHILWLR+T++GA+VILPKLGVPYPFP P  E V++L EWWKSD E V
Sbjct  121   TITGQRGTLWWHAHILWLRATLYGAVVILPKLGVPYPFPTPHKELVLILGEWWKSDVEGV  180

Query  1483  INEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFF  1304
             +NEA KSGLAPNVSDAHTINGHPGPV  C T+ G+ + V+ GK Y+LR+INAALNE+LFF
Sbjct  181   VNEAAKSGLAPNVSDAHTINGHPGPVHGCLTR-GFSMPVQPGKTYLLRIINAALNEDLFF  239

Query  1303  KIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VA  1127
             K+AGHK+TVVEVDA Y KPF TDTIVIAPGQTTN ++TAD  SG+Y ++ASPFMD P VA
Sbjct  240   KVAGHKLTVVEVDAAYTKPFITDTIVIAPGQTTNALLTADLKSGKYAISASPFMDTPIVA  299

Query  1126  VDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDH  947
             VDN TATATLHYTGT+++ PT+ T  PP NAT +A  F +SLRSLNSKQ+PA V   VDH
Sbjct  300   VDNVTATATLHYTGTISTTPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPARVSLEVDH  359

Query  946   SLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANP  767
             SLLFT GLG+N C +C +GN  ++VA +NNVTFVMPT +LLQAH+F I GVFT DFPANP
Sbjct  360   SLLFTVGLGVNRCKTCSSGN--QLVADINNVTFVMPTISLLQAHYFNIDGVFTDDFPANP  417

Query  766   PFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGK  587
             P  ++YTG  P+N+QTT GT+L+RLAYNSTVQLVLQDT +IAPENHP+HLHGFNFF VG 
Sbjct  418   PIRYDYTGKQPSNMQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENHPVHLHGFNFFVVGS  477

Query  586   GLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLK  407
             GLGNFN K DP+KFNLVDPVERNT+G+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLK
Sbjct  478   GLGNFNHKKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLK  537

Query  406   MAFLVDNGKGPNES  365
             MAF+VDNG+GP ES
Sbjct  538   MAFVVDNGRGPEES  551



>ref|XP_011032153.1| PREDICTED: laccase-4-like isoform X1 [Populus euphratica]
Length=523

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/514 (79%), Positives = 451/514 (88%), Gaps = 2/514 (0%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             MKN T++CS+KP VTVNG+FPGPT+ AREDDTVL++VVN+VKYNVSIHWHGIRQLRTGWA
Sbjct  1     MKNSTKLCSTKPIVTVNGQFPGPTLVAREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWA  60

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCPI+PG SY+YNFTITGQRGTL WHAHILWLR+TVHGA+VILPK GVPYPFP
Sbjct  61    DGPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKRGVPYPFP  120

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
              P  E V+VL EWWKSD EAVINEA KSG+APNVSDAHTINGHPGPV+ CS+ GGY L+V
Sbjct  121   TPRKEKVIVLGEWWKSDVEAVINEATKSGMAPNVSDAHTINGHPGPVSACSSHGGYNLTV  180

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
               GK YM R+INAALNEELFFKIAGH++TVVEVDA YVKPFK DT+VIAPGQTTNV++TA
Sbjct  181   HPGKTYMFRIINAALNEELFFKIAGHQLTVVEVDAAYVKPFKIDTVVIAPGQTTNVLLTA  240

Query  1186  DQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVD  1007
             ++GSG+Y+VAASPFMDAP+AVDN TATA LHY+GTLAS  TTLT  P  NATPVA +F +
Sbjct  241   NRGSGKYLVAASPFMDAPIAVDNVTATAILHYSGTLASTITTLTVPPAKNATPVATNFTN  300

Query  1006  SLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTAL  827
             +LRSLNS ++PA VP  +D SL FT GLG+NPC +C   NGSRVVA +NNVTFVMPT AL
Sbjct  301   ALRSLNSIKYPARVPLKIDRSLFFTVGLGVNPCATCI--NGSRVVADINNVTFVMPTIAL  358

Query  826   LQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGI  647
             LQAH F I GVFT DFPANPP  FNYTG  P N QT  GTKL+RLAYN+TVQLVLQDTG+
Sbjct  359   LQAHVFNISGVFTDDFPANPPTPFNYTGTQPTNFQTVNGTKLYRLAYNNTVQLVLQDTGM  418

Query  646   IAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRAD  467
             + PENHPIHLHGFNFF VG+G+GNF+P  DPKKFNLVDPVERNTIG+PAGGW AIRF AD
Sbjct  419   LTPENHPIHLHGFNFFEVGRGVGNFDPNKDPKKFNLVDPVERNTIGVPAGGWTAIRFIAD  478

Query  466   NPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             NPGVWFMHCHLEVHTTWGLKMAF+VDNGKGPNES
Sbjct  479   NPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNES  512



>ref|XP_007134763.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
 gb|ESW06757.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
Length=527

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/516 (79%), Positives = 464/516 (90%), Gaps = 0/516 (0%)
 Frame = -3

Query  1912  VVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTG  1733
             VV K   R+CSSK  VT+NGKFPGPT+YAREDDTVL++V+N V +NV+IHWHG+RQLRTG
Sbjct  1     VVAKQTPRLCSSKSIVTINGKFPGPTLYAREDDTVLVKVINQVNHNVTIHWHGVRQLRTG  60

Query  1732  WADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYP  1553
             WADGPAY+TQCPI+PG +Y+YNFT+TGQRGTLL+HAH+ WLRST+HGALVILPK GVPYP
Sbjct  61    WADGPAYVTQCPIQPGQTYLYNFTLTGQRGTLLYHAHVNWLRSTLHGALVILPKRGVPYP  120

Query  1552  FPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRL  1373
             FPKPD E VVVL EWWKSDTEA+INEALKSGLAPNVSDAHTING PG V NCS++  Y L
Sbjct  121   FPKPDDELVVVLGEWWKSDTEAIINEALKSGLAPNVSDAHTINGLPGTVTNCSSKDVYNL  180

Query  1372  SVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIV  1193
              VE GK Y+LR++NAALNEELFFKIAGHK+TVVEVDATYVKPFK +TIVIAPGQTTNV++
Sbjct  181   PVEGGKTYLLRIVNAALNEELFFKIAGHKLTVVEVDATYVKPFKIETIVIAPGQTTNVLL  240

Query  1192  TADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSF  1013
             +ADQ SG+Y+VAASPFM+APVAVDN TATATLHYTGTLA+ PT LTT PP NAT VA +F
Sbjct  241   SADQKSGKYLVAASPFMNAPVAVDNLTATATLHYTGTLATTPTVLTTPPPKNATQVATNF  300

Query  1012  VDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTT  833
             + SLR LNSK++P NVP TVDHSL FTAGLGINPCPSCKA NGSRVVAS+NNVTF+MPT 
Sbjct  301   ISSLRGLNSKKYPVNVPLTVDHSLFFTAGLGINPCPSCKAANGSRVVASINNVTFLMPTI  360

Query  832   ALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDT  653
             ALLQAH+F IKGVFTTDFPANPP  FNY+G GPANL T TGTK+++L +N+TVQ+VLQDT
Sbjct  361   ALLQAHYFNIKGVFTTDFPANPPHVFNYSGPGPANLNTETGTKVYKLPFNATVQVVLQDT  420

Query  652   GIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFR  473
             GIIAPENHP+HLHGFNFF VG+G+GN+NP TDPK FNLVDPVERNT+G+PAGGW AIRFR
Sbjct  421   GIIAPENHPVHLHGFNFFVVGRGIGNYNPNTDPKNFNLVDPVERNTVGVPAGGWAAIRFR  480

Query  472   ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             ADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKG  +S
Sbjct  481   ADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGSKQS  516



>ref|XP_009590412.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/540 (73%), Positives = 461/540 (85%), Gaps = 3/540 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             ++V LA   FPA VE  VRHYKF VV KN TR+C++KP +TVNGKFPGPT+YAREDDTVL
Sbjct  9     VLVTLATSFFPAFVESIVRHYKFTVVRKNATRLCATKPIITVNGKFPGPTLYAREDDTVL  68

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             +RVVN+V+ NV+IHWHG+RQLRTGW+DGPAYITQCPI+ G SY+YNFT+TGQRGTLLWHA
Sbjct  69    VRVVNHVQDNVTIHWHGVRQLRTGWSDGPAYITQCPIQTGQSYLYNFTLTGQRGTLLWHA  128

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             HI W R+TVHGA+VILPK  VPYPFPKP+ E +++L EWW SD EAVIN+A+K G+APNV
Sbjct  129   HINWQRATVHGAIVILPKRRVPYPFPKPEKEEIIILGEWWSSDVEAVINQAMKMGVAPNV  188

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTINGHPGP  NCS++ GY L VE+GK Y+LR+INAALNEELFFKIAGH +TVVEVD
Sbjct  189   SDAHTINGHPGPAPNCSSK-GYTLHVESGKTYLLRIINAALNEELFFKIAGHNLTVVEVD  247

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A+YVKPFKTDTI IAPGQTTN I+TADQ +G+Y++A SPFMD  VA DN TAT T+HY G
Sbjct  248   ASYVKPFKTDTIFIAPGQTTNAILTADQSAGKYLIAVSPFMDTIVATDNLTATGTVHYLG  307

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
             T A  PT LTT P  NATPV N FVDSLRSLNSK++PANVP T+DHSLL T G+G+NPC 
Sbjct  308   TDALSPTALTTIPSRNATPVTNIFVDSLRSLNSKKYPANVPLTIDHSLLLTMGIGVNPCA  367

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANL  725
             +C+  NGSRVVA++NNVTFVMPTTA+LQAH++ I GV+T DFP NP   FNYTG  P NL
Sbjct  368   TCQ--NGSRVVAAINNVTFVMPTTAILQAHYYNISGVYTADFPGNPSIPFNYTGTPPTNL  425

Query  724   QTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKF  545
             QT  GTK++++ +NSTVQ+VLQ T IIAPE+HP HLHGFNFF VGKG+GN++PK DPKKF
Sbjct  426   QTQNGTKVYKVEFNSTVQVVLQGTSIIAPESHPTHLHGFNFFVVGKGVGNYDPKNDPKKF  485

Query  544   NLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             NLVDPVERNT+ +P  GW AIRFRADNPGVWFMHCHLEVHTTWGLKM FLV+NGKGPN+S
Sbjct  486   NLVDPVERNTMSVPTAGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMGFLVENGKGPNQS  545



>ref|XP_002265173.1| PREDICTED: laccase-4-like [Vitis vinifera]
Length=553

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/543 (71%), Positives = 472/543 (87%), Gaps = 4/543 (1%)
 Frame = -3

Query  1990  FRI-VVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             FR+  +LL   +FP +V   VRHYKF VVMKN TR+C++KP VTVNG+FPGP +YAREDD
Sbjct  3     FRVGAMLLVVLIFPTLVGAMVRHYKFSVVMKNTTRLCATKPIVTVNGRFPGPKLYAREDD  62

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TV++RV+N+V YNV++HWHG++QLRTGW+DGPAY+TQCPI+PG SY+YNFT++GQRGTLL
Sbjct  63    TVIVRVINHVTYNVTLHWHGVKQLRTGWSDGPAYVTQCPIQPGQSYIYNFTLSGQRGTLL  122

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHI WLR+T++GA+VILPK GVPYPFPKPD E VV+L EWWK+D EAVIN+A++SGL 
Sbjct  123   WHAHISWLRATMYGAIVILPKRGVPYPFPKPDREVVVILGEWWKADVEAVINQAIQSGLP  182

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PN+SDAHTINGHPGP + CS+Q GY L+VE+GK YMLR++NAA+N+ELFFKI+GH++TVV
Sbjct  183   PNISDAHTINGHPGPTSTCSSQ-GYTLNVESGKTYMLRIVNAAVNDELFFKISGHQLTVV  241

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA Y KPFKTDT+ IAPGQTTN ++TADQG+G+Y+V  SPFMDAP+ VDN T TA L 
Sbjct  242   EVDAIYAKPFKTDTLFIAPGQTTNALLTADQGAGKYLVVVSPFMDAPIPVDNITGTAILS  301

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             YTGTLA+ PT LTT+P  NAT + +SF+DSL+SLNSKQ+PANVP  +DHSLLFT G+G+N
Sbjct  302   YTGTLAASPTVLTTSPSQNATQLTSSFMDSLKSLNSKQYPANVPLAIDHSLLFTIGVGVN  361

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PC +C   NGSR+V+ +NNVTFVMPTT LL+AH++ I GVFT DFP NP  AFNYTG  P
Sbjct  362   PCSTCV--NGSRLVSYINNVTFVMPTTGLLEAHYYNIGGVFTVDFPGNPLIAFNYTGTQP  419

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
             +N+QT  GT+L+RLAYNSTVQ+V+Q T +I+PE+HP HLHGF+F+AVG+GLGNF+P  DP
Sbjct  420   SNMQTMNGTRLYRLAYNSTVQVVIQGTAMISPESHPTHLHGFDFYAVGRGLGNFDPVNDP  479

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             KKFNL+DP+ RNTIG+P+GGW AIRFRADNPGVW +HCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  480   KKFNLIDPIARNTIGVPSGGWTAIRFRADNPGVWLLHCHLEVHTTWGLKMAFLVENGKGP  539

Query  373   NES  365
             NES
Sbjct  540   NES  542



>gb|KDO37344.1| hypothetical protein CISIN_1g009854mg [Citrus sinensis]
Length=524

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/515 (78%), Positives = 455/515 (88%), Gaps = 3/515 (1%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             MKN TR+CS+KP VTVNG FPGPTI AREDDTVL++VVN+VKYNVSIHWHG+RQLRT WA
Sbjct  1     MKNATRLCSTKPIVTVNGYFPGPTIVAREDDTVLVKVVNHVKYNVSIHWHGVRQLRTCWA  60

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCPI+PG +Y+YNFT+ GQRGTL WHAHILWLR+TVHGA+VILPK GVPYPFP
Sbjct  61    DGPAYITQCPIQPGQNYIYNFTLAGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFP  120

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
             KP  E  V+L+EWWKSD EAVINEALKSGLAPNVSDAHTINGHPGP+++C +QGG++L V
Sbjct  121   KPHKEVTVILSEWWKSDVEAVINEALKSGLAPNVSDAHTINGHPGPLSSCPSQGGFKLPV  180

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
             E+GK YMLR+INAALNEELFFKIAGHK+TVVEVDA YVKPFKT+T++IAPGQTTNV+++A
Sbjct  181   ESGKTYMLRLINAALNEELFFKIAGHKLTVVEVDAAYVKPFKTETVLIAPGQTTNVLLSA  240

Query  1186  DQGSGQYMVAASPFMDAP-VAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFV  1010
                +G+Y+VAASPF+D P + VDN+TATAT+HY+GTL S  TTLT  PP NATPVA +F 
Sbjct  241   AHATGKYLVAASPFLDTPAILVDNKTATATVHYSGTLGSTATTLTVPPPRNATPVAANFT  300

Query  1009  DSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTA  830
              SLRSLNSK++PA VP  +DHSL FT GLGINPC +C   NGSRVVA +NNVTFVMPT +
Sbjct  301   ASLRSLNSKKYPARVPLKIDHSLFFTIGLGINPCATCV--NGSRVVADINNVTFVMPTIS  358

Query  829   LLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTG  650
             LLQAHFF I GVFT DFP NPP  +N+TG  PAN QT  GT+++RL YNSTVQLVLQDTG
Sbjct  359   LLQAHFFKIGGVFTDDFPGNPPVTYNFTGTQPANFQTNNGTRIYRLPYNSTVQLVLQDTG  418

Query  649   IIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRA  470
             +IAPENHP+HLHGFNFF VG+GLGNFN K DPKKFNLVDPVERNTIG+P+GGW AIRFRA
Sbjct  419   MIAPENHPLHLHGFNFFEVGRGLGNFNSKKDPKKFNLVDPVERNTIGVPSGGWTAIRFRA  478

Query  469   DNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             DNPGVWFMHCHLEVHTTWGLKMAF+VDNGKGPNES
Sbjct  479   DNPGVWFMHCHLEVHTTWGLKMAFIVDNGKGPNES  513



>gb|KGN65788.1| hypothetical protein Csa_1G528530 [Cucumis sativus]
Length=562

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/554 (73%), Positives = 468/554 (84%), Gaps = 10/554 (2%)
 Frame = -3

Query  2005  MECSWF------RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFP  1844
             M   WF       ++ ++ C M P  VEC VRHYKF+VVM+ +TR+CSSKP VT+NGKFP
Sbjct  1     MATLWFIRGGLAAVLTVVFCFMSPPPVECLVRHYKFNVVMRKVTRLCSSKPIVTINGKFP  60

Query  1843  GPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNF  1664
             GPTIYAREDDTVLI+VVN+V YNVSIHWHGIRQLRTGWADGPAYITQCP++ G SY+YNF
Sbjct  61    GPTIYAREDDTVLIKVVNHVPYNVSIHWHGIRQLRTGWADGPAYITQCPLQTGQSYVYNF  120

Query  1663  TITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAV  1484
             TITGQRGTL WHAHILWLR+T++GA+VILPKLGVPYPFP P  E V++L EWWKSD EAV
Sbjct  121   TITGQRGTLWWHAHILWLRATLYGAVVILPKLGVPYPFPTPHKELVLILGEWWKSDVEAV  180

Query  1483  INEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFF  1304
             ++EA KSGLAPNVSDAHTINGHPGPV  C T+ G+ + V+ GK Y+LR+INAALNEELFF
Sbjct  181   VHEAAKSGLAPNVSDAHTINGHPGPVNGCLTR-GFSMPVQPGKTYLLRIINAALNEELFF  239

Query  1303  KIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VA  1127
             K+AGHK+TVVEVDA Y KPF TDTI IAPGQTTN ++TAD  SG+Y ++ASPF D P VA
Sbjct  240   KVAGHKLTVVEVDAAYTKPFITDTIFIAPGQTTNALLTADLKSGKYAISASPFRDTPIVA  299

Query  1126  VDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDH  947
             VDN TATATLHYTGT+++ PT+ T  PP NAT +A  F +SLRSLNSKQ+PA V   VDH
Sbjct  300   VDNVTATATLHYTGTISTSPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPARVSLEVDH  359

Query  946   SLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANP  767
             SL FT GLG+N C +C +  G++VVA +NNVTFVMPT +LLQAH+F I GVFT DFPANP
Sbjct  360   SLFFTVGLGVNRCKTCSS--GTQVVADINNVTFVMPTISLLQAHYFNIDGVFTDDFPANP  417

Query  766   PFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGK  587
             P  ++YTG  P+NLQTT GT+L+RLAYNSTVQLVLQDT +IAPENHP+HLHGFNFF VG 
Sbjct  418   PIRYDYTGKQPSNLQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENHPVHLHGFNFFVVGS  477

Query  586   GLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLK  407
             GLGNFN K DP+KFNLVDPVERNT+G+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLK
Sbjct  478   GLGNFNHKKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLK  537

Query  406   MAFLVDNGKGPNES  365
             MAF+V+NG+GP ES
Sbjct  538   MAFVVNNGRGPEES  551



>ref|XP_004506788.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=557

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/544 (76%), Positives = 480/544 (88%), Gaps = 2/544 (0%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             W R+++L++C + PA+VEC+VR YKF VV KN++R+CSSK  VTVNG+FPGPT+YAREDD
Sbjct  4     WVRVLLLISC-ILPALVECKVRRYKFHVVAKNISRLCSSKSIVTVNGEFPGPTLYAREDD  62

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TVL+RVVN V +N++IHWHGIRQLRTGWADGPAY+TQCPI PGHSY+YNFTITGQRGTLL
Sbjct  63    TVLVRVVNKVNHNITIHWHGIRQLRTGWADGPAYVTQCPILPGHSYVYNFTITGQRGTLL  122

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAH+ WLRSTVHGA+VILPK GVPYPFPKPD E V+VL EWWKSDTEA+INEALKSG+A
Sbjct  123   WHAHVNWLRSTVHGAIVILPKRGVPYPFPKPDEELVLVLGEWWKSDTEAIINEALKSGMA  182

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSD+HTING PG V+NCS Q  Y L VE+GK Y+LR+INAALNEELFFKIA HK+T+V
Sbjct  183   PNVSDSHTINGFPGKVSNCSNQEVYNLPVESGKSYLLRIINAALNEELFFKIANHKLTIV  242

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDATYVKPF+ +TIVIAPGQTTNV++ A+Q SG+Y+VAASPFMDAPVAVDN TATATLH
Sbjct  243   EVDATYVKPFEIETIVIAPGQTTNVLLKANQKSGKYLVAASPFMDAPVAVDNLTATATLH  302

Query  1093  YTG-TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             Y+G TL++ PT LTT PP N+T  AN+F++SLR LNSK +P N+P  +DHSL FT GLG+
Sbjct  303   YSGLTLSNTPTFLTTPPPKNSTENANNFLNSLRGLNSKTYPVNLPLKIDHSLYFTIGLGL  362

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
              PCPSCKA NGSRVVA++NNVTFVMPTTALLQAH+F I GVFTTDFP NPPF FN+TG+G
Sbjct  363   QPCPSCKAANGSRVVAAVNNVTFVMPTTALLQAHYFNIGGVFTTDFPPNPPFFFNFTGSG  422

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL T +GTK++RL +N TVQLV+QDTGI+  ENHP+HLHGFNFF +G GLGN+N   D
Sbjct  423   PKNLNTDSGTKVYRLKFNETVQLVMQDTGILTLENHPVHLHGFNFFVIGSGLGNYNSTID  482

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
              K FNLVDPVERNT+G+PAGGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG+G
Sbjct  483   SKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGQG  542

Query  376   PNES  365
             P +S
Sbjct  543   PKQS  546



>ref|XP_010685615.1| PREDICTED: laccase-4 [Beta vulgaris subsp. vulgaris]
Length=560

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/541 (74%), Positives = 466/541 (86%), Gaps = 4/541 (1%)
 Frame = -3

Query  1981  VVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLI  1802
             +V++ C +   +VECRVRHYKF+VV+KN TR+CS+KP VT+NGK+PGPTI AREDDTVL+
Sbjct  11    LVIIGCILPAVLVECRVRHYKFNVVLKNHTRLCSTKPIVTINGKYPGPTIVAREDDTVLV  70

Query  1801  RVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAH  1622
             +VVN+VKYN+SIHWHGIRQ+RTGW+DGPAYITQCPI  G +Y YNFT+TGQRGTL +HAH
Sbjct  71    KVVNHVKYNLSIHWHGIRQIRTGWSDGPAYITQCPIETGQTYTYNFTLTGQRGTLFYHAH  130

Query  1621  ILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVS  1442
             ILWLR+TVHGA+VILPKLGVPYPFPKP  E V+VL EWWKSD EAVINEALKSGLAPNVS
Sbjct  131   ILWLRATVHGAIVILPKLGVPYPFPKPHKENVIVLGEWWKSDVEAVINEALKSGLAPNVS  190

Query  1441  DAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDA  1262
             DAHTING+PGPV +C++Q  + L V  GK+YMLR+INAALNEELFFKIAGH +TVVEVDA
Sbjct  191   DAHTINGYPGPVRSCNSQELFNLHVRPGKKYMLRIINAALNEELFFKIAGHHLTVVEVDA  250

Query  1261  TYVKPFKTDTIVIAPGQTTNVIVTADQGS-GQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             TYVKPFKTDTIVI+PGQTTNVI+ A+    G+Y++  SPFMDAP+ VDN T  AT+ YT 
Sbjct  251   TYVKPFKTDTIVISPGQTTNVILEANNKVLGKYLMVVSPFMDAPIPVDNATGLATVRYTT  310

Query  1084  TL-ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPC  908
             +  A+  TTLT  PP+NAT VA++F ++L++LNSK+FPA VPQ +DHSL FT GLG+NPC
Sbjct  311   SKSATLSTTLTAPPPINATKVADNFTNALKALNSKEFPAKVPQKIDHSLFFTIGLGVNPC  370

Query  907   PSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPAN  728
              +C   NGSRVVAS+NNVTF+MPT +LLQAH+F + GVFT DFP+ P   FNYTG    N
Sbjct  371   STCV--NGSRVVASINNVTFIMPTISLLQAHYFNLSGVFTADFPSKPVIPFNYTGNQVTN  428

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             L TTTGTK++RL YN+TVQLVLQDT +IAPENHP HLHGFNFF VG+GLGN+NPK DPKK
Sbjct  429   LGTTTGTKVYRLPYNATVQLVLQDTAMIAPENHPFHLHGFNFFVVGRGLGNYNPKEDPKK  488

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             FNLVDPVERNTIG+P+GGW AIRFRADNPGVWF+HCHLE+HTTWGLKMAFLVDNGKG NE
Sbjct  489   FNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFLHCHLEIHTTWGLKMAFLVDNGKGLNE  548

Query  367   S  365
             S
Sbjct  549   S  549



>emb|CBI31539.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/523 (72%), Positives = 461/523 (88%), Gaps = 2/523 (0%)
 Frame = -3

Query  1933  VRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHG  1754
             VRHYKF VVMKN TR+C++KP VTVNG+FPGP +YAREDDTV++RV+N+V YNV++HWHG
Sbjct  2     VRHYKFSVVMKNTTRLCATKPIVTVNGRFPGPKLYAREDDTVIVRVINHVTYNVTLHWHG  61

Query  1753  IRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILP  1574
             ++QLRTGW+DGPAY+TQCPI+PG SY+YNFT++GQRGTLLWHAHI WLR+T++GA+VILP
Sbjct  62    VKQLRTGWSDGPAYVTQCPIQPGQSYIYNFTLSGQRGTLLWHAHISWLRATMYGAIVILP  121

Query  1573  KLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCS  1394
             K GVPYPFPKPD E VV+L EWWK+D EAVIN+A++SGL PN+SDAHTINGHPGP + CS
Sbjct  122   KRGVPYPFPKPDREVVVILGEWWKADVEAVINQAIQSGLPPNISDAHTINGHPGPTSTCS  181

Query  1393  TQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPG  1214
             +Q GY L+VE+GK YMLR++NAA+N+ELFFKI+GH++TVVEVDA Y KPFKTDT+ IAPG
Sbjct  182   SQAGYTLNVESGKTYMLRIVNAAVNDELFFKISGHQLTVVEVDAIYAKPFKTDTLFIAPG  241

Query  1213  QTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMNA  1034
             QTTN ++TADQG+G+Y+V  SPFMDAP+ VDN T TA L YTGTLA+ PT LTT+P  NA
Sbjct  242   QTTNALLTADQGAGKYLVVVSPFMDAPIPVDNITGTAILSYTGTLAASPTVLTTSPSQNA  301

Query  1033  TPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNV  854
             T + +SF+DSL+SLNSKQ+PANVP  +DHSLLFT G+G+NPC +C   NGSR+V+ +NNV
Sbjct  302   TQLTSSFMDSLKSLNSKQYPANVPLAIDHSLLFTIGVGVNPCSTCV--NGSRLVSYINNV  359

Query  853   TFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNSTV  674
             TFVMPTT LL+AH++ I GVFT DFP NP  AFNYTG  P+N+QT  GT+L+RLAYNSTV
Sbjct  360   TFVMPTTGLLEAHYYNIGGVFTVDFPGNPLIAFNYTGTQPSNMQTMNGTRLYRLAYNSTV  419

Query  673   QLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGG  494
             Q+V+Q T +I+PE+HP HLHGF+F+AVG+GLGNF+P  DPKKFNL+DP+ RNTIG+P+GG
Sbjct  420   QVVIQGTAMISPESHPTHLHGFDFYAVGRGLGNFDPVNDPKKFNLIDPIARNTIGVPSGG  479

Query  493   WVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             W AIRFRADNPGVW +HCHLEVHTTWGLKMAFLV+NGKGPNES
Sbjct  480   WTAIRFRADNPGVWLLHCHLEVHTTWGLKMAFLVENGKGPNES  522



>ref|XP_010543228.1| PREDICTED: laccase-10 [Tarenaya hassleriana]
Length=558

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/542 (75%), Positives = 471/542 (87%), Gaps = 1/542 (0%)
 Frame = -3

Query  1987  RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             R++VL+A  + P  V+  VR Y F+VV K MTR+CS+K  VTVNGKFPGPTIYAREDDT+
Sbjct  6     RLLVLIALYILPVTVQGDVRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYAREDDTI  65

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPG +Y+YNFT+TGQRGTL WH
Sbjct  66    LVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGQNYVYNFTVTGQRGTLWWH  125

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AHILWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWWKSDTEAVINEALKSGLAPN
Sbjct  126   AHILWLRATVHGAIVILPKPGLPYPFPKPHREEVIMLGEWWKSDTEAVINEALKSGLAPN  185

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAH INGHPGPV+ C +QGG++LSVE GK YMLR+INAA+NEELFFKIAGH+ TVVEV
Sbjct  186   VSDAHIINGHPGPVSTCPSQGGFKLSVETGKTYMLRLINAAMNEELFFKIAGHRFTVVEV  245

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLHY  1091
             DA YVKPF TDTI+IAPGQTT  +V+A + SG+Y++AASPF D A VAVDN+TATAT+HY
Sbjct  246   DAVYVKPFSTDTILIAPGQTTTALVSAVRTSGKYLIAASPFQDAAAVAVDNRTATATVHY  305

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             +GTL++ PT+LT+ PP NAT VANSF+ SLRSLNSK FPANVP TVDH LLF  GLGIN 
Sbjct  306   SGTLSAAPTSLTSPPPRNATSVANSFIGSLRSLNSKNFPANVPATVDHDLLFAVGLGINR  365

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C SCKAGNG+RVVA +NNVTF MPTTALLQAH+F + GV+TTDFP  P  AF++TG  P+
Sbjct  366   CHSCKAGNGTRVVAGINNVTFKMPTTALLQAHYFNLSGVYTTDFPGKPHHAFDFTGKPPS  425

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T   TK+++L YNS VQ+VLQDTG+I+PE+HPIHLHG+NFF VG+G GN+N K+D K
Sbjct  426   NLATMKATKVYKLPYNSRVQVVLQDTGVISPESHPIHLHGYNFFVVGRGSGNYNAKSDAK  485

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+ +P+GGWVAIRFRADNPGVWF+HCHLEVHT+WGLKMAFLV++G GPN
Sbjct  486   KFNLVDPVERNTVSVPSGGWVAIRFRADNPGVWFLHCHLEVHTSWGLKMAFLVEDGNGPN  545

Query  370   ES  365
             +S
Sbjct  546   QS  547



>ref|XP_007220829.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
 gb|EMJ22028.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
Length=558

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/549 (70%), Positives = 464/549 (85%), Gaps = 3/549 (1%)
 Frame = -3

Query  2008  MMECSW-FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTI  1832
             M  C    R ++LL   ++PA V+  VRHYKF VV KN T++CSSKPT+TVNGKFPGPT+
Sbjct  1     MESCRLHLRAMLLLVAFLYPAFVQSLVRHYKFSVVFKNTTKLCSSKPTITVNGKFPGPTL  60

Query  1831  YAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITG  1652
             YAREDDTV++RV+N+V +N++IHWHG+RQL T WADGPAYITQCPI+PG +++YNFT+TG
Sbjct  61    YAREDDTVIVRVINHVNHNLTIHWHGVRQLGTAWADGPAYITQCPIQPGQNFIYNFTLTG  120

Query  1651  QRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEA  1472
             QRGTLLWHAH  WLR+T+HGA+VILPK G PYPFP PD E  V+LAEWWKSD EAV+N++
Sbjct  121   QRGTLLWHAHTSWLRATLHGAIVILPKRGTPYPFPTPDEEKTVILAEWWKSDVEAVVNQS  180

Query  1471  LKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAG  1292
             +KSGL PNVSDAHTINGH GPV  CS+QGGY L VE+GK Y+LR+INAALN++LFFKIAG
Sbjct  181   IKSGLPPNVSDAHTINGHAGPVPGCSSQGGYTLHVESGKTYLLRIINAALNDDLFFKIAG  240

Query  1291  HKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQT  1112
             H +TVVEVDA+Y KPF+TDTI I+PGQTTN I+TA++G G+Y++AASPFMDAPV  DN T
Sbjct  241   HNLTVVEVDASYTKPFQTDTIFISPGQTTNAILTANRGIGKYLIAASPFMDAPVGFDNLT  300

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             + A+L Y GT A+    LT+ PP NATPV N+F+DSLRSLNSKQ+PANVP T+DHSL FT
Sbjct  301   SIASLLYKGTPANPKAFLTSIPPQNATPVTNTFMDSLRSLNSKQYPANVPLTIDHSLFFT  360

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
               +G+NPC +C   NGS++VA+ NNV+FVMPT ALLQA+++  KGVFT DFPANPP  FN
Sbjct  361   IAVGVNPCATCV--NGSKLVAAFNNVSFVMPTIALLQAYYYNTKGVFTLDFPANPPIPFN  418

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG   AN+QTT GT+L+RL YNSTVQ+VLQ T +IAPE+HP HLHGFNFF VGKG+GNF
Sbjct  419   YTGNSTANMQTTNGTRLYRLGYNSTVQIVLQGTAVIAPESHPTHLHGFNFFVVGKGIGNF  478

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             +PK DPK FNLVDPVERNTI +P GGW AIRFRADNPG+WF+HCHLEVHTTWGLKM FLV
Sbjct  479   DPKKDPKTFNLVDPVERNTISVPTGGWTAIRFRADNPGIWFLHCHLEVHTTWGLKMPFLV  538

Query  391   DNGKGPNES  365
             +NGKGPNE+
Sbjct  539   ENGKGPNET  547



>emb|CDP14064.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/546 (71%), Positives = 459/546 (84%), Gaps = 4/546 (1%)
 Frame = -3

Query  1999  CSWFR-IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAR  1823
              SW + +VVL A  +FP  VE   RHYKF+VV +  TR+C++K  VTVNGKFPGPT+YAR
Sbjct  2     ASWLQAVVVLSALVLFPVSVEPVTRHYKFNVVQRKKTRLCATKSIVTVNGKFPGPTVYAR  61

Query  1822  EDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRG  1643
             EDD ++++VVN+V+ NV+IHWHG+RQLRTGW+DGPAYITQCPI+ G SY YNFT+TGQRG
Sbjct  62    EDDRLVVKVVNHVQENVTIHWHGVRQLRTGWSDGPAYITQCPIQSGQSYTYNFTLTGQRG  121

Query  1642  TLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKS  1463
             TLLWH H+ WLR+TVHGA+VILPK GVPYPFPKPD E ++VL EWWKSD EAVIN++L+ 
Sbjct  122   TLLWHGHVNWLRATVHGAIVILPKRGVPYPFPKPDKEEIIVLGEWWKSDVEAVINQSLQV  181

Query  1462  GLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             G APNVSDAHTING PGP  NCS+  GY L VE+GK Y+LR++NA LNEELFFKIAGH++
Sbjct  182   GRAPNVSDAHTINGLPGPAPNCSSN-GYTLHVESGKTYLLRIVNAGLNEELFFKIAGHQL  240

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATA  1103
             T+VEVDA+YVKPFKTDTI I PGQTTN I+TADQ +G+Y++A SPFMD  VA DNQTAT 
Sbjct  241   TIVEVDASYVKPFKTDTIFIGPGQTTNAILTADQDAGKYLIAISPFMDTTVATDNQTATG  300

Query  1102  TLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
              + Y  T A  PT LTT PP NATPV NSF++SLRSLNSK++P  VP  +DHSLLFT G+
Sbjct  301   VIRYKSTTAFSPTALTTIPPRNATPVTNSFMESLRSLNSKEYPTKVPLEIDHSLLFTIGI  360

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG  743
             GINPC +C+  NGSRVVA++NNVTFV+PTTALLQAH++GI GV+T DFP NPP  +NYTG
Sbjct  361   GINPCATCQ--NGSRVVAAINNVTFVLPTTALLQAHYYGISGVYTEDFPGNPPTPYNYTG  418

Query  742   AGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
               P N+QTT GTK+++LA+NSTVQ+V+Q   I+APE+HP HLHGFNFF VGKGLGNFNP 
Sbjct  419   TPPTNIQTTNGTKVYKLAFNSTVQVVIQGNSIVAPESHPTHLHGFNFFVVGKGLGNFNPN  478

Query  562   TDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  383
             TDPKKFNLVDPVERNTI +P GGW  IRFRADNPG+WFMHCHLEVHTTWGLKMAFLV+NG
Sbjct  479   TDPKKFNLVDPVERNTISVPTGGWTVIRFRADNPGIWFMHCHLEVHTTWGLKMAFLVENG  538

Query  382   KGPNES  365
              GPNES
Sbjct  539   NGPNES  544



>gb|EPS60103.1| laccase 1a, partial [Genlisea aurea]
Length=546

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/534 (75%), Positives = 460/534 (86%), Gaps = 2/534 (0%)
 Frame = -3

Query  1960  MFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVK  1781
             +FP IV+ RVRHYKF VV+KN T++CS+K  +TVNG+FPGPTIYAREDDTVL++VVN V 
Sbjct  2     LFPLIVQSRVRHYKFHVVLKNTTKICSTKQILTVNGRFPGPTIYAREDDTVLVKVVNLVN  61

Query  1780  YNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRST  1601
             YNVSIHWHG+RQLRTGW+DGPAYITQCPIRP  S++YNFTI GQRGTLLWHAH+LWLR+T
Sbjct  62    YNVSIHWHGVRQLRTGWSDGPAYITQCPIRPDGSFVYNFTIAGQRGTLLWHAHVLWLRAT  121

Query  1600  VHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  1421
             VHGALV+LP++GVPYPFPKPDHE VVVLAEWWKSDTEAVINEA+ SGLAPNVSD HTING
Sbjct  122   VHGALVVLPRIGVPYPFPKPDHERVVVLAEWWKSDTEAVINEAMSSGLAPNVSDGHTING  181

Query  1420  HPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFK  1241
               GPV  CS+   Y L+V  GK Y+LR+INAALNEELFFKIAGH +TVVE DA YVKPF+
Sbjct  182   LTGPVEGCSSSESYNLAVAPGKTYLLRLINAALNEELFFKIAGHSLTVVEADAVYVKPFQ  241

Query  1240  TDTIVIAPGQTTNVIVTA-DQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGT-LASGP  1067
             TD IVIAPGQTTN I+TA D+ +G++ + A+PF DAP+ VDN+TATAT++Y GT L+S  
Sbjct  242   TDVIVIAPGQTTNAILTASDKLAGKFTILATPFQDAPLPVDNRTATATVNYAGTVLSSSA  301

Query  1066  TTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGN  887
              TL T P +NATP+AN F DSLRSLNSK FPANVP  +DHSL FT GLG+ PC +C+AGN
Sbjct  302   LTLATPPRVNATPIANGFTDSLRSLNSKNFPANVPLEIDHSLFFTVGLGVIPCATCRAGN  361

Query  886   GSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGT  707
             GSR+VA +NNVTFVMPTTALLQAHFF  KGVFTTDFP NPP +F+YTG  P NL TT GT
Sbjct  362   GSRIVADINNVTFVMPTTALLQAHFFKTKGVFTTDFPGNPPSSFDYTGRSPRNLATTNGT  421

Query  706   KLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPV  527
             KL+RL YN TVQ+V+QDTG+I  ENHP+HLHGFNFF VGKGLGNFN   DPK+FNLVDPV
Sbjct  422   KLYRLKYNDTVQIVIQDTGMIMAENHPVHLHGFNFFGVGKGLGNFNSTADPKRFNLVDPV  481

Query  526   ERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             ERNTIG+P+GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD+G  P ++
Sbjct  482   ERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDDGTSPEQT  535



>ref|XP_010676357.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=561

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/547 (73%), Positives = 466/547 (85%), Gaps = 12/547 (2%)
 Frame = -3

Query  1984  IVVLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             ++++L  C+ PAI VECRVRHYKF+VVMKN TR CS+K  VTVNGKFPGPTI AREDDTV
Sbjct  9     VLLVLVACILPAILVECRVRHYKFNVVMKNHTRQCSTKSIVTVNGKFPGPTIVAREDDTV  68

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L++VVN+VKYN++IHWHGIRQ+RTGW+DGPAYI QCPI+PG +Y YNFT+TGQRGTL +H
Sbjct  69    LVKVVNHVKYNLTIHWHGIRQIRTGWSDGPAYIAQCPIQPGQTYTYNFTVTGQRGTLFYH  128

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AHILWLR+TVHGA+VILPKLGVPYPFPKPD E ++VL EWWKSD EAVINEALKSGLAPN
Sbjct  129   AHILWLRATVHGAIVILPKLGVPYPFPKPDKENIIVLGEWWKSDVEAVINEALKSGLAPN  188

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAHTING+  PV NC+++  + + V+ GKRYMLR+INAALNEELFFKIA HK+TVVEV
Sbjct  189   VSDAHTINGYTRPVKNCNSKEMFNIHVKPGKRYMLRIINAALNEELFFKIADHKLTVVEV  248

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTA-DQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             DATYVKPFKTDTIVI+PGQTTNVI+ A ++  G+Y+V  SPFMDAPV VDN T  ATL Y
Sbjct  249   DATYVKPFKTDTIVISPGQTTNVILEANNKAMGKYLVVVSPFMDAPVPVDNATGFATLRY  308

Query  1090  TG----TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
                   TL++   TLT  PP+NAT VA++F ++LRSLN+K+FPA VPQ VDHSL FT GL
Sbjct  309   PAFRHKTLSA---TLTAPPPINATAVADNFTNALRSLNTKEFPAKVPQKVDHSLFFTVGL  365

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG  743
             G+NPC +C   NGSR+VA +NN+TFVMP  ++LQAH++ I GVFT DFPA PP  FN+TG
Sbjct  366   GVNPCKTCV--NGSRIVADINNITFVMPDISILQAHYYNISGVFTDDFPAKPPTPFNFTG  423

Query  742   AGPA-NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
                  N+ TT GTK++RL YN+TVQLVLQDT IIAPENHP HLHGFNFF VGKG+GNFNP
Sbjct  424   NNQVTNVGTTKGTKVYRLPYNATVQLVLQDTAIIAPENHPFHLHGFNFFVVGKGVGNFNP  483

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             K DPKKFNLVDPVERNTIG+P+GGW AIRFRADNPGVWF HCHLE+HTTWGLKMAFLVD+
Sbjct  484   KNDPKKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFFHCHLEIHTTWGLKMAFLVDD  543

Query  385   GKGPNES  365
             GKGP+ES
Sbjct  544   GKGPSES  550



>ref|XP_009407561.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=559

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/551 (70%), Positives = 466/551 (85%), Gaps = 6/551 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M   S  R ++L+   + P + E   RHYKF+V  K  TR+CS+K   TVNG+FPGPT+Y
Sbjct  1     MAASSSLRALILV-FFLLPLLAEGITRHYKFNVAEKKFTRLCSTKSIATVNGQFPGPTLY  59

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             ARE DTVL++VVN+V YNV+IHWHG+RQLRTGWADGPAYITQCPI+PG +Y+YNFT+TGQ
Sbjct  60    AREGDTVLVKVVNHVHYNVTIHWHGVRQLRTGWADGPAYITQCPIQPGQNYVYNFTLTGQ  119

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL WHAHI WLR+TVHGA+V+LPK  VPYPFP P  E V+VLAEWWKSDTEAVINEAL
Sbjct  120   RGTLWWHAHISWLRATVHGAIVVLPKSNVPYPFPAPHKEVVLVLAEWWKSDTEAVINEAL  179

Query  1468  KSGLAPNVSDAHTINGHPGPVANCST--QGGYRLSVEAGKRYMLRVINAALNEELFFKIA  1295
              SGLAPNVSDAHTINGH GP++ CS+  + G+ L V+ GKRY+LR+INAALNE+LFFK+A
Sbjct  180   NSGLAPNVSDAHTINGHAGPLSGCSSSARDGFTLQVDKGKRYLLRIINAALNEDLFFKVA  239

Query  1294  GHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDN  1118
             GH++TVVEVDA Y KPF TDT+++ PGQTTNV++TA QG+G+Y+V ASPFMD+P VAVDN
Sbjct  240   GHQLTVVEVDAAYTKPFTTDTLLLTPGQTTNVLLTARQGAGRYIVTASPFMDSPLVAVDN  299

Query  1117  QTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLL  938
             +TATAT+ Y  ++++   T T  PP NATPVA+SF DSLRSLNS+Q+PA VP TVDHSLL
Sbjct  300   RTATATVQYANSVSTSAITTTKPPPQNATPVASSFTDSLRSLNSQQYPAKVPATVDHSLL  359

Query  937   FTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFA  758
             FT GLG+NPC +C   NGSRVVA +NNV+FVMPTTALLQAH+F   GVFT DFP  PP A
Sbjct  360   FTVGLGVNPCATC--ANGSRVVADINNVSFVMPTTALLQAHYFNASGVFTDDFPGQPPIA  417

Query  757   FNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLG  578
             FNYTG+GP NLQT +GT+L+R+ YN++VQLVLQDTGII PENHPIHLHG+NFF VG+G+G
Sbjct  418   FNYTGSGPRNLQTMSGTRLYRVPYNASVQLVLQDTGIIGPENHPIHLHGYNFFVVGRGVG  477

Query  577   NFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAF  398
             N++PK+ P  FNLVDP+ERNTIG+P+GGW AIRFRADNPGVWF+HCH EVHTTWGLKMAF
Sbjct  478   NYDPKSSPSNFNLVDPIERNTIGVPSGGWTAIRFRADNPGVWFLHCHFEVHTTWGLKMAF  537

Query  397   LVDNGKGPNES  365
             +VD+G+GPN+S
Sbjct  538   VVDDGEGPNQS  548



>ref|XP_007009094.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY17904.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=554

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/544 (71%), Positives = 460/544 (85%), Gaps = 3/544 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW + ++ ++  +FP +VEC++RHY F VV+KN TR+C++KP VTVNG+FPGPT+YARE 
Sbjct  3     SWVQTLLFMSA-LFPVLVECKIRHYNFTVVLKNTTRLCATKPIVTVNGQFPGPTLYAREG  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D VL RV N+V++NV+IHWHG+RQLRTGW+DGPAYITQCPI+PG +++YNFT+TGQRGTL
Sbjct  62    DNVLARVTNHVQHNVTIHWHGVRQLRTGWSDGPAYITQCPIQPGQNFLYNFTVTGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHI WLRST+HGA+VILPK GVPYPFPKP  E V++L EWWK+DTEAV+N+A+++GL
Sbjct  122   LWHAHISWLRSTMHGAIVILPKKGVPYPFPKPYKEKVIILGEWWKADTEAVVNQAMQTGL  181

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGH GP+ANCS++G Y L VE GK Y+LRV+NAA+NEELFFKIAGH +TV
Sbjct  182   APNVSDAHTINGHAGPLANCSSEGAYTLHVETGKTYLLRVVNAAVNEELFFKIAGHNLTV  241

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDA Y KP+KTDT+ + PGQTT  ++TADQG G+Y++A SPFMD  VAVDN TA   L
Sbjct  242   VEVDAVYTKPYKTDTLFLGPGQTTTSLLTADQGIGKYLIAVSPFMDTIVAVDNLTAVGFL  301

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
              Y  TLA  PTTLT+ PP+NAT V   F  SLRSLNSK++PANVP T+DHSL FT G+GI
Sbjct  302   RYNHTLAFTPTTLTSIPPVNATSVTEVFSKSLRSLNSKEYPANVPLTIDHSLFFTIGIGI  361

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPC +C   NGSR VA++NNVTF MPTTALLQAH++GI GVFT DFPA P   FNYTG  
Sbjct  362   NPCATCV--NGSRAVAAINNVTFDMPTTALLQAHYYGISGVFTDDFPAKPLIPFNYTGTP  419

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P++LQT  GT+++RLAYNSTVQL++Q   IIAPE+HP HLHGFNFFAVG+G+GNF+P+ D
Sbjct  420   PSSLQTMNGTRVYRLAYNSTVQLIIQGNSIIAPESHPTHLHGFNFFAVGRGVGNFDPEKD  479

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P KFNLVDPVERNTI +P  GW AIRFRADNPGVWF HCHLEVHTTWGLKMAFLV+NGKG
Sbjct  480   PLKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFFHCHLEVHTTWGLKMAFLVENGKG  539

Query  376   PNES  365
             PNES
Sbjct  540   PNES  543



>ref|XP_011084946.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=555

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/532 (72%), Positives = 448/532 (84%), Gaps = 3/532 (1%)
 Frame = -3

Query  1960  MFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVK  1781
             ++P  VE RVR+YKF VV KN T +C+SKP + VNGKFPGPT+YAREDD V++RVVN+VK
Sbjct  16    LYPTCVESRVRNYKFSVVRKNTTALCASKPIIVVNGKFPGPTLYAREDDIVIVRVVNHVK  75

Query  1780  YNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRST  1601
              NV+IHWHG+RQLRTGW+DGPAYITQCPI+ G SY+YNFT+TGQRGTLLWHAHI W R+T
Sbjct  76    DNVTIHWHGVRQLRTGWSDGPAYITQCPIQTGQSYIYNFTLTGQRGTLLWHAHINWQRAT  135

Query  1600  VHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  1421
             VHGA+VILPK GVPYPFPKPD E +++  EWWKSD EAVIN+A+K G  PNVSDAHTING
Sbjct  136   VHGAIVILPKRGVPYPFPKPDKEEIIIFGEWWKSDVEAVINQAMKLGQPPNVSDAHTING  195

Query  1420  HPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFK  1241
              PGP  NCS+Q GY L VE GK Y+LR++NAA+NEELFFKIAGH++T+VEVDA+Y KPFK
Sbjct  196   LPGPAPNCSSQ-GYTLQVETGKTYLLRIVNAAVNEELFFKIAGHQLTIVEVDASYTKPFK  254

Query  1240  TDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTT  1061
             TDTI I PGQTTN ++TADQ  G Y++A SPFMD  VA+DNQTA  TL Y G LA   TT
Sbjct  255   TDTIFIGPGQTTNALLTADQKIGNYLIAISPFMDTIVAIDNQTAMGTLRYNGMLAVSSTT  314

Query  1060  LTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGS  881
             LT  PP NATP+   F+DSLRSLNSK++PANVPQTVDHSL+F  G+ +NPC +C   NGS
Sbjct  315   LTAMPPQNATPITTKFMDSLRSLNSKEYPANVPQTVDHSLMFAIGVAVNPCATCV--NGS  372

Query  880   RVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKL  701
             RV+A +NNV+FVMPTTA+LQAH++ I GV+T DFPANPP  +NYTG  P ++QT  GTK+
Sbjct  373   RVMADINNVSFVMPTTAILQAHYYNISGVYTDDFPANPPNPYNYTGTPPTSIQTNNGTKV  432

Query  700   FRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVER  521
             +RLAYNSTVQLVLQ T IIAPE+HP HLHGFNF+ VGKGLGN++PK DPK FNLVDPVER
Sbjct  433   YRLAYNSTVQLVLQGTSIIAPESHPTHLHGFNFYVVGKGLGNYDPKNDPKNFNLVDPVER  492

Query  520   NTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             NTI +P  GW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN+S
Sbjct  493   NTISVPTAGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQS  544



>ref|XP_008233715.1| PREDICTED: laccase-4-like [Prunus mume]
Length=558

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/549 (70%), Positives = 461/549 (84%), Gaps = 3/549 (1%)
 Frame = -3

Query  2008  MMECSW-FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTI  1832
             M  C    R ++LL   + PA V+  VRHYKF VV KN T++CSSKPT+TVNGKFPGPT+
Sbjct  1     MESCRLHLRAMLLLVVFLHPAFVQSLVRHYKFSVVFKNTTKLCSSKPTITVNGKFPGPTL  60

Query  1831  YAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITG  1652
             YAREDDTV++RV+N+V +N++IHWHG++QL T WADGPAYITQCPI+PG +++YNFT+TG
Sbjct  61    YAREDDTVIVRVINHVNHNLTIHWHGVKQLGTAWADGPAYITQCPIQPGQNFIYNFTLTG  120

Query  1651  QRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEA  1472
             QRGTLLWHAH  WLR+T+HGA+VILPK G PYPFP PD E  V+LAEWWKSD EAV+N++
Sbjct  121   QRGTLLWHAHTSWLRATLHGAIVILPKRGTPYPFPTPDEEKTVILAEWWKSDVEAVVNQS  180

Query  1471  LKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAG  1292
             +KSGL PNVSDAHTINGH GPV  CS+QGGY L VE+GK Y+LR+INAALN++LFFKIAG
Sbjct  181   IKSGLPPNVSDAHTINGHAGPVPGCSSQGGYTLHVESGKTYLLRIINAALNDDLFFKIAG  240

Query  1291  HKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQT  1112
             H +TVVEVDA+Y KPF+TDTI I+PGQTTN I+TA++  G+Y++AASPFMDAPV  DN T
Sbjct  241   HNLTVVEVDASYTKPFQTDTIFISPGQTTNAILTANRRIGKYLIAASPFMDAPVGFDNLT  300

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             + A+L Y GT A+    LT+ PP NATPV N+F+DSLRSLNSKQ+PANVP T+DHSL FT
Sbjct  301   SIASLRYKGTPANPKAFLTSIPPQNATPVTNTFMDSLRSLNSKQYPANVPLTIDHSLFFT  360

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
               +G+NPC +C   NGS++VA+ NNV+FVMPT ALLQA+++ IKGV+T DFPANPP  FN
Sbjct  361   IAVGVNPCATCV--NGSKLVAAFNNVSFVMPTIALLQAYYYNIKGVYTLDFPANPPIPFN  418

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG   AN+QTT GT+L+RL YNSTVQ+VLQ T +IAPE+HP HLHGFNFF VGKG+GNF
Sbjct  419   YTGNTTANMQTTNGTRLYRLGYNSTVQIVLQGTAVIAPESHPTHLHGFNFFVVGKGIGNF  478

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             +P  DPK FNLVDPVERNTI +P GGW AIRFRADNPG+WF+HCHLEVHTTWGLKM FLV
Sbjct  479   DPTKDPKTFNLVDPVERNTISVPTGGWTAIRFRADNPGIWFLHCHLEVHTTWGLKMPFLV  538

Query  391   DNGKGPNES  365
             +NGKG NE+
Sbjct  539   ENGKGANET  547



>ref|XP_007026782.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY07284.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
Length=490

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/465 (84%), Positives = 433/465 (93%), Gaps = 0/465 (0%)
 Frame = -3

Query  1759  HGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVI  1580
             HG+RQLRTGWADGPAYITQCPI  G SY+YNFTITGQRGTLLWHAHILWLRSTVHGA+VI
Sbjct  15    HGVRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVI  74

Query  1579  LPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVAN  1400
             LPK GVPYPFPKP  E VV+LAEWWKSDTEAVINEALKSGLAPNVSDAHTINGH GPV++
Sbjct  75    LPKRGVPYPFPKPHKEVVVILAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHTGPVSS  134

Query  1399  CSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIA  1220
             C +QGG+ L VE GK Y+LR+INAALNEELFFKIAGHK+TVVEVDATYVKPFKT T++IA
Sbjct  135   CPSQGGFTLPVENGKTYLLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFKTKTVIIA  194

Query  1219  PGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPM  1040
             PGQTTNV+V+AD+ SG+Y+VAASPFMDAP+AVDN TATATLHY+GTLA+ PTTLT+ PP 
Sbjct  195   PGQTTNVLVSADKSSGKYLVAASPFMDAPIAVDNLTATATLHYSGTLANTPTTLTSLPPK  254

Query  1039  NATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLN  860
             NATPVAN+F++SLR+LNSKQ+PA VPQ++DH+L FT GLGINPCP+CKAGNGSR VAS+N
Sbjct  255   NATPVANNFINSLRALNSKQYPALVPQSIDHNLFFTVGLGINPCPTCKAGNGSRAVASIN  314

Query  859   NVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNS  680
             NVTFVMPTTALLQAHFF I GVFTTDFPANPP  FNY+G  P NLQTT GTK+FRLAYNS
Sbjct  315   NVTFVMPTTALLQAHFFNISGVFTTDFPANPPNVFNYSGTPPTNLQTTNGTKVFRLAYNS  374

Query  679   TVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPA  500
             TVQLVLQDTGIIAPENHPIHLHGFNFFAVG+GLGN+NPKTDP+ FNLVDPVERNTIG+P+
Sbjct  375   TVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPKTDPQNFNLVDPVERNTIGVPS  434

Query  499   GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             GGWVAIRFRADNPGVWF+HCHLEVHTTWGLKMAFLVDNGKGPN+S
Sbjct  435   GGWVAIRFRADNPGVWFLHCHLEVHTTWGLKMAFLVDNGKGPNQS  479



>ref|XP_010535416.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535417.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535418.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535419.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
Length=568

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/550 (73%), Positives = 454/550 (83%), Gaps = 9/550 (2%)
 Frame = -3

Query  1993  WFRIVVLLAC-CMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             W  ++ + A  C+ P  V   VRHYKF+VVMKN T++CSSKP VTVNG FPGPTI ARED
Sbjct  10    WVLVLSVFAVVCLLPTTVHSMVRHYKFNVVMKNTTKLCSSKPIVTVNGMFPGPTIVARED  69

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++VVN+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+ G SY YNFT+ GQRGTL
Sbjct  70    DTVLVKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQTGQSYTYNFTLAGQRGTL  129

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
              WHAHILWLR+TVHGA+VILPKLGVPYPFP+P  E ++VL EWWKSD EAVINEA +SGL
Sbjct  130   WWHAHILWLRATVHGAIVILPKLGVPYPFPQPHKEKIIVLGEWWKSDVEAVINEATRSGL  189

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGH GP+ NC +Q GY L V+ GK YMLR++NAALNEELFFKIAGH++TV
Sbjct  190   APNVSDAHTINGHTGPLPNCPSQQGYGLPVKPGKTYMLRIVNAALNEELFFKIAGHELTV  249

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQ-YMVAASPFMDAPVAVDNQTATAT  1100
             VEVDA Y KPFKTDT+VIAPGQTTNV++TA+  +G  YMVAA+ +MDAP+A DN TATAT
Sbjct  250   VEVDAVYTKPFKTDTVVIAPGQTTNVLLTANAYAGSNYMVAATTYMDAPIAFDNVTATAT  309

Query  1099  LHYTG-----TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLF  935
             LHY G       A+  T L T PP NAT VA  F+ SLRSLNS+++PA VP  VDHSL F
Sbjct  310   LHYVGPTTANANAAAKTVLATLPPQNATWVATKFIKSLRSLNSEEYPARVPMNVDHSLFF  369

Query  934   TAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAF  755
             T GLG+NPC SC   NGSRVVA +NNVTFVMP  ALLQAHFF + GVFT DFPA P   +
Sbjct  370   TVGLGVNPCRSCV--NGSRVVADINNVTFVMPKIALLQAHFFNLPGVFTDDFPARPSHPY  427

Query  754   NYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGN  575
             NYTG  PAN  T  GT+L+RL YN+ V++VLQDTG+I PENHPIHLHGFNFF VG+GLGN
Sbjct  428   NYTGTQPANPATMKGTRLYRLPYNARVEIVLQDTGMITPENHPIHLHGFNFFEVGRGLGN  487

Query  574   FNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFL  395
             FN K DPKKFNLVDPVERNT+G+PAGGWVAIRF ADNPGVWFMHCHLE+HTTWGLKMAF+
Sbjct  488   FNQKKDPKKFNLVDPVERNTVGVPAGGWVAIRFTADNPGVWFMHCHLEIHTTWGLKMAFV  547

Query  394   VDNGKGPNES  365
             VDNG GPN S
Sbjct  548   VDNGDGPNHS  557



>sp|Q0IQU1.2|LAC22_ORYSJ RecName: Full=Laccase-22; AltName: Full=Benzenediol:oxygen oxidoreductase 
22; AltName: Full=Diphenol oxidase 22; AltName: 
Full=Urishiol oxidase 22; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAX95423.1| laccase (EC 1.10.3.2) precursor - common tobacco [Oryza sativa 
Japonica Group]
 gb|ABA95532.1| Multicopper oxidase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ19339.1| hypothetical protein OsJ_34890 [Oryza sativa Japonica Group]
Length=564

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/550 (69%), Positives = 467/550 (85%), Gaps = 6/550 (1%)
 Frame = -3

Query  2002  ECSWFRIVVLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             E     ++++ AC +  A+      RHYKF+VVM+NMTR+CS+KP +TVNGKFPGPT+YA
Sbjct  6     ESRRLSLLLMAACFLLQALSAHAITRHYKFNVVMRNMTRLCSTKPILTVNGKFPGPTLYA  65

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             RE D VL++VVN+V +NV+IHWHG+RQ+RTGW DGPAYITQCPI+PG S++YNFTITGQR
Sbjct  66    REGDNVLVKVVNHVAHNVTIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTITGQR  125

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLR+TVHGA+VILPKLGVPYPFP P  EAV+VL EWWK DTE VIN+A++
Sbjct  126   GTLLWHAHINWLRATVHGAIVILPKLGVPYPFPAPHKEAVIVLGEWWKEDTETVINQAMQ  185

Query  1465  SGLAPNVSDAHTINGHPGPVANC-STQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
              G+ PN+SD+HTINGHPGP++ C S+Q G++LSVE GK YMLR+INAALN++LFFK+AGH
Sbjct  186   LGVGPNISDSHTINGHPGPLSECASSQDGFKLSVENGKTYMLRIINAALNDDLFFKVAGH  245

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             ++TVVEVDA Y KPFKTDT++I PGQTTNV+V A+QG+G+Y+++ SPFMDAPV VDN+T 
Sbjct  246   ELTVVEVDAVYTKPFKTDTLLITPGQTTNVLVRANQGAGRYLLSVSPFMDAPVQVDNKTG  305

Query  1108  TATLHYTGTLASGPTTLTTA--PPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLF  935
             TATLHY  T++S   +LT    PP NAT + + F DSL SLNSK++PANVPQTVDHSLL 
Sbjct  306   TATLHYANTVSSSMASLTLVKPPPQNATHIVSKFTDSLHSLNSKEYPANVPQTVDHSLLL  365

Query  934   TAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAF  755
             T G+G+NPCPSC   NG+RVV ++NNVTF+MP+T +LQAH++ I GVFT DFPA P   F
Sbjct  366   TVGVGVNPCPSCI--NGTRVVGTINNVTFIMPSTPILQAHYYNIPGVFTEDFPATPLHKF  423

Query  754   NYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGN  575
             NYTG+GP NLQT  GT+++RL YN++VQ+VLQDTGII+PE+HPIHLHGFNFF VGKG+GN
Sbjct  424   NYTGSGPKNLQTMNGTRVYRLPYNASVQVVLQDTGIISPESHPIHLHGFNFFVVGKGVGN  483

Query  574   FNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFL  395
             +NP+T P  FNL+DP+ERNTIG+P GGW AIRFR+DNPGVWFMHCH EVHT+WGLKMAF+
Sbjct  484   YNPRTSPSTFNLIDPIERNTIGVPTGGWTAIRFRSDNPGVWFMHCHFEVHTSWGLKMAFV  543

Query  394   VDNGKGPNES  365
             VDNGK P+E+
Sbjct  544   VDNGKRPSET  553



>gb|EPS65618.1| hypothetical protein M569_09159, partial [Genlisea aurea]
Length=539

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/528 (74%), Positives = 443/528 (84%), Gaps = 1/528 (0%)
 Frame = -3

Query  1945  VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSI  1766
             V+ ++R Y+F+V+M   TR+CS+K  +TVNGKFPGPTIYAREDDT+ +RV+N   YN+SI
Sbjct  1     VQSKIRRYQFNVMMTKTTRLCSTKSILTVNGKFPGPTIYAREDDTLHVRVINSSPYNISI  60

Query  1765  HWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGAL  1586
             HWHGIRQLRTGWADGPAYITQCPIRPGHSY+YNFTI GQRGTLLWHAHI WLR+TVHG L
Sbjct  61    HWHGIRQLRTGWADGPAYITQCPIRPGHSYVYNFTIAGQRGTLLWHAHISWLRATVHGGL  120

Query  1585  VILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPV  1406
             V+LPK G PYPF KPDHE VVVL EWWKSDTEAV+N+A  SGLAPN+SDAHTING PG  
Sbjct  121   VVLPKAGAPYPFTKPDHERVVVLGEWWKSDTEAVVNQATTSGLAPNISDAHTINGQPGLR  180

Query  1405  ANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIV  1226
             +NC++ GG+ L V  GKRYMLR+INAALN+ELFFKIAGH+MTVVEVDA YVKPF T T++
Sbjct  181   SNCASSGGFTLGVSPGKRYMLRLINAALNDELFFKIAGHEMTVVEVDAVYVKPFTTHTVL  240

Query  1225  IAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTATATLHYTGTLASGPTTLTTA  1049
             + PGQTTNVI++A QGSG+YMVA SPFMD P +AVDN TATATL Y GTL   PT     
Sbjct  241   LTPGQTTNVIISATQGSGKYMVAVSPFMDNPSLAVDNITATATLQYYGTLTDSPTAPARP  300

Query  1048  PPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVA  869
             P  NAT +A +F  SLRSLNS +FPA VP  VDHSLLFT GLGINPC +C+AGNGSRVVA
Sbjct  301   PSQNATTIAEAFASSLRSLNSARFPALVPLKVDHSLLFTVGLGINPCATCRAGNGSRVVA  360

Query  868   SLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLA  689
             S+NNVTF MPTT++LQAH++ I GVFT DFP  P   FNYTGA   N+ T TGTK+++LA
Sbjct  361   SVNNVTFAMPTTSILQAHYYKIAGVFTADFPGKPLNPFNYTGAYKGNMATVTGTKVYKLA  420

Query  688   YNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIG  509
             YNSTVQ+VLQ TGIIAPE+HP HLHGFNFFAVG G GNFNP  DP +FNLVDPVERNT+ 
Sbjct  421   YNSTVQVVLQGTGIIAPESHPFHLHGFNFFAVGSGKGNFNPNLDPARFNLVDPVERNTVA  480

Query  508   IPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             +P GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKM FLV+NG GPN+S
Sbjct  481   VPNGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMVFLVENGNGPNQS  528



>ref|XP_006398646.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
 gb|ESQ40099.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
Length=558

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/542 (74%), Positives = 462/542 (85%), Gaps = 1/542 (0%)
 Frame = -3

Query  1987  RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             RI+V+ A   FPA V   +R Y F+V+ K +TR+CS+K  VTVNGKFPGPTIYA EDDT+
Sbjct  6     RILVIFALLAFPACVHGAIRKYTFNVITKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTI  65

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSY+YNFT+TGQRGTL WH
Sbjct  66    LVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWH  125

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AH+LWLR+TVHGA+VILPK G+PYPFPKP  E V+VL EWWKSDTE V+NEALKSGLAPN
Sbjct  126   AHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIVLGEWWKSDTETVVNEALKSGLAPN  185

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAH INGHPG V NC +QG ++L+VE+GK YMLR++NAA+NEELFFKIAGH+ TVVEV
Sbjct  186   VSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTVVEV  245

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLHY  1091
             DA YVKPF TDTI+IAPGQTT  +V+A + SGQY++AA+PF D A VAVDN+TATAT+HY
Sbjct  246   DAVYVKPFTTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHY  305

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             +GT ++  T  T+ PP NAT VANSFV+SLRSLNS  +PA VP TVDH LLFT GLGIN 
Sbjct  306   SGTFSATATKTTSPPPQNATSVANSFVNSLRSLNSITYPAKVPITVDHDLLFTVGLGINR  365

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C SCKAGN SRVVA++NN+TF MP TALLQAH+F + G++TTDFPA P   F++TG  P+
Sbjct  366   CHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPRRFFDFTGKPPS  425

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N K D K
Sbjct  426   NLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGSGNYNSKKDSK  485

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN
Sbjct  486   KFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPN  545

Query  370   ES  365
             +S
Sbjct  546   QS  547



>ref|NP_195739.2| laccase 10 [Arabidopsis thaliana]
 sp|Q6ID18.1|LAC10_ARATH RecName: Full=Laccase-10; AltName: Full=Benzenediol:oxygen oxidoreductase 
10; AltName: Full=Diphenol oxidase 10; AltName: 
Full=Urishiol oxidase 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAT41838.1| At5g01190 [Arabidopsis thaliana]
 gb|AED90308.1| laccase 10 [Arabidopsis thaliana]
Length=558

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/542 (75%), Positives = 466/542 (86%), Gaps = 1/542 (0%)
 Frame = -3

Query  1987  RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             RI+VL A   FPA V   +R Y F+VV K +TR+CS+K  VTVNGKFPGPTIYA EDDT+
Sbjct  6     RILVLFALLAFPACVHGAIRKYTFNVVTKQVTRICSTKQIVTVNGKFPGPTIYANEDDTI  65

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSY+YNFT+TGQRGTL WH
Sbjct  66    LVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWH  125

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AH+LWLR+TVHGA+VILPKLG+PYPFPKP  E V++L EWWKSDTE V+NEALKSGLAPN
Sbjct  126   AHVLWLRATVHGAIVILPKLGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPN  185

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAH INGHPG V NC +QG ++L+VE+GK YMLR+INAALNEELFFKIAGH+ TVVEV
Sbjct  186   VSDAHVINGHPGFVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEV  245

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLHY  1091
             DA YVKPF TDTI+IAPGQTT  +V+A + SGQY++AA+PF D A VAVDN+TATAT+HY
Sbjct  246   DAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHY  305

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             +GTL++ PT  T+ PP NAT VAN+FV+SLRSLNSK +PANVP TVDH LLFT GLGIN 
Sbjct  306   SGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSKTYPANVPITVDHDLLFTVGLGINR  365

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C SCKAGN SRVVA++NN+TF MP TALLQAH+F + G++TTDFPA P   F++TG  P+
Sbjct  366   CHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPRRVFDFTGKPPS  425

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N K D  
Sbjct  426   NLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYNSKKDSN  485

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN
Sbjct  486   KFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPN  545

Query  370   ES  365
             +S
Sbjct  546   QS  547



>ref|XP_006435668.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
 ref|XP_006486373.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR48908.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
Length=553

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/538 (71%), Positives = 451/538 (84%), Gaps = 3/538 (1%)
 Frame = -3

Query  1978  VLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             +LLA  MFPA+VE  VRHY F VVM NMT++C+SK  VTVNGKFPGPT++AREDD V++R
Sbjct  8     ILLATFMFPALVESAVRHYNFTVVMTNMTKLCASKSIVTVNGKFPGPTLHAREDDNVIVR  67

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             V N+VKYNV+IHWHG+RQLRTGW DGPAYITQCPI+PG SY+YNFT+TGQRGTLLWHAHI
Sbjct  68    VTNHVKYNVTIHWHGVRQLRTGWYDGPAYITQCPIQPGQSYVYNFTLTGQRGTLLWHAHI  127

Query  1618  LWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSD  1439
              WLR+TVHGA+VILPK  VPYPFPK D E ++V  EWWK+D EAVIN+A + G+APNVSD
Sbjct  128   SWLRATVHGAIVILPKRSVPYPFPKADKEKIIVFGEWWKADVEAVINQATQMGVAPNVSD  187

Query  1438  AHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDAT  1259
             AHTINGHPGPV NC++Q G+ L VE+GK Y+LR++NAA+N+ELFFKIAGH +TVVEVD++
Sbjct  188   AHTINGHPGPVTNCTSQ-GFTLHVESGKTYLLRIVNAAVNDELFFKIAGHNLTVVEVDSS  246

Query  1258  YVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTL  1079
             Y KPFKTDTI I PGQTTN ++TAD+  G+Y++  SPFMD  VAV+N T  A L Y GT+
Sbjct  247   YTKPFKTDTIFIGPGQTTNALLTADKKIGKYLITVSPFMDTIVAVNNVTGIAFLRYKGTV  306

Query  1078  ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSC  899
             A   TTLT  P +NAT V N+F D+LRSLNSK++PA VP TVDHSLL T  + +NPC +C
Sbjct  307   AFSSTTLTNVPAINATEVTNTFSDNLRSLNSKRYPAKVPLTVDHSLLITMAVAVNPCATC  366

Query  898   KAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQT  719
                NG++V A++NN++FVMPTTALLQAH++ I GVFT DFPA PP AFNYTG     LQT
Sbjct  367   P--NGTKVGAAMNNISFVMPTTALLQAHYYKISGVFTDDFPAKPPIAFNYTGNYTGTLQT  424

Query  718   TTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNL  539
             T GT+L+RLAYNSTVQLVLQ T +IAPENHP HLHGFNFFAVGKG GNF+P  DP+KFNL
Sbjct  425   TNGTRLYRLAYNSTVQLVLQGTTVIAPENHPTHLHGFNFFAVGKGSGNFDPNKDPQKFNL  484

Query  538   VDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             VDPVERNTI +P  GW AIRFRADNPGVWF+HCHLEVHT+WGLKMAF+VDNGKGPNES
Sbjct  485   VDPVERNTISVPTAGWTAIRFRADNPGVWFLHCHLEVHTSWGLKMAFVVDNGKGPNES  542



>gb|KDO69098.1| hypothetical protein CISIN_1g008799mg [Citrus sinensis]
Length=553

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/538 (71%), Positives = 451/538 (84%), Gaps = 3/538 (1%)
 Frame = -3

Query  1978  VLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             +LLA  MFPA+VE  VRHY F VVM NMT++C+SK  VTVNGKFPGPT++AREDD V++R
Sbjct  8     ILLATFMFPALVESAVRHYNFTVVMTNMTKLCASKSIVTVNGKFPGPTLHAREDDNVIVR  67

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             V N+VKYNV+IHWHG+RQLRTGW DGPAYITQCPI+PG SY+YNFT+TGQRGTLLWHAHI
Sbjct  68    VTNHVKYNVTIHWHGVRQLRTGWYDGPAYITQCPIQPGQSYVYNFTLTGQRGTLLWHAHI  127

Query  1618  LWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSD  1439
              WLR+TVHGA+VILPK  VPYPFPK D E ++V  EWWK+D EAVIN+A + G+APNVSD
Sbjct  128   SWLRATVHGAIVILPKRSVPYPFPKADKEKIIVFGEWWKADVEAVINQATQMGVAPNVSD  187

Query  1438  AHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDAT  1259
             AHTINGHPGPV NC++Q G+ L VE+GK Y+LR++NAA+N+ELFFKIAGH +TVVEVD++
Sbjct  188   AHTINGHPGPVTNCTSQ-GFTLHVESGKTYLLRIVNAAVNDELFFKIAGHNLTVVEVDSS  246

Query  1258  YVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTL  1079
             Y KPFKTDTI I PGQTTN ++TAD+  G+Y++  SPFMD  VAV+N T  A L Y GT+
Sbjct  247   YTKPFKTDTIFIGPGQTTNALLTADKKIGKYLITISPFMDTIVAVNNVTGIAFLRYKGTV  306

Query  1078  ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSC  899
             A   TTLT  P +NAT V N+F D+LRSLNSK++PA VP TVDHSLL T  + +NPC +C
Sbjct  307   AFSSTTLTNVPAINATEVTNTFSDNLRSLNSKRYPAKVPLTVDHSLLLTMAVAVNPCATC  366

Query  898   KAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQT  719
                NG++V A++NN++FVMPTTALLQAH++ I GVFT DFPA PP AFNYTG     LQT
Sbjct  367   P--NGTKVGAAMNNISFVMPTTALLQAHYYKISGVFTDDFPAKPPIAFNYTGNYTGTLQT  424

Query  718   TTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNL  539
             T GT+L+RLAYNSTVQLVLQ T +IAPENHP HLHGFNFFAVGKG GNF+P  DP+KFNL
Sbjct  425   TNGTRLYRLAYNSTVQLVLQGTTVIAPENHPTHLHGFNFFAVGKGSGNFDPNKDPQKFNL  484

Query  538   VDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             VDPVERNTI +P  GW AIRFRADNPGVWF+HCHLEVHT+WGLKMAF+VDNGKGPNES
Sbjct  485   VDPVERNTISVPTAGWTAIRFRADNPGVWFLHCHLEVHTSWGLKMAFVVDNGKGPNES  542



>ref|XP_009384856.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=558

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/551 (69%), Positives = 460/551 (83%), Gaps = 7/551 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M  CSW  ++++    + P + + R RHYKF+VV KN TR+CS K  +TVNG+FPGPT+Y
Sbjct  1     MEPCSWRALILVF--FLLPLLTQGRTRHYKFNVVAKNFTRLCSPKSIITVNGRFPGPTLY  58

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             ARE DTV+++V N+V+ NV+IHWHG+RQL TGWADGPAY+TQCPI+PG +Y YNFT+TGQ
Sbjct  59    AREGDTVIVKVANHVQENVTIHWHGVRQLTTGWADGPAYVTQCPIQPGQNYAYNFTLTGQ  118

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTLLWHAHI+W R+TVHGA+VILPK GVPYPFP P  E V+VLAEWWKSD EAVINEAL
Sbjct  119   RGTLLWHAHIMWQRATVHGAIVILPKRGVPYPFPAPHKEVVLVLAEWWKSDVEAVINEAL  178

Query  1468  KSGLAPNVSDAHTINGHPGPVANC--STQGGYRLSVEAGKRYMLRVINAALNEELFFKIA  1295
             +SGL PNVSDAHTINGH GP + C  S + G+ L V+  K Y+LR+INAALN++LFFK+A
Sbjct  179   QSGLGPNVSDAHTINGHAGPTSGCASSARDGFTLRVDQRKTYLLRIINAALNDDLFFKVA  238

Query  1294  GHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDN  1118
             GH MTVVEVDATY KPF  DT++IAPGQTTNV++TADQG+G+Y+V ASPFMD+P VAVDN
Sbjct  239   GHLMTVVEVDATYTKPFTIDTLLIAPGQTTNVLLTADQGAGRYLVTASPFMDSPLVAVDN  298

Query  1117  QTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLL  938
              T TAT+ YT  +++     T  PP N+T +A+ F+DSLRSLNSKQ+PANVP TVDHSLL
Sbjct  299   STGTATVQYTDAVSTSAIATTKLPPRNSTSLASQFIDSLRSLNSKQYPANVPSTVDHSLL  358

Query  937   FTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFA  758
             FT GLG+NPCP+C   NGSRVVA++NNVTF+MPTTALLQAH+F + GVFT DFP  P  A
Sbjct  359   FTVGLGVNPCPACT--NGSRVVAAMNNVTFMMPTTALLQAHYFNMSGVFTNDFPGQPLIA  416

Query  757   FNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLG  578
             FNYTG+GP N QT  GT+L+RL YN++VQLVLQDTGII PE+HPIHLHG+NFF VG+G+G
Sbjct  417   FNYTGSGPNNTQTMNGTRLYRLPYNASVQLVLQDTGIIGPESHPIHLHGYNFFVVGRGVG  476

Query  577   NFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAF  398
             N++P T P KFNLVDP+ERNT+ +PA GW AIRFRADNPGVWF+HCH EVHTTWGLKMAF
Sbjct  477   NYDPATSPSKFNLVDPIERNTMAVPAAGWTAIRFRADNPGVWFLHCHFEVHTTWGLKMAF  536

Query  397   LVDNGKGPNES  365
             +V++GKGPNES
Sbjct  537   VVEDGKGPNES  547



>ref|XP_009125430.1| PREDICTED: laccase-10 [Brassica rapa]
Length=559

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/544 (74%), Positives = 462/544 (85%), Gaps = 2/544 (0%)
 Frame = -3

Query  1990  FRIVVLLACCMFPA-IVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
              RI+VL A   FPA  V   +R Y F+VV K MTR+CS+K  VTVNGKFPGPTIYA EDD
Sbjct  5     IRILVLFALLAFPAACVHGAIRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYANEDD  64

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSYMYNFT+TGQRGTL 
Sbjct  65    TILVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYMYNFTVTGQRGTLW  124

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAH+LWLR+TVHGA+VILPK G+PYPFPKP  E V+VL EWWKSDTE VINEALKSGLA
Sbjct  125   WHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIVLGEWWKSDTENVINEALKSGLA  184

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAH INGHPG V NC +QG ++L+VE+GK YMLR++NAA+NEELFFKIAGH+ T+V
Sbjct  185   PNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTIV  244

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATL  1097
             EVDA YVKPF TDTI+IAPGQTT  +V+A + SG+Y++AA+PF D A VAVDN+TATAT+
Sbjct  245   EVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATATV  304

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTL++ PT  T+ P  NAT VANSFV+SLRSLNS  +PA VP  +DH LLFT GLGI
Sbjct  305   HYSGTLSATPTKTTSPPAQNATSVANSFVNSLRSLNSVTYPAKVPIKIDHDLLFTVGLGI  364

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             N C SCKAGN SRVVA++NN+TF MP TALLQAH+F + G++TTDFPA P   F++TG  
Sbjct  365   NRCHSCKAGNLSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPHHVFDFTGKP  424

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P+NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N K D
Sbjct  425   PSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGIGSGNYNSKKD  484

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
              KKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKG
Sbjct  485   SKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKG  544

Query  376   PNES  365
             PN+S
Sbjct  545   PNQS  548



>ref|XP_009350996.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/542 (69%), Positives = 454/542 (84%), Gaps = 2/542 (0%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             FR ++ L   ++PA VE  +RHYKF VV KN T +C+SKP VTVNGKFPGPT+YAREDDT
Sbjct  8     FRTMLFLVAFLYPAFVESLIRHYKFSVVYKNTTNLCASKPIVTVNGKFPGPTLYAREDDT  67

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             V++RV N+VKYNV+IHWHG++Q  TGW+DGPAYITQCPI+PG +Y+YNFT+TGQRGTLLW
Sbjct  68    VIVRVTNHVKYNVTIHWHGVKQRGTGWSDGPAYITQCPIQPGQNYIYNFTLTGQRGTLLW  127

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAH  WLR+T+HGA+VILPK   PYPFP PD E ++++AEWWKSD E VIN+A +SGL P
Sbjct  128   HAHDSWLRATLHGAIVILPKRSTPYPFPTPDEEKIIIMAEWWKSDVEDVINQATQSGLPP  187

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             NVSDAHTING  GP+  CS+QGGY L VE GK YMLR++NAA+N+ELFFK+AGH +TVVE
Sbjct  188   NVSDAHTINGRVGPLPGCSSQGGYTLHVENGKTYMLRIVNAAINDELFFKVAGHNLTVVE  247

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             VDA+Y KPF+TDTI   PGQTTNVI+TA+QG G+Y + ASPFMDAP+  DN T  ATL Y
Sbjct  248   VDASYTKPFQTDTIYTGPGQTTNVILTANQGIGKYFITASPFMDAPIGFDNATVIATLRY  307

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
              GT A+    LT+ PP NATP+ ++FVDSLRSLNSKQ+PA+VP T+DHSL FT  +G NP
Sbjct  308   KGTPANPTAILTSIPPRNATPLTDAFVDSLRSLNSKQYPADVPLTIDHSLFFTISVGANP  367

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C +C +  GS++V+++NNV+FVMP+ +LLQA+++ +KGV+T DFPANPP  FNYTG  PA
Sbjct  368   CAACVS--GSKLVSAINNVSFVMPSISLLQAYYYNVKGVYTLDFPANPPIPFNYTGTSPA  425

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NLQTT GT+L+RL YNSTVQ+VLQ T IIAPE+HP HLHGFNFF VGKGLGNF+PK DP+
Sbjct  426   NLQTTNGTRLYRLEYNSTVQIVLQGTAIIAPESHPTHLHGFNFFVVGKGLGNFDPKKDPE  485

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+ +P  GW AIRFRA+NPG+WF+HCHLEVHT+WGLKMAFLV+NG+G N
Sbjct  486   KFNLVDPVERNTVSVPTAGWTAIRFRANNPGIWFLHCHLEVHTSWGLKMAFLVENGEGQN  545

Query  370   ES  365
             ES
Sbjct  546   ES  547



>ref|XP_010033027.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
Length=553

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/543 (72%), Positives = 448/543 (83%), Gaps = 5/543 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             W R  VLLA C+    VE  VRHYKF+VV K   R+CSSKP VTVNG+FPGPTIYAREDD
Sbjct  5     WMR--VLLAACLLATHVEGMVRHYKFNVVEKRTDRLCSSKPIVTVNGRFPGPTIYAREDD  62

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TV ++VVN+V YNV+IHWHG+RQLRT WADGPAYITQCPI+PG  Y YNFTITGQRGTLL
Sbjct  63    TVFVKVVNHVSYNVTIHWHGVRQLRTCWADGPAYITQCPIQPGQIYTYNFTITGQRGTLL  122

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TVHGALVILPK GVPYPFPKP  E V+VLAEWWKSD EAVI EA+KSG A
Sbjct  123   WHAHILWLRATVHGALVILPKRGVPYPFPKPHKEKVIVLAEWWKSDVEAVIGEAIKSGGA  182

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAHTIN HPGPVANC  +GGY L+V  GK YMLR+INAALNEELFFKIA H++TVV
Sbjct  183   PNVSDAHTINSHPGPVANCP-KGGYELAVRPGKTYMLRIINAALNEELFFKIARHQLTVV  241

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA YVKP +TD I++ PGQTT  ++ A   +G+Y++  SPFMDAPV+VDN TATAT+ 
Sbjct  242   EVDAAYVKPLRTDAILVGPGQTTTALLMAYHTTGKYLMIVSPFMDAPVSVDNVTATATVR  301

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y GT A+ P      P  NAT VA  FV SLRSLN+  +PA VP  +DHSL FT G+G+N
Sbjct  302   YAGTPAASPAVPIAPPSPNATWVAEGFVGSLRSLNTGAYPARVPLEIDHSLFFTVGIGVN  361

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PC +C   +G RVVA  NN++FVMP TALL AH++ + GVFT DFPA P   FNYTGA P
Sbjct  362   PCATC--ASGFRVVADFNNISFVMPKTALLSAHYYKMTGVFTDDFPAKPMIRFNYTGAQP  419

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              NL T TGT+L+RL YNSTVQLVLQDTG++APENHPIHLHGFNFFAVG+G+GNF+P TDP
Sbjct  420   VNLNTMTGTRLYRLRYNSTVQLVLQDTGMVAPENHPIHLHGFNFFAVGRGIGNFDPITDP  479

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             +KFNLVDPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VD+G+GP
Sbjct  480   RKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDDGEGP  539

Query  373   NES  365
             ++S
Sbjct  540   DQS  542



>emb|CDY48114.1| BnaC02g03710D [Brassica napus]
Length=559

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/543 (75%), Positives = 465/543 (86%), Gaps = 2/543 (0%)
 Frame = -3

Query  1987  RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             RI+VL A   FPA V   VR Y F+VV K MTR+CS+K  VTVNGKFPGPTIYA EDDT+
Sbjct  6     RILVLFALLAFPACVHGAVRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYANEDDTI  65

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSY+YNFT+TGQRGTL WH
Sbjct  66    LVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWH  125

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AH+LWLR+TVHGA+VILPKLG+PYPFPKP  E V+VL EWWKSDTE VINEALKSGLAPN
Sbjct  126   AHVLWLRATVHGAIVILPKLGLPYPFPKPHREEVIVLGEWWKSDTENVINEALKSGLAPN  185

Query  1447  VSDAHTINGHPGPVANCSTQGG-YRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             VSDAH INGHPG V NC +QG  ++L+VE+GK YMLR++NAA+NEELFFKIAGH+ T+VE
Sbjct  186   VSDAHVINGHPGLVPNCPSQGSNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTIVE  245

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLH  1094
             VDA YVKPF TDTI+IAPGQTT  +V+A + SG+Y++AA+PF D A VAVDN+TATAT+H
Sbjct  246   VDAVYVKPFTTDTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATATVH  305

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y+GTL++ PT  T+ PP NAT VANSFV+SLRSLNS  +PA VP TVDH LLFT GLGIN
Sbjct  306   YSGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSATYPAKVPTTVDHDLLFTVGLGIN  365

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
              C SCKAGN SRVVA++NN+TF MP TALLQAH+F + G++TTDFPA P   F++TG  P
Sbjct  366   RCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPHHVFDFTGKPP  425

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
             +NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N K D 
Sbjct  426   SNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGIGSGNYNSKKDA  485

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             KKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGP
Sbjct  486   KKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGP  545

Query  373   NES  365
             N+S
Sbjct  546   NQS  548



>ref|XP_002873023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49282.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/548 (73%), Positives = 466/548 (85%), Gaps = 1/548 (0%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME    RI+VL A   FPA V   +R Y F+VV K +TR+CS+K  VTVNGKFPGPTIYA
Sbjct  1     MEFPITRILVLFALLAFPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
              EDDT+L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSY+YNFT+TGQR
Sbjct  61    NEDDTILVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAH+LWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWWKSDTE V+NEALK
Sbjct  121   GTLWWHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTETVVNEALK  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAH INGHPG V NC +QG ++L+VE+GK YMLR+INAA+NEELFFKIAGH+
Sbjct  181   SGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAAMNEELFFKIAGHR  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTA  1109
              TVVEVDA YVKPF TDTI+IAPGQTT  +V+A + SGQY++AA+PF D A VAVDN+TA
Sbjct  241   FTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTA  300

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TAT+HY+GTL++ PT  T+ PP NAT VAN+F++SLRSLNSK +PA VP TVDH LLFT 
Sbjct  301   TATVHYSGTLSATPTKTTSPPPQNATSVANTFINSLRSLNSKTYPAKVPITVDHDLLFTV  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+N C SCKAGN SRVVA++NN+TF MP TALLQAH+F + G++TTDFP  P   F++
Sbjct  361   GLGVNRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPGKPRRFFDF  420

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P+NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N
Sbjct  421   TGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYN  480

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
              K D KKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+
Sbjct  481   SKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVE  540

Query  388   NGKGPNES  365
             NGKGPN+S
Sbjct  541   NGKGPNQS  548



>ref|XP_008392913.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/542 (68%), Positives = 452/542 (83%), Gaps = 2/542 (0%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             FR ++ L   ++PA VE  +RHY+F VV K+ T +CSSKP VTVNGKFPGPT+YAREDDT
Sbjct  8     FRTMLFLVAFLYPAFVESLIRHYEFSVVYKDTTNLCSSKPIVTVNGKFPGPTLYAREDDT  67

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             V+++V N+VKYNV+IHWHG++Q  TGW+DGPAYITQCPI+PG +Y+YNFT+TGQRGTLLW
Sbjct  68    VIVKVTNHVKYNVTIHWHGVKQRGTGWSDGPAYITQCPIQPGRNYIYNFTLTGQRGTLLW  127

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAH  WLR+T+HGA+VILPK G PYPFP PD E ++++AEWWKSD E VIN+A +SGL P
Sbjct  128   HAHDSWLRATLHGAIVILPKRGTPYPFPTPDEEKIIIMAEWWKSDVEDVINQATQSGLPP  187

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             NVSDAHTING  GP+  CS+QGGY L VE+ K YMLR++NAALN+ELFFK+AGH +TVVE
Sbjct  188   NVSDAHTINGRVGPLPGCSSQGGYTLHVESDKTYMLRIVNAALNDELFFKVAGHSLTVVE  247

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             VDA+Y KPF+TDTI   PGQTTN I+TA+QG G+Y + ASPFMDAP+  DN T  ATL Y
Sbjct  248   VDASYTKPFQTDTIYTGPGQTTNAILTANQGIGKYFITASPFMDAPIGFDNATVIATLRY  307

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
              GT A+    LT+ PP NATP+ ++FVDSLRSLNSKQ+PA+VP T+DHSL FT  +G NP
Sbjct  308   KGTPANPTAILTSIPPRNATPLTDAFVDSLRSLNSKQYPADVPLTIDHSLFFTISVGANP  367

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C +C +  GS++V++ NNV+FVMP+ +LLQA+++ +KGV+T DFPANPP  FNYTG  PA
Sbjct  368   CATCVS--GSKLVSAFNNVSFVMPSISLLQAYYYNVKGVYTLDFPANPPIPFNYTGTSPA  425

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NLQTT GT+L+RL YNSTVQ+VLQ T IIAPE+HP HLHGFNFF VGKGLGNF+PK DP 
Sbjct  426   NLQTTNGTRLYRLEYNSTVQIVLQGTAIIAPESHPTHLHGFNFFVVGKGLGNFDPKKDPG  485

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+ +P  GW AIRFRA+NPG+WF+HCHLEVHT+WGLKMAFLV+NG+G N
Sbjct  486   KFNLVDPVERNTVSVPTAGWTAIRFRANNPGIWFLHCHLEVHTSWGLKMAFLVENGEGQN  545

Query  370   ES  365
             ES
Sbjct  546   ES  547



>ref|XP_006287399.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
 gb|EOA20297.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
Length=558

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/542 (75%), Positives = 462/542 (85%), Gaps = 1/542 (0%)
 Frame = -3

Query  1987  RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             RI+VL A   FPA V   +R Y F+VV K +TR+CS+K  VTVNGKFPGPTIYA EDDT+
Sbjct  6     RILVLFALLAFPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTI  65

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSY+YNFT+TGQRGTL WH
Sbjct  66    LVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWH  125

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AH+LWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWWKSDTE VINEAL+SGLAPN
Sbjct  126   AHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVINEALRSGLAPN  185

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAH INGHPG V NC +QG ++L+VE+GK YMLR+INAALNEELFFKIAGH+ TVVEV
Sbjct  186   VSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEV  245

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLHY  1091
             DA YVKPF TDTI+IAPGQTT  +V+A + SGQY++AA+PF D A VAVDN+TATAT+HY
Sbjct  246   DAAYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHY  305

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             +GTL++ PT  T+ PP NAT VANSFV SLRSLNS  +PA VP TVDH LLFT GLGIN 
Sbjct  306   SGTLSATPTKTTSPPPQNATSVANSFVKSLRSLNSNTYPAKVPVTVDHDLLFTVGLGINR  365

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C SCKAGN SRVVA++NN+TF MPTTALLQAH+F   GV+TTDFP  P   F++TG  P+
Sbjct  366   CHSCKAGNFSRVVAAINNITFKMPTTALLQAHYFNQTGVYTTDFPGRPRRVFDFTGKPPS  425

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T   TKL++L YN+TVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N K D K
Sbjct  426   NLATMKATKLYKLPYNATVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGSGNYNSKRDSK  485

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN
Sbjct  486   KFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  545

Query  370   ES  365
             +S
Sbjct  546   QS  547



>ref|XP_004980096.1| PREDICTED: laccase-22-like [Setaria italica]
Length=589

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/544 (68%), Positives = 465/544 (85%), Gaps = 5/544 (1%)
 Frame = -3

Query  1987  RIVVLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             R++++ +  +  A+      RHYKF+V+M+N+TR+CS+KP +TVNGKFPGPT+YAREDD 
Sbjct  37    RLLLMASFVLLQALSAHAITRHYKFNVIMRNVTRLCSTKPILTVNGKFPGPTLYAREDDN  96

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             VL++VVN+V +NV+IHWHG+RQ+RTGW+DGPAYITQCPI+PG S++YNFT+TGQRGTLLW
Sbjct  97    VLVKVVNHVTHNVTIHWHGVRQIRTGWSDGPAYITQCPIQPGTSFLYNFTVTGQRGTLLW  156

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHI WLR+TVHGA+VILPKLGVPYPFP P  E VVVL EWWK+DTE VIN+A++ G+ P
Sbjct  157   HAHINWLRATVHGAIVILPKLGVPYPFPTPHKEVVVVLGEWWKADTEVVINQAMQQGVGP  216

Query  1450  NVSDAHTINGHPGPVANC-STQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             NVSD+HTINGHPGP+++C S+Q G++L+VE GK YMLR+INAALN++LFFKIAGHK TVV
Sbjct  217   NVSDSHTINGHPGPLSDCASSQDGFKLNVENGKTYMLRIINAALNDDLFFKIAGHKFTVV  276

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA Y KPFKT T++I PGQTTNV++TAD+ +G+Y+++ SPFMDAPV VDN+T TATLH
Sbjct  277   EVDAVYTKPFKTATLLITPGQTTNVLLTADRTAGRYLLSVSPFMDAPVQVDNKTGTATLH  336

Query  1093  YTGTL-ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             Y  T+ A+ P TL   PP NAT + + FV+SLRSLNS+++PANVP TVDHSL+FT G+G+
Sbjct  337   YANTISATAPLTLIKPPPQNATTIVSKFVESLRSLNSEEYPANVPLTVDHSLVFTVGVGV  396

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPC  C   N +R+V ++NNVTF+MP+T +LQAH++ I GVFT DFPA PP  FNYTG+G
Sbjct  397   NPCAKCI--NATRLVGTINNVTFIMPSTPILQAHYYNIPGVFTDDFPATPPHKFNYTGSG  454

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NLQT  GT+++RL YN++VQ+VLQDTGII+PE+HPIHLHGFNFF VG G+GN+NPKT 
Sbjct  455   PKNLQTMKGTRVYRLPYNASVQVVLQDTGIISPESHPIHLHGFNFFVVGNGVGNYNPKTS  514

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P  FNL+DP+ERNTIG+P GGW AIRFRADNPGVWFMHCH EVHT+WGLKM F+VDNGK 
Sbjct  515   PSTFNLIDPIERNTIGVPTGGWAAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDNGKR  574

Query  376   PNES  365
             P+E+
Sbjct  575   PDET  578



>emb|CDY55905.1| BnaAnng13970D [Brassica napus]
Length=563

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/548 (73%), Positives = 462/548 (84%), Gaps = 6/548 (1%)
 Frame = -3

Query  1990  FRIVVLLACCMFPA-IVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
              RI+VL A   FPA  V   +R Y F+VV K MTR+CS+K  VTVNGKFPGPTIYA EDD
Sbjct  5     IRILVLFALLAFPAACVHGAIRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYANEDD  64

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             T+L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSYMYNFT+TGQRGTL 
Sbjct  65    TILVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYMYNFTVTGQRGTLW  124

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAH+LWLR+TVHGA+VILPK G+PYPFPKP  E V+VL EWWKSDTE VINEALKSGLA
Sbjct  125   WHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIVLGEWWKSDTENVINEALKSGLA  184

Query  1453  PNVSDAHTINGHPGPVANCSTQGG----YRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             PNVSDAH INGHPG V NC +QG     ++L+VE+GK YMLR++NAA+NEELFFKIAGH+
Sbjct  185   PNVSDAHVINGHPGLVPNCPSQGSLSCNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHR  244

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTA  1109
              T+VEVDA YVKPF TDTI+IAPGQTT  +V+A + SG+Y++AA+PF D A VAVDN+TA
Sbjct  245   FTIVEVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTA  304

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TAT+HY+GTL++ PT  T+ P  NAT VANSFV+SLRSLNS  +PA VP  +DH LLFT 
Sbjct  305   TATVHYSGTLSATPTKTTSPPAQNATSVANSFVNSLRSLNSVTYPAKVPIKIDHDLLFTV  364

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLGIN C SCKAGN SRVVA++NN+TF MP TALLQAH+F + G++TTDFPA P   F++
Sbjct  365   GLGINRCHSCKAGNLSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPHHVFDF  424

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P+NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N
Sbjct  425   TGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGIGSGNYN  484

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
              K D KKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+
Sbjct  485   SKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVE  544

Query  388   NGKGPNES  365
             NGKGPN+S
Sbjct  545   NGKGPNQS  552



>ref|XP_006840270.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
 gb|ERN01945.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
Length=565

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/556 (71%), Positives = 467/556 (84%), Gaps = 11/556 (2%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME    R ++L+AC + PA+VECRVRHYKF+VV+KN TR+C +KP VTVNG FPGPT+YA
Sbjct  1     MESRVVRTLLLVAC-LLPALVECRVRHYKFNVVVKNTTRLCQTKPIVTVNGGFPGPTVYA  59

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             RE D VL++VVN+VKYN+SIHWHGIRQ+RTGWADGPAYITQCPI+ G +Y YNFTITGQR
Sbjct  60    REGDNVLVKVVNHVKYNLSIHWHGIRQVRTGWADGPAYITQCPIQTGQTYTYNFTITGQR  119

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHILWLR+TVHGA+VILPK GVPYPFPKP  E VV+LAEWW SD EAVIN A+K
Sbjct  120   GTLLWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVVVILAEWWNSDVEAVINTAMK  179

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQ--GGYRLSVEAGKRYMLRVINAALNEELFFKIAG  1292
             SG APNVSDAHTINGHPGP++NCS+Q  GG++L VE+GK Y+LR+INAALNEELFF +AG
Sbjct  180   SGAAPNVSDAHTINGHPGPLSNCSSQGGGGFKLEVESGKTYLLRIINAALNEELFFGVAG  239

Query  1291  HKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQT  1112
             H +TVVEVDATY KPF T T++IAPGQTTNV++ AD+  G+Y+ AASPFMDAP+AVDN T
Sbjct  240   HPLTVVEVDATYNKPFTTTTVLIAPGQTTNVLLKADKSGGRYIAAASPFMDAPIAVDNAT  299

Query  1111  ATATLHYTGT--LASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQ--TVDHS  944
             ATA LHYT T   +S  TT  + PP+NATPVA+ F+DSLRSL  K   +++P+   VDHS
Sbjct  300   ATALLHYTDTPSSSSVSTTFVSLPPLNATPVASKFMDSLRSL-KKPPSSSLPRHSRVDHS  358

Query  943   LLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPP  764
             L  T GLGI PCP+C A NGSRV+A++NN++FVMPT  LLQAH+F I GVFT DFPA PP
Sbjct  359   LFITVGLGIFPCPTCTANNGSRVLAAMNNISFVMPTFNLLQAHYFNISGVFTDDFPAKPP  418

Query  763   FAFNYT-GAGPAN--LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAV  593
               FNYT    P N  +  + GT+L+RL +NS+VQ+VLQDTG I+PENHP+HLHGFNFF V
Sbjct  419   TPFNYTQNPTPQNTSIVLSNGTRLYRLPFNSSVQVVLQDTGFISPENHPVHLHGFNFFVV  478

Query  592   GKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWG  413
             G+G+GNF+PK DP KFNLVDPVERNT+G+P+GGW A RF ADNPGVWFMHCHLE+HTTWG
Sbjct  479   GRGIGNFDPKKDPAKFNLVDPVERNTVGLPSGGWTAFRFIADNPGVWFMHCHLEIHTTWG  538

Query  412   LKMAFLVDNGKGPNES  365
             LKMAF+VDNGKGPN+S
Sbjct  539   LKMAFVVDNGKGPNQS  554



>gb|KHG11130.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/544 (75%), Positives = 450/544 (83%), Gaps = 54/544 (10%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             S F+++VLLA  +FP +V+C VRHY                                   
Sbjct  3     SLFQVLVLLAF-LFPVLVDCTVRHYT----------------------------------  27

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
                                HG+RQLRTGWADGPAYITQCPI  G SY+YNFTITGQRGTL
Sbjct  28    -------------------HGVRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQRGTL  68

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAHILWLRSTVHGA+VILPK GVPYPFPKP  EAVVVL EWWKSDTEAVINEALKSGL
Sbjct  69    LWHAHILWLRSTVHGAIVILPKRGVPYPFPKPHKEAVVVLGEWWKSDTEAVINEALKSGL  128

Query  1456  APNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTV  1277
             APNVSDAHTINGHPGP+++C +Q G+ L+VE GK Y+LR+INAALNEELFFKIAGHK+TV
Sbjct  129   APNVSDAHTINGHPGPISSCPSQRGFTLAVENGKTYLLRLINAALNEELFFKIAGHKLTV  188

Query  1276  VEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATL  1097
             VEVDATYVKPFK DT+VIAPGQTTNV+++ADQ SG+Y+VAASPFMDAPVAVDN TATAT+
Sbjct  189   VEVDATYVKPFKIDTVVIAPGQTTNVLLSADQSSGKYLVAASPFMDAPVAVDNLTATATV  248

Query  1096  HYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
             HY+GTLA+ PTTLT  PP NAT VAN F++SLR+LNSKQFPA VPQT+DHSL FT GLGI
Sbjct  249   HYSGTLANTPTTLTAPPPKNATAVANKFINSLRALNSKQFPALVPQTIDHSLYFTVGLGI  308

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
             NPCP+CKAGNGSR VAS+NN+TF MPTTALLQAHFF I GVFTTDFPANPP  FNY+G  
Sbjct  309   NPCPTCKAGNGSRAVASVNNLTFTMPTTALLQAHFFNISGVFTTDFPANPPHKFNYSGTP  368

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL+T TGTK+FRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFF+VGKGLGN+NPKTD
Sbjct  369   PTNLKTMTGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFSVGKGLGNYNPKTD  428

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P+ FNLVDPVERNTIG+PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKG
Sbjct  429   PQNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKG  488

Query  376   PNES  365
             PN+S
Sbjct  489   PNQS  492



>gb|KDP24484.1| hypothetical protein JCGZ_25048 [Jatropha curcas]
Length=486

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/465 (82%), Positives = 424/465 (91%), Gaps = 0/465 (0%)
 Frame = -3

Query  1759  HGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVI  1580
             HGIRQLRTGWADGPAYITQCPI+PG +Y+YNFTITGQRGTLLWHAHILWLRSTVHG LVI
Sbjct  11    HGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLLWHAHILWLRSTVHGGLVI  70

Query  1579  LPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVAN  1400
             LPK GVPYPFP P  E VVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPG VAN
Sbjct  71    LPKRGVPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGAVAN  130

Query  1399  CSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIA  1220
             C +Q G+ L VE GK Y+LR++NAALNEELFFKIAGH++TVVEVDATYVKPFKTDT++IA
Sbjct  131   CPSQDGFNLPVENGKTYLLRLVNAALNEELFFKIAGHQLTVVEVDATYVKPFKTDTVLIA  190

Query  1219  PGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPM  1040
             PGQTTNV+VTADQ SG+Y+VAA+PFMDAPVAVDN+TATATLHY+  L+S  T LT  PP 
Sbjct  191   PGQTTNVLVTADQSSGKYLVAAAPFMDAPVAVDNKTATATLHYSAALSSTTTILTKPPPQ  250

Query  1039  NATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLN  860
             NAT VAN F++SLRSLNSK++PA VP  +DH+LLFT GLG+NPCP+CKAGNGSRVVAS+N
Sbjct  251   NATAVANKFINSLRSLNSKKYPAKVPLKIDHNLLFTVGLGVNPCPTCKAGNGSRVVASIN  310

Query  859   NVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNS  680
             NVTFVMPTTALLQAHFF I GVFTTDFPANPP  FN+TG GPANLQT  GT++++L YN 
Sbjct  311   NVTFVMPTTALLQAHFFNINGVFTTDFPANPPHVFNFTGKGPANLQTKNGTRVYKLKYNE  370

Query  679   TVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPA  500
             TVQLV+QDTGIIAPENHP+HLHGFNFFAVG+G+G++NPKTDP+ FNLVDP ERNTIG+P 
Sbjct  371   TVQLVMQDTGIIAPENHPVHLHGFNFFAVGRGIGSYNPKTDPQNFNLVDPPERNTIGVPT  430

Query  499   GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPNES
Sbjct  431   GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNES  475



>ref|XP_010452014.1| PREDICTED: laccase-10 isoform X1 [Camelina sativa]
 ref|XP_010452015.1| PREDICTED: laccase-10 isoform X2 [Camelina sativa]
Length=559

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/542 (75%), Positives = 464/542 (86%), Gaps = 1/542 (0%)
 Frame = -3

Query  1987  RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             RI+V+ A   FPA V   +R Y F+VV K +TR+CS+K  VTVNGKFPGPTIYA EDDTV
Sbjct  7     RILVIFALIAFPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTV  66

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSY+YNFT+TGQRGTL WH
Sbjct  67    LVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWH  126

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AH+LWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWWKSDTE V+NEALKSGLAPN
Sbjct  127   AHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVVNEALKSGLAPN  186

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAH INGHPG V NC +QG ++L+VE+GK YMLR+INAALNEELFFKIAGH+ TVVEV
Sbjct  187   VSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEV  246

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLHY  1091
             DA YVKPF TDTI+IAPGQTT  +V+A + SGQY++AA+PF D A VAVDN+TATAT+HY
Sbjct  247   DAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHY  306

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             +GTL++ PT  T+ PP NAT VANSFV+SLRSLNS  +PANVP  VDH LLFT GLGIN 
Sbjct  307   SGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGLGINR  366

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C SCKAGN SRVVA++NN+TF MPTTALLQAH+F + GV+TTDFP  P   F++TG  P+
Sbjct  367   CHSCKAGNFSRVVAAINNITFKMPTTALLQAHYFNLTGVYTTDFPGKPRRFFDFTGKPPS  426

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N K D K
Sbjct  427   NLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYNSKKDSK  486

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN
Sbjct  487   KFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPN  546

Query  370   ES  365
             +S
Sbjct  547   QS  548



>gb|EYU41257.1| hypothetical protein MIMGU_mgv1a003880mg [Erythranthe guttata]
Length=558

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/546 (70%), Positives = 461/546 (84%), Gaps = 7/546 (1%)
 Frame = -3

Query  1990  FRIVVLLACCMF-PAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             F +++L+A  ++ P++VE R+RHYKF VV KN +++C+SKP +TVNGKFPGPT+YAREDD
Sbjct  5     FLVMMLVAALLWKPSLVESRIRHYKFTVVKKNTSKLCASKPIITVNGKFPGPTLYAREDD  64

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TV++RVVN+VK NV+ HWHGIRQLRTGWADGPAYITQCPI+ G SY+YNFT+TGQRGTLL
Sbjct  65    TVVVRVVNHVKDNVTFHWHGIRQLRTGWADGPAYITQCPIQTGQSYIYNFTLTGQRGTLL  124

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHI W R+TVHGA+VILPK GVPYPFPKPD E ++V  EWWKSD E VIN+A+K G  
Sbjct  125   WHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEIIVFGEWWKSDVEMVINQAMKLGQP  184

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAHTING  GP  NCS++ GY + VE+GK Y+LR++NAA+NEELFFKIAGH+MT+V
Sbjct  185   PNVSDAHTINGQTGPAPNCSSK-GYTMYVESGKTYLLRIVNAAVNEELFFKIAGHQMTIV  243

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDATY KPF+TDTI I PGQTTN ++ AD+  G Y +A SPFMD  VA D+QTATATL 
Sbjct  244   EVDATYTKPFRTDTIFIGPGQTTNALLKADRKIGNYQIAISPFMDTIVATDSQTATATLR  303

Query  1093  YTGTL---ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
             Y GTL   AS PTTLTT P  NAT V  +F+DSLRSLNS+++PANVP+T+DHSLL   G+
Sbjct  304   YNGTLSAAASSPTTLTTMPSKNATKVTTNFMDSLRSLNSRKYPANVPKTIDHSLLLAIGV  363

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG  743
             G+NPC +C   NGSRVVA +NNVTFVMPTTA+LQAH++ + GV+T DFP NPP  +NYTG
Sbjct  364   GVNPCGTCV--NGSRVVADINNVTFVMPTTAILQAHYYNVSGVYTDDFPGNPPVPYNYTG  421

Query  742   AGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
             + P N+QTT GTK++RL YNSTVQ+VLQ T IIAPE+HP HLHGFNF+ VGKG+GN++PK
Sbjct  422   SPPTNMQTTNGTKVYRLGYNSTVQIVLQGTAIIAPESHPTHLHGFNFYVVGKGIGNYDPK  481

Query  562   TDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  383
              DPK FNLVDP+ERNTI +P GGW AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+V+NG
Sbjct  482   NDPKSFNLVDPIERNTISVPTGGWTAIRFRADNPGVWFLHCHLEIHTTWGLKMAFVVENG  541

Query  382   KGPNES  365
             KGPN+S
Sbjct  542   KGPNQS  547



>emb|CAB69847.1| laccase-like protein [Arabidopsis thaliana]
Length=553

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/542 (74%), Positives = 462/542 (85%), Gaps = 6/542 (1%)
 Frame = -3

Query  1987  RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             RI+VL A   FPA V   +R Y F+VV K +TR+CS+K  VTVNGKFPGPTIYA EDDT+
Sbjct  6     RILVLFALLAFPACVHGAIRKYTFNVVTKQVTRICSTKQIVTVNGKFPGPTIYANEDDTI  65

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSY+YNFT+TGQRGTL WH
Sbjct  66    LVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWH  125

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AH+LWLR+TVHGA+VILPKLG+PYPFPKP  E V++L EWWKSDTE V+NEALKSGLAPN
Sbjct  126   AHVLWLRATVHGAIVILPKLGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPN  185

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAH INGHPG V NC +Q     +VE+GK YMLR+INAALNEELFFKIAGH+ TVVEV
Sbjct  186   VSDAHVINGHPGFVPNCPSQ-----AVESGKTYMLRLINAALNEELFFKIAGHRFTVVEV  240

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLHY  1091
             DA YVKPF TDTI+IAPGQTT  +V+A + SGQY++AA+PF D A VAVDN+TATAT+HY
Sbjct  241   DAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHY  300

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             +GTL++ PT  T+ PP NAT VAN+FV+SLRSLNSK +PANVP TVDH LLFT GLGIN 
Sbjct  301   SGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSKTYPANVPITVDHDLLFTVGLGINR  360

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C SCKAGN SRVVA++NN+TF MP TALLQAH+F + G++TTDFPA P   F++TG  P+
Sbjct  361   CHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPRRVFDFTGKPPS  420

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N K D  
Sbjct  421   NLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYNSKKDSN  480

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN
Sbjct  481   KFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPN  540

Query  370   ES  365
             +S
Sbjct  541   QS  542



>ref|XP_010423919.1| PREDICTED: laccase-10-like [Camelina sativa]
Length=558

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/542 (75%), Positives = 463/542 (85%), Gaps = 1/542 (0%)
 Frame = -3

Query  1987  RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             RI+VL A   FPA V   +R Y F+VV K +TR+CS+K  VTVNGKFPGPTIYA EDDTV
Sbjct  6     RILVLFALLAFPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTV  65

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSY+YNFT+TGQRGTL WH
Sbjct  66    LVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWH  125

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AH+LWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWWKSDTE V+NEALKSGLAPN
Sbjct  126   AHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVVNEALKSGLAPN  185

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAH INGHPG V NC +QG ++L+VE+GK YMLR+INAALNEELFFKIAGH+ TVVEV
Sbjct  186   VSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEV  245

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLHY  1091
             DA YVKPF TDTI+IAPGQTT  +V+A + SGQY++AA+PF D A VAVDN+TATAT+HY
Sbjct  246   DAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHY  305

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             +GTL++ PT  T+ PP NAT VANSFV+SLRSLNS  +PANVP  VDH LLFT GLGIN 
Sbjct  306   SGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGLGINR  365

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C SCKAGN SRVVA++NN+TF MPTTALL+AH+F + GV+TTDFP  P   F++ G  P+
Sbjct  366   CHSCKAGNFSRVVAAINNITFKMPTTALLEAHYFNLTGVYTTDFPGKPRRFFDFNGKPPS  425

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+N K D K
Sbjct  426   NLSTMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYNSKKDSK  485

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN
Sbjct  486   KFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPN  545

Query  370   ES  365
             +S
Sbjct  546   QS  547



>ref|XP_010067496.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW65638.1| hypothetical protein EUGRSUZ_G03028 [Eucalyptus grandis]
Length=561

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/543 (68%), Positives = 452/543 (83%), Gaps = 4/543 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             WF  ++++A  M PA  E  +RHYKF VVMKN+T++C+SKP  TVNGKFPGPT+YAREDD
Sbjct  12    WFPAMLVVAV-MLPAAAEGLIRHYKFSVVMKNVTKLCASKPIATVNGKFPGPTLYAREDD  70

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TVL+RVVN+V YNV+IHWHG+RQLRTGW+DGPA+ITQCPI+PG SY+YNFT+TGQRGTLL
Sbjct  71    TVLVRVVNHVSYNVTIHWHGVRQLRTGWSDGPAFITQCPIQPGQSYIYNFTLTGQRGTLL  130

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHI WLRST+HGA+VILPK GVPYPFPKP  E  ++  EWWK+DTE V++++++SG+ 
Sbjct  131   WHAHITWLRSTLHGAIVILPKRGVPYPFPKPYKEKTIIFGEWWKADTELVLSQSVQSGMP  190

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PN SD+HTING+PGP+ NCS+Q GY L VE+GK Y+LR++NAA+N+ELFFKIAGH +TVV
Sbjct  191   PNKSDSHTINGYPGPLPNCSSQ-GYELQVESGKTYLLRIVNAAVNDELFFKIAGHNLTVV  249

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA+Y KPF  DTI IAPGQTTN ++ AD+  G Y++A SPFMD  VAVDN TAT  + 
Sbjct  250   EVDASYTKPFSIDTIFIAPGQTTNALLAADKSGGSYIMAISPFMDTVVAVDNLTATGIVQ  309

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y GT+AS PT   + P +NAT    SF++SLRSLNSKQ+PA VP TVDHSL  T   G+N
Sbjct  310   YKGTIASAPTVQASIPAINATSFEFSFINSLRSLNSKQYPAKVPLTVDHSLFITMSAGVN  369

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PC +C   NG ++VA+LNNV+FVMP+T +L+AH++ IKGV+T DFP NPP  FNYTG  P
Sbjct  370   PCSTCV--NGKKLVAALNNVSFVMPSTDILEAHYYKIKGVYTDDFPGNPPTPFNYTGTPP  427

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
             +N+QTT GT++++LAYNSTVQ+VLQ T IIAPENHP HLHGFNFF +GKGLGNF+P  DP
Sbjct  428   SNMQTTNGTRVYKLAYNSTVQVVLQGTSIIAPENHPTHLHGFNFFGIGKGLGNFDPNKDP  487

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             K FNLVDPVERNTIG+P  GW AIRFRADNPGVWF+HCHLEVHTTWGLKM F+V++G GP
Sbjct  488   KNFNLVDPVERNTIGVPTAGWTAIRFRADNPGVWFLHCHLEVHTTWGLKMVFIVEDGDGP  547

Query  373   NES  365
             NES
Sbjct  548   NES  550



>ref|XP_010490598.1| PREDICTED: laccase-10-like isoform X1 [Camelina sativa]
 ref|XP_010490599.1| PREDICTED: laccase-10-like isoform X2 [Camelina sativa]
Length=558

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/542 (75%), Positives = 463/542 (85%), Gaps = 1/542 (0%)
 Frame = -3

Query  1987  RIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             RI+V+ A   FPA V   +R Y F+VV K +TR+CS+K  VTVNGKFPGPTIYA EDDTV
Sbjct  6     RILVIFALLAFPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTV  65

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGHSY+YNFT+TGQRGTL WH
Sbjct  66    LVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWH  125

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AH+LWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWWKSDTE VINEALKSGLAPN
Sbjct  126   AHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVINEALKSGLAPN  185

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             VSDAH INGHPG V NC +QG ++L+VE+GK YMLR+INAALNEELFFKIAGH+ TVVEV
Sbjct  186   VSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEV  245

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTATATLHY  1091
             DA YVKPF TDTI+IAPGQTT  +V+A + SGQY++AA+PF D A VAVDN+TATAT+HY
Sbjct  246   DAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHY  305

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
             +GTL++ PT  T+ PP NAT VANSFV+SLRSLNS  +PANVP  VDH LLFT GLGIN 
Sbjct  306   SGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGLGINR  365

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA  731
             C SCKAGN SRVVA++NN+TF MPTTALLQAH+F + GV+TTDFP  P   F++TG  P+
Sbjct  366   CHSCKAGNFSRVVAAINNITFKMPTTALLQAHYFNLTGVYTTDFPGKPRRFFDFTGKPPS  425

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G GN+  K D K
Sbjct  426   NLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYISKKDSK  485

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             KFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NGKGPN
Sbjct  486   KFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPN  545

Query  370   ES  365
             +S
Sbjct  546   QS  547



>ref|XP_003558760.1| PREDICTED: laccase-22 [Brachypodium distachyon]
Length=561

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/547 (67%), Positives = 464/547 (85%), Gaps = 5/547 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARE  1820
             S   +VV++ C +  A+ V    RHYKF+VVM+ M+R+CS+K  +TVNGKFPGPT+YARE
Sbjct  6     SQLLLVVMVNCVLLQALSVHAITRHYKFNVVMRKMSRLCSTKTILTVNGKFPGPTLYARE  65

Query  1819  DDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGT  1640
              D VL++VVN+V +NV+IHWHG+RQ+RTGW DGPAYITQCPI+PG S++YNFTITGQRGT
Sbjct  66    GDNVLVKVVNHVPHNVTIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTITGQRGT  125

Query  1639  LLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSG  1460
             LLWHAHI WLR+TVHGA+VILPKLGVPYPFP P  EAVVVL EWWK+D E +IN A++ G
Sbjct  126   LLWHAHINWLRATVHGAIVILPKLGVPYPFPAPHKEAVVVLGEWWKADIETIINRAMQLG  185

Query  1459  LAPNVSDAHTINGHPGPVANC-STQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             + PN+SD+HTINGHPGP+++C S+Q G++L+VE+GK YMLR+INAALN++LFFKIAGHK+
Sbjct  186   VGPNISDSHTINGHPGPMSDCASSQDGFKLNVESGKTYMLRIINAALNDDLFFKIAGHKL  245

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATA  1103
             TVVEVDA Y KP+KTD ++I PGQTTNV++ ADQ +G+Y+++ SPFMDAPV VDN T TA
Sbjct  246   TVVEVDAVYTKPYKTDILLITPGQTTNVLLAADQSAGRYLLSISPFMDAPVQVDNTTGTA  305

Query  1102  TLHYTGTL-ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
              LHYT T+ A+   TL   PP NAT +A+ F DSLRSLNSK++PANVP+TVDHSL FT G
Sbjct  306   ILHYTNTVSAAARLTLFKPPPQNATLIASKFADSLRSLNSKEYPANVPRTVDHSLFFTIG  365

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             +G+NPCP+C   NG+RVV ++NN+TFVMP+T +LQA+++ I GVFT DFPA PP  FNYT
Sbjct  366   VGVNPCPNCI--NGTRVVGTINNLTFVMPSTPILQAYYYNIPGVFTEDFPATPPHKFNYT  423

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G+GP NL+T  GT+++RL YN++VQ++LQDTGII+ E+HPIHLHGFNFF VG+G+GN++P
Sbjct  424   GSGPKNLRTMNGTRVYRLPYNASVQVILQDTGIISTESHPIHLHGFNFFVVGRGIGNYSP  483

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             KT P  FNL+DP+ERNTIG+P GGW AIRFRADNPGVWFMHCH EVHT+WGLKM F+V+N
Sbjct  484   KTSPSTFNLIDPIERNTIGVPTGGWTAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVEN  543

Query  385   GKGPNES  365
             GK P+E+
Sbjct  544   GKRPSET  550



>gb|KHG28836.1| Laccase-22 [Gossypium arboreum]
Length=574

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/547 (69%), Positives = 449/547 (82%), Gaps = 4/547 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M C W R ++ ++  + PA VECR+RHY F+VV+KN T++CS+KP VTVNGKFPG T+YA
Sbjct  21    MVC-WVRTLLFISV-LVPAFVECRIRHYHFNVVVKNETKLCSTKPIVTVNGKFPGQTLYA  78

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             RE D VL+R+ N+V+YNV+IHWHG+RQLRTGW+DGPAYITQCPI+PG +++YNFT+TGQR
Sbjct  79    REGDNVLVRLTNHVQYNVTIHWHGVRQLRTGWSDGPAYITQCPIQPGQNFLYNFTLTGQR  138

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLRSTVHGA+VILPK GVPYPFPKP  E V+VL EWWK+DTEAV+N+A++
Sbjct  139   GTLLWHAHISWLRSTVHGAIVILPKKGVPYPFPKPYKEKVIVLGEWWKADTEAVVNQAMQ  198

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             +GL PN+SDAHTINGHPGPV NCS+   Y L VE GK Y+LRVINAALN+ELFFKIA H 
Sbjct  199   TGLPPNISDAHTINGHPGPVPNCSSDDAYTLHVETGKTYLLRVINAALNDELFFKIANHN  258

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA Y KP +TDT+ + PGQTT  ++ ADQG G+Y++A SPFMD  VAVDN T  
Sbjct  259   LTVVEVDACYTKPLETDTLFLGPGQTTTALLKADQGIGKYLIAISPFMDTVVAVDNLTGM  318

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
               L Y  TLA  PTT    P +NATP+ + F DSLRSLNSKQ+ ANVP T+DHSL FT G
Sbjct  319   GYLRYNHTLAFTPTTFVPIPSVNATPLTSVFSDSLRSLNSKQYLANVPLTIDHSLFFTIG  378

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             +GINPC +C   NGSR VA++NNV+FVMPTTA+LQAH++GI GVFT DFPA P   FNYT
Sbjct  379   VGINPCATC--FNGSRAVAAINNVSFVMPTTAILQAHYYGINGVFTDDFPAKPAIPFNYT  436

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  P+ +QT  GTK++RLAYNSTVQLV+Q   I+APE+HP HLHG NFF VG+G+GNF+P
Sbjct  437   GTPPSGIQTMNGTKVYRLAYNSTVQLVIQGNTIVAPESHPTHLHGSNFFVVGRGVGNFDP  496

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
               DP KFNLVDPVERNT+ +P  GW AIRFRADNPG+WF HCHLEVHTTWGLKMAFLV+N
Sbjct  497   DKDPLKFNLVDPVERNTVSVPTAGWTAIRFRADNPGIWFFHCHLEVHTTWGLKMAFLVEN  556

Query  385   GKGPNES  365
             GKGPNES
Sbjct  557   GKGPNES  563



>ref|XP_009789473.1| PREDICTED: laccase-4-like isoform X1 [Nicotiana sylvestris]
Length=557

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/548 (69%), Positives = 463/548 (84%), Gaps = 6/548 (1%)
 Frame = -3

Query  1999  CSWFRIVVLLACCMFPAIVECR--VRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
               W RI+V+LA   +P +VECR  +RHYKF+VVMKN+TR+CS+K TVTVNGKFPGPTIYA
Sbjct  2     AEWLRIMVVLALS-WPVLVECRGNIRHYKFNVVMKNITRLCSTKATVTVNGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDT+LI+VVN V YN++IHWHG++Q+RTGWADGPAYITQCPI+PG SY+YNFT+T QR
Sbjct  61    REDDTLLIKVVNQVHYNLTIHWHGVKQIRTGWADGPAYITQCPIQPGKSYVYNFTVTDQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAHILWLR+TVHGA+VILPKL +PYPFP P  E +++L EWWKSD EAV++EA +
Sbjct  121   GTLFWHAHILWLRATVHGAIVILPKLALPYPFPNPQKEILIILGEWWKSDVEAVVDEATQ  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
              GL PN+SDAHTING PGPV+ C +Q G+   VE GK+Y+LR++NAALNEELFFKIAGHK
Sbjct  181   LGLPPNISDAHTINGLPGPVSTCLSQEGFTFLVEPGKKYLLRIVNAALNEELFFKIAGHK  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA+YVKPFK DTI+  PGQTTNVI++AD G+G+Y++  SP+MD+P+ V+N+TAT
Sbjct  241   LTVVEVDASYVKPFKADTILTTPGQTTNVILSADLGTGKYLMVTSPYMDSPILVNNRTAT  300

Query  1105  ATLHYTG-TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             ATL Y G   +S  TTLT  PP NATP+A  F+DSLRSLNS+++PA VP T+DHSL FT 
Sbjct  301   ATLQYVGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAKVPLTIDHSLFFTI  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
              LG+NPC SC    G R+VA++NNVTFVMP+ +LL AHFF   GVFT DFP NP + F+Y
Sbjct  361   SLGLNPCESCY--RGFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFTDDFPGNPAYTFDY  418

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P NL+T  GT+L+RLAYNS VQ+++QDTG+++PENHP+HLHGFNFF VG+G GNF+
Sbjct  419   TGIPPENLRTMEGTRLYRLAYNSNVQVIMQDTGLLSPENHPMHLHGFNFFVVGRGRGNFD  478

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             P+ DPKKFNLVDPVERNTI  P+GGWVAIRFRA+NPG+WF+HCHLEVHTTWGLKMAF+VD
Sbjct  479   PEEDPKKFNLVDPVERNTINAPSGGWVAIRFRANNPGIWFLHCHLEVHTTWGLKMAFVVD  538

Query  388   NGKGPNES  365
             NG GP ES
Sbjct  539   NGNGPEES  546



>gb|EPS61127.1| laccase 3, partial [Genlisea aurea]
Length=551

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/543 (69%), Positives = 444/543 (82%), Gaps = 3/543 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             W   ++L+A C +P  VE  VRHYKF VV KN  ++C SKP +TVNGKFPGPT+YAREDD
Sbjct  1     WILAMLLIAACWYPLHVESIVRHYKFSVVKKNTRKLCESKPIITVNGKFPGPTLYAREDD  60

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
             TVL++VVN V  NV+IHWHG+RQLRTGW+DGPAYITQCPI+ G SY YNFT+TGQRGTLL
Sbjct  61    TVLVKVVNRVTENVTIHWHGVRQLRTGWSDGPAYITQCPIQAGKSYTYNFTLTGQRGTLL  120

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             +H+HI W R+T+HGA+VILP+L   YPFPKPD E +++LAEWWKSD EAVIN A+  GL 
Sbjct  121   YHSHINWQRATLHGAIVILPRLRDSYPFPKPDDEKIIILAEWWKSDVEAVINSAMSQGLP  180

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PNVSDAHTING PGP+ NC T  GY L VE+GK Y+LR+INAALNEELFFKIA HK TVV
Sbjct  181   PNVSDAHTINGLPGPLPNC-TSPGYTLHVESGKTYLLRIINAALNEELFFKIADHKFTVV  239

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             EVDA Y KPF TDT+ I PGQTTNV++ ADQ  G+Y++A SPFMD  VA DNQ ATA L 
Sbjct  240   EVDARYTKPFTTDTLFIGPGQTTNVLLRADQKIGKYLIAISPFMDTIVATDNQRATAFLR  299

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y  T+A  PT LT  PP NAT V  +FVDSLRS+NS  FPANVP+ +DHSLL   G+G+N
Sbjct  300   YNNTVAFSPTNLTPLPPRNATSVTTTFVDSLRSINSNTFPANVPKKIDHSLLLAIGVGVN  359

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP  734
             PCPSC   NG+R+VA +NNV+FVMPTTALLQAH++ + G+FTTDFP NPP  +NYTG  P
Sbjct  360   PCPSC--FNGTRLVADINNVSFVMPTTALLQAHYYNMSGIFTTDFPGNPPIPYNYTGTPP  417

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
              N+QT  GTKL+RLAYNSTV++V Q T IIAPE+HP HLHGF+F+ VGKG+GN++PK DP
Sbjct  418   RNMQTVNGTKLYRLAYNSTVEIVFQGTSIIAPESHPTHLHGFDFYVVGKGVGNYDPKNDP  477

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
             KKFNLVDPVERNT+ +P GGW AIRFRADNPG+WF+HCHLEVHTTWGLKMAFLV+NG+GP
Sbjct  478   KKFNLVDPVERNTVSVPTGGWTAIRFRADNPGIWFLHCHLEVHTTWGLKMAFLVENGEGP  537

Query  373   NES  365
             N +
Sbjct  538   NAT  540



>ref|XP_011080855.1| PREDICTED: laccase-4 [Sesamum indicum]
Length=554

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/545 (70%), Positives = 448/545 (82%), Gaps = 3/545 (1%)
 Frame = -3

Query  1999  CSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARE  1820
              +W R V+LL  C+ P +VE  +R YKF+VVM+N +R+CSSKP VTVNG+FPGP IYARE
Sbjct  2     AAWVR-VLLLFTCLLPGMVESDLRRYKFNVVMRNKSRLCSSKPVVTVNGRFPGPNIYARE  60

Query  1819  DDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGT  1640
             DDT+LI+VVN+V YN+SIHWHGI+QL TGWADGPAYITQCPI+PG SY+YNFT+ GQRGT
Sbjct  61    DDTLLIKVVNHVNYNISIHWHGIKQLGTGWADGPAYITQCPIQPGQSYVYNFTVNGQRGT  120

Query  1639  LLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSG  1460
              LWHAHILWLR+TVHGA+V+LPK GVPYPFPKP  EAV +L EWWKSD E VINEA+  G
Sbjct  121   FLWHAHILWLRATVHGAIVVLPKPGVPYPFPKPHQEAVFILGEWWKSDVEDVINEAMDLG  180

Query  1459  LAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMT  1280
             +APNVSDAHTINGHPGP+++C  QGG+ L V  GK Y+LRVINAALNEELFFKIAGHK+ 
Sbjct  181   VAPNVSDAHTINGHPGPISSCVGQGGFDLGVMPGKTYLLRVINAALNEELFFKIAGHKLR  240

Query  1279  VVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATAT  1100
             VVE+DA YVKPF TDT++IAPGQTTN ++TAD   G+Y V ASPFMD+P+ +DN+TATAT
Sbjct  241   VVEIDAAYVKPFDTDTLLIAPGQTTNALLTADLPIGRYQVVASPFMDSPIDIDNRTATAT  300

Query  1099  LHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
             LHYTGTL S P  LT  P  NAT  A  F  SLRSLNS ++P  VP+ VDH LLF  GLG
Sbjct  301   LHYTGTLPSTPAVLTDPPSRNATATATKFAHSLRSLNSAEYPCRVPREVDHHLLFAIGLG  360

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
             +N C +C   NG RVVA +NNVTF MP+ +LL AHFF I GVFT DFP +PP  ++YT  
Sbjct  361   LNRCSTC--ANGYRVVADINNVTFAMPSVSLLNAHFFNIPGVFTDDFPGDPPTPYDYTAR  418

Query  739   GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKT  560
                N+ TTTGT+L+R+ YN++VQ+VLQ TG+I PENHPIHLHGFNFFAVGKGLGNF+ + 
Sbjct  419   RVVNMGTTTGTRLYRVRYNASVQVVLQGTGMIFPENHPIHLHGFNFFAVGKGLGNFDSEK  478

Query  559   DPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  380
             D + FNL DPVERNTI +P+GGWVAIRF ADNPGVWF+HCHLEVHT+WGLKMAF+V+NGK
Sbjct  479   DTRSFNLDDPVERNTIVVPSGGWVAIRFIADNPGVWFLHCHLEVHTSWGLKMAFIVENGK  538

Query  379   GPNES  365
             GPN+S
Sbjct  539   GPNQS  543



>gb|KFK44563.1| hypothetical protein AALP_AA1G273400 [Arabis alpina]
Length=556

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/548 (73%), Positives = 465/548 (85%), Gaps = 4/548 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME S  RI+V+ A   FPA V   +R Y F+VV K +TR+CS+K  VTVNGKFPGPTIYA
Sbjct  1     MEFS-IRILVIFALLAFPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYA  59

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
              EDDT+L+ VVN VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PGH+Y+YNFT+TGQR
Sbjct  60    NEDDTILVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHNYVYNFTVTGQR  119

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAH+LWLR+TVHGA+VILPKL  PYPFPKP  E V++L EWW SDTEAV+NEAL+
Sbjct  120   GTLWWHAHVLWLRATVHGAIVILPKL--PYPFPKPHREEVIILGEWWISDTEAVVNEALR  177

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGLAPNVSDAH INGHPG V NC +QG ++L+VE+GK YMLR+INAALNEELFFKIAGH+
Sbjct  178   SGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHR  237

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMD-APVAVDNQTA  1109
              TVVEVDA YVKPF TDTI+IAPGQTT  +V+A + SGQY++AA+PF D A VAVDN+TA
Sbjct  238   FTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTA  297

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TAT+HY+GTL++ PT  T+ PP NAT VAN+FV+SLRSLNS  +PA VP T+DH LLFT 
Sbjct  298   TATVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSNTYPAKVPITIDHDLLFTV  357

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLGIN C SCK GN SRVVA++NN+TF MPTT LLQAH+F + GV+TTDFP  P   +++
Sbjct  358   GLGINRCHSCKKGNFSRVVAAINNITFKMPTTGLLQAHYFNLTGVYTTDFPGKPRRFYDF  417

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P+NL T   TKL++L YNSTVQ+VLQDTG +APENHPIHLHGFNFF VG G+GN+N
Sbjct  418   TGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGFGIGNYN  477

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
              K D KKFNLVDPVERNT+G+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+
Sbjct  478   SKKDSKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVE  537

Query  388   NGKGPNES  365
             NGKGPN+S
Sbjct  538   NGKGPNQS  545



>ref|XP_006663136.1| PREDICTED: laccase-22-like [Oryza brachyantha]
Length=566

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/545 (67%), Positives = 457/545 (84%), Gaps = 7/545 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             ++++  C +  A+      RHYKF+VVM+NMTR+CS+KP +TVNGKFPGPT+YARE D V
Sbjct  13    LLLMAGCFLLQALSAHAITRHYKFNVVMRNMTRLCSTKPVLTVNGKFPGPTLYAREGDNV  72

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             L++VVN+V  NV+IHWHG+RQ+RTGW DGPAYITQCPI+PG S++YNFTITGQRGTLLWH
Sbjct  73    LVKVVNHVANNVTIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTITGQRGTLLWH  132

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AHI WLR+T+HGA+VILPKLGVPYPFP P  E V+VL EWWK DTE VIN+A++ G+ PN
Sbjct  133   AHINWLRATIHGAIVILPKLGVPYPFPAPHKEDVIVLGEWWKEDTENVINQAMQLGVGPN  192

Query  1447  VSDAHTINGHPGPVANC-STQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             +SD+HTINGHPGP++ C S+Q G++L VE GK YMLR+INAALN++LFFK+AGH++TVVE
Sbjct  193   ISDSHTINGHPGPLSECASSQDGFKLKVENGKTYMLRIINAALNDDLFFKVAGHELTVVE  252

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             VDA Y KPF TDT++I PGQTT+V++ A+Q +G+Y+++ SPFMD+P+ VDN+T TATLHY
Sbjct  253   VDAVYTKPFTTDTLLITPGQTTSVLLRANQSAGRYLLSVSPFMDSPLQVDNKTGTATLHY  312

Query  1090  TGTLAS---GPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
               T++S    P  L   PP NAT + + F D L SLNSK++PANVPQT+DHSLL T G+G
Sbjct  313   ANTVSSSMAAPLILIKLPPQNATSIVSKFADRLHSLNSKEYPANVPQTIDHSLLLTVGVG  372

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
             +NPCPSC   NG+RVV ++NNVTF+MP+T +LQA+++ I GVFT DFPA P   FNYTG+
Sbjct  373   VNPCPSCI--NGTRVVGTINNVTFIMPSTPILQAYYYNIPGVFTQDFPATPLHKFNYTGS  430

Query  739   GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKT  560
             GP NLQT  GT+++RL YN++VQ+VLQDTGII+PE+HPIHLHGFNFF VG+G+GN+NPKT
Sbjct  431   GPKNLQTMNGTRVYRLPYNASVQVVLQDTGIISPESHPIHLHGFNFFVVGRGVGNYNPKT  490

Query  559   DPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  380
              P  FNL+DP+ERNT+G+P GGW AIRFRADNPGVWFMHCH EVHT+WGLKM F+VDNGK
Sbjct  491   SPSTFNLIDPIERNTVGVPTGGWTAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDNGK  550

Query  379   GPNES  365
              P+E+
Sbjct  551   RPSET  555



>ref|XP_009120399.1| PREDICTED: laccase-16 [Brassica rapa]
Length=565

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/550 (71%), Positives = 449/550 (82%), Gaps = 10/550 (2%)
 Frame = -3

Query  1990  FRIVVLLACCMF---PAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARE  1820
             F + +L    +F   P  V   +RHYKF+VVM N T++CSSKP VTVNG+FPGPTI ARE
Sbjct  7     FCVCILTLFVIFLLSPTTVHSIIRHYKFNVVMTNTTKLCSSKPIVTVNGQFPGPTIVARE  66

Query  1819  DDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGT  1640
             DDTVLI+VVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+P  +Y+YNFT+TGQRGT
Sbjct  67    DDTVLIKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPRQNYLYNFTLTGQRGT  126

Query  1639  LLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSG  1460
             L WHAHILWLR+TVHGA+VILPKLGVPYPFPKP  E  +VLAEWWKSD E +INEA K+G
Sbjct  127   LWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLAEWWKSDVEQLINEATKNG  186

Query  1459  LAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMT  1280
              APN SDAHTINGH GP++NC +Q GY L V  GK YMLR+INAALNEELFFKIAGHK+T
Sbjct  187   TAPNASDAHTINGHSGPISNCPSQSGYGLPVRPGKTYMLRIINAALNEELFFKIAGHKLT  246

Query  1279  VVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSG-QYMVAASPFMDAPVAVDNQTATA  1103
             VVEVDA Y KP+KTDT++IAPGQTTNV++TA+  +G +YMVAA+ FMDAP++ DN TATA
Sbjct  247   VVEVDAVYTKPYKTDTVLIAPGQTTNVLLTANANTGSKYMVAATTFMDAPISFDNVTATA  306

Query  1102  TLHYTG--TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TLHY G    +S  T L + P  NAT VA+ F+ SLRSLNS+++PA VP TVDHSL FT 
Sbjct  307   TLHYIGHTVSSSKKTVLASLPQPNATLVASKFIKSLRSLNSREYPAKVPTTVDHSLFFTV  366

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG NPCPSC   NG R+VA +NNVTF MP TALLQAH+F I  VFT DFPA P   FNY
Sbjct  367   GLGANPCPSCN--NGFRLVAGINNVTFTMPETALLQAHYFNISHVFTDDFPAKPSNPFNY  424

Query  748   TGA--GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGN  575
             T       N  T TGTKL+RL YN+TVQ++LQ+T +I  ENHP HLHGFNFF VG+GLGN
Sbjct  425   TAPVDQSVNAATMTGTKLYRLPYNATVQIILQNTAMILSENHPFHLHGFNFFEVGRGLGN  484

Query  574   FNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFL  395
             FNP+ DPK+FNLVDPVERNT+G+PAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+
Sbjct  485   FNPEKDPKRFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLEIHTTWGLKMAFV  544

Query  394   VDNGKGPNES  365
             VDNG GP++S
Sbjct  545   VDNGHGPDQS  554



>ref|XP_002316233.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
 gb|EEF02404.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
Length=555

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/539 (69%), Positives = 446/539 (83%), Gaps = 4/539 (1%)
 Frame = -3

Query  1978  VLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             +LL   +FPA+VEC+VR Y F VV+ N T++CS+K   T+NGKFPGPTIYARE D V IR
Sbjct  9     MLLVIFIFPALVECKVRLYNFRVVLTNTTKLCSTKSIPTINGKFPGPTIYAREGDNVNIR  68

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             + N V+YNV++HWHG+RQLRTGWADGPAYITQCPI+PG SY+YNFT+TGQRGTLLWHAHI
Sbjct  69    LTNQVQYNVTVHWHGVRQLRTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHI  128

Query  1618  LWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSD  1439
              WLR+T+HGA+VI PK GVPYPFPKPD E +++L+EWWK+D EAV+N+A  +GL PN+SD
Sbjct  129   SWLRATIHGAIVIFPKKGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISD  188

Query  1438  AHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDAT  1259
             AHT+NGH G V  C T  G+ L VE+GK Y+LR+INAALN+ELFFKIAGH +TVVEVDAT
Sbjct  189   AHTVNGHTGAVPGC-TSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDAT  247

Query  1258  YVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTL  1079
             + KPF TDTI I PGQTTN ++TAD+  G+Y++A SPFMD  VAVDN TA A L Y GTL
Sbjct  248   FTKPFSTDTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYKGTL  307

Query  1078  ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSC  899
             A  P  LTT P +NATP  ++F+D LRSLNSK++PANVP TVDH L FT G+GI+PC +C
Sbjct  308   AFSPPVLTTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATC  367

Query  898   KAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA-NLQ  722
                NGS+ VA +NNV+F+MPTTALLQAH++ I GVFT DFPA PP +FNYTG   A NL+
Sbjct  368   T--NGSKAVADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPISFNYTGNNTAMNLK  425

Query  721   TTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFN  542
             TT GT+ +RLA+NS VQ+VLQ T IIAPE+HP HLHGFNFF VGKG+GNF+P  DPKKFN
Sbjct  426   TTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGFNFFVVGKGIGNFDPDNDPKKFN  485

Query  541   LVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             L DPVERNT+ +P  GW+AIRF+ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES
Sbjct  486   LADPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  544



>ref|XP_006602642.1| PREDICTED: laccase-4-like isoform X2 [Glycine max]
Length=533

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/521 (76%), Positives = 451/521 (87%), Gaps = 5/521 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R++ L+AC + PA+VEC+VRHYKF+VV+KN TR+CSSKP VTVNGKFPGPT+YARED
Sbjct  3     SWVRMLFLIAC-IVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++V N V +NV+IHWHG+RQLRTGWADGPAYITQCPI  G SY+YNFT+TGQRGTL
Sbjct  62    DTVLVKVNNLVNHNVTIHWHGVRQLRTGWADGPAYITQCPILSGQSYLYNFTLTGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAH+ WLRST+HGA+VILPK GVPYPFPKPD E VV+L EWWKSDTE VINEALKSGL
Sbjct  122   LWHAHVNWLRSTLHGAIVILPKRGVPYPFPKPDKELVVILGEWWKSDTEDVINEALKSGL  181

Query  1456  APNVSDAHTINGHPG--PVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             APNVSDAHTING PG   VANCSTQ  Y+L VE+GK Y+LR+INAALNEELFFKIAGH  
Sbjct  182   APNVSDAHTINGLPGIVSVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIAGHPF  241

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVDNQTAT  1106
             TVVEVDA+YVKPFKTDT+ IAPGQTTN ++TADQ SG+Y + AS FMD+P VAVDN TAT
Sbjct  242   TVVEVDASYVKPFKTDTLSIAPGQTTNALLTADQNSGKYTIVASTFMDSPVVAVDNLTAT  301

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATLHYTGTLA+ PT LTT PP NAT VAN+F +SL+SLNSK++PA VPQ VDHSLL T G
Sbjct  302   ATLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLLTVG  361

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LGINPCPSC AGNGSRVVA++NNVTFVMPTTALLQAH+F IKGVFTTDFP NP   +NYT
Sbjct  362   LGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVFTTDFPGNPSHVYNYT  421

Query  745   GAGPANL-QTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
                PA   QTT GTK +RLA+NSTVQ+VLQDTG+IAPE+HP+HLHGFNFF VG G+GN++
Sbjct  422   ATPPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPESHPVHLHGFNFFVVGSGVGNYD  481

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFM  446
             PKTD   FNL DPVERNTIG+P GGWVA RFRADNPG + M
Sbjct  482   PKTDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGAYNM  522



>ref|XP_002311202.1| laccase family protein [Populus trichocarpa]
 gb|EEE88569.1| laccase family protein [Populus trichocarpa]
Length=556

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/548 (68%), Positives = 448/548 (82%), Gaps = 4/548 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME    R ++LL   +FPA+VEC VR Y F VV+ N T++CS+K  VT+NGKFPGPTIYA
Sbjct  1     MENYRARAILLLVIFIFPALVECEVRLYDFRVVLTNTTKLCSTKSIVTINGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             RE D V I++ N+V+YNV+IHWHG+RQLRTGW+DGPAYITQCPIRPG SY+YNFT+TGQR
Sbjct  61    REGDNVNIKLTNHVQYNVTIHWHGVRQLRTGWSDGPAYITQCPIRPGQSYLYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLR+T+HGA+VILP+ GVPYPFPKPD E +++L EWWK+D EAV+N+A +
Sbjct  121   GTLLWHAHISWLRATIHGAIVILPQKGVPYPFPKPDKEKIIILGEWWKADVEAVVNQATQ  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             +GL PN+SDAH +NG  G V  C +  G+ L VE+GK Y+LR+INAALN+ELFFKIAGH 
Sbjct  181   TGLPPNISDAHIVNGQTGAVPGCPSP-GFTLHVESGKTYLLRIINAALNDELFFKIAGHN  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA Y KPF TDTI I PGQTTN ++TAD+  G+Y++A SPFMD  VAVDN TA 
Sbjct  240   ITVVEVDAAYTKPFSTDTIFIGPGQTTNALLTADKSVGKYLMAVSPFMDTVVAVDNVTAI  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             A L Y GT+A  P  LTT P +NATPV ++F+D+LRSLNSK+FPANVP TVDHSL FT G
Sbjct  300   AFLRYKGTIAFSPPVLTTTPAINATPVTSTFMDNLRSLNSKKFPANVPLTVDHSLYFTIG  359

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             +GI+PC +C   NGS+ V ++NN++F+MPTTALLQAH++ I GVFT DFPA PP +FNYT
Sbjct  360   VGIDPCATCV--NGSKAVGAINNISFIMPTTALLQAHYYSISGVFTDDFPAMPPNSFNYT  417

Query  745   GAGPA-NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             G   A NLQT  GT+ +RLA+NSTVQLVLQ T IIAPE+HP HLHGFNFF VGKG GNF+
Sbjct  418   GNNTALNLQTINGTRTYRLAFNSTVQLVLQGTTIIAPESHPFHLHGFNFFVVGKGFGNFD  477

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
                DPKKFNL DPVERNTI +P  GW AIRFRADNPGVWF+HCHLEVHTTWGLKM F+VD
Sbjct  478   ADNDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVD  537

Query  388   NGKGPNES  365
             NG+GP+ES
Sbjct  538   NGEGPDES  545



>ref|XP_011036009.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=555

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/539 (70%), Positives = 443/539 (82%), Gaps = 4/539 (1%)
 Frame = -3

Query  1978  VLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             +LL   +FPA+VEC+VR Y F VV+ N T++CS+K   T+NGKFPGPTIYARE D V IR
Sbjct  9     MLLVIFIFPALVECKVRLYNFRVVLTNTTKLCSTKSIPTINGKFPGPTIYAREGDNVNIR  68

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             + N V++NV++HWHG+RQLRTGWADGPAYITQCPI PG SY+YNFT+TGQRGTLLWHAHI
Sbjct  69    LTNQVQHNVTVHWHGVRQLRTGWADGPAYITQCPILPGQSYLYNFTLTGQRGTLLWHAHI  128

Query  1618  LWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSD  1439
              WLR+T+HGA+VI PK GVPYPFPKPD E ++ L+EWWK+D EAVIN+A  +GL PN+SD
Sbjct  129   SWLRATIHGAIVIFPKKGVPYPFPKPDKEKIITLSEWWKADVEAVINQATMTGLPPNISD  188

Query  1438  AHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDAT  1259
             AHT+NG  G V  C T  G+ L VE+GK Y+LR+INAALN+ELFFKIAGH +TVVEVDAT
Sbjct  189   AHTVNGQTGAVPGC-TSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDAT  247

Query  1258  YVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTL  1079
             Y KPF TDTI I PGQTTN ++TAD+  G+Y++A SPFMD  VAVDN TA A L Y GTL
Sbjct  248   YTKPFSTDTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYKGTL  307

Query  1078  ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSC  899
             A  P  LTT P +NATP  ++F+D LRSLNSK++PANVP TVDH L FT G+GI+PC +C
Sbjct  308   AFSPPVLTTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATC  367

Query  898   KAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA-NLQ  722
                NGS+ VA +NNV+F+MPTTALLQAH++ I GVFT DFPA PP  FNYTG   A NL+
Sbjct  368   I--NGSKAVADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPITFNYTGNNTAMNLK  425

Query  721   TTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFN  542
             TT GT+ +RLA+NS VQ+VLQ T IIAPE+HP HLHGFNFF VGKGLGNF+P  DPKKFN
Sbjct  426   TTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGFNFFVVGKGLGNFDPDNDPKKFN  485

Query  541   LVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             LVDPVERNT+ +P  GW+AIRF+ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES
Sbjct  486   LVDPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  544



>dbj|BAJ98144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/529 (69%), Positives = 450/529 (85%), Gaps = 4/529 (1%)
 Frame = -3

Query  1945  VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSI  1766
             V    RHYKF+VVM+NMT +CS+K  +TVNGKFPGPT+YARE D VL++VVN+  +NV+I
Sbjct  27    VHAIARHYKFNVVMRNMTLLCSTKSILTVNGKFPGPTLYAREGDNVLVKVVNHAPHNVTI  86

Query  1765  HWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGAL  1586
             HWHG+RQ+RTGW DGPAYITQCPI+PG S++YNFT+TGQRGTLLWHAHI WLR+TVHGA+
Sbjct  87    HWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTVTGQRGTLLWHAHINWLRATVHGAI  146

Query  1585  VILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPV  1406
             VILPKLGVPYPFP P  EAVVVL EWWK+DTE VIN+A++ G+ PN+SD+HTINGHPGP+
Sbjct  147   VILPKLGVPYPFPAPHKEAVVVLGEWWKADTETVINQAMQLGVGPNISDSHTINGHPGPM  206

Query  1405  ANC-STQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTI  1229
             + C S+Q G++L VE  K YMLR+INA LN++LFFKIAGH +TVVEVDA Y KP+KTD +
Sbjct  207   SACASSQDGFKLDVENSKTYMLRIINAGLNDDLFFKIAGHGLTVVEVDAVYTKPYKTDIL  266

Query  1228  VIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLA-SGPTTLTT  1052
             +I PGQTTNV+VTADQ +G+Y+++ SPFMDAP+ VDN+T TATLHY  T++ +   TL  
Sbjct  267   LITPGQTTNVLVTADQSAGRYLLSVSPFMDAPLQVDNKTGTATLHYANTVSTTARLTLVN  326

Query  1051  APPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVV  872
              PP NATP+A++F +SLRSLNSK++PANVPQTVDHSL FT G+G+NPC +C   NG+RVV
Sbjct  327   PPPQNATPIASTFSESLRSLNSKEYPANVPQTVDHSLFFTIGVGVNPCANCI--NGTRVV  384

Query  871   ASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRL  692
              ++NN TFVMP+T +LQA ++ I GVFT DFPA PP  FNYTG+GP NLQT  GT+++RL
Sbjct  385   GTINNSTFVMPSTPILQARYYSIPGVFTEDFPATPPHKFNYTGSGPNNLQTMNGTRVYRL  444

Query  691   AYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTI  512
              YN++VQ++LQDTGII+ E+HPIHLHGFNFF VG+G+GN+NPK+ P  FNL+DPVERNTI
Sbjct  445   PYNASVQVLLQDTGIISTESHPIHLHGFNFFVVGRGIGNYNPKSSPFTFNLIDPVERNTI  504

Query  511   GIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             G+P GGW AIRFRADNPGVWFMHCH EVHT+WGLKM F+VDNGK P+E+
Sbjct  505   GVPTGGWTAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDNGKRPSET  553



>ref|XP_009589148.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/548 (69%), Positives = 458/548 (84%), Gaps = 6/548 (1%)
 Frame = -3

Query  1999  CSWFRIVVLLACCMFPAIVECR--VRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
               W RI+V+LA  ++P +VECR  +RHYKF+VVMKN+TR+CS+K TVTVNGKFPGPTIY 
Sbjct  2     AEWLRIMVVLAL-LWPVLVECRGNIRHYKFNVVMKNITRLCSTKATVTVNGKFPGPTIYT  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDT+LI+VVN V YN++IHWHG++Q+RTGWADGPAYITQCPI+PG SY+YNFT+T QR
Sbjct  61    REDDTLLIKVVNQVHYNLTIHWHGVKQIRTGWADGPAYITQCPIQPGKSYVYNFTVTDQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTL WHAHILWLR+TVHGA+VILPKL  PYPFPKP  E +++L EWWKSD EAVI+EA K
Sbjct  121   GTLFWHAHILWLRATVHGAIVILPKLVFPYPFPKPQKEILIILGEWWKSDVEAVIDEATK  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
              GL PN+SDAHTING PGP++ C +Q G+   VE GK+Y+LR++NAALNEELFFKIAGHK
Sbjct  181   LGLPPNISDAHTINGLPGPLSTCLSQEGFTFLVEPGKKYLLRIVNAALNEELFFKIAGHK  240

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA+YVKPFKT+TI+  PGQTTNVI++AD  SG+Y++  S +MD+P+ V+N+TAT
Sbjct  241   LTVVEVDASYVKPFKTETILTTPGQTTNVILSADLESGKYLMVTSAYMDSPILVNNRTAT  300

Query  1105  ATLHYTG-TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             ATL Y G   +S  TTLT  PP NATP+A  F+DSLRSLNS+++PA VP  +DHSL FT 
Sbjct  301   ATLQYRGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAKVPLKIDHSLFFTI  360

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
              LG+NPC SC      R+VA++NNVTFVMP+ +LL AHFF   GVFT DFP NP + F+Y
Sbjct  361   SLGLNPCESCY--REFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFTDDFPGNPAYTFDY  418

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P NL+T  GT+L+RLAYNS VQL++QDTG+++PENHP+HLHGFNFF VG+G GNF+
Sbjct  419   TGIPPENLRTMEGTRLYRLAYNSNVQLIMQDTGLLSPENHPMHLHGFNFFVVGRGRGNFD  478

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PK DP KFNLVDPVERNTI  P+GGWVAIRF A+NPG+WF+HCHLEVHTTWGLKMAF+VD
Sbjct  479   PKEDPNKFNLVDPVERNTINAPSGGWVAIRFTANNPGIWFLHCHLEVHTTWGLKMAFVVD  538

Query  388   NGKGPNES  365
             NG GP ES
Sbjct  539   NGNGPEES  546



>ref|XP_011039810.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=556

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/548 (68%), Positives = 449/548 (82%), Gaps = 4/548 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME    R ++LL   +FPA+V+C+VR Y F VV+ N T++CS+K  VT+NGKFPGPTIYA
Sbjct  1     MENYRARAILLLVISIFPALVQCKVRRYDFRVVLTNTTKLCSTKSIVTINGKFPGPTIYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             RE D V I++ N+V+YNV+IHWHG+RQLRTGW+DGPAYITQCPIRPG SY+YNFT+TGQR
Sbjct  61    REGDNVNIKLTNHVQYNVTIHWHGVRQLRTGWSDGPAYITQCPIRPGQSYLYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLR+T+HGA+VILP+ GVPYPFPKPD E +++L EWWK+D EAV+N+A +
Sbjct  121   GTLLWHAHISWLRATIHGAIVILPQKGVPYPFPKPDKEKIIILGEWWKADVEAVVNQATQ  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             +GL PN+SDAH +NG  G V  C +  G+ L VE+GK Y+LR+INAALN+ELFFKIAGH 
Sbjct  181   TGLPPNISDAHIVNGQTGAVPGCPSP-GFTLHVESGKTYLLRIINAALNDELFFKIAGHN  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA Y KP  TDTI I PGQTTN ++TAD+  G+Y++A SPFMD  VAVDN TA 
Sbjct  240   ITVVEVDAAYTKPLSTDTIFIGPGQTTNALLTADKRVGKYLMAVSPFMDTVVAVDNVTAI  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             A L Y GT+A  P  LTT P +NATPV ++F+D+LRSLNSK++PANVP TVDHSL FT G
Sbjct  300   AFLRYKGTIAFSPPVLTTTPAINATPVTSTFMDNLRSLNSKKYPANVPLTVDHSLYFTIG  359

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             +GI+PC +C   NGS+ V ++NN++F+MPTTALLQAH++ I GVFT DFPA PP +FNYT
Sbjct  360   VGIDPCATCV--NGSKAVGAINNISFIMPTTALLQAHYYSISGVFTDDFPAMPPNSFNYT  417

Query  745   GAGPA-NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             G   A NLQT  GT+++RLA+NSTVQLVLQ T IIAPE+HP HLHGFNFF VGKG GNF+
Sbjct  418   GNNTALNLQTNNGTRIYRLAFNSTVQLVLQGTTIIAPESHPFHLHGFNFFVVGKGFGNFD  477

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
                DPKKFNL DPVERNTI +P  GW AIRFRADNPGVWF+HCHLEVHTTWGLKM F+VD
Sbjct  478   ADNDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVD  537

Query  388   NGKGPNES  365
             NG+GP+ES
Sbjct  538   NGEGPDES  545



>ref|XP_004150626.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004169234.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=517

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/515 (74%), Positives = 438/515 (85%), Gaps = 10/515 (2%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             M+ +TR+CSSKP VT+NGKFPGPTIYAREDDTVLI+VVN+V YNVSIHW       TGWA
Sbjct  1     MRKVTRLCSSKPIVTINGKFPGPTIYAREDDTVLIKVVNHVPYNVSIHW-------TGWA  53

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCP++ G SY+YNFTITGQRGTL WHAHILWLR+T++GA+VILPKLGVPYPFP
Sbjct  54    DGPAYITQCPLQTGQSYVYNFTITGQRGTLWWHAHILWLRATLYGAVVILPKLGVPYPFP  113

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
              P  E V++L EWWKSD EAV++EA KSGLAPNVSDAHTINGHPGPV  C T+G   + V
Sbjct  114   TPHKELVLILGEWWKSDVEAVVHEAAKSGLAPNVSDAHTINGHPGPVNGCLTRGKGIMPV  173

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
             + GK Y+LR+INAALNEELFFK+AGHK+TVVEVDA Y KPF TDTI IAPGQTTN ++TA
Sbjct  174   QPGKTYLLRIINAALNEELFFKVAGHKLTVVEVDAAYTKPFITDTIFIAPGQTTNALLTA  233

Query  1186  DQGSGQYMVAASPFMDAP-VAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFV  1010
             D  SG+Y ++ASPF D P VAVDN TATATLHYTGT+++ PT+ T  PP NAT +A  F 
Sbjct  234   DLKSGKYAISASPFRDTPIVAVDNVTATATLHYTGTISTSPTSFTGLPPQNATLIATKFT  293

Query  1009  DSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTA  830
             +SLRSLNSKQ+PA V   VDHSL FT GLG+N C +C +  G++VVA +NNVTFVMPT +
Sbjct  294   NSLRSLNSKQYPARVSLEVDHSLFFTVGLGVNRCKTCSS--GTQVVADINNVTFVMPTIS  351

Query  829   LLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTG  650
             LLQAH+F I GVFT DFPANPP  ++YTG  P+NLQTT GT+L+RLAYNSTVQLVLQDT 
Sbjct  352   LLQAHYFNIDGVFTDDFPANPPIRYDYTGKQPSNLQTTKGTRLYRLAYNSTVQLVLQDTA  411

Query  649   IIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRA  470
             +IAPENHP+HLHGFNFF VG GLGNFN K DP+KFNLVDPVERNT+G+P+GGWVAIRFRA
Sbjct  412   MIAPENHPVHLHGFNFFVVGSGLGNFNHKKDPEKFNLVDPVERNTVGVPSGGWVAIRFRA  471

Query  469   DNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             DNPGVWFMHCHLEVHTTWGLKMAF+V+NG+GP ES
Sbjct  472   DNPGVWFMHCHLEVHTTWGLKMAFVVNNGRGPEES  506



>gb|EMT26873.1| Laccase-22 [Aegilops tauschii]
Length=563

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/540 (68%), Positives = 452/540 (84%), Gaps = 5/540 (1%)
 Frame = -3

Query  1975  LLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             + +C +  A+ V    RHYKF+VVM+NMT +CS+K  +TVNGKFPGPT+YARE D VL++
Sbjct  15    MASCFLLQALSVHAITRHYKFNVVMRNMTLLCSTKSILTVNGKFPGPTLYAREGDDVLVK  74

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             VVN+  +NV+IHWHG+RQ+RTGW DGPAYITQCPI+PG S++YNFT+TGQRGTLLWHAHI
Sbjct  75    VVNHSPHNVTIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTVTGQRGTLLWHAHI  134

Query  1618  LWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSD  1439
              WLR+TVHGA+VILPKLGVPYPFP P  EAVVVL EWWK+DTE VIN+A++ G+ PN+SD
Sbjct  135   NWLRATVHGAIVILPKLGVPYPFPAPHKEAVVVLGEWWKADTETVINQAMQLGVGPNISD  194

Query  1438  AHTINGHPGPVANC-STQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDA  1262
             +HTINGHPGP+++C S+Q G+ L VE GK YMLR+INA LN++LFFKIAGH +TVVEVDA
Sbjct  195   SHTINGHPGPMSDCASSQDGFNLDVENGKTYMLRIINAGLNDDLFFKIAGHGLTVVEVDA  254

Query  1261  TYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGT  1082
              Y KP+KTD ++I PGQTTNV+VT DQ +G+Y+++ SPF+DAP+ VDN+T TATL Y  T
Sbjct  255   VYTKPYKTDILLITPGQTTNVLVTTDQSAGRYLLSVSPFLDAPLQVDNKTGTATLQYANT  314

Query  1081  L-ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
             + A+   TL   PP NATP+A+ F +SLRSLNSK++PANVPQTVDHSL FT G+G+NPC 
Sbjct  315   VSATARLTLVKPPPQNATPIASKFSESLRSLNSKEYPANVPQTVDHSLFFTIGVGVNPCA  374

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANL  725
             +C   NG+RVV ++NN TFVMP+T +LQA ++ I GVFT DFPA PP  FNYTG+GP NL
Sbjct  375   NCI--NGTRVVGTINNSTFVMPSTPILQARYYSIPGVFTEDFPATPPHKFNYTGSGPKNL  432

Query  724   QTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKF  545
             QT  GT++ RL YN++VQ++LQDTGII+ E+HPIHLHGFNFF VG+G+GN+NPK  P  F
Sbjct  433   QTMKGTRVHRLPYNASVQVILQDTGIISTESHPIHLHGFNFFVVGRGVGNYNPKASPSTF  492

Query  544   NLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             NL+DPVERNTIG+P GGW AIRFRADNPGVWFMHCH EVHT+WGLKM F+VDNGK P+E+
Sbjct  493   NLIDPVERNTIGVPTGGWTAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDNGKRPSET  552



>emb|CDX80325.1| BnaC09g34170D [Brassica napus]
Length=570

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/555 (69%), Positives = 446/555 (80%), Gaps = 15/555 (3%)
 Frame = -3

Query  1990  FRIVVLLACCMF---PAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARE  1820
             F + +L    +F   P  V   +RHYKF+VVM N T++CSSKP VTVNG+FPGPTI ARE
Sbjct  7     FSVCILTLFVIFLLSPTTVHSIIRHYKFNVVMTNTTKLCSSKPIVTVNGQFPGPTIVARE  66

Query  1819  DDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGT  1640
             DDTVLI+VVN+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+P  +Y YNFT+TGQRGT
Sbjct  67    DDTVLIKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPRQNYFYNFTLTGQRGT  126

Query  1639  LLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSG  1460
             L WHAHILWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL EWWKSD E +INEA K G
Sbjct  127   LWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEQLINEATKHG  186

Query  1459  LAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMT  1280
              APN SDAHTINGH GP++NC +Q GY L V  GK YMLR+INAALNEELFFKIAGHK+T
Sbjct  187   TAPNASDAHTINGHSGPISNCPSQSGYGLPVRPGKTYMLRIINAALNEELFFKIAGHKLT  246

Query  1279  VVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSG-QYMVAASPFMDAPVAVDNQTATA  1103
             VVEVDA Y KP+KTDT++IAPGQTTNV++TA+  +G +YMVAA+ FMDAP++ DN TATA
Sbjct  247   VVEVDAVYTKPYKTDTVLIAPGQTTNVLLTANANTGSKYMVAATTFMDAPISFDNVTATA  306

Query  1102  T-----LHYTG--TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHS  944
             T     LHY G    +S  T L + P  NAT V++ F+ SLRSLNS+++PA VP TVDHS
Sbjct  307   TLHSNALHYIGHTVSSSKKTVLASLPQPNATLVSSKFIKSLRSLNSREYPAKVPTTVDHS  366

Query  943   LLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPP  764
             L FT GLG NPCPSC   NG R+VA +NNVTF MP TALLQAH+F I  VFT DFPA P 
Sbjct  367   LFFTVGLGANPCPSCN--NGIRLVAGINNVTFTMPETALLQAHYFNISHVFTDDFPAKPS  424

Query  763   FAFNYTGA--GPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVG  590
               +NYT       N  T TGTKL+RL YN+TVQ++LQ+T +I  ENHP HLHGFNFF VG
Sbjct  425   NPYNYTAPVDQSVNAATMTGTKLYRLPYNATVQIILQNTAMILSENHPFHLHGFNFFEVG  484

Query  589   KGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGL  410
             +GLGNFNP+ DPK+FNLVDPVERNT+G+PAGGW AIRF ADNPGVWFMHCHLE+HTTWGL
Sbjct  485   RGLGNFNPEKDPKRFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLEIHTTWGL  544

Query  409   KMAFLVDNGKGPNES  365
             KMAF+VDNG GP++S
Sbjct  545   KMAFVVDNGHGPDQS  559



>ref|XP_009416212.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=562

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/553 (70%), Positives = 464/553 (84%), Gaps = 7/553 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M   S ++ ++L+   + P + +   RHYKFDVV K+ TR+CS+K  VTVNG+FPGPT+Y
Sbjct  1     MESSSSWKALLLMVFFLLPLLAQGMTRHYKFDVVEKSFTRLCSTKSIVTVNGQFPGPTLY  60

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             AREDDTV+++VVN VK NV+IHWHG+RQLRTGWADGPAYITQCPI+PG SY+YNFT+ GQ
Sbjct  61    AREDDTVVVKVVNRVKVNVTIHWHGVRQLRTGWADGPAYITQCPIQPGQSYVYNFTLAGQ  120

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPF-PKPDHEAVVVLAEWWKSDTEAVINEA  1472
             RGTLLWHAHI W R+TVHGA+VILPK GV YPF P P  E V+VLAEWW+SD EAVI+EA
Sbjct  121   RGTLLWHAHISWQRATVHGAIVILPKRGVAYPFFPTPHKEVVLVLAEWWRSDVEAVIDEA  180

Query  1471  LKSGLAPNVSDAHTINGHPGPVANC--STQGGYRLSVEAGKRYMLRVINAALNEELFFKI  1298
             + SG APNVSDAHTINGH GPV+ C  S Q G  + V+ GK Y+ R+INAALNE+LFFK+
Sbjct  181   MNSGRAPNVSDAHTINGHAGPVSGCASSAQDGLTVRVDKGKTYLFRIINAALNEDLFFKV  240

Query  1297  AGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP-VAVD  1121
             AGH++TVVEVDATY KPF TDT++I PGQTTNV++TADQG+G+Y+VAASPF D+P VAVD
Sbjct  241   AGHQLTVVEVDATYTKPFTTDTLLITPGQTTNVLLTADQGAGRYLVAASPFADSPLVAVD  300

Query  1120  NQTATATLHYTGTLASGPTTLTTAPP-MNATPVANSFVDSLRSLNSKQFPANVPQTVDHS  944
             N+TATAT+ Y  ++++     TT PP  NATPVA+SFVD+LRSLNSKQ+PA VP  VD S
Sbjct  301   NRTATATVQYASSVSASAVVTTTKPPPQNATPVASSFVDTLRSLNSKQYPAKVPLMVDRS  360

Query  943   LLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPP  764
             LLFT GLG+NPC +C   NGSRVVA +NNVTFVMPTTALLQAH+F   GVFT DFP  PP
Sbjct  361   LLFTVGLGVNPCATCT--NGSRVVADINNVTFVMPTTALLQAHYFNTSGVFTDDFPGQPP  418

Query  763   FAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKG  584
              AFNYTG+GP+N+QT  GT+L+RL++N++VQLVLQDTG+I PE+HPIHLHG+NFF VG+G
Sbjct  419   IAFNYTGSGPSNMQTMNGTRLYRLSFNASVQLVLQDTGVIGPESHPIHLHGYNFFVVGRG  478

Query  583   LGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKM  404
             +GN++PKT P KFNLVDPVERNTIG+P GGW AIRFRADNPGVWF+HCH EVHT+WGLKM
Sbjct  479   VGNYDPKTSPSKFNLVDPVERNTIGVPTGGWTAIRFRADNPGVWFLHCHFEVHTSWGLKM  538

Query  403   AFLVDNGKGPNES  365
             AF+VD+GKG NES
Sbjct  539   AFVVDDGKGTNES  551



>gb|KHN24301.1| Laccase-4 [Glycine soja]
Length=522

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/547 (73%), Positives = 448/547 (82%), Gaps = 41/547 (7%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             SW R++ L+AC + PA+VEC+VRHYKF+VV+KN TR+CSSKP VTVNGKFPGPT+YARED
Sbjct  3     SWVRMLFLIAC-IVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLYARED  61

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             DTVL++V N V +NV+IHWHG+RQLRTGWADGPAYITQCPI  G SY+YNFT+TGQRGTL
Sbjct  62    DTVLVKVNNLVNHNVTIHWHGVRQLRTGWADGPAYITQCPILSGQSYLYNFTLTGQRGTL  121

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGL  1457
             LWHAH+ WLRST+HGA+VILPK GVPYPFPKPD E VV+L EWWKSDTE VINEALKSGL
Sbjct  122   LWHAHVNWLRSTLHGAIVILPKRGVPYPFPKPDKELVVILGEWWKSDTEDVINEALKSGL  181

Query  1456  APNVSDAHTINGHPG--PVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             APNVSDAHTING PG   VANCSTQ  Y+L VE+GK Y+LR+INAALNEELFFKIAGH  
Sbjct  182   APNVSDAHTINGLPGIVSVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIAGHPF  241

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATA  1103
             TVVEVDA+YVKPFKTDT+ IAP                                     A
Sbjct  242   TVVEVDASYVKPFKTDTLSIAP-------------------------------------A  264

Query  1102  TLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
             TLHYTGTLA+ PT LTT PP NAT VAN+F +SL+SLNSK++PA VPQ VDHSLL T GL
Sbjct  265   TLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLLTVGL  324

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG  743
             GINPCPSC AGNGSRVVA++NNVTFVMPTTALLQAH+F IKGVFTTDFP NP   +NYT 
Sbjct  325   GINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVFTTDFPGNPSHVYNYTA  384

Query  742   AGP-ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
               P A  QTT GTK +RLA+NSTVQ+VLQDTG+IAPE+HP+HLHGFNFF VG G+GN++P
Sbjct  385   TPPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPESHPVHLHGFNFFVVGSGVGNYDP  444

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             KTD   FNL DPVERNTIG+P GGWVA RFRADNPGVWF+HCH EVHTTWGLKMAFLVDN
Sbjct  445   KTDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGVWFLHCHFEVHTTWGLKMAFLVDN  504

Query  385   GKGPNES  365
             GKGPNES
Sbjct  505   GKGPNES  511



>ref|XP_003544123.1| PREDICTED: laccase-4-like [Glycine max]
Length=554

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/541 (67%), Positives = 452/541 (84%), Gaps = 4/541 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             + +      F   V+  VRHYKF VV+KN T++CS+K  VTVNG+ PGPT+YAREDDTV+
Sbjct  6     LTIFFVVLSFSPFVQSLVRHYKFSVVLKNTTKLCSTKSFVTVNGQCPGPTLYAREDDTVI  65

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             ++V N+VKYN++IHWHGI+QLRTGW+DGPAY+TQCPI+PG SY+YNFTI GQRGTLLWHA
Sbjct  66    VKVTNHVKYNITIHWHGIKQLRTGWSDGPAYVTQCPIQPGQSYVYNFTINGQRGTLLWHA  125

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             HI WLR+TV+G +VILPK G+ YPFPKPD E +++L EWWKSD EA++N+A  SGL PN+
Sbjct  126   HITWLRATVYGGIVILPKRGISYPFPKPDKEKIIILGEWWKSDVEAILNQAENSGLPPNI  185

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTINGH GP+  C++Q GY L VE+GK Y+LR+INAALN+ELFFKIAGHK+TVVE D
Sbjct  186   SDAHTINGHTGPIPGCTSQ-GYTLHVESGKTYLLRIINAALNDELFFKIAGHKLTVVEAD  244

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A+YVKPF+TDTI ++PGQTTNV++TA+Q  G+Y++A +PFMDAP+  DN T+ ATL Y G
Sbjct  245   ASYVKPFETDTIFMSPGQTTNVLLTANQVVGKYLIAVTPFMDAPIGFDNVTSIATLRYKG  304

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
             T     TTLTT P +NATP+ + F+DSLRSLNSK++PA  P TVDHSL F+  +G+NPC 
Sbjct  305   TPPYPKTTLTTIPALNATPLTSDFIDSLRSLNSKEYPAIAPLTVDHSLFFSITVGLNPCH  364

Query  904   SCKAGNGSRVVASLNNVTFVMP-TTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPAN  728
             +C    G+R+V+++NN+TF+MP TT+LL+AH++ IKGVFT DFP+ PP AFNYTG  PAN
Sbjct  365   TCLT--GARLVSAINNITFLMPTTTSLLEAHYYNIKGVFTDDFPSFPPIAFNYTGTQPAN  422

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             +QT  GT+L+RL +NSTVQ++LQ T +IAPENHP HLHG+NFF VG+GLGNF+P+ DP  
Sbjct  423   IQTNNGTRLYRLDFNSTVQIILQGTAMIAPENHPFHLHGYNFFVVGQGLGNFDPEKDPLS  482

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             FNLVDPVERNTIG+P GGW AIRFRA+NPGVWF+HCHLEVHTTWGLKMAF+VDNG GP+E
Sbjct  483   FNLVDPVERNTIGVPNGGWAAIRFRANNPGVWFLHCHLEVHTTWGLKMAFIVDNGNGPHE  542

Query  367   S  365
             S
Sbjct  543   S  543



>gb|KCW52562.1| hypothetical protein EUGRSUZ_J01941, partial [Eucalyptus grandis]
Length=524

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/516 (73%), Positives = 431/516 (84%), Gaps = 3/516 (1%)
 Frame = -3

Query  1912  VVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTG  1733
             VV K   R+CSSKP VTVNG+FPGPTIYAREDDTV ++VVN+V YNV+IHWHG+RQLRT 
Sbjct  1     VVEKRTDRLCSSKPIVTVNGRFPGPTIYAREDDTVFVKVVNHVSYNVTIHWHGVRQLRTC  60

Query  1732  WADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYP  1553
             WADGPAYITQCPI+PG  Y YNFTITGQRGTLLWHAHILWLR+TVHGALVILPK GVPYP
Sbjct  61    WADGPAYITQCPIQPGQIYTYNFTITGQRGTLLWHAHILWLRATVHGALVILPKRGVPYP  120

Query  1552  FPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRL  1373
             FPKP  E V+VLAEWWKSD EAVI EA+KSG APNVSDAHTIN HPGPVANC  +GGY L
Sbjct  121   FPKPHKEKVIVLAEWWKSDVEAVIGEAIKSGGAPNVSDAHTINSHPGPVANCP-KGGYEL  179

Query  1372  SVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIV  1193
             +V  GK YMLR+INAALNEELFFKIA H++TVVEVDA YVKP +TD I++ PGQTT  ++
Sbjct  180   AVRPGKTYMLRIINAALNEELFFKIARHQLTVVEVDAAYVKPLRTDAILVGPGQTTTALL  239

Query  1192  TADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSF  1013
              A   +G+Y++  SPFMDAPV+VDN TATAT+ Y GT A+ P      P  NAT VA  F
Sbjct  240   MAYHTTGKYLMIVSPFMDAPVSVDNVTATATVRYAGTPAASPAVPIAPPSPNATWVAEGF  299

Query  1012  VDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTT  833
             V SLRSLN+  +PA VP  +DHSL FT G+G+NPC +C   +G RVVA  NN++FVMP T
Sbjct  300   VGSLRSLNTGAYPARVPLEIDHSLFFTVGIGVNPCATC--ASGFRVVADFNNISFVMPKT  357

Query  832   ALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDT  653
             ALL AH++ + GVFT DFPA P   FNYTGA P NL T TGT+L+RL YNSTVQLVLQDT
Sbjct  358   ALLSAHYYKMTGVFTDDFPAKPMIRFNYTGAQPVNLNTMTGTRLYRLRYNSTVQLVLQDT  417

Query  652   GIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFR  473
             G++APENHPIHLHGFNFFAVG+G+GNF+P TDP+KFNLVDPVERNTIG+P+GGW AIRFR
Sbjct  418   GMVAPENHPIHLHGFNFFAVGRGIGNFDPITDPRKFNLVDPVERNTIGVPSGGWAAIRFR  477

Query  472   ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             ADNPGVWFMHCHLEVHTTWGLKMAF+VD+G+GP++S
Sbjct  478   ADNPGVWFMHCHLEVHTTWGLKMAFVVDDGEGPDQS  513



>ref|XP_004490949.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=554

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/541 (66%), Positives = 445/541 (82%), Gaps = 4/541 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             + +     +FP  V+  VRHY F+VV+KN T++CS+K  VTVNGKFPGPTIYAREDD V+
Sbjct  6     VAIFFVAFLFPTFVQSLVRHYNFNVVLKNSTKLCSTKSFVTVNGKFPGPTIYAREDDNVI  65

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             +RV N+VK+NV+IHWHGI+QLRT W+DGPAYITQCPI+ G S++YNFTITGQRGTLLWHA
Sbjct  66    VRVTNHVKHNVTIHWHGIKQLRTCWSDGPAYITQCPIQTGQSFVYNFTITGQRGTLLWHA  125

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             HI WLR+T+HGA+VILPK  +PYPFPKPD E +++L EWWKSD EAV+N+A  SGL PN+
Sbjct  126   HITWLRATMHGAIVILPKRDIPYPFPKPDKEKIIILGEWWKSDVEAVVNQATNSGLPPNI  185

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTINGHPG V  C +Q GY L VE GK Y+LR+INAALN+ELFFKIAGHK+TVVE D
Sbjct  186   SDAHTINGHPGSVPGCMSQ-GYTLHVERGKTYLLRIINAALNDELFFKIAGHKLTVVEAD  244

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A+Y+KPF+TDTI ++PGQTTNV++T +Q  G+Y++A +PFMDAP+  DN T+ ATLHY G
Sbjct  245   ASYIKPFETDTIFLSPGQTTNVLLTTNQSVGKYLIATTPFMDAPIGFDNVTSIATLHYKG  304

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
             T     T LT  PP+NAT +  +F DSL+SLNSKQ+P  VP  +D SLLF   +GI+PC 
Sbjct  305   TQPDTKTILTNIPPLNATTLTKTFTDSLKSLNSKQYPTKVPLKIDQSLLFAITVGIDPCD  364

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PAN  728
             +C +GN  ++V+++NNVTF+MPT +LLQAH++ IKGVFT DFPANPP  F+YTGA  P N
Sbjct  365   TCTSGN--KLVSAINNVTFLMPTISLLQAHYYNIKGVFTDDFPANPPLVFDYTGADQPDN  422

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             L T  GT+++RL +NS+V++VLQ T +IAPENHP HLHG+NFF VG+GLGNF+   DP +
Sbjct  423   LHTENGTRVYRLNFNSSVEIVLQGTAMIAPENHPFHLHGYNFFVVGQGLGNFDHDKDPLR  482

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             FNLVDPVERNT+ +P  GW+AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNG+GPNE
Sbjct  483   FNLVDPVERNTLSVPNAGWIAIRFRADNPGVWFLHCHLEVHTTWGLKMAFIVDNGRGPNE  542

Query  367   S  365
             S
Sbjct  543   S  543



>ref|XP_006350822.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=559

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/546 (68%), Positives = 448/546 (82%), Gaps = 6/546 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECR--VRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAR  1823
              W RI+V+LA  M+P +V+CR  +R YKF+V+M N+TR+CS+KPTVTVNGKFPGPTIYAR
Sbjct  7     EWLRILVVLAF-MWPVLVQCRGNIRQYKFNVMMTNVTRLCSTKPTVTVNGKFPGPTIYAR  65

Query  1822  EDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRG  1643
             EDDT+LI+VVN V YN+SIHWHG++QLRT WADGPAYI QCPI+PG SY+YNFT+T QRG
Sbjct  66    EDDTLLIKVVNQVHYNLSIHWHGVKQLRTCWADGPAYIAQCPIQPGKSYVYNFTVTEQRG  125

Query  1642  TLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKS  1463
             TL WHAHILWLR+TVHGA+VILPK  +PYPF KP  E V++L EWWKSD EAV++EA +S
Sbjct  126   TLFWHAHILWLRATVHGAVVILPKHTLPYPFSKPKKEVVIILGEWWKSDVEAVVDEATQS  185

Query  1462  GLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             GL PN+SDAHTING  GPV+ C +Q G+   VE GK+Y+LR+INAALNEELFFKIAGH +
Sbjct  186   GLPPNISDAHTINGLTGPVSTCLSQEGFNFLVEPGKKYLLRIINAALNEELFFKIAGHNL  245

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATA  1103
             TVVEVDA YVKPF+T+TI+ APGQTTNVI++    +G+Y +  SP+MD+P+ V+N+ ATA
Sbjct  246   TVVEVDAAYVKPFETETILTAPGQTTNVILSTTYKNGKYSMVTSPYMDSPILVNNKAATA  305

Query  1102  TLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
             TL Y GT  S  TT T  PP NAT +A +F+DSL+SLNSK++PA VP  ++HSL F   L
Sbjct  306   TLQYIGTNNSS-TTFTVPPPRNATFIAFNFMDSLKSLNSKKYPAKVPIKINHSLFFIISL  364

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG  743
             G+NPC +C    G R+VA++NNVTFVMP+ +LL  HF    GVFT DFP NP  AF+YTG
Sbjct  365   GLNPCATCY--RGFRIVAAINNVTFVMPSVSLLSTHFLNKSGVFTDDFPGNPQNAFDYTG  422

Query  742   AGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
               P NL+T  GTKL+RL YNS VQ++LQDTG+++PENHP+HLHGFNFF VG+G GNFNPK
Sbjct  423   VPPENLRTMEGTKLYRLEYNSNVQIILQDTGLLSPENHPMHLHGFNFFVVGRGKGNFNPK  482

Query  562   TDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  383
              D KKFNLVDPVERNTI  P+GGWVAIRFRA+NPGVWF HCHLEVHTTWGLKMAF+V+NG
Sbjct  483   EDSKKFNLVDPVERNTINAPSGGWVAIRFRANNPGVWFFHCHLEVHTTWGLKMAFVVNNG  542

Query  382   KGPNES  365
              GPNES
Sbjct  543   NGPNES  548



>gb|KHN20872.1| Laccase-4 [Glycine soja]
Length=562

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/549 (66%), Positives = 452/549 (82%), Gaps = 12/549 (2%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             + +      F   V+  VRHYKF VV+KN T++CS+K  VTVNG+ PGPT+YAREDDTV+
Sbjct  6     LTIFFVVLSFSPFVQSLVRHYKFSVVLKNTTKLCSTKSFVTVNGQCPGPTLYAREDDTVI  65

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             ++V N+VKYN++IHWHGI+QLRTGW+DGPAY+TQCPI+PG SY+YNFTI GQRGTLLWHA
Sbjct  66    VKVTNHVKYNITIHWHGIKQLRTGWSDGPAYVTQCPIQPGQSYVYNFTINGQRGTLLWHA  125

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLA--------EWWKSDTEAVINEAL  1469
             HI WLR+TV+G +VILPK G+ YPFPKPD E +++L         EWWKSD EA++N+A 
Sbjct  126   HITWLRATVYGGIVILPKRGISYPFPKPDKEKIIILGKIYVRIKCEWWKSDVEAILNQAE  185

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
              SGL PN+SDAHTINGH GP+  C++QG Y L VE+GK Y+LR+INAALN+ELFFKIAGH
Sbjct  186   NSGLPPNISDAHTINGHTGPIPGCTSQG-YTLHVESGKTYLLRIINAALNDELFFKIAGH  244

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             K+TVVE DA+YVKPF+TDTI ++PGQTTNV++TA+Q  G+Y++A +PFMDAP+  DN T+
Sbjct  245   KLTVVEADASYVKPFETDTIFMSPGQTTNVLLTANQVVGKYLIAVTPFMDAPIGFDNVTS  304

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
              ATL Y GT     TTLTT P +NATP+ + F+DSLRSLNSK++PA  P TVDHSL F+ 
Sbjct  305   IATLRYKGTPPYPKTTLTTIPALNATPLTSDFIDSLRSLNSKEYPAIAPLTVDHSLFFSI  364

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTT-ALLQAHFFGIKGVFTTDFPANPPFAFN  752
              +G+NPC +C  G  +R+V+++NN+TF+MPTT +LL+AH++ IKGVFT DFP+ PP AFN
Sbjct  365   TVGLNPCHTCLTG--ARLVSAINNITFLMPTTTSLLEAHYYNIKGVFTDDFPSFPPIAFN  422

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG  PAN+QT  GT+L+RL +NSTVQ++LQ T +IAPENHP HLHG+NFF VG+GLGNF
Sbjct  423   YTGTQPANIQTNNGTRLYRLDFNSTVQIILQGTAMIAPENHPFHLHGYNFFVVGQGLGNF  482

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             +P+ DP  FNLVDPVERNTIG+P GGW AIRFRA+NPGVWF+HCHLEVHTTWGLKMAF+V
Sbjct  483   DPEKDPLSFNLVDPVERNTIGVPNGGWAAIRFRANNPGVWFLHCHLEVHTTWGLKMAFIV  542

Query  391   DNGKGPNES  365
             DNG GP+ES
Sbjct  543   DNGNGPHES  551



>emb|CAA74103.1| laccase [Populus trichocarpa]
Length=555

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/539 (68%), Positives = 440/539 (82%), Gaps = 4/539 (1%)
 Frame = -3

Query  1978  VLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             +LL   +FPA+VEC+VR Y F VV+ N T++CSSK   T+NGKFPGPTIYARE D V IR
Sbjct  9     MLLVIFIFPALVECKVRLYNFRVVLTNTTKLCSSKSIPTINGKFPGPTIYAREGDNVNIR  68

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             + N V+YNV++HWHG+    TGWADGPAYITQCPI+PG SY+YNFT+TGQRGTLLWHAHI
Sbjct  69    LTNQVQYNVTVHWHGVSSCFTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHI  128

Query  1618  LWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSD  1439
              WLR+T+HGA+VI PK GVPYPFPKPD E +++L+EWWK+D EAV+N+A  +GL PN+SD
Sbjct  129   SWLRATIHGAIVIFPKKGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISD  188

Query  1438  AHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDAT  1259
             AHT+NGH G V  C T  G+ L VE+GK Y+LR+INAALN+ELFFKIAGH +TVVEVDAT
Sbjct  189   AHTVNGHTGAVPGC-TSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDAT  247

Query  1258  YVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTL  1079
             + KPF TDTI I PGQTTN ++TAD+  G+Y++A SPFMD  VAVDN TA A L Y   L
Sbjct  248   FTKPFSTDTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYNEPL  307

Query  1078  ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSC  899
              S   +LTT P +NATP  ++F+D LRSLNSK++PANVP TVDH L FT G+GI+PC +C
Sbjct  308   HSPHLSLTTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATC  367

Query  898   KAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA-NLQ  722
                NGS+ VA +NNV+F+MPTTALLQAH++ I GVFT DFPA PP +FNYTG   A NL+
Sbjct  368   T--NGSKAVADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPISFNYTGNNTAMNLK  425

Query  721   TTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFN  542
             TT GT+ +RLA+NS VQ+VLQ T IIAPE+HP HLHGFNFF VGKG+GNF+P  DPKKFN
Sbjct  426   TTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGFNFFVVGKGIGNFDPDNDPKKFN  485

Query  541   LVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             L DPVERNT+ +P  GW+AIRF+ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES
Sbjct  486   LADPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  544



>ref|XP_007141799.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
 gb|ESW13793.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
Length=553

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/538 (68%), Positives = 448/538 (83%), Gaps = 3/538 (1%)
 Frame = -3

Query  1978  VLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             + L    F   V   VRHYKF V+ KN TR+CS+K  VTVNG+ PGPT+YAREDDTVL+R
Sbjct  8     IFLVALSFSPFVHSLVRHYKFSVISKNSTRLCSTKSFVTVNGQCPGPTLYAREDDTVLVR  67

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             V N+VKYN++IHWHGI+QLR+GW+DGPAY+TQCPI+PG S++YNFT TGQRGTLLWHAHI
Sbjct  68    VTNHVKYNITIHWHGIKQLRSGWSDGPAYVTQCPIQPGQSFVYNFTTTGQRGTLLWHAHI  127

Query  1618  LWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSD  1439
              WLR+TV+GA+VILPK G+ YPFP PD E  ++L EWWKSD EAV+NEA  SGL PN+SD
Sbjct  128   TWLRATVYGAIVILPKRGISYPFPTPDKEKTIILGEWWKSDVEAVLNEAESSGLPPNISD  187

Query  1438  AHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDAT  1259
             AHTINGH GPV  C+++ GY L VE+GK Y+LR+INAALN+ELFFKIAGHK+TVVE DA+
Sbjct  188   AHTINGHTGPVPGCTSR-GYTLHVESGKTYLLRIINAALNDELFFKIAGHKLTVVEADAS  246

Query  1258  YVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTL  1079
             YVKPF+TDTI ++PGQTTNV+++ADQG G+Y++A +PFMDAP+  DN T+ ATL Y  T 
Sbjct  247   YVKPFETDTIFMSPGQTTNVLLSADQGVGKYLIAVTPFMDAPIGFDNVTSIATLRYKTTP  306

Query  1078  ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSC  899
                 TTLTT P +NATP+ + F+DSLRSLNSK++PA VP TVDHSL F   +G+NPC +C
Sbjct  307   PYPTTTLTTIPALNATPLTSHFIDSLRSLNSKEYPARVPLTVDHSLFFAITVGLNPCDAC  366

Query  898   KAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQT  719
                 GS++V++LNN+TFVMPTT+LL+AH++ +KGVFT DFPA+PP  FNYTG  PAN+QT
Sbjct  367   PT--GSKLVSALNNITFVMPTTSLLEAHYYNVKGVFTDDFPAHPPIVFNYTGTQPANIQT  424

Query  718   TTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNL  539
               GT+L+RL +NSTVQ++LQ T +IAPENHP HLHG+NFF VG+G GNF+P+ DP  FNL
Sbjct  425   NNGTRLYRLNFNSTVQIILQGTAMIAPENHPFHLHGYNFFVVGQGSGNFDPEKDPLGFNL  484

Query  538   VDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             VDPVERNTIG+P GGWVAIRFRA+NPGVWF+HCHLEVHTTWGLKMAF+VDNG  P+ES
Sbjct  485   VDPVERNTIGVPNGGWVAIRFRANNPGVWFLHCHLEVHTTWGLKMAFIVDNGNSPHES  542



>emb|CAC14719.1| laccase [Populus trichocarpa]
Length=555

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/539 (68%), Positives = 439/539 (81%), Gaps = 4/539 (1%)
 Frame = -3

Query  1978  VLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             +LL   +FPA+VEC+VR Y F VV+ N T++CSSK   T+NGKFPGPTIYARE D V IR
Sbjct  9     MLLVIFIFPALVECKVRLYNFRVVLTNTTKLCSSKSIPTINGKFPGPTIYAREGDNVNIR  68

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             + N V+YNV++HWHG+    TGWADGPAYITQCPI+PG SY+YNFT+TGQRGTLLWHAHI
Sbjct  69    LTNQVQYNVTVHWHGVSSCFTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHI  128

Query  1618  LWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSD  1439
              WLR+T+HGA+VI PK GVPYPFPKPD E +++L+EWWK+D EAV+N+A  +GL PN+SD
Sbjct  129   SWLRATIHGAIVIFPKKGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISD  188

Query  1438  AHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDAT  1259
             AHT+NGH G V  C T  G+ L VE+GK Y+LR+INAALN+ELFFKIAGH +TVVEVDAT
Sbjct  189   AHTVNGHTGAVPGC-TSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDAT  247

Query  1258  YVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTL  1079
             + KPF  DTI I PGQTTN ++TAD+  G+Y++A SPFMD  VAVDN TA A L Y   L
Sbjct  248   FTKPFSADTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYNEPL  307

Query  1078  ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSC  899
              S   +LTT P +NATP  ++F+D LRSLNSK++PANVP TVDH L FT G+GI+PC +C
Sbjct  308   HSPHLSLTTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATC  367

Query  898   KAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPA-NLQ  722
                NGS+ VA +NNV+F+MPTTALLQAH++ I GVFT DFPA PP +FNYTG   A NL+
Sbjct  368   T--NGSKAVADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPISFNYTGNNTAMNLK  425

Query  721   TTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFN  542
             TT GT+ +RLA+NS VQ+VLQ T IIAPE+HP HLHGFNFF VGKG+GNF+P  DPKKFN
Sbjct  426   TTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGFNFFVVGKGIGNFDPDNDPKKFN  485

Query  541   LVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             L DPVERNT+ +P  GW+AIRF+ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES
Sbjct  486   LADPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  544



>ref|XP_004241179.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=560

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/547 (67%), Positives = 449/547 (82%), Gaps = 7/547 (1%)
 Frame = -3

Query  1996  SWFRIVVLLACCMFPAIVECR--VRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAR  1823
              W +I+V+LA  ++P +V C+  +RHYKF+V+M N+TR+CS+KPTVTVNGKFPGP+IYAR
Sbjct  7     EWLKILVVLAF-LWPVLVLCKGNIRHYKFNVMMTNVTRLCSTKPTVTVNGKFPGPSIYAR  65

Query  1822  EDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRG  1643
             EDDT+LI+VVN V YN+SIHWHG++QLRT WADGPAYI QCPI+PG SY+YNFT+  QRG
Sbjct  66    EDDTLLIKVVNQVHYNLSIHWHGVKQLRTCWADGPAYIAQCPIQPGKSYVYNFTVREQRG  125

Query  1642  TLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKS  1463
             TL WHAHILWLR+TVHGA+VILPKL +PYPF KP  E V++L EWWKSD EAV++EA +S
Sbjct  126   TLFWHAHILWLRATVHGAIVILPKLALPYPFSKPKKEVVIILGEWWKSDVEAVVDEATQS  185

Query  1462  GLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             GL PN+SDAHTING  GPV+ C +Q G+   VE GK+Y+LR+INAALNEELFFKIAGH +
Sbjct  186   GLPPNISDAHTINGLTGPVSTCLSQEGFNFQVEPGKKYLLRIINAALNEELFFKIAGHNL  245

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATA  1103
             TV EVDA YVKPF+T+TI+ APGQTTNVI++ +  +G+Y++  SP+MD+P+ V+N+ ATA
Sbjct  246   TVEEVDAAYVKPFETETILTAPGQTTNVILSTNHKNGKYLMVTSPYMDSPILVNNKAATA  305

Query  1102  TLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
             TL YTGT  S  TT T  PP NAT +A +F+DSL+SLNSK++PA VP  ++HSL F   L
Sbjct  306   TLQYTGTNNSS-TTFTVPPPRNATSIAFNFMDSLQSLNSKRYPAKVPIKINHSLFFIISL  364

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG  743
             G+NPC +C    G R+VA++NNVTFVMP+ +LL  HF    GVFT DFP NP   F+YTG
Sbjct  365   GLNPCATCY--RGFRIVAAINNVTFVMPSVSLLGTHFLNKSGVFTDDFPGNPQNVFDYTG  422

Query  742   AGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
               P NL+T  GTKL+RL YNS VQ++LQDTG+++PENHP+HLHGFNFF VG+G GNFNPK
Sbjct  423   VPPENLRTIEGTKLYRLEYNSNVQIILQDTGLLSPENHPMHLHGFNFFVVGRGKGNFNPK  482

Query  562   TDPKKFNLVDPVERNTIGIPA-GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
              D KKFNLVDPVERNTI  P+ GGWVAIRFRA+NPGVWF HCHLEVHTTWGLKMAF+V+N
Sbjct  483   EDFKKFNLVDPVERNTINAPSGGGWVAIRFRANNPGVWFFHCHLEVHTTWGLKMAFVVNN  542

Query  385   GKGPNES  365
             G GPNES
Sbjct  543   GNGPNES  549



>ref|XP_004308920.1| PREDICTED: laccase-22-like [Fragaria vesca subsp. vesca]
Length=556

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/540 (67%), Positives = 442/540 (82%), Gaps = 4/540 (1%)
 Frame = -3

Query  1981  VVLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             V+LL   ++PA+ VE  VRHY F VV+K+ T++CSSK  +TVNGKFPGPT+YAREDDTV+
Sbjct  9     VILLVAFIYPALMVESLVRHYNFRVVLKSTTKLCSSKAILTVNGKFPGPTLYAREDDTVI  68

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             IRV N+   NV+IHWHG++QL T WADGPAYITQCPI+PG +++Y FTITGQRGTLLWHA
Sbjct  69    IRVTNHGNRNVTIHWHGVKQLGTCWADGPAYITQCPIQPGQNFIYKFTITGQRGTLLWHA  128

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             H  WLR+T+HGA+VILPKLG PYPFP P  E +++L+EWWKSD EAV++E+ +SGL PN+
Sbjct  129   HDSWLRATLHGAIVILPKLGTPYPFPTPQKERIIILSEWWKSDVEAVVDESTQSGLPPNI  188

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTINGHPGP   CS+Q G+ L VE+GK Y+LR+INAALN++LFFKIA H +TVVEVD
Sbjct  189   SDAHTINGHPGPAPGCSSQ-GFTLHVESGKTYLLRIINAALNDDLFFKIARHNLTVVEVD  247

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A+Y KPF+TDTI I+PGQTT  ++ A++  G Y+++ SPFMDAP+ +DN T+ ATL Y  
Sbjct  248   ASYTKPFQTDTIFISPGQTTTALLEANKDIGNYLISVSPFMDAPIGIDNFTSIATLRYKH  307

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
             T  +  T LT+ PP NATP+  +F+DSLRSL+SK +PANVP T+DHSL  T G+GINPC 
Sbjct  308   TPRNSTTFLTSIPPQNATPLTATFIDSLRSLDSKLYPANVPLTIDHSLFLTVGVGINPCD  367

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANL  725
             +C   NGS++VAS+NNV+FVMPT ALLQA+++ IKGV+T DFP  PP  F+YTG  P N+
Sbjct  368   TCV--NGSKLVASVNNVSFVMPTIALLQAYYYNIKGVYTLDFPPKPPNPFDYTGTPPVNV  425

Query  724   QTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKF  545
             Q   GTKL+RL YNSTVQ+VLQD  II PE+HP HLHGFNFF VG GLGNF+P  D K F
Sbjct  426   QAANGTKLYRLGYNSTVQIVLQDIAIILPESHPTHLHGFNFFVVGTGLGNFDPDKDTKTF  485

Query  544   NLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             NLVDPVERNT+ +P GGW AIRFRADNPG+WF+HCHLEVHTTWGLKMAFLVDNG+GPNES
Sbjct  486   NLVDPVERNTVSVPTGGWTAIRFRADNPGIWFLHCHLEVHTTWGLKMAFLVDNGEGPNES  545



>ref|XP_003616564.1| Laccase [Medicago truncatula]
Length=675

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/553 (64%), Positives = 448/553 (81%), Gaps = 6/553 (1%)
 Frame = -3

Query  2020  QLHTMMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPG  1841
             QL   ME  +  + + L    FP  V+  VRHY F VV+KN T++CS+K  V+VNGKFPG
Sbjct  117   QLLKRMEPRF--LAIFLVALSFPLFVQSLVRHYNFSVVLKNETKLCSTKSFVSVNGKFPG  174

Query  1840  PTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFT  1661
             PT+YAREDDT+++RV N V++NV+IHWHGI+QLRT W+DGPAY+TQCPI+ G S++YNFT
Sbjct  175   PTLYAREDDTLIVRVTNLVQHNVTIHWHGIKQLRTCWSDGPAYVTQCPIQTGQSFVYNFT  234

Query  1660  ITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVI  1481
             ITGQRGTLLWHAHI WLR+T+HGA+VILPK G PYPFPKPD E +++L EWWKSD EAV+
Sbjct  235   ITGQRGTLLWHAHITWLRATMHGAIVILPKRGTPYPFPKPDKEKIIILGEWWKSDVEAVV  294

Query  1480  NEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFK  1301
             N+A  SG+ PN+SDAHTINGHPGPV  C +Q GY L VE+GK Y+LR+INAALN+ELFFK
Sbjct  295   NQATSSGMPPNISDAHTINGHPGPVPGCISQ-GYTLHVESGKTYLLRIINAALNDELFFK  353

Query  1300  IAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVD  1121
             IAGHK+ VVE DA+Y+KPF+ DTI ++PGQTTNV++TA+Q  G+Y++A +PFMDAP+  D
Sbjct  354   IAGHKLIVVEADASYLKPFEIDTIFLSPGQTTNVLLTANQPIGKYLIAITPFMDAPIGFD  413

Query  1120  NQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSL  941
             N ++ ATL Y G      T LT  PP+NATP+  +F DSLRSLNSK +P  V  T+DHSL
Sbjct  414   NLSSIATLRYKGIPPYTKTILTNIPPLNATPITKTFTDSLRSLNSKTYPTRVSLTIDHSL  473

Query  940   LFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPF  761
             LF   +G+NPC +C   N  ++V+++NN+TF+MPT +LLQA+++ IKGVFT DFP+ PP 
Sbjct  474   LFAITVGLNPCDTCITDN--KLVSAINNITFLMPTVSLLQANYYNIKGVFTDDFPSKPPM  531

Query  760   AFNYTGAG-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKG  584
              F+YTG   PANL T  GTK++RL +NS+VQ+VLQ T +IAPENHP HLHGFNFF VG+G
Sbjct  532   VFDYTGTDQPANLHTDNGTKVYRLNFNSSVQIVLQGTAMIAPENHPFHLHGFNFFVVGQG  591

Query  583   LGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKM  404
             LGNF+P+ DP +FNLVDP+ERNT+ +P  GW+AIRFRADNPGVWF+HCHLEVHTTWGLKM
Sbjct  592   LGNFDPEKDPLRFNLVDPIERNTLSVPNNGWIAIRFRADNPGVWFLHCHLEVHTTWGLKM  651

Query  403   AFLVDNGKGPNES  365
             AF+VDNG+GP+ES
Sbjct  652   AFIVDNGRGPSES  664



>ref|XP_009789474.1| PREDICTED: laccase-4-like isoform X2 [Nicotiana sylvestris]
Length=524

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/515 (70%), Positives = 439/515 (85%), Gaps = 3/515 (1%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             MKN+TR+CS+K TVTVNGKFPGPTIYAREDDT+LI+VVN V YN++IHWHG++Q+RTGWA
Sbjct  1     MKNITRLCSTKATVTVNGKFPGPTIYAREDDTLLIKVVNQVHYNLTIHWHGVKQIRTGWA  60

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCPI+PG SY+YNFT+T QRGTL WHAHILWLR+TVHGA+VILPKL +PYPFP
Sbjct  61    DGPAYITQCPIQPGKSYVYNFTVTDQRGTLFWHAHILWLRATVHGAIVILPKLALPYPFP  120

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
              P  E +++L EWWKSD EAV++EA + GL PN+SDAHTING PGPV+ C +Q G+   V
Sbjct  121   NPQKEILIILGEWWKSDVEAVVDEATQLGLPPNISDAHTINGLPGPVSTCLSQEGFTFLV  180

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
             E GK+Y+LR++NAALNEELFFKIAGHK+TVVEVDA+YVKPFK DTI+  PGQTTNVI++A
Sbjct  181   EPGKKYLLRIVNAALNEELFFKIAGHKLTVVEVDASYVKPFKADTILTTPGQTTNVILSA  240

Query  1186  DQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG-TLASGPTTLTTAPPMNATPVANSFV  1010
             D G+G+Y++  SP+MD+P+ V+N+TATATL Y G   +S  TTLT  PP NATP+A  F+
Sbjct  241   DLGTGKYLMVTSPYMDSPILVNNRTATATLQYVGTNTSSTTTTLTVPPPTNATPIAIKFM  300

Query  1009  DSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTA  830
             DSLRSLNS+++PA VP T+DHSL FT  LG+NPC SC    G R+VA++NNVTFVMP+ +
Sbjct  301   DSLRSLNSRKYPAKVPLTIDHSLFFTISLGLNPCESCY--RGFRIVAAINNVTFVMPSVS  358

Query  829   LLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTG  650
             LL AHFF   GVFT DFP NP + F+YTG  P NL+T  GT+L+RLAYNS VQ+++QDTG
Sbjct  359   LLNAHFFNKSGVFTDDFPGNPAYTFDYTGIPPENLRTMEGTRLYRLAYNSNVQVIMQDTG  418

Query  649   IIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRA  470
             +++PENHP+HLHGFNFF VG+G GNF+P+ DPKKFNLVDPVERNTI  P+GGWVAIRFRA
Sbjct  419   LLSPENHPMHLHGFNFFVVGRGRGNFDPEEDPKKFNLVDPVERNTINAPSGGWVAIRFRA  478

Query  469   DNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             +NPG+WF+HCHLEVHTTWGLKMAF+VDNG GP ES
Sbjct  479   NNPGIWFLHCHLEVHTTWGLKMAFVVDNGNGPEES  513



>ref|XP_010454388.1| PREDICTED: laccase-16 [Camelina sativa]
Length=540

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/530 (71%), Positives = 430/530 (81%), Gaps = 9/530 (2%)
 Frame = -3

Query  1933  VRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHG  1754
             +RHYKF+VVM N T++CSSKP VTVNGKFPGPTI ARE DTVLI+VVN+VKYNVSIHWHG
Sbjct  2     IRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTVLIKVVNHVKYNVSIHWHG  61

Query  1753  IRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILP  1574
             IRQLRTGWADGPAYITQCPI+PG +Y++NFT+TGQRGTL WHAHILWLR+TVHGA+VILP
Sbjct  62    IRQLRTGWADGPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGAIVILP  121

Query  1573  KLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCS  1394
             KLGVPYPFPKP  E  +VL EWWKSD E +INEA K G AP+ SDAHTINGH G ++NC 
Sbjct  122   KLGVPYPFPKPYKEKTIVLGEWWKSDVEELINEASKIGTAPSASDAHTINGHSGSISNCP  181

Query  1393  TQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPG  1214
             +Q  Y L V AGK YMLR+INAALNEELFFKIAGH +TVVEVDA Y KP+KTDT+ IAPG
Sbjct  182   SQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAPG  241

Query  1213  QTTNVIVTADQGSGQ-YMVAASPFMDAPVAVDNQTATATLHYTGTLASGP----TTLTTA  1049
             QTTNV++TA+  +G  YM+AA+ F DA +  DN TATATLHY G  A+ P    T L + 
Sbjct  242   QTTNVLLTANANAGSNYMIAATTFTDAHIPYDNVTATATLHYIGPTATVPTFKKTILASL  301

Query  1048  PPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVA  869
             PP NAT VA  F  SLRSLNS+++PA VP TVD SL FT GLG NPCPSC   NG R+VA
Sbjct  302   PPQNATWVAAKFTKSLRSLNSREYPARVPTTVDRSLFFTVGLGANPCPSCS--NGIRLVA  359

Query  868   SLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP--ANLQTTTGTKLFR  695
              +NNVTF MP TALLQAHFF I GVFT DFPA P   ++YT       N  T  GT+L+R
Sbjct  360   GINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTRLYR  419

Query  694   LAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNT  515
             L YN+TVQ+VLQ+T +I  +NHP HLHGFNFF VG+GLGNFNP+ DPK FNLVDPVERNT
Sbjct  420   LPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGLGNFNPEKDPKMFNLVDPVERNT  479

Query  514   IGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             +G+PAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  480   VGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQS  529



>ref|XP_010483503.1| PREDICTED: laccase-16-like isoform X3 [Camelina sativa]
Length=567

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/533 (70%), Positives = 429/533 (80%), Gaps = 8/533 (2%)
 Frame = -3

Query  1945  VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSI  1766
             V+  +RHYKF+VVM N T++CSSKP VTVNGKFPGPTI ARE DT+LI+VVN+VKYNVSI
Sbjct  26    VQAMIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTILIKVVNHVKYNVSI  85

Query  1765  HWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGAL  1586
             HWHGIRQLRTGWADGPAYITQCPI+PG +Y++NFT+TGQRGTL WHAHILWLR+TVHGA+
Sbjct  86    HWHGIRQLRTGWADGPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGAI  145

Query  1585  VILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPV  1406
             VILPKLGVPYPFPKP  E  +VL EWWKSD E +IN A K G AP+ SDAHTINGH G +
Sbjct  146   VILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINVASKIGTAPSASDAHTINGHSGSI  205

Query  1405  ANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIV  1226
             +NC +Q  Y L V AGK YMLR+INAALNEELFFKIAGH +TVVEVDA Y KP+KTDT+ 
Sbjct  206   SNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVY  265

Query  1225  IAPGQTTNVIVTADQGSGQ-YMVAASPFMDAPVAVDNQTATATLHYTGTLASG-----PT  1064
             IAPGQTTNV++TA+  +G  YMVAA+ F DA +  DN TATATLHY G  A+       T
Sbjct  266   IAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGPTATSVPTFKKT  325

Query  1063  TLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNG  884
              L + PP NAT VA  F  SLRSLNS+++PA VP TVD SL FT GLG NPCPSC    G
Sbjct  326   ILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFFTVGLGANPCPSCS--KG  383

Query  883   SRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTK  704
              R+VA +NNVTF MP TALLQAHFF I GVFT DFPA P   ++YT     N  T  GTK
Sbjct  384   IRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPLNPYDYTAPLGVNAATMKGTK  443

Query  703   LFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVE  524
             L+RL YN+TVQ+VLQ+T +I  +NHP HLHGFNFF VG+GLGNFNP+ DPK FNLVDPVE
Sbjct  444   LYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGLGNFNPEKDPKIFNLVDPVE  503

Query  523   RNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             RNT+G+PAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  504   RNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQS  556



>ref|XP_002530417.1| laccase, putative [Ricinus communis]
 gb|EEF31987.1| laccase, putative [Ricinus communis]
Length=554

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/547 (67%), Positives = 443/547 (81%), Gaps = 4/547 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             ME  W R  +L    +FPA+VE  VRHY F V   N T++CSSK  VTVNGKFPGPT++A
Sbjct  1     MEYFWAR-TMLPIIFLFPALVESTVRHYNFTVATTNTTKLCSSKSIVTVNGKFPGPTLFA  59

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDD V +RV+N V+YNV+IHWHG+RQL TGWADGPAYITQCPI+PG SY+YNFT+TGQR
Sbjct  60    REDDNVNVRVINNVQYNVTIHWHGVRQLLTGWADGPAYITQCPIQPGQSYLYNFTLTGQR  119

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLR+TVHGA+VILPK GVPYPFPKP+ E ++VL EWWK+DTEAVI +A++
Sbjct  120   GTLLWHAHISWLRTTVHGAIVILPKKGVPYPFPKPNKEKLIVLGEWWKTDTEAVIKQAMQ  179

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             +GLAPN+SD+HTINGH GPV  C T  GY L VE GK Y++R++NAA+N+ELFFKIAGH 
Sbjct  180   TGLAPNISDSHTINGHTGPVPGC-TSPGYTLHVERGKTYLIRLVNAAVNDELFFKIAGHN  238

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA Y KPF TD + + PGQTT+ ++TADQ +G+Y++A SPFMD  VAVDN T  
Sbjct  239   LTVVEVDACYTKPFNTDIVFVGPGQTTSFLLTADQPTGKYLIAVSPFMDTIVAVDNATGI  298

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             A L Y  T+   P  LTT P +NAT   + F+D LRSLNSK++P NVP TVDHSL FT G
Sbjct  299   AFLRYKDTVKFSPPVLTTTPAINATSETSIFLDKLRSLNSKRYPCNVPLTVDHSLYFTIG  358

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             +GIN CP+C   NGSR V  +NNV+FVMPT  LL+AH++ I GVFT DFPANPP  FNYT
Sbjct  359   VGINSCPTCV--NGSRAVGDINNVSFVMPTMDLLEAHYYNISGVFTDDFPANPPTPFNYT  416

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G       T+ GT+L+RLA+NSTVQ+VLQ TGI+APE+HP HLHGFNFFA+G+G+GN++P
Sbjct  417   GNYTGGFATSNGTRLYRLAFNSTVQVVLQGTGILAPESHPFHLHGFNFFAIGRGVGNYDP  476

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
               DPKKFNLVDPVERNT  +P GGWVAIRFRADNPGVWF+HCHLEVHT+WGLKMAF+VDN
Sbjct  477   VNDPKKFNLVDPVERNTNSVPTGGWVAIRFRADNPGVWFLHCHLEVHTSWGLKMAFVVDN  536

Query  385   GKGPNES  365
             G+GPN+S
Sbjct  537   GEGPNDS  543



>ref|XP_010098906.1| hypothetical protein L484_006544 [Morus notabilis]
 gb|EXB76109.1| hypothetical protein L484_006544 [Morus notabilis]
Length=545

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/547 (67%), Positives = 440/547 (80%), Gaps = 13/547 (2%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M  S F   +LLA  +FPA V+C VRHY F VV+ N T++CSSKPTVTVNG+FPGPT+YA
Sbjct  1     MNKSCFGAFLLLAF-LFPASVDCLVRHYNFSVVLTNTTKLCSSKPTVTVNGQFPGPTLYA  59

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDD V++RV+N+V  N++IHWHGIRQLRT WADGPAY+TQCPI+PG +Y+YNFT+TGQR
Sbjct  60    REDDNVIVRVINHVNRNLTIHWHGIRQLRTAWADGPAYVTQCPIQPGQNYVYNFTLTGQR  119

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLR+TVHGA+VILPK GVPYPFPKPD E +++LAEWWK+D EAV+N+A +
Sbjct  120   GTLLWHAHISWLRATVHGAIVILPKRGVPYPFPKPDKEKIIILAEWWKADVEAVVNQATQ  179

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SG  PNVSDAHTING PG V +CS+Q GY L V+ GK Y+LR+INAALN+ELFFKIAGH 
Sbjct  180   SGQPPNVSDAHTINGFPGQVPSCSSQ-GYTLHVKTGKTYLLRIINAALNDELFFKIAGHN  238

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVE DA+Y KPF+TDTI ++PGQTTN ++  DQ  G+Y++A +PFMDAP+  +N T+ 
Sbjct  239   LTVVEADASYTKPFETDTIFLSPGQTTNALLKTDQAIGKYLIAINPFMDAPIGYNNVTSF  298

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             ATL Y  T  +  T LT  PP N TP   +F+DSLRSLNSKQ+PA VP  V HSL  T  
Sbjct  299   ATLRYKKTPPNPKTILTKIPPQNDTPKTKAFIDSLRSLNSKQYPAKVPLNVHHSLFLTIA  358

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             +G+NPC +C   NG+++VA +NNV+FV+P+ ALLQAH++ I  VFT DFP NPPF FNYT
Sbjct  359   VGVNPCDTCV--NGTKLVADINNVSFVLPSIALLQAHYYNIGAVFTDDFPGNPPFRFNYT  416

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  PAN+QTT GT+L+RLAYNS+VQ+VLQ T +IAPENHP HLHGFNF+ VG GLGNF+P
Sbjct  417   GPSPANIQTTNGTRLYRLAYNSSVQVVLQGTSVIAPENHPTHLHGFNFYVVGMGLGNFDP  476

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
               DPKKFNLVDPVERNT+G+P  GW AIRFRADNP         EVHTTWGLKMAFLV+N
Sbjct  477   VEDPKKFNLVDPVERNTLGVPTAGWAAIRFRADNP---------EVHTTWGLKMAFLVEN  527

Query  385   GKGPNES  365
             G GPNES
Sbjct  528   GFGPNES  534



>gb|KHG17519.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/548 (71%), Positives = 428/548 (78%), Gaps = 56/548 (10%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M    W R+++LLAC  FPA VEC VRHYK                              
Sbjct  1     MEMAPWIRVLMLLACLWFPASVECMVRHYK------------------------------  30

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
                                    HGIRQ+RTGWADGPAYITQCPI+PG +Y+YNFT+TGQ
Sbjct  31    -----------------------HGIRQIRTGWADGPAYITQCPIQPGQNYVYNFTLTGQ  67

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTL +HAHILWLR+TVHGA+VILPK  VPYPFPKP  E +VVL EWWKSD EAVINEAL
Sbjct  68    RGTLWYHAHILWLRATVHGAIVILPKRDVPYPFPKPHKEEIVVLGEWWKSDVEAVINEAL  127

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             KSGLAPNVSDAHTINGHPGPV  C ++G Y L V  GK YMLR+INAALNEELFFKIAGH
Sbjct  128   KSGLAPNVSDAHTINGHPGPVPGCPSKG-YMLPVTPGKTYMLRIINAALNEELFFKIAGH  186

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
             ++TVVEVDATYVKPFKTDTIVIAPGQTTNV+VT  +G G+YMVAAS FMDAP+AVDN TA
Sbjct  187   QLTVVEVDATYVKPFKTDTIVIAPGQTTNVLVTTHRGGGKYMVAASTFMDAPIAVDNVTA  246

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
             TATLHY+G+L S  TTLT+ PP NAT VA +F+ SLRSLNSKQ+PANVP  +DHSLLFT 
Sbjct  247   TATLHYSGSLTSAATTLTSTPPKNATSVATNFISSLRSLNSKQYPANVPLKIDHSLLFTV  306

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GLG+NPCP+C   NGSRVVAS+NNVTFVMP  +LLQAHFF I GVFT+DFP NPP  FNY
Sbjct  307   GLGVNPCPTCV--NGSRVVASINNVTFVMPKISLLQAHFFNISGVFTSDFPGNPPAPFNY  364

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             T     N  T  GT+L+RLAYN TVQLVLQDTG+I PENHP+HLHGFNFF VG+GLGNFN
Sbjct  365   TSTQVTNFATKQGTRLYRLAYNDTVQLVLQDTGMITPENHPLHLHGFNFFEVGRGLGNFN  424

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             PK DPKKFNLVDPVERNTIG+P+GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VD
Sbjct  425   PKEDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVD  484

Query  388   NGKGPNES  365
             NGKGPNES
Sbjct  485   NGKGPNES  492



>ref|XP_008441433.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=553

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/546 (65%), Positives = 441/546 (81%), Gaps = 5/546 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M   +F  ++ L+C +   +VE  VRHY F V++KN  +VC  K  +TVNGKFPGPT+YA
Sbjct  1     MRNCFFTFLIALSCGV---VVESLVRHYSFIVLLKNEKKVCGRKNIMTVNGKFPGPTLYA  57

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDDTV++RV N   +N++IHWHG+RQLR+GWADGPAYITQCPI+PG +Y+YNFT+  QR
Sbjct  58    REDDTVIVRVTNRANHNLTIHWHGVRQLRSGWADGPAYITQCPIQPGQNYVYNFTLNSQR  117

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI W+R+TVHGA+VILPKLGVPYPFP+P  + +++L EWWKSD EA++N++ +
Sbjct  118   GTLLWHAHISWIRATVHGAIVILPKLGVPYPFPRPHKQKIIILGEWWKSDVEAMVNKSTQ  177

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
              G  PNVSDAHTINGHPG V  C+ +GG+ L+VE GK Y+LR+INAALNE+ FFKIA H 
Sbjct  178   LGQPPNVSDAHTINGHPGHVPGCAAKGGFTLNVETGKTYLLRIINAALNEDFFFKIASHH  237

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
              T+VEVDA+Y KPFKT+TI I+PGQTTN ++TA +  G+Y++ ASPFMDAPVA+DN TAT
Sbjct  238   FTIVEVDASYTKPFKTNTIFISPGQTTNALITAHKPIGKYLITASPFMDAPVAIDNLTAT  297

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             A L Y  T  + P   T  PP N+T + N F++SLRSLNS+++PA VP  +DH+L FT G
Sbjct  298   AFLRYKRTPRNSPIVFTKIPPPNSTFLTNQFINSLRSLNSEEYPAKVPLFIDHNLFFTVG  357

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             +G NPC +C   NG R+VA++NNVTF+MP  +LLQ+H++ I G+FT DFPANPPF +NYT
Sbjct  358   VGANPCETCV--NGMRLVAAVNNVTFIMPKISLLQSHYYNIPGIFTDDFPANPPFVYNYT  415

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G  PAN QT+ GTK++RL +NSTVQLVLQDT +IAPE+HPIHLHGFN F VG GLGNF+P
Sbjct  416   GKPPANNQTSNGTKIYRLRFNSTVQLVLQDTAVIAPESHPIHLHGFNVFIVGTGLGNFDP  475

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
               + K FNLVDPVERNT G+P GGW AIRFRADNPGVWF+HCHLEVHTTWGL+MAFLV+N
Sbjct  476   IENSKGFNLVDPVERNTFGVPNGGWTAIRFRADNPGVWFLHCHLEVHTTWGLRMAFLVEN  535

Query  385   GKGPNE  368
             G+GPNE
Sbjct  536   GEGPNE  541



>ref|XP_010483501.1| PREDICTED: laccase-16-like isoform X1 [Camelina sativa]
 ref|XP_010483502.1| PREDICTED: laccase-16-like isoform X2 [Camelina sativa]
Length=569

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/535 (70%), Positives = 429/535 (80%), Gaps = 10/535 (2%)
 Frame = -3

Query  1945  VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSI  1766
             V+  +RHYKF+VVM N T++CSSKP VTVNGKFPGPTI ARE DT+LI+VVN+VKYNVSI
Sbjct  26    VQAMIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTILIKVVNHVKYNVSI  85

Query  1765  HWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGAL  1586
             HWHGIRQLRTGWADGPAYITQCPI+PG +Y++NFT+TGQRGTL WHAHILWLR+TVHGA+
Sbjct  86    HWHGIRQLRTGWADGPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGAI  145

Query  1585  VILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPV  1406
             VILPKLGVPYPFPKP  E  +VL EWWKSD E +IN A K G AP+ SDAHTINGH G +
Sbjct  146   VILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINVASKIGTAPSASDAHTINGHSGSI  205

Query  1405  ANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIV  1226
             +NC +Q  Y L V AGK YMLR+INAALNEELFFKIAGH +TVVEVDA Y KP+KTDT+ 
Sbjct  206   SNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVY  265

Query  1225  IAPGQTTNVIVTADQGSGQ-YMVAASPFMDAPVAVDNQTATATLHYTGTLASG-----PT  1064
             IAPGQTTNV++TA+  +G  YMVAA+ F DA +  DN TATATLHY G  A+       T
Sbjct  266   IAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGPTATSVPTFKKT  325

Query  1063  TLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNG  884
              L + PP NAT VA  F  SLRSLNS+++PA VP TVD SL FT GLG NPCPSC    G
Sbjct  326   ILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFFTVGLGANPCPSCS--KG  383

Query  883   SRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP--ANLQTTTG  710
              R+VA +NNVTF MP TALLQAHFF I GVFT DFPA P   ++YT       N  T  G
Sbjct  384   IRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPLNPYDYTAPVKLGVNAATMKG  443

Query  709   TKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDP  530
             TKL+RL YN+TVQ+VLQ+T +I  +NHP HLHGFNFF VG+GLGNFNP+ DPK FNLVDP
Sbjct  444   TKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGLGNFNPEKDPKIFNLVDP  503

Query  529   VERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             VERNT+G+PAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  504   VERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQS  558



>sp|Q1PDH6.2|LAC16_ARATH RecName: Full=Laccase-16; AltName: Full=Benzenediol:oxygen oxidoreductase 
16; AltName: Full=Diphenol oxidase 16; AltName: 
Full=Urishiol oxidase 16; Flags: Precursor [Arabidopsis thaliana]
Length=566

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/549 (69%), Positives = 436/549 (79%), Gaps = 14/549 (3%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             F + VLL+    P  V   +RHYKF+V M N T++CSSKP VTVNG+FPGPTI ARE DT
Sbjct  14    FFVFVLLS----PTTVHSIIRHYKFNV-MTNTTKLCSSKPIVTVNGQFPGPTIVAREGDT  68

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             +LI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y++NFT+TGQRGTL W
Sbjct  69    ILIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYLHNFTLTGQRGTLWW  128

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHILWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL+EWWKSD E +INEA + G AP
Sbjct  129   HAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLSEWWKSDVEELINEASRIGTAP  188

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             + SDAHTINGH G ++NC +Q  Y L V AGK YMLR+INAALNEELFFKIAGH +TVVE
Sbjct  189   SASDAHTINGHSGSISNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVE  248

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQ-YMVAASPFMDAPVAVDNQTATATLH  1094
             VDA Y KP+KTDT+ IAPGQTTNV++TA+  +G  YMVAA+ F DA +  DN TATATLH
Sbjct  249   VDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLH  308

Query  1093  YTGTLA----SGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             Y G  +    S  T L + PP NAT VA  F  SLRSLNS ++PA VP TV+HSL FT G
Sbjct  309   YIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSLRSLNSLEYPARVPTTVEHSLFFTVG  368

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYT  746
             LG NPC SC   NG R+VA +NNVTF MP TALLQAHFF I GVFT DFPA P   ++YT
Sbjct  369   LGANPCQSCN--NGVRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPSNPYDYT  426

Query  745   GAGP--ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
                    N  T  GTKL+RL YN+TVQ+VLQ+T +I  +NHP HLHGFNFF VG+GLGNF
Sbjct  427   APVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGLGNF  486

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             NP+ DPK FNLVDPVERNT+G+PAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+V
Sbjct  487   NPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMAFVV  546

Query  391   DNGKGPNES  365
             DNG GP++S
Sbjct  547   DNGHGPDQS  555



>ref|XP_010443638.1| PREDICTED: laccase-16-like [Camelina sativa]
Length=568

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/534 (70%), Positives = 429/534 (80%), Gaps = 9/534 (2%)
 Frame = -3

Query  1945  VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSI  1766
             V+  +RHYKF+VVM N T++CSSKP VTVNGKFPGPTI ARE DTVLI+VVN+VKYNVSI
Sbjct  26    VQAMIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTVLIKVVNHVKYNVSI  85

Query  1765  HWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGAL  1586
             HWHGIRQLRTGWAD PAYITQCPI+PG +Y++NFT+TGQRGTL WHAHILWLR+TVHGA+
Sbjct  86    HWHGIRQLRTGWADEPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGAI  145

Query  1585  VILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPV  1406
             VILPKLGVPYPFPKP  E  +VL EWWKSD E +IN A K G AP+ SDAHTINGH G +
Sbjct  146   VILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINVASKIGTAPSASDAHTINGHSGSL  205

Query  1405  ANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIV  1226
             +NC +Q  Y L V AGK YMLR+INAALNEELFFKIAGH +TVVEVDA Y KP+KTDT+ 
Sbjct  206   SNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVY  265

Query  1225  IAPGQTTNVIVTADQGSGQ-YMVAASPFMDAPVAVDNQTATATLHYTGTLASGP----TT  1061
             IAPGQTTNV++TA+  +G  YM+AA+ F DA +  DN TATATLHY G  A+ P    T 
Sbjct  266   IAPGQTTNVLLTANANAGSNYMIAATTFTDAHIPYDNVTATATLHYIGPTATVPTFKKTI  325

Query  1060  LTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGS  881
             L + PP NAT VA  F  SLRSLNS+++PA VP TVD SL FT GLG NPCPSC   NG 
Sbjct  326   LASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFFTVGLGSNPCPSCS--NGI  383

Query  880   RVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP--ANLQTTTGT  707
             R+VA +NNVTF MP TALLQAHFF I GVFT DFPA P   ++YT       N  T  GT
Sbjct  384   RLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPLNPYDYTAPVKLGVNAATMKGT  443

Query  706   KLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPV  527
             KL+RL YN+TVQ+VLQ+T +I  +NHP HLHGFNFF VG+GLGNFN + DPK FNLVDPV
Sbjct  444   KLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGLGNFNSEKDPKMFNLVDPV  503

Query  526   ERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             ERNT+G+PAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  504   ERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQS  557



>gb|KHG22893.1| Laccase-4 -like protein [Gossypium arboreum]
Length=486

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/465 (77%), Positives = 403/465 (87%), Gaps = 2/465 (0%)
 Frame = -3

Query  1759  HGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVI  1580
             HGIRQLRTGWADGPAYITQCPI+PG SY+YNFT+TGQRGTL WHAHILWLR+TVHGA+VI
Sbjct  13    HGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTVTGQRGTLFWHAHILWLRATVHGAIVI  72

Query  1579  LPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVAN  1400
             LPK GVPYPFPKP  E +V+L EWWKSD EAVINEALKSGLAPNVSDAHTINGHPG   +
Sbjct  73    LPKRGVPYPFPKPHKEEIVILGEWWKSDVEAVINEALKSGLAPNVSDAHTINGHPGSTPS  132

Query  1399  CSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIA  1220
             C ++GGY L+V+ GK YMLR+INAALNEELFF IAGH++TVVEVDATYVKPFKTDTIVI+
Sbjct  133   CPSKGGYTLAVKPGKTYMLRIINAALNEELFFMIAGHQLTVVEVDATYVKPFKTDTIVIS  192

Query  1219  PGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPM  1040
             PGQTTNV+VT  + +G+Y+VAASPFMDAP+AVDN TATATLHY G+L S  TTL + PP 
Sbjct  193   PGQTTNVLVTTHRRAGKYLVAASPFMDAPIAVDNLTATATLHYAGSLTSSATTLVSPPPK  252

Query  1039  NATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLN  860
             NAT VA +F ++LRSLNS+++PA VP  +DHSLLFT GLGINPC +C   NGSRVVAS+N
Sbjct  253   NATSVAANFTNALRSLNSEKYPAKVPLKIDHSLLFTIGLGINPCSTCV--NGSRVVASVN  310

Query  859   NVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNS  680
             N+TFVMP TALLQAHFF I GVF T+FP  PP  FNYT     NL T   TKL+RL YN 
Sbjct  311   NITFVMPKTALLQAHFFNINGVFATNFPGRPPVPFNYTSIQLTNLGTKQATKLYRLGYND  370

Query  679   TVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPA  500
             TVQLVLQDTG+I PENHPIHLHGFNFF VG+G+GNF+PK DPK FNLVDPVERNTIG+P+
Sbjct  371   TVQLVLQDTGMITPENHPIHLHGFNFFEVGRGVGNFDPKKDPKNFNLVDPVERNTIGVPS  430

Query  499   GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+VDNGKGPNES
Sbjct  431   GGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNES  475



>ref|XP_006282033.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
 gb|EOA14931.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
Length=530

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/521 (71%), Positives = 418/521 (80%), Gaps = 9/521 (2%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             M N T++CSSKP VTVNGKFPGPTI ARE DT+LI+VVN+V YNVSIHWHGIRQLRTGWA
Sbjct  1     MTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTILIKVVNHVNYNVSIHWHGIRQLRTGWA  60

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCPI+PG +Y++NFT+TGQRGTL WHAHILWLR+TVHGA+VILPKLGVPYPFP
Sbjct  61    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  120

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
             KP  E  +VL EWWKSD E ++NEA K G AP  SDAHTINGH G + NC +Q  Y L V
Sbjct  121   KPYKEKTIVLGEWWKSDVEELVNEASKIGTAPMASDAHTINGHSGSIPNCPSQSSYGLPV  180

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
              AGK YMLR+INAALNEELFFKIAGH +TVVEVDA Y KP+KTDT+ IAPGQTTNV++TA
Sbjct  181   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAPGQTTNVLLTA  240

Query  1186  DQGSGQ-YMVAASPFMDAPVAVDNQTATATLHYTG----TLASGPTTLTTAPPMNATPVA  1022
             +  +G  YMVAA+ F DA +  DN TATATLHY G      AS  T L + PP NAT VA
Sbjct  241   NANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSASKKTVLASLPPQNATWVA  300

Query  1021  NSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVM  842
               F  SLRSLNS ++PA VP TVDHSL FT GLG NPCPSC   NG R+VA +NNVTF M
Sbjct  301   TKFTRSLRSLNSHEYPARVPTTVDHSLFFTVGLGANPCPSCS--NGVRLVAGINNVTFTM  358

Query  841   PTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP--ANLQTTTGTKLFRLAYNSTVQL  668
             P TALLQAHFF I GVFT DFPA P   ++YT       N  T  GTKL+RL YN+TVQ+
Sbjct  359   PKTALLQAHFFNISGVFTDDFPAKPANPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQV  418

Query  667   VLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWV  488
             VLQ+T +I P+NHP HLHGFNFF VG+GLGNFNP+ DPK FNLVDPVERNT+G+PAGGW 
Sbjct  419   VLQNTAMIVPDNHPFHLHGFNFFEVGRGLGNFNPEKDPKMFNLVDPVERNTVGVPAGGWT  478

Query  487   AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  479   AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQS  519



>gb|AES99522.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=529

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/518 (66%), Positives = 432/518 (83%), Gaps = 4/518 (1%)
 Frame = -3

Query  1915  DVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRT  1736
             +VV+KN T++CS+K  V+VNGKFPGPT+YAREDDT+++RV N V++NV+IHWHGI+QLRT
Sbjct  4     NVVLKNETKLCSTKSFVSVNGKFPGPTLYAREDDTLIVRVTNLVQHNVTIHWHGIKQLRT  63

Query  1735  GWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPY  1556
              W+DGPAY+TQCPI+ G S++YNFTITGQRGTLLWHAHI WLR+T+HGA+VILPK G PY
Sbjct  64    CWSDGPAYVTQCPIQTGQSFVYNFTITGQRGTLLWHAHITWLRATMHGAIVILPKRGTPY  123

Query  1555  PFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYR  1376
             PFPKPD E +++L EWWKSD EAV+N+A  SG+ PN+SDAHTINGHPGPV  C +Q GY 
Sbjct  124   PFPKPDKEKIIILGEWWKSDVEAVVNQATSSGMPPNISDAHTINGHPGPVPGCISQ-GYT  182

Query  1375  LSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVI  1196
             L VE+GK Y+LR+INAALN+ELFFKIAGHK+ VVE DA+Y+KPF+ DTI ++PGQTTNV+
Sbjct  183   LHVESGKTYLLRIINAALNDELFFKIAGHKLIVVEADASYLKPFEIDTIFLSPGQTTNVL  242

Query  1195  VTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANS  1016
             +TA+Q  G+Y++A +PFMDAP+  DN ++ ATL Y G      T LT  PP+NATP+  +
Sbjct  243   LTANQPIGKYLIAITPFMDAPIGFDNLSSIATLRYKGIPPYTKTILTNIPPLNATPITKT  302

Query  1015  FVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPT  836
             F DSLRSLNSK +P  V  T+DHSLLF   +G+NPC +C   N  ++V+++NN+TF+MPT
Sbjct  303   FTDSLRSLNSKTYPTRVSLTIDHSLLFAITVGLNPCDTCITDN--KLVSAINNITFLMPT  360

Query  835   TALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKLFRLAYNSTVQLVLQ  659
              +LLQA+++ IKGVFT DFP+ PP  F+YTG   PANL T  GTK++RL +NS+VQ+VLQ
Sbjct  361   VSLLQANYYNIKGVFTDDFPSKPPMVFDYTGTDQPANLHTDNGTKVYRLNFNSSVQIVLQ  420

Query  658   DTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIR  479
              T +IAPENHP HLHGFNFF VG+GLGNF+P+ DP +FNLVDP+ERNT+ +P  GW+AIR
Sbjct  421   GTAMIAPENHPFHLHGFNFFVVGQGLGNFDPEKDPLRFNLVDPIERNTLSVPNNGWIAIR  480

Query  478   FRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             FRADNPGVWF+HCHLEVHTTWGLKMAF+VDNG+GP+ES
Sbjct  481   FRADNPGVWFLHCHLEVHTTWGLKMAFIVDNGRGPSES  518



>ref|XP_010690098.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=565

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/555 (65%), Positives = 436/555 (79%), Gaps = 9/555 (2%)
 Frame = -3

Query  2014  HTMMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPT  1835
              T ME  W R  V L   +FPA+ E +VRHY F VVMKN T++CS+KP  TVNGKFPGPT
Sbjct  4     ETTME-PWIR-AVFLVMVLFPALAEAKVRHYNFKVVMKNYTKLCSTKPIATVNGKFPGPT  61

Query  1834  IYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTIT  1655
             + ARE D VL++V+N V YNV+IHWHGIRQLRTGW+DGPAYI QCPI+PG SY+YNF+I 
Sbjct  62    LRAREGDNVLVKVINDVSYNVTIHWHGIRQLRTGWSDGPAYIAQCPIQPGQSYLYNFSII  121

Query  1654  GQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINE  1475
             GQRGTL WHAHI WLR+T+HGA+VILPK G PYPFP+P  E ++VLAEWWK+DTEAVIN+
Sbjct  122   GQRGTLFWHAHISWLRATMHGAIVILPKKGTPYPFPQPVKEKIIVLAEWWKADTEAVINQ  181

Query  1474  ALKSGLAPNVSDAHTINGHPGPVANC--STQGGYRLSVEAGKRYMLRVINAALNEELFFK  1301
                SG+ PNVSDAHT+NG+ GP+ NC  S+QG Y L VE  K Y+LR+INAA+N+E+FF+
Sbjct  182   GTLSGMPPNVSDAHTMNGYTGPIRNCSISSQGTYTLHVEHNKTYLLRIINAAINDEIFFR  241

Query  1300  IAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQG-SGQYMVAASPFMDAP-VA  1127
             IAGHK TVVEVDA+Y KPF TDTI IAPGQTTN ++ ADQ  S +Y++  S FMDAP VA
Sbjct  242   IAGHKFTVVEVDASYTKPFVTDTIYIAPGQTTNALLKADQSPSKKYLIGMSSFMDAPSVA  301

Query  1126  VDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDH  947
             VDN T    L Y G        LTT PP+NAT    +F ++LRSLNSK++PA VP T+DH
Sbjct  302   VDNTTNYGLLRYNGGPLGSRLVLTTMPPINATKAQLNFSNALRSLNSKKYPAQVPLTIDH  361

Query  946   SLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANP  767
             SLLFT G+G+NPC +C   NGS++V ++NNVTFVMP+ ALLQA+++ I GVFT DFP+ P
Sbjct  362   SLLFTTGVGVNPCATCL--NGSKLVGNINNVTFVMPSIALLQAYYYNISGVFTDDFPSKP  419

Query  766   PFAFNYTGAG-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVG  590
             P  F+YT A     L T  GTK++RL+YN+TVQ+VLQDT IIAPE+HP+HLHG NFF VG
Sbjct  420   PTNFDYTIANYTGGLATMNGTKVYRLSYNATVQVVLQDTSIIAPESHPLHLHGTNFFVVG  479

Query  589   KGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGL  410
              G GN+N   D K FNLVDPVERNTI +P GGW AIRFRADNPGVWFMHCHLEVHT+WGL
Sbjct  480   MGTGNYNATKDFKNFNLVDPVERNTIDVPTGGWTAIRFRADNPGVWFMHCHLEVHTSWGL  539

Query  409   KMAFLVDNGKGPNES  365
             KMAFL++NG GPN+S
Sbjct  540   KMAFLIENGDGPNKS  554



>gb|KGN45770.1| hypothetical protein Csa_6G009490 [Cucumis sativus]
Length=555

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/548 (64%), Positives = 436/548 (80%), Gaps = 7/548 (1%)
 Frame = -3

Query  2005  MEC--SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTI  1832
             M C   +  ++++L+C +   +VE  VRHY F V++KN  + C  K  +TVNGKFPGPT+
Sbjct  1     MRCIIVFITLLIVLSCGV---VVESLVRHYSFIVLLKNERKACGRKDIMTVNGKFPGPTL  57

Query  1831  YAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITG  1652
             YAREDDTV++RV N   +N++IHWHG+RQLR+GWADGPAYITQCPI+PG +Y+YNFT++ 
Sbjct  58    YAREDDTVIVRVTNRANHNLTIHWHGVRQLRSGWADGPAYITQCPIQPGQNYVYNFTLSS  117

Query  1651  QRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEA  1472
             QRGTLLWHAH  W+R+TVHGA+VI PK GVPYPFP P  +  ++L EWWKSD EA++N++
Sbjct  118   QRGTLLWHAHFSWIRATVHGAIVIFPKHGVPYPFPHPYKQKTIILGEWWKSDVEAMVNKS  177

Query  1471  LKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAG  1292
              + G  PNVSDA TINGHPG V  C+T+ G+ L VE GK Y+LR+INAALNE+ FFKIA 
Sbjct  178   TQLGQPPNVSDAQTINGHPGHVPGCATKRGFTLHVETGKTYLLRIINAALNEDFFFKIAS  237

Query  1291  HKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQT  1112
             H  T+VEVDA+Y KPFKT+TI I+PGQTTN +V A +  G+Y++AASPFMDAPVA+DN T
Sbjct  238   HHFTIVEVDASYTKPFKTNTIFISPGQTTNALVRAHRPIGKYLIAASPFMDAPVAIDNLT  297

Query  1111  ATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFT  932
             ATA L Y  T  + P   T  PP N+T + N F DSLRSLNS+++PA VP  +DH+L FT
Sbjct  298   ATAFLRYKRTPKNSPIVFTHIPPPNSTLLTNQFTDSLRSLNSEEYPAKVPLFIDHNLFFT  357

Query  931   AGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFN  752
              G+G+NPC +C   NG R+VA++NNVTF+MP  +LLQ+H++ I GVFT DFPANPPF ++
Sbjct  358   VGVGVNPCETCV--NGVRLVAAVNNVTFLMPQISLLQSHYYNIPGVFTDDFPANPPFVYD  415

Query  751   YTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNF  572
             YTG  P N QT+ GTK++RL +NSTVQLVLQDT +IAPE+HPIHLHGFN F VG GLGNF
Sbjct  416   YTGKPPTNNQTSNGTKVYRLRFNSTVQLVLQDTAVIAPESHPIHLHGFNVFIVGTGLGNF  475

Query  571   NPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  392
             +P  D K FNLVDPVERNT G+P GGW+AIRFRADNPGVWF+HCHLEVHTTWGL+MAFLV
Sbjct  476   DPIEDWKGFNLVDPVERNTFGVPNGGWIAIRFRADNPGVWFLHCHLEVHTTWGLRMAFLV  535

Query  391   DNGKGPNE  368
             +NG+GPNE
Sbjct  536   ENGEGPNE  543



>gb|ACN39933.1| unknown [Picea sitchensis]
Length=559

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/550 (66%), Positives = 429/550 (78%), Gaps = 5/550 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVEC--RVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTI  1832
             M  S  RI  L+   MF + +E   + RHYKFDV +KN++R+C +KP VTVNG+FPGPTI
Sbjct  1     MGDSVMRITFLVMVIMFSSAMEAEGKTRHYKFDVGLKNVSRLCQTKPIVTVNGEFPGPTI  60

Query  1831  YAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITG  1652
             YARE DTV++ V N+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+ G SY YNFTITG
Sbjct  61    YAREGDTVIVNVTNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQTGQSYAYNFTITG  120

Query  1651  QRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEA  1472
             QRGTL WHAHILWLR+T+HGA+VILP     YPFPKP  E  ++L EWW +D EAVINEA
Sbjct  121   QRGTLWWHAHILWLRATIHGAIVILPPKHHLYPFPKPHKEITLLLGEWWNADVEAVINEA  180

Query  1471  LKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAG  1292
             LKSG APNVSDAHTING PGP+  C T+  + +SVE GK Y+LR+IN ALN+ELFF +A 
Sbjct  181   LKSGGAPNVSDAHTINGKPGPLFKCPTKDTFVVSVEHGKTYLLRIINVALNDELFFDVAD  240

Query  1291  HKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQT  1112
             H + VVEVDA Y KP +T +IVIAPGQTTN ++ A++GSG+Y +A   FMDAPVAVDN+T
Sbjct  241   HHLKVVEVDAVYTKPLRTKSIVIAPGQTTNALLYANKGSGRYFIATRTFMDAPVAVDNKT  300

Query  1111  ATATLHYTGTLASGP-TTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLF  935
             ATA L Y  + ++     +   P  N T  A +F +SLRSLNS +FPA VPQTVD  LLF
Sbjct  301   ATAILQYVNSNSNTDFIAMPRIPSQNDTSFATNFSNSLRSLNSARFPAKVPQTVDRHLLF  360

Query  934   TAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAF  755
             T GL ++ CP+C   NGSRV AS+NN++FVMP  +LLQAHFF I GVFTTDFP  PP  F
Sbjct  361   TVGLAMDSCPTCN--NGSRVAASINNISFVMPKISLLQAHFFNITGVFTTDFPDRPPTPF  418

Query  754   NYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGN  575
             NYTGA P N  T+ GT+L R+ +NSTVQLVLQ T ++A E HP+HLHGFNFF VG+G GN
Sbjct  419   NYTGAPPQNPMTSKGTRLTRIPFNSTVQLVLQGTSVLAMEKHPLHLHGFNFFIVGRGFGN  478

Query  574   FNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFL  395
             +NP  DP KFNLVDP ERNT+G+P GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+
Sbjct  479   YNPNKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFV  538

Query  394   VDNGKGPNES  365
             V+NG GPN+S
Sbjct  539   VENGDGPNQS  548



>gb|ABE66261.1| laccase/diphenol oxidase [Arabidopsis thaliana]
Length=530

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/521 (70%), Positives = 420/521 (81%), Gaps = 9/521 (2%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             M N T++CSSKP VTVNG+FPGPTI ARE DT+LI+VVN+VKYNVSIHWHGIRQLRTGWA
Sbjct  1     MTNTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYNVSIHWHGIRQLRTGWA  60

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCPI+PG +Y++NFT+TGQRGTL WHAHILWLR+TVHGA+VILPKLGVPYPFP
Sbjct  61    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  120

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
             KP  E  +VL+EWWKSD E +INEA + G AP+ SDAHTINGH G ++NC +Q  Y L V
Sbjct  121   KPYKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPV  180

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
              AGK YMLR+INAALNEELFFKIAGH +TVVEVDA Y KP+KTDT+ IAPGQTTNV++TA
Sbjct  181   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTA  240

Query  1186  DQGSGQ-YMVAASPFMDAPVAVDNQTATATLHYTGTLA----SGPTTLTTAPPMNATPVA  1022
             +  +G  YMVAA+ F DA +  DN TATATLHY G  +    S  T L + PP NAT VA
Sbjct  241   NANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVA  300

Query  1021  NSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVM  842
               F  SLRSLNS ++PA VP TV+HSL FT GLG NPC SC   NG R+VA +NNVTF M
Sbjct  301   TKFTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCN--NGVRLVAGINNVTFTM  358

Query  841   PTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP--ANLQTTTGTKLFRLAYNSTVQL  668
             P TALLQAHFF I GVFT DFPA P   ++YT       N  T  GTKL+RL YN+TVQ+
Sbjct  359   PKTALLQAHFFNISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQI  418

Query  667   VLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWV  488
             VLQ+T +I  +NHP HLHGFNFF VG+GLGNFNP+ DPK FNLVDPVERNT+G+PAGGW 
Sbjct  419   VLQNTAMILSDNHPFHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWT  478

Query  487   AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  479   AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQS  519



>gb|ABK28766.1| unknown [Arabidopsis thaliana]
Length=531

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/521 (70%), Positives = 420/521 (81%), Gaps = 9/521 (2%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             M N T++CSSKP VTVNG+FPGPTI ARE DT+LI+VVN+VKYNVSIHWHGIRQLRTGWA
Sbjct  1     MTNTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYNVSIHWHGIRQLRTGWA  60

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCPI+PG +Y++NFT+TGQRGTL WHAHILWLR+TVHGA+VILPKLGVPYPFP
Sbjct  61    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  120

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
             KP  E  +VL+EWWKSD E +INEA + G AP+ SDAHTINGH G ++NC +Q  Y L V
Sbjct  121   KPYKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPV  180

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
              AGK YMLR+INAALNEELFFKIAGH +TVVEVDA Y KP+KTDT+ IAPGQTTNV++TA
Sbjct  181   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTA  240

Query  1186  DQGSGQ-YMVAASPFMDAPVAVDNQTATATLHYTGTLA----SGPTTLTTAPPMNATPVA  1022
             +  +G  YMVAA+ F DA +  DN TATATLHY G  +    S  T L + PP NAT VA
Sbjct  241   NANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVA  300

Query  1021  NSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVM  842
               F  SLRSLNS ++PA VP TV+HSL FT GLG NPC SC   NG R+VA +NNVTF M
Sbjct  301   TKFTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCN--NGVRLVAGINNVTFTM  358

Query  841   PTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP--ANLQTTTGTKLFRLAYNSTVQL  668
             P TALLQAHFF I GVFT DFPA P   ++YT       N  T  GTKL+RL YN+TVQ+
Sbjct  359   PKTALLQAHFFNISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQI  418

Query  667   VLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWV  488
             VLQ+T +I  +NHP HLHGFNFF VG+GLGNFNP+ DPK FNLVDPVERNT+G+PAGGW 
Sbjct  419   VLQNTAMILSDNHPFHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWT  478

Query  487   AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  479   AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQS  519



>emb|CDP09155.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/561 (64%), Positives = 437/561 (78%), Gaps = 32/561 (6%)
 Frame = -3

Query  1993  WFRIVVL-LACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARED  1817
             W R+ VL L  C+ P+ ++C++R YKF+V+  N TR+CS+KP VTVNG FPGPTI+A ED
Sbjct  187   WLRLRVLVLVACLLPSFIQCKIRIYKFNVMATNTTRLCSTKPAVTVNGLFPGPTIFANED  246

Query  1816  DTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTL  1637
             D +L++VVN V+YN++IHWHGI+QLR+GWADGPA+ITQCPI+PG +Y+YNFTIT QRGTL
Sbjct  247   DDLLVKVVNQVQYNLTIHWHGIKQLRSGWADGPAFITQCPIQPGQTYVYNFTITDQRGTL  306

Query  1636  LWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVL-----------------AEW  1508
              WHAHI WLR+TVHGALVILPKLG+PYPFP PD E V++L                 A  
Sbjct  307   WWHAHIGWLRATVHGALVILPKLGLPYPFPPPDSEVVIILDLAENKNLMDYLFYMVAAIV  366

Query  1507  WKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINA  1328
             + SD E +IN A+K GL   VSDA+TING   P++NCS++GG+   VE GK+YMLR+INA
Sbjct  367   FYSDIETLINSAMKEGLPFQVSDAYTINGQSRPISNCSSEGGFSFPVEPGKKYMLRIINA  426

Query  1327  ALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASP  1148
             ALNEELFFKIAGH +TVVEVDATYVKPFKT TI I PGQTTN I+ AD G+G Y++AASP
Sbjct  427   ALNEELFFKIAGHSLTVVEVDATYVKPFKTGTIFITPGQTTNAILEADLGTGNYLMAASP  486

Query  1147  FMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPAN  968
             FM  PV +D   ATAT+HY+GT +S  TT T  PP NATP+A +FVDSL+SLNS+++PA 
Sbjct  487   FMAEPVPIDYTAATATVHYSGTQSSAATTFTDLPPRNATPLATAFVDSLKSLNSQRYPAR  546

Query  967   VPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFT  788
             VP TVDHSLLFT GLG NPC +C    GSR+ A  NN++F+ P  +LL AHFF I GVF 
Sbjct  547   VPLTVDHSLLFTMGLGFNPCATCI--RGSRIAAYFNNISFIRPAISLLNAHFFNISGVFA  604

Query  787   TDFPANPPFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGF  608
              DFP NPP            ++T  GT+L+RLA+NSTVQLVLQDT +I PENHPIHLHG 
Sbjct  605   DDFPGNPP------------IRTMEGTRLYRLAFNSTVQLVLQDTAMITPENHPIHLHGM  652

Query  607   NFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEV  428
             NFF VG+GLGNF+P+ DP  FNLVDPVERNT+G+P+GGWVA+RFRADNPGVWFMHCHLE 
Sbjct  653   NFFVVGRGLGNFDPEKDPSNFNLVDPVERNTVGVPSGGWVAVRFRADNPGVWFMHCHLES  712

Query  427   HTTWGLKMAFLVDNGKGPNES  365
             HT  GL+MAF+VDNG+GPN+S
Sbjct  713   HTLVGLEMAFVVDNGQGPNQS  733


 Score =   165 bits (417),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -3

Query  649  IIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRA  470
            +I+PE+HP HLHGFNFF VG G+GNFNP  DP  FNLVDPVERNT+G+P GGWVAIRFRA
Sbjct  1    MISPESHPFHLHGFNFFVVGSGIGNFNPNKDPPNFNLVDPVERNTVGVPTGGWVAIRFRA  60

Query  469  DNPGVWFMHCHLEVHTTWGLKMAF  398
            DNPGVWF+HCHLEVHTTWGLKMAF
Sbjct  61   DNPGVWFLHCHLEVHTTWGLKMAF  84



>gb|EMS48198.1| Laccase-22 [Triticum urartu]
Length=537

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/523 (67%), Positives = 433/523 (83%), Gaps = 9/523 (2%)
 Frame = -3

Query  1978  VLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLI  1802
             ++ +C +  A+ V    RHYKF+VVM+NMTR+CS+K  +TVNGKFPGPT+YARE D VL+
Sbjct  14    LMASCFLLQALSVHAITRHYKFNVVMRNMTRLCSTKSILTVNGKFPGPTLYAREGDNVLV  73

Query  1801  RVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAH  1622
             +VVN   +NV+IHWHG+RQ+RTGW DGPAYITQCPI+PG S++YNFT+TGQRGTLLWHAH
Sbjct  74    KVVNQASHNVTIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTVTGQRGTLLWHAH  133

Query  1621  ILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVS  1442
             I WLR+TVHGA+VILPKLGVPYPFP P  EAVVVL EWWK+DTE VIN+A++ G+ PN+S
Sbjct  134   INWLRATVHGAIVILPKLGVPYPFPAPHKEAVVVLGEWWKADTETVINQAMQLGVGPNIS  193

Query  1441  DAHTINGHPGPVANC-STQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             D+HTINGHPGP+++C S+Q G+ L VE  K YMLR+INA LN++LFFKIAGH +TVVEVD
Sbjct  194   DSHTINGHPGPMSDCASSQDGFNLDVENDKTYMLRIINAGLNDDLFFKIAGHGLTVVEVD  253

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A Y KP+KTD ++I PGQTTNV+VTADQ +G+Y+++ SPF+DAP+ VDN+T TATLHY  
Sbjct  254   AVYTKPYKTDILLITPGQTTNVLVTADQSAGRYLLSVSPFLDAPLQVDNKTGTATLHYAN  313

Query  1084  TL-ASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPC  908
             T+ A+   TL   PP NATP+A+ F +SLRSLNSK++PANVPQTVDHSL FT G+G+NPC
Sbjct  314   TVSATARLTLVKPPPQNATPIASKFSESLRSLNSKEYPANVPQTVDHSLFFTIGVGVNPC  373

Query  907   PSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPAN  728
              +C   NG+RVV ++NN TFVMP+T +LQA ++ I GVFT DFPA PP  FNYTG+GP N
Sbjct  374   ANCI--NGTRVVGTINNSTFVMPSTPILQARYYSIPGVFTEDFPATPPHKFNYTGSGPKN  431

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             LQT  GT+++RL YN++VQ++LQDTGII+ E+HPIHLHGFNFF VG+G+GN+NPKT P  
Sbjct  432   LQTMKGTRVYRLPYNASVQVILQDTGIISTESHPIHLHGFNFFVVGRGVGNYNPKTSPST  491

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFM----HCHLE  431
             FNL+DPVERNTIG+P GGW AIRFRADNPG  F     +C LE
Sbjct  492   FNLIDPVERNTIGVPTGGWTAIRFRADNPGRDFNPTLPYCLLE  534



>ref|XP_010543748.1| PREDICTED: laccase-22-like [Tarenaya hassleriana]
Length=555

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/525 (66%), Positives = 420/525 (80%), Gaps = 4/525 (1%)
 Frame = -3

Query  1936  RVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWH  1757
             ++R YKFDVVMKN T++CS+K  VTVNGKFPGPT+YAREDD V++ + N+V YNV+IHWH
Sbjct  23    KIRRYKFDVVMKNTTKLCSTKSIVTVNGKFPGPTLYAREDDQVIVNLTNHVNYNVTIHWH  82

Query  1756  GIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVIL  1577
             G++QLRTGW+DGPAYITQCPI+PG +++YNFT+TGQRGTLLWHAHI WLR+TVHGA+VIL
Sbjct  83    GVKQLRTGWSDGPAYITQCPIQPGGTFIYNFTLTGQRGTLLWHAHISWLRATVHGAIVIL  142

Query  1576  PKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANC  1397
             P+  V YPFP+P  E +++  EWWKSD EAVIN++  +GL PNVSDAHTING  GP+  C
Sbjct  143   PRHRVAYPFPRPHKEKIIIFGEWWKSDVEAVINQSTFTGLPPNVSDAHTINGQSGPLLGC  202

Query  1396  STQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAP  1217
             ++  GY L VE+GK YMLR+INAALN+ELFFKIAGH +TV+EVDA+Y KPF  DT+ + P
Sbjct  203   NSP-GYTLHVESGKTYMLRIINAALNDELFFKIAGHTLTVIEVDASYTKPFSADTLFLGP  261

Query  1216  GQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMN  1037
             GQTTN ++TADQ SG+Y++  SPFMD  V VDN T TA LHY  T +S        PP+N
Sbjct  262   GQTTNALLTADQSSGKYLITISPFMDTIVTVDNVTGTAFLHYNDTTSSPSLVSDKIPPVN  321

Query  1036  ATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNN  857
             AT VA  F D+LRSLNS+ +PANVP  VDHSL FT G+GINPC +C   N ++ V  +NN
Sbjct  322   ATSVALGFSDNLRSLNSRDYPANVPLRVDHSLFFTIGVGINPCETCI--NNTKAVGDINN  379

Query  856   VTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP-ANLQTTTGTKLFRLAYNS  680
             V+FVMPT  +LQAH++ I GVFT DFP  P   FNYT     AN++T  GTK +RLAYNS
Sbjct  380   VSFVMPTIGILQAHYYNISGVFTDDFPGKPLIPFNYTANNSTANMRTMNGTKAYRLAYNS  439

Query  679   TVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPA  500
             TVQLV+Q T +IAPE+HP HLHGFNFF +GKG+GNF+P  DPKKFNLVDPVERNT+ +P 
Sbjct  440   TVQLVIQGTSVIAPESHPTHLHGFNFFVIGKGVGNFDPLNDPKKFNLVDPVERNTVSVPT  499

Query  499   GGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
              GW AIRFRADNPGVWF HCHLEVHT+WGLKM FLV+NGKGPNE+
Sbjct  500   AGWTAIRFRADNPGVWFFHCHLEVHTSWGLKMVFLVENGKGPNET  544



>ref|XP_004138572.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis sativus]
Length=561

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/555 (63%), Positives = 435/555 (78%), Gaps = 15/555 (3%)
 Frame = -3

Query  2005  MEC--SWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTI  1832
             M C   +  ++++L+C +   +VE  VRHY F V++KN  + C  K  +TVNGKFPGPT+
Sbjct  1     MRCIIVFITLLIVLSCGV---VVESLVRHYSFIVLLKNERKACGRKDIMTVNGKFPGPTL  57

Query  1831  YAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITG  1652
             YAREDDTV++RV N   +N++IHWHG+RQLR+GWADGPAYITQCPI+PG +Y+YNFT++ 
Sbjct  58    YAREDDTVIVRVTNRANHNLTIHWHGVRQLRSGWADGPAYITQCPIQPGQNYVYNFTLSS  117

Query  1651  QRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINE-  1475
             QRGTLLWHAH  W+R+TVHGA+VI PK GVPYPFP P  +  ++L EWWKSD EA++N+ 
Sbjct  118   QRGTLLWHAHFSWIRATVHGAIVIFPKHGVPYPFPHPYKQKTIILGEWWKSDVEAMVNDV  177

Query  1474  ------ALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEE  1313
                   + + G  PNVSDA TINGHPG V  C+T+  + L VE GK Y+LR+INAALNE+
Sbjct  178   EAMVNKSTQLGQPPNVSDAQTINGHPGHVPGCATKS-FTLHVETGKTYLLRIINAALNED  236

Query  1312  LFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAP  1133
              FFKIA H  T+VEVDA+Y KPFKT+TI I+PGQTTN +V A +  G+Y++AASPFMDAP
Sbjct  237   FFFKIASHHFTIVEVDASYTKPFKTNTIFISPGQTTNALVRAHRPIGKYLIAASPFMDAP  296

Query  1132  VAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTV  953
             VA+DN TATA L Y  T  + P   T  PP N+T + N F DSLRSLNS+++PA VP  +
Sbjct  297   VAIDNLTATAFLRYKRTPKNSPIVFTHIPPPNSTLLTNQFTDSLRSLNSEEYPAKVPLFI  356

Query  952   DHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPA  773
             DH+L FT G+G+NPC +C   NG R+VA++NNVTF+MP  +LLQ+H++ I GVFT DFPA
Sbjct  357   DHNLFFTVGVGVNPCETCV--NGVRLVAAVNNVTFLMPQISLLQSHYYNIPGVFTDDFPA  414

Query  772   NPPFAFNYTGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAV  593
             NPPF ++YTG  P N QT+ GTK++RL +NSTVQLVLQDT +IAPE+HPIHLHGFN F V
Sbjct  415   NPPFVYDYTGKPPTNNQTSNGTKVYRLRFNSTVQLVLQDTAVIAPESHPIHLHGFNVFIV  474

Query  592   GKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWG  413
             G GLGNF+P  D K FNLVDPVERNT G+P GGW+AIRFRADNPGVWF+HCHLEVHTTWG
Sbjct  475   GTGLGNFDPIEDWKGFNLVDPVERNTFGVPNGGWIAIRFRADNPGVWFLHCHLEVHTTWG  534

Query  412   LKMAFLVDNGKGPNE  368
             L+MAFLV+NG+GPNE
Sbjct  535   LRMAFLVENGEGPNE  549



>ref|XP_002866298.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42557.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/521 (69%), Positives = 415/521 (80%), Gaps = 16/521 (3%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             M N T++CSSKP VTVNGKFPGPTI AREDDT+LI+VVN+V YNVSIHW       TGWA
Sbjct  1     MTNTTKLCSSKPIVTVNGKFPGPTIVAREDDTLLIKVVNHVNYNVSIHW-------TGWA  53

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCPI+PG +Y++NFT+TGQRGTL WHAHILWLR+TVHGA+VILPKLGVPYPFP
Sbjct  54    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  113

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
             KP  E  +VL+EWWKSD E +INEA K G AP+ SDAHTINGH G ++NC +Q  Y L V
Sbjct  114   KPYKEKTIVLSEWWKSDVEELINEASKIGTAPSASDAHTINGHSGSISNCPSQSSYGLPV  173

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
              AGK YMLR+INAALNEELFFKIAGH +TVVEVDA Y KP+KTDT+ IAPGQTTNV++TA
Sbjct  174   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTA  233

Query  1186  DQGSG-QYMVAASPFMDAPVAVDNQTATATLHYTG----TLASGPTTLTTAPPMNATPVA  1022
             +  +G  YMVAA+ F DA +  DN TATATLHY G      AS  T L + PP NAT VA
Sbjct  234   NANAGSNYMVAATTFTDAQIPYDNVTATATLHYIGHTATVSASKKTVLASLPPQNATWVA  293

Query  1021  NSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVM  842
               F  SLRSLNS+++PA VP TVDHSL FT GLG NPC SC   NG R+VA +NNVTF M
Sbjct  294   TKFTRSLRSLNSREYPARVPTTVDHSLFFTVGLGANPCQSCN--NGVRLVAGINNVTFTM  351

Query  841   PTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP--ANLQTTTGTKLFRLAYNSTVQL  668
             P TALLQAHFF I GVFT DFPANP   ++YT       N  T  GTKL+RL YN+TVQ+
Sbjct  352   PETALLQAHFFNISGVFTDDFPANPSNPYDYTAPVKIGVNAATMKGTKLYRLPYNATVQI  411

Query  667   VLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWV  488
             VLQ+T +I  +NHP HLHGFNFF VG+G+GNFNP+ DPK FNLVDPVERNT+G+PAGGW 
Sbjct  412   VLQNTAMILSDNHPFHLHGFNFFEVGRGMGNFNPEKDPKMFNLVDPVERNTVGVPAGGWT  471

Query  487   AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG GP+++
Sbjct  472   AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQA  512



>gb|KFK27419.1| hypothetical protein AALP_AA8G380300 [Arabis alpina]
Length=524

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/517 (69%), Positives = 414/517 (80%), Gaps = 7/517 (1%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             + + +L+   + P  V   +RHYKF+VV+ N T++CSSKP VTVNG+FPGPTI AREDDT
Sbjct  10    YVLTLLMVSFLSPITVHSMIRHYKFNVVLTNTTKLCSSKPIVTVNGQFPGPTIVAREDDT  69

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             VLI+VVN+VKYNVSIHWHGIRQLRTGWADGPAYITQCPI+PG +Y+YNFT+TGQRGTL W
Sbjct  70    VLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYIYNFTVTGQRGTLWW  129

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHILWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL+EWWKSD E +INEA K G AP
Sbjct  130   HAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLSEWWKSDVEELINEASKIGTAP  189

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
               SDAHTINGH GPV+NC +Q GY L V  GK YMLR+INAALNEELFFKIAGHK+TVVE
Sbjct  190   IASDAHTINGHSGPVSNCPSQNGYGLPVRLGKTYMLRIINAALNEELFFKIAGHKLTVVE  249

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSG-QYMVAASPFMDAPVAVDNQTATATLH  1094
             VDA Y KPFKTDT++IAPGQTTNV++TA+  +G +YMVAA+ FMDAP+  DN TATA LH
Sbjct  250   VDAVYTKPFKTDTVLIAPGQTTNVLLTANANAGSKYMVAATTFMDAPLPFDNVTATAILH  309

Query  1093  YTGTLA--SGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
             Y G     S  T L + PP NAT VA+ F+ SLRSLNS+++P  VP  +DHSL FT GLG
Sbjct  310   YIGHTVPTSKKTVLASLPPQNATWVASKFIRSLRSLNSREYPVRVPTKIDHSLSFTVGLG  369

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
              NPCPSC   NG+R+VA +NN+TF MP TALLQAHFF I  VFT DFPA P   ++YT  
Sbjct  370   ANPCPSCI--NGTRLVAGINNITFTMPKTALLQAHFFNISNVFTDDFPAKPLNPYDYTAP  427

Query  739   GP--ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
              P   N  T  GTKL+RL YN+TVQ+VLQ+T ++  ENHP HLHGFNFF VG+GLGNFNP
Sbjct  428   VPQSVNAATMKGTKLYRLPYNATVQIVLQNTAMVLSENHPFHLHGFNFFEVGRGLGNFNP  487

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGV  455
             + DPK FNLVDPVERNT+G+PAGGW AIRF ADNP V
Sbjct  488   EKDPKTFNLVDPVERNTVGVPAGGWTAIRFIADNPEV  524



>ref|XP_010924287.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=559

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/542 (64%), Positives = 425/542 (78%), Gaps = 4/542 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             I++L A  +F ++  E  +++Y+FDVV+KN++R+C +KP VTVNG+FPGPTIYARE D V
Sbjct  9     ILLLSAFLIFMSLPAEAAIKNYQFDVVLKNVSRLCHAKPIVTVNGRFPGPTIYAREGDRV  68

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             +I V NY +YN+SIHWHG++Q R GWADGPAYITQCPI+ G SY Y+F +TGQRGTL WH
Sbjct  69    VINVTNYAQYNISIHWHGLKQFRNGWADGPAYITQCPIQSGRSYTYDFNVTGQRGTLWWH  128

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AHILWLR+T+HGA+VI+PK GVPYPFP+P  EA +VL EWW +D E V  +    GL PN
Sbjct  129   AHILWLRATIHGAIVIMPKEGVPYPFPQPHAEAELVLGEWWHADVEEVEKQGNMLGLPPN  188

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
             +SDAHTING PGP+  CS +  + + VE GK Y+LR++NAALN+ELFF IAGH MT+VE+
Sbjct  189   MSDAHTINGKPGPLFPCSEKHTFAMEVEWGKTYLLRIVNAALNDELFFAIAGHSMTMVEI  248

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYT  1088
             DA Y KPF T+ IVIAPGQTT+V+V AD+  G+Y +AA PFMDAP+AVDN+TATA L Y 
Sbjct  249   DAVYCKPFTTNAIVIAPGQTTSVLVKADKNPGRYFMAARPFMDAPIAVDNRTATAILQYK  308

Query  1087  GTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPC  908
             G   +    L   P  N T   N F+D LRSLNS QFPANVP +VD  L +TA LG++PC
Sbjct  309   GIPTTIVPILPQLPAPNDTEFVNDFLDKLRSLNSPQFPANVPLSVDRHLFYTASLGVDPC  368

Query  907   PSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PA  731
             P+C   NG+R+ ASLNN+TFVMPT  LLQAH+F IKGVF  DFP  P   FNYTGA   A
Sbjct  369   PTCL--NGTRLTASLNNITFVMPTIGLLQAHYFNIKGVFRLDFPDKPATTFNYTGAPLTA  426

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T+ GT+L R+ YNSTV+LVLQDT ++APE+HP HLHG+NFF VG+G+GNF+PK DP 
Sbjct  427   NLGTSLGTRLSRIPYNSTVELVLQDTNLLAPESHPFHLHGYNFFVVGRGIGNFDPKKDPA  486

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
             K+NLVDP ERNT+G+P GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+V+NG G  
Sbjct  487   KYNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTTWGLKMAFVVENGNGTE  546

Query  370   ES  365
             +S
Sbjct  547   QS  548



>gb|AAK37829.1|AF132125_1 laccase [Pinus taeda]
Length=555

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/539 (64%), Positives = 422/539 (78%), Gaps = 7/539 (1%)
 Frame = -3

Query  1972  LACCMFPAI---VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLI  1802
             ++C +   +   VE   RHYKFD+  KN+TR+C ++P VT NGKFPGPTI+ARE DTV +
Sbjct  10    MSCLLIAVVALNVEAETRHYKFDIKFKNVTRLCHTEPIVTANGKFPGPTIHAREGDTVTV  69

Query  1801  RVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAH  1622
             +V N+V YNVSIHWHGIRQLRTGWADGPAYITQCPI+ G +++YNFTITGQRGTL WHAH
Sbjct  70    KVTNHVTYNVSIHWHGIRQLRTGWADGPAYITQCPIQTGQTFVYNFTITGQRGTLFWHAH  129

Query  1621  ILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVS  1442
             ILWLR+T++G +VILP  G PYPFPKP  E +++L EWW SDTE VIN+A+ SGLAPN S
Sbjct  130   ILWLRATLYGPIVILPPKG-PYPFPKPHKEVILILGEWWNSDTETVINQAMNSGLAPNSS  188

Query  1441  DAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDA  1262
             D+HTING  GP+  C T+  + LSVE  K Y+LR+I A LN+E+FF +A H +TVVEVDA
Sbjct  189   DSHTINGKAGPLFYCPTKDTFALSVEPDKTYLLRIIKA-LNQEVFFGVANHHLTVVEVDA  247

Query  1261  TYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGT  1082
              Y KPF+T  IV APGQTTN ++  D+ +G+Y +AA  FMDAP+AVDN+TATA L YTG+
Sbjct  248   VYTKPFETKAIVSAPGQTTNALLHTDKKAGRYFMAARVFMDAPIAVDNKTATAILQYTGS  307

Query  1081  LASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPS  902
               S    +   P +N T  +++F ++L+SLNS Q+PA VPQ++D +L FT GL +N CP+
Sbjct  308   SNSLNPVMPLIPALNDTAFSSNFSNALKSLNSPQYPAKVPQSIDRNLFFTVGLALNACPT  367

Query  901   CKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGPANLQ  722
             C   NG+R  AS+NN++F MPT ALLQ+H+F I GVFTTDFP NPP  FNYTG  P NLQ
Sbjct  368   CI--NGARPAASVNNISFTMPTIALLQSHYFNISGVFTTDFPDNPPATFNYTGTPPKNLQ  425

Query  721   TTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFN  542
             ++ GT+L R+ +NSTVQLVLQDT  +  ENHP+HLHGFNFF VG+G GN+NPK DP KFN
Sbjct  426   SSNGTRLSRIPFNSTVQLVLQDTSALTVENHPVHLHGFNFFIVGRGFGNYNPKKDPAKFN  485

Query  541   LVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             LVDP ERNT+G+P GGW  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NG GP +S
Sbjct  486   LVDPPERNTVGVPTGGWTVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGHGPEQS  544



>gb|AAK37830.1|AF132126_1 laccase [Pinus taeda]
Length=577

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/544 (64%), Positives = 416/544 (76%), Gaps = 8/544 (1%)
 Frame = -3

Query  1978  VLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIR  1799
             +L+A  + PA V+   RHYKF++ +KN+TR+C +KP VTVNG+FPGPTI ARE DT+LI+
Sbjct  25    MLIAMFLLPAAVQGETRHYKFNIQLKNVTRICRTKPIVTVNGEFPGPTIEAREGDTLLIK  84

Query  1798  VVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHI  1619
             V N+VKYNVSIHWHG+RQLRTGWADGPAYITQCPI+ G +Y+YNFT+TGQRGTL WHAHI
Sbjct  85    VTNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQTGQTYVYNFTVTGQRGTLWWHAHI  144

Query  1618  LWLRSTVHGALVILPKLGVPYPF-PKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVS  1442
             LWLR+T++GA+VILP   VPYPF PKP  E  +VL EWW +D EAVINEAL++G APN+S
Sbjct  145   LWLRATLYGAIVILPPPNVPYPFEPKPHKEITLVLGEWWNADVEAVINEALQTGAAPNIS  204

Query  1441  DAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDA  1262
             DAHTING PG +  C  +  + L VE GK Y+LR++NAALN+ELFF++A H + VVEVDA
Sbjct  205   DAHTINGKPGEIFKCPVKDTFTLPVEHGKVYLLRIVNAALNDELFFEVANHLVKVVEVDA  264

Query  1261  TYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGT  1082
              Y KPF T  IVIAPGQTTNV++ A++ SG Y VAA PFMDAPV V+N+TATA LHY   
Sbjct  265   VYTKPFDTKAIVIAPGQTTNVLLEANKRSGSYFVAARPFMDAPVTVNNKTATAILHYISR  324

Query  1081  LASGPT-----TLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGI  917
              +          +   P +N T  A SF   LRSLNS QFPA VPQT+D +L F  GL  
Sbjct  325   NSESDIPAVNPLMPRLPLLNDTAFATSFTSKLRSLNSVQFPAKVPQTIDRNLFFAVGLAT  384

Query  916   NPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG  737
               C +C  G   R  AS+NN++FVMP+ +LL AH F I GVFT DFP  PP  FNYTG  
Sbjct  385   ESCQTCNGG--LRASASINNISFVMPSISLLDAHIFNISGVFTADFPDKPPTPFNYTGTP  442

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
             P NL T+ GT+L RL +NSTVQLVLQDT ++  ENHPIHLHGFNFF VG+G GN++P TD
Sbjct  443   PKNLITSKGTRLSRLPFNSTVQLVLQDTSVLTVENHPIHLHGFNFFIVGRGFGNYDPNTD  502

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P  FNLVDP ERNT+G+P GGW  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLV+NG G
Sbjct  503   PASFNLVDPPERNTVGVPTGGWTVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGDG  562

Query  376   PNES  365
             P++S
Sbjct  563   PDQS  566



>ref|NP_200699.1| laccase 16 [Arabidopsis thaliana]
 gb|AED97116.1| laccase 16 [Arabidopsis thaliana]
Length=523

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/521 (69%), Positives = 413/521 (79%), Gaps = 16/521 (3%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             M N T++CSSKP VTVNG+FPGPTI ARE DT+LI+VVN+VKYNVSIHW       TGWA
Sbjct  1     MTNTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYNVSIHW-------TGWA  53

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCPI+PG +Y++NFT+TGQRGTL WHAHILWLR+TVHGA+VILPKLGVPYPFP
Sbjct  54    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  113

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
             KP  E  +VL+EWWKSD E +INEA + G AP+ SDAHTINGH G ++NC +Q  Y L V
Sbjct  114   KPYKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPV  173

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
              AGK YMLR+INAALNEELFFKIAGH +TVVEVDA Y KP+KTDT+ IAPGQTTNV++TA
Sbjct  174   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTA  233

Query  1186  DQGSGQ-YMVAASPFMDAPVAVDNQTATATLHYTGTLA----SGPTTLTTAPPMNATPVA  1022
             +  +G  YMVAA+ F DA +  DN TATATLHY G  +    S  T L + PP NAT VA
Sbjct  234   NANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVA  293

Query  1021  NSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVM  842
               F  SLRSLNS ++PA VP TV+HSL FT GLG NPC SC   NG R+VA +NNVTF M
Sbjct  294   TKFTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCN--NGVRLVAGINNVTFTM  351

Query  841   PTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAGP--ANLQTTTGTKLFRLAYNSTVQL  668
             P TALLQAHFF I GVFT DFPA P   ++YT       N  T  GTKL+RL YN+TVQ+
Sbjct  352   PKTALLQAHFFNISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQI  411

Query  667   VLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWV  488
             VLQ+T +I  +NHP HLHGFNFF VG+GLGNFNP+ DPK FNLVDPVERNT+G+PAGGW 
Sbjct  412   VLQNTAMILSDNHPFHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWT  471

Query  487   AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  472   AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQS  512



>ref|XP_009146739.1| PREDICTED: laccase-22-like [Brassica rapa]
Length=560

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/530 (63%), Positives = 418/530 (79%), Gaps = 7/530 (1%)
 Frame = -3

Query  1942  ECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIH  1763
             E  +RHYKF+VVMKNMT++CS+KP VT+NGKFPGPT+YAREDD V++ + N V YNV+IH
Sbjct  21    EANIRHYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNSVSYNVTIH  80

Query  1762  WHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALV  1583
             WHG++QLRTGW+DGPAYITQCP++PG +++YNFT+TGQRGTLLWHAHI WLR+TVHGA+V
Sbjct  81    WHGVKQLRTGWSDGPAYITQCPVQPGGNFIYNFTLTGQRGTLLWHAHISWLRATVHGAIV  140

Query  1582  ILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVA  1403
             ILPK GVPYPFP+P  + V+V  EWWKSD E VI ++ +SGL PN+SDAHTING  GP+ 
Sbjct  141   ILPKRGVPYPFPRPHTDKVIVFGEWWKSDVEDVIKQSTQSGLPPNLSDAHTINGLTGPIT  200

Query  1402  NCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVI  1223
              C+   GY + VE GK Y+LR+INAA+N+ELFFKIA H +TVVEVDA+Y KP+ T+T+ +
Sbjct  201   GCNNSHGYTIHVETGKSYLLRIINAAVNDELFFKIAQHNLTVVEVDASYTKPYNTETLFL  260

Query  1222  APGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPP  1043
              PGQT N ++TA+  +G +++  SPFMD  V VDN TATA L Y  T  +   T++  PP
Sbjct  261   GPGQTANAVLTANHPTGNFLMTISPFMDTVVPVDNATATAFLRYKNTTTTDSLTMSNTPP  320

Query  1042  MNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASL  863
             +NAT +A +F DSLRSLNS ++P NVP  +DHSL F  G+G+NPC +C   NG++ +A +
Sbjct  321   INATSIAQNFSDSLRSLNSLKYPTNVPLKIDHSLFFAIGVGVNPCATCI--NGTKTIADI  378

Query  862   NNVTFVMPTTALLQAHFFG-IKGVFTTDFPANPPFAFNYTGAGP----ANLQTTTGTKLF  698
             NNVTFVMP  ALLQAH+F   +GVFT DFP  P   F+YTG       +NLQT  GT+++
Sbjct  379   NNVTFVMPAMALLQAHYFNKSQGVFTNDFPGRPLTPFDYTGGNNSIPLSNLQTKNGTQVY  438

Query  697   RLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERN  518
             RL +N+TVQ+V+Q T +IAPE+HP HLHG NFF VGKGLGNF+P  DPKKFNLVDPVERN
Sbjct  439   RLEFNATVQIVIQGTSVIAPESHPTHLHGSNFFVVGKGLGNFDPLMDPKKFNLVDPVERN  498

Query  517   TIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             T+ +P  GW AIRF ADNPGVWF HCHLEVHT+WGLKMAFLV++GK  NE
Sbjct  499   TVSVPTAGWTAIRFIADNPGVWFFHCHLEVHTSWGLKMAFLVEDGKYSNE  548



>ref|XP_006401026.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
 gb|ESQ42479.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
Length=512

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/520 (69%), Positives = 413/520 (79%), Gaps = 25/520 (5%)
 Frame = -3

Query  1906  MKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWA  1727
             M N T++CSSKP VTVNG+FPGPTI AREDDTVLI+VVN+VKYNVSIHWHGIRQLRTGWA
Sbjct  1     MTNTTKLCSSKPIVTVNGQFPGPTIVAREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWA  60

Query  1726  DGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFP  1547
             DGPAYITQCPI+PG +Y+YNFT+TGQRGTL WHAHILWLR+TVHGA+VILPKLGV YPFP
Sbjct  61    DGPAYITQCPIQPGQNYIYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVTYPFP  120

Query  1546  KPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSV  1367
             KP  E  +VL EWWKSD E +IN+A + G AP  SDAHTINGH GP++NC +Q GY L V
Sbjct  121   KPYKEKTIVLGEWWKSDVEQLINDASRIGTAPIASDAHTINGHSGPISNCPSQRGYNLPV  180

Query  1366  EAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTA  1187
               GK YMLR+INAALNE+LFFKIAGH++TVVEVDA Y KPFKTDT++IAPGQTTNV++TA
Sbjct  181   RPGKTYMLRIINAALNEDLFFKIAGHELTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLTA  240

Query  1186  DQGSG-QYMVAASPFMDAPVAVDNQTATATLHYTGTL---ASGPTTLTTAPPMNATPVAN  1019
             +  +G +YMVAA+ FMDAP+  DN TATATLHY G     AS  T L + PP NAT VA 
Sbjct  241   NANAGSKYMVAATTFMDAPILFDNVTATATLHYIGNTTVPASKKTVLASLPPQNATWVAT  300

Query  1018  SFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMP  839
              F  SLRSLNS+++PA VP TV+HSLLFT GLG NPC SC   NG R+VA +NNVTF MP
Sbjct  301   RFTRSLRSLNSREYPARVPTTVEHSLLFTVGLGANPCRSCI--NGVRLVAGINNVTFTMP  358

Query  838   TTALLQAHFFGIKGVFTTDFPANPPFAFNYTG--AGPANLQTTTGTKLFRLAYNSTVQLV  665
             +TALLQAHFF I  VFT DFPA P   +NYT       N  T  GTKL+RL YN+TVQ+V
Sbjct  359   STALLQAHFFNIPHVFTDDFPARPLNPYNYTAPVTQSVNAATMKGTKLYRLPYNATVQVV  418

Query  664   LQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVA  485
             LQ+T +                 VG+GLG+F+P+ DPK FNLVDPVERNT+G+PAGGW A
Sbjct  419   LQNTAM-----------------VGRGLGDFDPEKDPKVFNLVDPVERNTVGVPAGGWTA  461

Query  484   IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             IRF ADNPGVWFMHCHLE+HT+WGLKMAF+VDNG GP++S
Sbjct  462   IRFLADNPGVWFMHCHLEIHTSWGLKMAFVVDNGHGPDQS  501



>gb|KDP41783.1| hypothetical protein JCGZ_26801 [Jatropha curcas]
Length=840

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/533 (64%), Positives = 418/533 (78%), Gaps = 3/533 (1%)
 Frame = -3

Query  1960  MFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVK  1781
             +  + VE  V+ Y+FD+ +KN++R+C +KP VTVNG+FPGPTIYARE D VLI V N+ +
Sbjct  299   LLTSFVEADVKKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYAREGDRVLINVTNHAQ  358

Query  1780  YNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRST  1601
             YN+SIHWHG++Q R GWADGPAYITQCPI+ G+SY Y+F ITGQRGTL WHAHI WLR+T
Sbjct  359   YNMSIHWHGLKQFRNGWADGPAYITQCPIKTGNSYTYDFNITGQRGTLWWHAHIFWLRAT  418

Query  1600  VHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  1421
             V+GA+VI+P+LG P+PFP+P+ E V++L EWW +D E ++N+  K GL PN SDAHTING
Sbjct  419   VYGAIVIMPQLGTPFPFPQPEREEVLLLGEWWNNDVEQLVNQGNKLGLPPNASDAHTING  478

Query  1420  HPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFK  1241
              PGP+  CS +  + + VE GK Y+LR+INAALN+ELFF +AGH +TVVE+DA Y KPF 
Sbjct  479   KPGPLFPCSEKHTFAMEVEQGKTYLLRIINAALNDELFFAVAGHNLTVVEIDAVYTKPFT  538

Query  1240  TDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTT  1061
             T  I+IAPGQTT+V++ A Q  G+Y +AA PFMDAP+++DN+TATA L Y G   +    
Sbjct  539   TQAILIAPGQTTSVLIQATQSPGRYFMAARPFMDAPISIDNKTATAILQYKGIPNTILPI  598

Query  1060  LTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGS  881
             L   P  N T  A  +   LRSLNSKQFPANVP  VD  LLFTAGLGIN CPSC   NG+
Sbjct  599   LPQLPSPNDTAFALDYNSKLRSLNSKQFPANVPLKVDRHLLFTAGLGINACPSCL--NGT  656

Query  880   RVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTK  704
             ++ ASLNN+TFVMP   LLQAH+F IKGVF TDFP NPP  FNYTGA   ANL TT GT+
Sbjct  657   KLTASLNNITFVMPQIGLLQAHYFKIKGVFRTDFPDNPPTPFNYTGAPLTANLGTTLGTR  716

Query  703   LFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVE  524
             L ++AYNSTVQLVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP KFNLVDP E
Sbjct  717   LSKIAYNSTVQLVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPKKDPAKFNLVDPPE  776

Query  523   RNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             RNT+G+P GGW A+RFRADNPGVWFMHCHLE+HT+WGLK AF+V+NG GP+ES
Sbjct  777   RNTVGVPTGGWTAVRFRADNPGVWFMHCHLELHTSWGLKTAFVVENGNGPDES  829



>ref|XP_010486777.1| PREDICTED: laccase-22-like isoform X1 [Camelina sativa]
Length=554

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/547 (63%), Positives = 427/547 (78%), Gaps = 6/547 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M  S  RI++LL       + E  +R YKF+VVMKNMT++CS+KP VT+NGKFPGPT+YA
Sbjct  1     MATSCARILLLLVFLSLQYLAEANIRRYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDD V++ + N V YNV+IHWHG++QLRTGW+DGPAYITQCP++PG +++YNFT+TGQR
Sbjct  61    REDDNVIVNLTNNVNYNVTIHWHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLR+TVHGA+VILPK GVPYPFP+P  E ++V  EWW SD EAVI+++ +
Sbjct  121   GTLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTERIIVFGEWWNSDVEAVISQSTQ  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGL PN+SDAHTING  G V  C ++ GY L VE GK+Y+LR+INAA+N+ELFFKIAGH 
Sbjct  181   SGLPPNISDAHTINGLTGQVPGCKSR-GYTLHVETGKKYLLRIINAAVNDELFFKIAGHN  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDATY+KPF T+T+ + PGQTTN I+TA+   G +++  SPFMD  V V+N TAT
Sbjct  240   LTVVEVDATYIKPFDTETLFLGPGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTAT  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             A L Y  T      + +  PP+NAT +A  F DSLRSLNS  +P NVP  VDHSL F  G
Sbjct  300   AFLRYKDTRTQALKS-SKIPPVNATSIALGFSDSLRSLNSPDYPTNVPLKVDHSLFFAIG  358

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFG-IKGVFTTDFPANPPFAFNY  749
             +G+NPC +C   NG++ +A +NNV+FVMPT A+LQAH+F   +GVFT DFP  P   FNY
Sbjct  359   VGVNPCATCI--NGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVFTDDFPGKPSTPFNY  416

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG G +NL+T  GTK++RL +N+TVQ+++Q T +IAPE+HP HLHG NFF +GKGLGNF+
Sbjct  417   TG-GLSNLRTENGTKVYRLEFNATVQVIIQGTSVIAPESHPTHLHGSNFFVIGKGLGNFD  475

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             P  D KKFNLVDPVERNT+ +P  GW AIRF ADNPGVWF HCHLEVHT+WGLKMAFLV+
Sbjct  476   PLKDTKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFHCHLEVHTSWGLKMAFLVE  535

Query  388   NGKGPNE  368
             +G G NE
Sbjct  536   DGNGSNE  542



>ref|XP_010494695.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/547 (61%), Positives = 428/547 (78%), Gaps = 6/547 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M  S  RI++LL       + +  +R Y+F+VVMKNMT++CS+KP VT+NGKFPGP +YA
Sbjct  1     MAKSCARILLLLVFISLQYLADANIRRYRFNVVMKNMTKLCSTKPIVTINGKFPGPALYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDD V++ ++N V YN++IHWHG++QLRTGW+DGPAYITQCP++PG +++YNFT+TGQR
Sbjct  61    REDDNVIVNLINNVNYNITIHWHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLR+TVHGA+VILPK GV YPFP+P  E ++V  EWW SD EAVI+++ +
Sbjct  121   GTLLWHAHISWLRATVHGAIVILPKRGVLYPFPRPHTERIIVFGEWWNSDVEAVISQSTQ  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGL PN+SDAHTING  G V +C ++ GY L+VE GK+Y+LR+INAA+N+ELFFKI GH 
Sbjct  181   SGLPPNISDAHTINGLIGQVPSCKSR-GYTLNVETGKKYLLRIINAAVNDELFFKITGHN  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDA+Y KPF T+T+ + PGQTTN I+TA+   G +++  SPFMD  V V+N TAT
Sbjct  240   LTVVEVDASYTKPFDTETLFLGPGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTAT  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             A L Y  T      + +  PP+NAT +A  F DSLRSLNS+ +P NVP  VDHSL F  G
Sbjct  300   AFLRYKDTRTQVLKS-SKIPPVNATSIALGFSDSLRSLNSQDYPTNVPLKVDHSLFFAIG  358

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFG-IKGVFTTDFPANPPFAFNY  749
             +G+NPC +C   NG++ +A +NNV+FVMPT A+LQAH+F   +GVFT DFP  P   FNY
Sbjct  359   VGVNPCATCI--NGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVFTDDFPGKPSTPFNY  416

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG G +NL+T  GTK++RL +N+TVQ+++Q T +IAPE+HP HLHG NFF +GKGLGNF+
Sbjct  417   TG-GLSNLRTENGTKVYRLEFNATVQVIIQGTSVIAPESHPTHLHGSNFFVIGKGLGNFD  475

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             P  DPKKFNLVDPVERNT+ +P  GW AIRF ADNPGVWF HCHLEVHT+WGLKMAFLV+
Sbjct  476   PLKDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFHCHLEVHTSWGLKMAFLVE  535

Query  388   NGKGPNE  368
             +G G NE
Sbjct  536   DGNGSNE  542



>emb|CDY01010.1| BnaC05g41900D [Brassica napus]
Length=559

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/531 (64%), Positives = 419/531 (79%), Gaps = 8/531 (2%)
 Frame = -3

Query  1942  ECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIH  1763
             E  +RHYKF+VVMKNMT++CS+KP VT+NGKFPGPT+YAREDD V++ + N V YNV+IH
Sbjct  21    EANIRHYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVSYNVTIH  80

Query  1762  WHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALV  1583
             WHG++QLRTGW+DGPAYITQCP++PG +++YNFT+TGQRGTLLWHAHI WLR+TVHGA+V
Sbjct  81    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  140

Query  1582  ILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVA  1403
             ILPK GVPYPFP+P  + ++V  EWWKSD E VI ++ +SGL PN+SDAHTING  GP+ 
Sbjct  141   ILPKRGVPYPFPRPHTDKIIVFGEWWKSDVEDVIKQSTQSGLPPNLSDAHTINGLTGPIT  200

Query  1402  NCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVI  1223
              C+   GY + VE GK Y+LR+INAA+N+ELFFKIA H +TVVEVDA+Y KPF T+T+ +
Sbjct  201   GCNNSHGYTIHVETGKSYLLRIINAAVNDELFFKIAQHNLTVVEVDASYTKPFNTETLFL  260

Query  1222  APGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPP  1043
              PGQT N I+TA+  +G +++  SPFMD  V V+N TATA L Y  T      TL+  PP
Sbjct  261   GPGQTANAILTANHPTGNFLMTISPFMDTVVPVNNATATAFLRYKTTTTQS-LTLSKIPP  319

Query  1042  MNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASL  863
             +NAT +A +F D+LRSLNS+ +P NVP  VDHSL F  G+G+NPC +C   NG++ +A +
Sbjct  320   INATSIAQNFSDALRSLNSRDYPTNVPLKVDHSLFFAIGVGVNPCATCI--NGTKNIADI  377

Query  862   NNVTFVMPTTALLQAHFFG-IKGVFTTDFPANPPFAFNYTGAGP----ANLQTTTGTKLF  698
             NNVTFVMPT ALLQAH+F   KGVFT DFP  P   F+YTG       +NLQT  GT+++
Sbjct  378   NNVTFVMPTMALLQAHYFNKSKGVFTDDFPGRPLTPFDYTGGNKSIPLSNLQTKNGTQVY  437

Query  697   RLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERN  518
             RL +N+TVQ+V+Q T +IAPE+HP HLHG NFF VGKGLGNF+P  DPKKFNLVDPVERN
Sbjct  438   RLEFNATVQIVIQGTSVIAPESHPTHLHGSNFFVVGKGLGNFDPLMDPKKFNLVDPVERN  497

Query  517   TIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             T+ +P  GW AIRF ADNPGVWF HCHLEVHT+WGLKMAFLV++GKG NE 
Sbjct  498   TVSVPTAGWTAIRFIADNPGVWFFHCHLEVHTSWGLKMAFLVEDGKGSNEK  548



>ref|XP_010486778.1| PREDICTED: laccase-22-like isoform X2 [Camelina sativa]
Length=565

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/557 (61%), Positives = 427/557 (77%), Gaps = 15/557 (3%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M  S  RI++LL       + E  +R YKF+VVMKNMT++CS+KP VT+NGKFPGPT+YA
Sbjct  1     MATSCARILLLLVFLSLQYLAEANIRRYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDD V++ + N V YNV+IHWHG++QLRTGW+DGPAYITQCP++PG +++YNFT+TGQR
Sbjct  61    REDDNVIVNLTNNVNYNVTIHWHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLR+TVHGA+VILPK GVPYPFP+P  E ++V  EWW SD EAVI+++ +
Sbjct  121   GTLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTERIIVFGEWWNSDVEAVISQSTQ  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGL PN+SDAHTING  G V  C ++ GY L VE GK+Y+LR+INAA+N+ELFFKIAGH 
Sbjct  181   SGLPPNISDAHTINGLTGQVPGCKSR-GYTLHVETGKKYLLRIINAAVNDELFFKIAGHN  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDATY+KPF T+T+ + PGQTTN I+TA+   G +++  SPFMD  V V+N TAT
Sbjct  240   LTVVEVDATYIKPFDTETLFLGPGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTAT  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             A L Y  T      + +  PP+NAT +A  F DSLRSLNS  +P NVP  VDHSL F  G
Sbjct  300   AFLRYKDTRTQALKS-SKIPPVNATSIALGFSDSLRSLNSPDYPTNVPLKVDHSLFFAIG  358

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFG-IKGVFTTDFPANPPFAFNY  749
             +G+NPC +C   NG++ +A +NNV+FVMPT A+LQAH+F   +GVFT DFP  P   FNY
Sbjct  359   VGVNPCATCI--NGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVFTDDFPGKPSTPFNY  416

Query  748   TGAGP----------ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFF  599
             TG  P          +NL+T  GTK++RL +N+TVQ+++Q T +IAPE+HP HLHG NFF
Sbjct  417   TGGKPSTPFNYTGGLSNLRTENGTKVYRLEFNATVQVIIQGTSVIAPESHPTHLHGSNFF  476

Query  598   AVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTT  419
              +GKGLGNF+P  D KKFNLVDPVERNT+ +P  GW AIRF ADNPGVWF HCHLEVHT+
Sbjct  477   VIGKGLGNFDPLKDTKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFHCHLEVHTS  536

Query  418   WGLKMAFLVDNGKGPNE  368
             WGLKMAFLV++G G NE
Sbjct  537   WGLKMAFLVEDGNGSNE  553



>ref|XP_010464832.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/547 (62%), Positives = 424/547 (78%), Gaps = 6/547 (1%)
 Frame = -3

Query  2005  MECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYA  1826
             M  S  RI++LL       + E  +R YKF+VVMKNMT++CS+KP VT+NGKFPGPT+YA
Sbjct  1     MASSCARILLLLVFLSLQYLAEANIRRYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYA  60

Query  1825  REDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQR  1646
             REDD V++ + N V YN++IHWHG++QLRTGW+DGPAYITQCP++PG +++YNFT+TGQR
Sbjct  61    REDDNVIVNLTNNVNYNITIHWHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQR  120

Query  1645  GTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALK  1466
             GTLLWHAHI WLR+TVHGA+VILPK GVPYPFP+P  E ++V  EWW SD EAVI+++ +
Sbjct  121   GTLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTEKIIVFGEWWNSDVEAVISQSTQ  180

Query  1465  SGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHK  1286
             SGL PN+SD HTING  G V  C ++ GY L VE GK+Y+LR+INAA+N+ELFFKI GH 
Sbjct  181   SGLPPNISDGHTINGLTGQVPGCKSR-GYTLHVETGKKYLLRIINAAVNDELFFKITGHN  239

Query  1285  MTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTAT  1106
             +TVVEVDATY KPF T+T+ + PGQTTN I+TA+   G +++  SPFMD  V V+N TAT
Sbjct  240   LTVVEVDATYTKPFDTETLFLGPGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTAT  299

Query  1105  ATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAG  926
             A L Y  T      + +  PP+NAT +A  F DSLRSLNS  +P NVP  VDHSL F  G
Sbjct  300   AILRYKYTRTQSLKS-SKIPPVNATSIALGFSDSLRSLNSPDYPTNVPLKVDHSLFFAIG  358

Query  925   LGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFG-IKGVFTTDFPANPPFAFNY  749
             +G+NPC +C   NG++ +A +NNV+FVMPT A+LQAH+F   +GVFT DFP  P   FNY
Sbjct  359   VGVNPCATCI--NGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVFTDDFPGRPSTPFNY  416

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG G +NLQT  GTK++RL +N+TVQ+++Q T +IAPE+HP HLHG NFF +GKGLGNF+
Sbjct  417   TG-GLSNLQTKNGTKVYRLQFNATVQVIIQGTSVIAPESHPTHLHGSNFFVIGKGLGNFD  475

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
             P  DPKKFNLVDPVERNT+ +P  GW AIRF ADNPGVWF HCHLEVHT+WGLKMAFLV+
Sbjct  476   PIKDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFHCHLEVHTSWGLKMAFLVE  535

Query  388   NGKGPNE  368
             +G   NE
Sbjct  536   DGNDSNE  542



>dbj|BAN10308.1| laccase [Chamaecyparis obtusa]
Length=555

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/548 (62%), Positives = 412/548 (75%), Gaps = 4/548 (1%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIY  1829
             M+      +VVLL      +I E +   YKFD+ +KN++R+C +KP VTVNG+FPGPTIY
Sbjct  1     MLASGCMFVVVLLLVTA--SIAEGKTNTYKFDIQLKNVSRMCQAKPIVTVNGQFPGPTIY  58

Query  1828  AREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQ  1649
             ARE DTVLI V N+VKYN+SIHWHGIRQLRTGWADGPAYITQCPI+   S++YNFTITGQ
Sbjct  59    AREGDTVLINVTNHVKYNMSIHWHGIRQLRTGWADGPAYITQCPIQTRQSFVYNFTITGQ  118

Query  1648  RGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAL  1469
             RGTLL+HAHILWLR+T+HG +VILPK  VPYPFPKP  E  +VL EWW +DTEAVIN+A+
Sbjct  119   RGTLLYHAHILWLRATLHGPIVILPKKHVPYPFPKPHKEVTLVLGEWWNADTEAVINQAM  178

Query  1468  KSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGH  1289
             K+G APN S+AHTING PGP+ NCST+  + L+VE  K Y+LR+INAALN+++FF I  H
Sbjct  179   KTGGAPNASNAHTINGKPGPLFNCSTKDTHALAVEPDKTYLLRIINAALNDQVFFSIGNH  238

Query  1288  KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTA  1109
              + VVEVDA Y KPF+T  I I+PGQTTNV++   + +G+Y +    FMDAP+ VDN T+
Sbjct  239   HLKVVEVDAVYTKPFETKAIAISPGQTTNVLLDTSKKTGRYFMTVRAFMDAPIPVDNLTS  298

Query  1108  TATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTA  929
                L Y GT  +    +   P +N T    +F  S++SLNS  +PA VPQTVD +L F  
Sbjct  299   AGILQYIGTSNTSNPIMPVIPKINDTAFYTNFSSSIKSLNSALYPAKVPQTVDRNLFFAM  358

Query  928   GLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  749
             GL ++ C +C   NGSR  AS+NNV+FVMPT ALLQAH   I GVFT DFP NPP  FNY
Sbjct  359   GLALDKCSTCV--NGSRASASINNVSFVMPTIALLQAHVNNISGVFTKDFPDNPPTPFNY  416

Query  748   TGAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFN  569
             TG  P NL T+ GT+   L YNSTVQLVLQDT I+  +NHP+HLHGFNFF VG G GN+N
Sbjct  417   TGTPPKNLFTSKGTRATSLTYNSTVQLVLQDTSILTVDNHPVHLHGFNFFIVGTGFGNYN  476

Query  568   PKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  389
              KTDP  FNLVDP ERNT+G+P GGW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+V+
Sbjct  477   SKTDPANFNLVDPAERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVE  536

Query  388   NGKGPNES  365
             NG G  +S
Sbjct  537   NGNGAEQS  544



>ref|XP_006300062.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
 gb|EOA32960.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
Length=548

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/547 (62%), Positives = 422/547 (77%), Gaps = 14/547 (3%)
 Frame = -3

Query  2002  ECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAR  1823
              C+   ++V L+      + E  +R YKF+VVMKN+T++CS+KP VT+NGKFPGPT+YAR
Sbjct  4     SCATILLIVFLS---LQYLAEANIRRYKFNVVMKNITKLCSTKPIVTINGKFPGPTLYAR  60

Query  1822  EDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRG  1643
             EDD V++ + N V YNV+IHWHG++QLRTGW+DGPAYITQCP++PG +++YNFT+TGQRG
Sbjct  61    EDDNVIVNLTNNVNYNVTIHWHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRG  120

Query  1642  TLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKS  1463
             TLLWHAHI WLR+TVHGA+VILPK GVPYPFP+P  E ++V  EWWKSD EAVIN++ +S
Sbjct  121   TLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTEKIIVFGEWWKSDVEAVINQSTQS  180

Query  1462  GLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             GL PN+SDAHTING  G       + GY L V+ GK+Y+LR+INAA+N+ELFFKIAGH  
Sbjct  181   GLPPNISDAHTINGLTG-------RSGYTLHVKTGKKYLLRIINAAVNDELFFKIAGHNF  233

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATA  1103
             TVVEVDA+Y KPF TDT+ + PGQTTN I+TA    G +++  SPFMD  V V+N T TA
Sbjct  234   TVVEVDASYTKPFNTDTLFLGPGQTTNAILTATHPPGNFLMTISPFMDTVVPVNNATGTA  293

Query  1102  TLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
              L Y  T  +   T +  PP+NAT +A  F DSLRSLNS  +P  VP  +DHSL FT G+
Sbjct  294   LLRYKDTTTTQSLTSSKIPPINATSIALGFSDSLRSLNSPDYPTKVPLKIDHSLFFTIGV  353

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFG-IKGVFTTDFPANPPFAFNYT  746
             G+NPC +C   NG++ +A +NNV+FVMPT A+LQAH+F   +GVFT DFP  P   FNYT
Sbjct  354   GVNPCTTCI--NGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVFTDDFPGRPLTPFNYT  411

Query  745   GAGPANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             G G  NL+T  GTK++RL +NSTVQ+++Q T +IAPE+HP HLHG NFF VGKGLGNF+P
Sbjct  412   G-GLNNLRTKKGTKVYRLEFNSTVQVIIQGTSVIAPESHPTHLHGSNFFVVGKGLGNFDP  470

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
               DPKKFNL+DPVERNT+ +P  GW AIRFRADNPGVWF HCHLEVHT+WGLKMAFLV++
Sbjct  471   LEDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFFHCHLEVHTSWGLKMAFLVED  530

Query  385   GKGPNES  365
             GK  NE 
Sbjct  531   GKSSNEK  537



>ref|XP_003632636.1| PREDICTED: laccase-11 [Vitis vinifera]
 emb|CBI32739.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/527 (64%), Positives = 410/527 (78%), Gaps = 3/527 (1%)
 Frame = -3

Query  1942  ECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIH  1763
             +  V+ Y+FD+ +KN++R+C +KP VTVNG FPGPTIY RE D VL+ V N+ +YN+SIH
Sbjct  27    DAAVKKYQFDIQVKNVSRLCHAKPIVTVNGMFPGPTIYVREGDQVLVNVTNHAQYNISIH  86

Query  1762  WHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALV  1583
             WHG++Q R GWADGPAYITQCPI+ GHSY YNF ++GQRGTL WHAHILWLR+TV+GA+V
Sbjct  87    WHGLKQFRNGWADGPAYITQCPIKTGHSYTYNFQVSGQRGTLWWHAHILWLRATVYGAIV  146

Query  1582  ILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVA  1403
             I+PK G P+PFP+P  EA +VL EWW SD E ++N+A K GL P +SDAHTING PGP+ 
Sbjct  147   IMPKQGTPFPFPQPYFEANIVLGEWWSSDVETIVNQANKLGLPPPMSDAHTINGKPGPLF  206

Query  1402  NCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVI  1223
              CS +  + + VE+GK Y+LR++NAALN+ELFF IAGH MTVVE+DA Y KPF T  ++I
Sbjct  207   PCSEKHTFAMEVESGKTYLLRIVNAALNDELFFAIAGHNMTVVEIDAVYTKPFTTQALLI  266

Query  1222  APGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPP  1043
             APGQTTNV+V ADQ   +Y +A  PFMDAPV VDN+TATA L Y G   +   TL   P 
Sbjct  267   APGQTTNVLVKADQSPSRYFMAVRPFMDAPVPVDNKTATAILQYKGIPNTVLPTLAQLPA  326

Query  1042  MNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASL  863
              N T  A S+   L+SLN+ QFPANVP  VD  L +T GLG NPCP+C+  NG+++ ASL
Sbjct  327   PNDTNFALSYNSKLKSLNTPQFPANVPLQVDRHLFYTIGLGQNPCPTCQ--NGTQLTASL  384

Query  862   NNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKLFRLAY  686
             NN+TFVMP  ALLQAH+F IKGVF TDFP  P   FNYTGA   ANL T+ GT+L +LA+
Sbjct  385   NNITFVMPKVALLQAHYFNIKGVFRTDFPDRPLAPFNYTGAPLTANLGTSLGTRLSKLAF  444

Query  685   NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGI  506
             NST++LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP KFNL+DP ERNT+G+
Sbjct  445   NSTIELVLQDTNLLTVESHPFHLHGYNFFVVGNGIGNFDPKKDPAKFNLIDPPERNTVGV  504

Query  505   PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             P GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NGK P ES
Sbjct  505   PTGGWTAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSPEES  551



>ref|XP_009392410.1| PREDICTED: laccase-11 [Musa acuminata subsp. malaccensis]
Length=559

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/542 (61%), Positives = 412/542 (76%), Gaps = 4/542 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTV  1808
             ++VLL   M  ++  E   + Y+FDVV+ N++R+C +KP VTVNG+ PGPTIYARE D +
Sbjct  9     VIVLLGFLMLVSVPTEAATKKYQFDVVVSNVSRLCHAKPVVTVNGRLPGPTIYAREGDRL  68

Query  1807  LIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWH  1628
             ++ V NY +YN++IHWHG++QLR GWADGPAY+TQCPIR G SY Y+F +TGQRGTL WH
Sbjct  69    IVNVTNYAQYNMTIHWHGVKQLRNGWADGPAYVTQCPIRSGGSYTYHFNVTGQRGTLWWH  128

Query  1627  AHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPN  1448
             AHILWLR+TVHGA+VI+P+ GVPYPFP+P  E  ++L EWW +D E V  +    GL PN
Sbjct  129   AHILWLRATVHGAIVIMPEQGVPYPFPQPYQETELILGEWWNADVEKVEQQGNLLGLPPN  188

Query  1447  VSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEV  1268
              SDAHTING PGP+  C  +  Y L VE+GK Y+LR+INAALN++LFF IAGH MTVVE+
Sbjct  189   TSDAHTINGKPGPLFPCPEKHTYALEVESGKTYLLRIINAALNDDLFFAIAGHSMTVVEI  248

Query  1267  DATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYT  1088
             DATY KPF T  +VIAPGQTTNV+V ADQ  G+Y +A   FMD P+ VDN+TATA L Y 
Sbjct  249   DATYCKPFNTSALVIAPGQTTNVLVRADQAPGRYFMATRSFMDIPIPVDNKTATAILQYR  308

Query  1087  GTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPC  908
             G   +    +   P  N T    SF D LRSLNS ++PA+VP  VD  L +T GLG+NPC
Sbjct  309   GVPTTVVPVMPQLPAPNDTSFVASFSDQLRSLNSPRYPASVPLDVDRRLFYTIGLGVNPC  368

Query  907   PSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PA  731
             P+C   NG+R+ ASLNN+TFV+P  ALLQAH++ +KGVF  DFP  PP +FNYTG    A
Sbjct  369   PTCL--NGTRLTASLNNITFVLPQVALLQAHYYDMKGVFRLDFPDKPPTSFNYTGTPLTA  426

Query  730   NLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPK  551
             NL T+ GT+L R+A+NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+P  DP+
Sbjct  427   NLGTSLGTRLSRIAFNSTVELVLQDTNLLMVESHPFHLHGYNFFVVGTGIGNFDPAKDPE  486

Query  550   KFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN  371
              FNL+DP ERNT+G+P GGW AIRFRADNPGVWFMHCHLEVHT+WGLKMAF+V+NG GP 
Sbjct  487   TFNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTSWGLKMAFVVENGDGPE  546

Query  370   ES  365
             ES
Sbjct  547   ES  548



>gb|KHG01609.1| Laccase-11 -like protein [Gossypium arboreum]
Length=562

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/541 (62%), Positives = 414/541 (77%), Gaps = 5/541 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             +V L+A   FPA  E  VR Y+FD+ +KN++R+C +KP VTVNG+FPGPTIYARE D V+
Sbjct  15    LVGLIAFISFPA--EAAVRKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYAREGDRVI  72

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             + V N+ KYN+SIHWHG++Q R GWADGPAYITQCPI+ G+SY+Y+F +TGQRGTL WHA
Sbjct  73    VNVTNHAKYNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHA  132

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             HILWLR+TV+GA+VI+PK G+PYPFPKP+ E +VVL EWW  D E ++ +    GL PN+
Sbjct  133   HILWLRATVYGAIVIMPKQGMPYPFPKPNMEQLVVLGEWWHKDVEEIVKQGNNMGLPPNM  192

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTING PGP+  CS +  + + VE+GK Y+LR+INAALN+ELFF IA H MTVVEVD
Sbjct  193   SDAHTINGKPGPLFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIASHNMTVVEVD  252

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A Y KPF T  I+IAPGQTTNV++ A+Q  G+Y +AA PFMDAP+ VDN+TAT    Y G
Sbjct  253   AVYTKPFVTQAILIAPGQTTNVLIQANQSPGRYFMAARPFMDAPIPVDNKTATGIFQYNG  312

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
                +   TL   P  N T  A S+   L+SLNS  FPANVP  VD  L +T G G + CP
Sbjct  313   IPNTVLPTLPQLPASNDTDFALSYNKKLKSLNSANFPANVPLKVDRKLFYTVGFGKDSCP  372

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PAN  728
             +C   NG+R++ASLNN++FVMP   LLQAH+F I GVF TDFP  PP  FNYTGA   AN
Sbjct  373   TCV--NGTRILASLNNISFVMPKIGLLQAHYFNISGVFRTDFPDKPPKPFNYTGAPLTAN  430

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             L T  GT+L ++A+NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+P  DP K
Sbjct  431   LGTAHGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPVKDPAK  490

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             +NLVDPVERNT+G+P GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF V++GKG ++
Sbjct  491   YNLVDPVERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTGWGLKMAFEVEDGKGADQ  550

Query  367   S  365
             S
Sbjct  551   S  551



>ref|XP_009378520.1| PREDICTED: laccase-11-like [Pyrus x bretschneideri]
 ref|XP_009378525.1| PREDICTED: laccase-11-like [Pyrus x bretschneideri]
Length=562

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/527 (64%), Positives = 406/527 (77%), Gaps = 3/527 (1%)
 Frame = -3

Query  1942  ECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIH  1763
             E  ++ Y+FDV + N++R+C SKP VTVNG FPGPT+YARE DT+++ V N+ KYN+SIH
Sbjct  27    EAAIKTYQFDVKVINVSRLCHSKPIVTVNGMFPGPTVYAREGDTLVVNVTNHAKYNMSIH  86

Query  1762  WHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALV  1583
             WHG++Q R GWADGPAYITQCPI  GHSY YN TIT QRGTL WHAHI WLR+TV+GA+V
Sbjct  87    WHGLKQYRNGWADGPAYITQCPIMTGHSYTYNITITAQRGTLWWHAHIFWLRATVYGAIV  146

Query  1582  ILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVA  1403
             I+PK G  +PFP+P  EA +VL EWW +D E ++ +  K GL PN+SDAHTING PGP+ 
Sbjct  147   IMPKQGAGFPFPQPYREANIVLGEWWNNDVEEIVKQGNKLGLPPNMSDAHTINGKPGPLF  206

Query  1402  NCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVI  1223
              CS +  Y L VE GK Y+LR+INAALN+ELFF IAGH +TVVE+DA Y KPF T  I+I
Sbjct  207   PCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAVYTKPFTTQAILI  266

Query  1222  APGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPP  1043
             APGQTTNV+V A Q  G+Y +AA PFMDAPV+VDN+TATA L Y G   S    L   P 
Sbjct  267   APGQTTNVLVQATQAPGRYFMAARPFMDAPVSVDNKTATAILQYKGIPNSVQPLLPQLPA  326

Query  1042  MNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASL  863
             +N T  A ++ D LRSLN+ QFPANVP  VD  L +T GLGINPCP+C   NG+++ ASL
Sbjct  327   LNNTAFALNYDDKLRSLNTAQFPANVPLKVDRHLFYTIGLGINPCPTCL--NGTQLTASL  384

Query  862   NNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKLFRLAY  686
             NN+TFVMP   LLQAHFF  KGVFTTDFP  PP +FN+TGA   ANL T  GT+L ++A+
Sbjct  385   NNITFVMPKIGLLQAHFFNTKGVFTTDFPDRPPTSFNFTGAPLTANLGTKQGTRLSKIAF  444

Query  685   NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGI  506
             NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP  FNLVDP ERNT+G+
Sbjct  445   NSTVELVLQDTNLLTVESHPFHLHGYNFFIVGSGIGNFDPKKDPATFNLVDPPERNTVGV  504

Query  505   PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             P GGW AIRFRADNPGVWFMHCHLE+HT+WGLK AF+V+NGK  + S
Sbjct  505   PTGGWTAIRFRADNPGVWFMHCHLELHTSWGLKTAFVVENGKDTDHS  551



>ref|XP_008357173.1| PREDICTED: laccase-11-like [Malus domestica]
Length=562

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/527 (64%), Positives = 408/527 (77%), Gaps = 3/527 (1%)
 Frame = -3

Query  1942  ECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIH  1763
             E  ++ Y+FDV + N++R+C SKP VTVNG FPGPT+YARE DT+++ V N+ KYN+SIH
Sbjct  27    EAALKTYQFDVKVTNVSRLCHSKPIVTVNGMFPGPTVYAREGDTLVVNVTNHAKYNMSIH  86

Query  1762  WHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALV  1583
             WHG++Q R GWADGPAYITQCPI+ GHSY YN TITGQRGTL WHAHI WLR+TV+GA+V
Sbjct  87    WHGLKQYRNGWADGPAYITQCPIKTGHSYTYNITITGQRGTLWWHAHIFWLRATVYGAIV  146

Query  1582  ILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVA  1403
             I+PK G  +PFP+P  EA +VL EWW +D E V+ +  K GL PN+SDAHTING PGP+ 
Sbjct  147   IMPKQGEGFPFPQPYREANIVLGEWWNNDVEEVVKQGNKKGLPPNMSDAHTINGKPGPLF  206

Query  1402  NCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVI  1223
              CS +  Y L VE GK Y+LR+INAALN+ELFF IAGH +TVVE+DA Y KPF T  I+I
Sbjct  207   PCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAVYTKPFTTQAILI  266

Query  1222  APGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPP  1043
             APGQTTNV+V A Q  G+Y +AA PFMDAPV+VDN+TATA L Y G   S    L   P 
Sbjct  267   APGQTTNVLVQATQAPGRYFMAARPFMDAPVSVDNKTATAILQYKGIPNSVQPVLPQLPA  326

Query  1042  MNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASL  863
              N T  A ++ D+LRSLN+ QFPA+VP  VD  L +T GLGINPCP+C   NG+++ ASL
Sbjct  327   PNNTAFALNYDDNLRSLNTAQFPAHVPLKVDRHLFYTIGLGINPCPTCL--NGTQLTASL  384

Query  862   NNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKLFRLAY  686
             NN+TFVMP   LLQAHFF  KGVFTTDFP  PP +FN+TGA   ANL T  GT+L ++A+
Sbjct  385   NNITFVMPKIGLLQAHFFNTKGVFTTDFPDRPPTSFNFTGAPLTANLGTKQGTRLSKIAF  444

Query  685   NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGI  506
             NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP  FNLVDP ERNT+G+
Sbjct  445   NSTVELVLQDTNLLTVESHPFHLHGYNFFIVGSGIGNFDPKKDPATFNLVDPPERNTVGV  504

Query  505   PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             P GGW AIRFRADNPGVWFMHCHLE+HT+WGLK AF+V+NGK  + S
Sbjct  505   PTGGWTAIRFRADNPGVWFMHCHLELHTSWGLKTAFVVENGKDTDHS  551



>emb|CDO97037.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/553 (61%), Positives = 417/553 (75%), Gaps = 9/553 (2%)
 Frame = -3

Query  2002  ECSWFRIVVLLACCMFPAI----VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPT  1835
              CS++     L  C    I    V   ++ Y+FD+ +KN++R+C +KP VTVNG FPGPT
Sbjct  5     HCSFYLNCAFLFMCSIGWISLPPVNAALKQYQFDIQVKNVSRLCHAKPIVTVNGMFPGPT  64

Query  1834  IYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTIT  1655
             IYARE D V I V NY +YN+SIHWHG++Q R GWADGPAY+TQCPI+ G SY Y+F +T
Sbjct  65    IYAREGDRVQINVTNYAQYNMSIHWHGLKQYRNGWADGPAYVTQCPIQTGQSYTYDFNVT  124

Query  1654  GQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINE  1475
             GQRGTL WHAHI WLR+TV+GA+VI+PK G+ YPFP+PD E  +VL EWW  D E V+ +
Sbjct  125   GQRGTLWWHAHIFWLRATVYGAIVIMPKQGMAYPFPQPDFEFNLVLGEWWNDDVEEVVKQ  184

Query  1474  ALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIA  1295
               K GL P +SDAHTING PGP+  CS +  Y + VE GK+Y+ R+INAALN+ELFF IA
Sbjct  185   GNKLGLPPRMSDAHTINGKPGPLFPCSEKHTYAVEVEQGKKYLFRIINAALNDELFFAIA  244

Query  1294  GHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQ  1115
             GH MTVVEVDA Y KPF TD I+IAPGQTTNV+V A++ S +Y +AA PFMDAP+ +DN+
Sbjct  245   GHNMTVVEVDAVYTKPFSTDAILIAPGQTTNVLVHANKISSRYFMAARPFMDAPLPIDNK  304

Query  1114  TATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLF  935
             TATA L Y G   +   +L   P  N T  A S+   LRSLNS QFPANVP  VD  L +
Sbjct  305   TATAILQYKGVPNNVLPSLPNLPAPNDTSFALSYSAKLRSLNSPQFPANVPLKVDRHLFY  364

Query  934   TAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAF  755
             T GLG+NPCP+C+  NG+R+ ASLNN+TF+MP   LLQAH+F + GVFTTDFP  PP  F
Sbjct  365   TIGLGMNPCPTCQ--NGTRLTASLNNITFIMPQIGLLQAHYFNLTGVFTTDFPDRPPTPF  422

Query  754   NYTGAG-PANLQTTTGT--KLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKG  584
             NYTGA   ANL+T   T  +L R+A+NSTV+LVLQDT +++ E+HPIHLHG+NFF VG G
Sbjct  423   NYTGAPLTANLRTVRSTRPRLSRIAFNSTVELVLQDTNLLSVESHPIHLHGYNFFVVGTG  482

Query  583   LGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKM  404
             +GNF+PK DP K+NLVDP ERNTIG+P GGW AIRFRADNPGVWFMHCHLE+HT+WGLK 
Sbjct  483   IGNFDPKKDPAKYNLVDPPERNTIGVPTGGWTAIRFRADNPGVWFMHCHLELHTSWGLKT  542

Query  403   AFLVDNGKGPNES  365
             AF+V+NG GP+++
Sbjct  543   AFVVENGPGPDQT  555



>ref|XP_004143251.1| PREDICTED: laccase-11-like [Cucumis sativus]
 ref|XP_004170658.1| PREDICTED: laccase-11-like [Cucumis sativus]
 gb|KGN48155.1| hypothetical protein Csa_6G445190 [Cucumis sativus]
Length=563

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/532 (64%), Positives = 409/532 (77%), Gaps = 3/532 (1%)
 Frame = -3

Query  1957  FPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKY  1778
              P +VE  V+ Y+FD+ +KN++R+C++KP VTVNG FPGPTIY RE D VLI V N+ +Y
Sbjct  23    LPFLVESAVKEYQFDIQVKNVSRLCNAKPIVTVNGMFPGPTIYVREGDRVLINVTNHAQY  82

Query  1777  NVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTV  1598
             N+SIHWHG++Q R GWADGPAYITQCPI+ G+SY Y+ T+TGQRGTL WHAHILWLR+TV
Sbjct  83    NMSIHWHGLKQQRNGWADGPAYITQCPIKTGNSYTYDITVTGQRGTLWWHAHILWLRATV  142

Query  1597  HGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGH  1418
             +GA VI+PKLG P+PFP+P  EA +VL EWW SD E ++N+A K GL P  SDAHTING 
Sbjct  143   YGAFVIMPKLGTPFPFPQPYLEANIVLGEWWNSDVETIVNQANKLGLPPQASDAHTINGK  202

Query  1417  PGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKT  1238
             PGP+  CS +  Y L VE+GK Y+LR+INAALN+ELFF IAGH +TVVE+DA Y KPF T
Sbjct  203   PGPLFPCSDKHTYALEVESGKTYLLRIINAALNDELFFAIAGHSLTVVEIDAVYTKPFTT  262

Query  1237  DTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTL  1058
               I+IAPGQTTNV+V ADQ  G+Y +AA PFMDAP+ VDN+T TA L Y G   +   +L
Sbjct  263   TAILIAPGQTTNVLVKADQAPGRYFMAARPFMDAPIPVDNKTVTAILQYKGIPTTILPSL  322

Query  1057  TTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSR  878
              T P  N T  A S+ + LRSLN+  FP NVP  +D  L +T GLG NPC SC   NG++
Sbjct  323   PTLPLPNDTNFALSYNNKLRSLNTPLFPTNVPIKIDRHLFYTIGLGANPCASCL--NGTQ  380

Query  877   VVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKL  701
             + ASLNN+TFVMP T LLQAH+F I GVFT DFP  P   FNYTG    ANL TT GT+L
Sbjct  381   LTASLNNITFVMPKTGLLQAHYFKIPGVFTADFPDRPAVPFNYTGVPLTANLATTLGTRL  440

Query  700   FRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVER  521
              +LA+NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP K+NL+DP ER
Sbjct  441   SKLAFNSTVELVLQDTNMLTVESHPFHLHGYNFFVVGTGIGNFDPKNDPLKYNLIDPPER  500

Query  520   NTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             NT+G+P GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NGK   ES
Sbjct  501   NTVGVPTGGWAAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSAEES  552



>ref|XP_002313847.2| hypothetical protein POPTR_0009s10550g [Populus trichocarpa]
 gb|EEE87802.2| hypothetical protein POPTR_0009s10550g [Populus trichocarpa]
Length=561

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/547 (61%), Positives = 411/547 (75%), Gaps = 5/547 (1%)
 Frame = -3

Query  2002  ECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAR  1823
             +  W   ++ L     PA  E  V+ Y+FD+ +KN++R+C +KP VTVNG+FPGPT+Y R
Sbjct  8     KLCWASYILYLYFIYHPA--EAAVKRYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTVYVR  65

Query  1822  EDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRG  1643
             E D VL+ V N+ +YN+SIHWHG++Q R GWADGPAYITQCPI+ GHSY Y+F +TGQRG
Sbjct  66    EGDRVLVNVTNHARYNMSIHWHGLKQFRNGWADGPAYITQCPIKTGHSYTYDFNVTGQRG  125

Query  1642  TLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKS  1463
             TL WHAHILWLR+TV+GA+VI+PK G P+PFP+P  E +++  EWW +D E +  +  K 
Sbjct  126   TLWWHAHILWLRATVYGAIVIMPKPGTPFPFPQPHREEIIIFGEWWNNDVEDIEKQGNKL  185

Query  1462  GLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             GL PN SDAHTING PGP+  CS +  + L VE  K Y+LR+INAALN+ELFF IAGH M
Sbjct  186   GLPPNASDAHTINGKPGPLFPCSEKHTFTLEVEQAKTYLLRIINAALNDELFFAIAGHNM  245

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATA  1103
             TVVE+DA Y KPF T  I+IAPGQTTNV+V A Q   +Y +AA PFMDAP+++DN+TATA
Sbjct  246   TVVEIDAVYTKPFTTQAILIAPGQTTNVLVQATQTPNRYFMAARPFMDAPLSIDNKTATA  305

Query  1102  TLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
              L Y G   +    L   P  N T  A S+   LRSLNS QF ANVP  VD  L +T GL
Sbjct  306   ILQYKGIPNTVLPLLPQLPEPNDTAFARSYNAKLRSLNSPQFQANVPLIVDRHLFYTIGL  365

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG  743
             GINPCP+C   NG+++ ASLNN+TFVMP   LLQAH+F IKGVF  DFP NPP  FNYTG
Sbjct  366   GINPCPTCL--NGTKLTASLNNITFVMPQIGLLQAHYFNIKGVFRLDFPDNPPTPFNYTG  423

Query  742   AG-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             A   ANL TT GT++ ++AYNSTVQLVLQDT ++  E+HP HLHG+NFF VG G+GNF+P
Sbjct  424   APLTANLGTTLGTRVSKIAYNSTVQLVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDP  483

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             K DP KFNLVDP ERNT+G+P GGW AIRFRADNPGVWFMHCHLE+HT WGLK AF+V+N
Sbjct  484   KRDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTGWGLKTAFVVEN  543

Query  385   GKGPNES  365
             GK P++S
Sbjct  544   GKLPDQS  550



>gb|KDO50695.1| hypothetical protein CISIN_1g036540mg [Citrus sinensis]
Length=562

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/541 (62%), Positives = 411/541 (76%), Gaps = 5/541 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             I   L    FPA  +  V+ Y+FDV +KN++R+C+SKP VTVNG FPGPTIY RE D VL
Sbjct  15    IFYFLGFLSFPA--DAAVKKYQFDVQVKNVSRLCNSKPIVTVNGMFPGPTIYIREGDRVL  72

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             I V N+ +YN+SIHWHG++Q R GWADGPAYITQCPI+ G+SY Y+F +TGQRGTL WHA
Sbjct  73    INVTNHAQYNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYTYDFNVTGQRGTLWWHA  132

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             HILWLR+TV+GA+VI+PK    +PFP+P  E  ++L EWW SD E ++N+  K GL P  
Sbjct  133   HILWLRATVYGAIVIMPKERTSFPFPQPYQETNIILGEWWNSDVETIVNQGNKLGLPPQT  192

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTING  GP+  CS +  + + VE+GK Y+LR++NAALN+ELFF IAGH MTVVE+D
Sbjct  193   SDAHTINGKSGPLFPCSEKHTFAMEVESGKTYLLRIVNAALNDELFFAIAGHNMTVVEID  252

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A Y KPF T  I+IAPGQTTNV+V ADQ   +Y +AA PFMDAP+ VDN+T TA L Y G
Sbjct  253   AVYTKPFTTQAILIAPGQTTNVLVKADQSPSRYFMAARPFMDAPIPVDNKTVTAILQYKG  312

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
                +   TL + P  + T  A ++   LRSLN+ Q+PANVP  VD  L +T GLG NPCP
Sbjct  313   IPNTVLPTLPSLPAPSDTNFALNYSSKLRSLNTPQYPANVPLRVDRHLFYTIGLGQNPCP  372

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PAN  728
             SC+  NG+++ ASLNN+TFVMP   LLQAH+F I GVF TDFP  PP  FNYTGA   AN
Sbjct  373   SCQ--NGTQLTASLNNITFVMPKIGLLQAHYFNISGVFRTDFPDRPPVPFNYTGAPLTAN  430

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             L T+ GT+L ++A+NST++LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP K
Sbjct  431   LGTSLGTRLSKVAFNSTIELVLQDTNLLTVESHPFHLHGYNFFVVGSGIGNFDPKKDPAK  490

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             FNLVDP ERNT+G+P GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NGK P++
Sbjct  491   FNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSPDQ  550

Query  367   S  365
             S
Sbjct  551   S  551



>ref|XP_010926015.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=847

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/524 (64%), Positives = 405/524 (77%), Gaps = 3/524 (1%)
 Frame = -3

Query  1933  VRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHG  1754
             ++ Y+FDVVMKN++R+C +KP VTVNG FPGPT+YARE D V++ V NY +YN+SIHWHG
Sbjct  315   IKKYQFDVVMKNVSRLCDAKPIVTVNGMFPGPTVYAREGDRVIMNVTNYAQYNISIHWHG  374

Query  1753  IRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILP  1574
             ++Q R GWADGPAYITQCPI+ G SY Y+F +TGQRGTL WHAHILWLR+T+HGA+VI+P
Sbjct  375   LKQFRNGWADGPAYITQCPIQSGRSYTYDFNVTGQRGTLWWHAHILWLRATIHGAIVIMP  434

Query  1573  KLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCS  1394
             K GVPYPFP+P  E  +VL EWW +D E V  +    GL PN+SDAHTING PGP+  CS
Sbjct  435   KEGVPYPFPQPQAETELVLGEWWHADVEEVEKQGNMLGLPPNMSDAHTINGKPGPLFPCS  494

Query  1393  TQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPG  1214
              +  + + VE GK Y+LR++NAALN+ELFF IAGH MTVVE+DA Y KPF T+ I+IAPG
Sbjct  495   EKHTFAMEVEWGKTYLLRIVNAALNDELFFAIAGHNMTVVEIDAVYCKPFTTNGILIAPG  554

Query  1213  QTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMNA  1034
             QTTNV+V AD+  G+Y +AA PFMDAP+AVDN+TATA L Y     +    L   P  N 
Sbjct  555   QTTNVLVKADKIPGRYFMAARPFMDAPIAVDNKTATAILQYKCVPTTVIPILPQLPAPND  614

Query  1033  TPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNV  854
             T   + F+  LRSLNS QFPA VP  +D  L +T  LGI+PCP+C   NG+R+ ASLNN+
Sbjct  615   TKFVDDFLGKLRSLNSPQFPAKVPLNIDRHLFYTVSLGIDPCPTCL--NGTRLTASLNNI  672

Query  853   TFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKLFRLAYNST  677
             TFVMP   LLQAH+F IKGVF  DFP  P   FNYTGA   ANL T+ GT+L R+ YNST
Sbjct  673   TFVMPQIGLLQAHYFNIKGVFGLDFPDKPLNTFNYTGAPLTANLGTSLGTRLSRIPYNST  732

Query  676   VQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAG  497
             V+LVLQDT ++A E+HP HLHG+NFF VG+G+GNF+P  DP KFNLVDP ERNT+G+P G
Sbjct  733   VELVLQDTNLLAAESHPFHLHGYNFFVVGRGIGNFDPTKDPAKFNLVDPPERNTVGVPTG  792

Query  496   GWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             GW AIRFRADNPGVWFMHCHLEVHTTWGLKMAF+V+NG GP ES
Sbjct  793   GWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVENGNGPEES  836



>ref|XP_002512915.1| laccase, putative [Ricinus communis]
 gb|EEF49418.1| laccase, putative [Ricinus communis]
Length=558

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/544 (62%), Positives = 414/544 (76%), Gaps = 5/544 (1%)
 Frame = -3

Query  1987  RIVVLLACCM-FPAI-VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDD  1814
             R+  L  C + F ++ VE  V+ Y+FD+ ++N++R+C +KP VTVNG+FPGPTIY RE D
Sbjct  6     RVHFLFLCLIGFISLSVEAAVKKYQFDIQVRNVSRLCHAKPIVTVNGRFPGPTIYVREGD  65

Query  1813  TVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLL  1634
              VL+ V N  +YN+SIHWHG++Q R GWADGPAYITQCPI+ GH+Y Y+F +TGQRGTL 
Sbjct  66    RVLVNVTNNAQYNMSIHWHGLKQFRNGWADGPAYITQCPIKTGHTYTYDFNVTGQRGTLW  125

Query  1633  WHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLA  1454
             WHAHILWLR+TV+GA+VI+PK G P+PFP+P  E +++L EWW +D E ++ +  K GL 
Sbjct  126   WHAHILWLRATVYGAIVIMPKPGTPFPFPQPQREELLILGEWWHNDVEQIVKQGNKMGLP  185

Query  1453  PNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVV  1274
             PN SDAHTING PGP+  CS +  + + VE GK Y+LR+INAALN+ELFF IAGH +TVV
Sbjct  186   PNASDAHTINGKPGPLFPCSEKHTFAMEVEQGKTYLLRIINAALNDELFFAIAGHNLTVV  245

Query  1273  EVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLH  1094
             E+DA Y KPF T  I+IAPGQTTNV+V A Q   +Y +AA PFMDAP++VDN+TATA L 
Sbjct  246   EIDAVYTKPFTTRAILIAPGQTTNVLVQATQAPNRYFMAARPFMDAPLSVDNRTATAILQ  305

Query  1093  YTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGIN  914
             Y G   +    L   P  N T  A S+   L+SLN+ QFPANVP  VD  L +T GLGIN
Sbjct  306   YKGIPNTVLPILPQLPAPNDTVFALSYNSKLKSLNTLQFPANVPLKVDRHLFYTIGLGIN  365

Query  913   PCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-  737
              CP+C   NG+++ ASLNN+TFVMP   LLQAH+F IKGVF TDFP  PP  FNYTGA  
Sbjct  366   LCPTCL--NGTQLTASLNNITFVMPQIGLLQAHYFNIKGVFRTDFPDKPPTPFNYTGAPL  423

Query  736   PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTD  557
              ANL TT GT+L ++AYNSTVQLVLQDT ++  E+HP HLHG+NFF VG G+GNFNPK D
Sbjct  424   TANLGTTLGTRLSKIAYNSTVQLVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFNPKKD  483

Query  556   PKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
             P KFNLVDP ERNT+G+P GGW AIRFRADNPGVWFMHCHLE+HT WGLK AF+V++G G
Sbjct  484   PAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTGWGLKTAFVVEDGSG  543

Query  376   PNES  365
             P+ S
Sbjct  544   PDLS  547



>ref|XP_008449246.1| PREDICTED: laccase-11 [Cucumis melo]
Length=563

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/532 (63%), Positives = 408/532 (77%), Gaps = 3/532 (1%)
 Frame = -3

Query  1957  FPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKY  1778
              P + E  ++ Y+FD+ +KN++R+C++KP VTVNG FPGPTIY RE D VLI V N  +Y
Sbjct  23    LPFLAESAIKKYQFDIQVKNVSRLCNAKPIVTVNGMFPGPTIYVREGDRVLINVTNNAQY  82

Query  1777  NVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTV  1598
             N+SIHWHG++Q R GWADGPAYITQCPI+ G+SY Y+ T+TGQRGTL WHAHILWLR+TV
Sbjct  83    NMSIHWHGLKQQRNGWADGPAYITQCPIKTGNSYTYDITVTGQRGTLWWHAHILWLRATV  142

Query  1597  HGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGH  1418
             +GA VI+PKLG P+PFP+P+ EA +VL EWW SD E ++N+A K GL P  SDAHTING 
Sbjct  143   YGAFVIMPKLGTPFPFPQPNLEANIVLGEWWNSDVETIVNQANKLGLPPQTSDAHTINGK  202

Query  1417  PGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKT  1238
             PGP+  CS +  Y L VE+GK Y+LR+INAALN+ELFF IAGH +TVVE+DA Y KPF T
Sbjct  203   PGPLFPCSDKHTYALEVESGKTYLLRIINAALNDELFFAIAGHSLTVVEIDAVYTKPFTT  262

Query  1237  DTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTL  1058
               I+IAPGQTTNV+V ADQ  G+Y +AA PFMDAP+ VDN+T TA L Y G   +   +L
Sbjct  263   TAILIAPGQTTNVLVKADQAPGRYFMAARPFMDAPIPVDNKTVTAILQYKGIPTTILPSL  322

Query  1057  TTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSR  878
              T P  N T  A S+ + LRSLN+  FP NVP  +D  L +T GLG NPC SC   NG++
Sbjct  323   PTLPLPNDTNFALSYNNKLRSLNTPLFPTNVPIKIDRHLFYTIGLGANPCASCL--NGTQ  380

Query  877   VVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKL  701
             + ASLNN+TFVMP T LLQAH+F I GVFT DFP  P   FNYTG    ANL TT GT+L
Sbjct  381   LTASLNNITFVMPKTGLLQAHYFNIPGVFTADFPDRPAVPFNYTGVPLTANLATTLGTRL  440

Query  700   FRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVER  521
              +LA+NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP K+NL+DP ER
Sbjct  441   SKLAFNSTVELVLQDTNMLTVESHPFHLHGYNFFVVGTGIGNFDPKNDPLKYNLIDPPER  500

Query  520   NTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             NT+G+P GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NGK   ES
Sbjct  501   NTVGVPTGGWAAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSAEES  552



>ref|XP_009590676.1| PREDICTED: laccase-11-like [Nicotiana tomentosiformis]
Length=559

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/547 (60%), Positives = 418/547 (76%), Gaps = 3/547 (1%)
 Frame = -3

Query  2002  ECSWFRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAR  1823
             + S+F ++  +         E  ++ Y+FD+ + N++R+C +KP VTVNG+FPGPTIY R
Sbjct  4     QTSFFPLLGFIVFAFLCLPAEAAIKKYQFDIQVANVSRLCHAKPIVTVNGRFPGPTIYVR  63

Query  1822  EDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRG  1643
             E D V I V N+ +YN+SIHWHG++Q R GWADGPAYITQCPI+ G+SY+Y+F +TGQRG
Sbjct  64    EGDRVQINVTNHAQYNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRG  123

Query  1642  TLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKS  1463
             TL WHAHILWLR+TV+GA+VILP+ G P+PFP+PD E V+VL EWW +D E V N+    
Sbjct  124   TLWWHAHILWLRATVYGAIVILPQQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNAL  183

Query  1462  GLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKM  1283
             GL PN+SDAHTING PGP+  CS +  Y + VE GK Y+LR+INAALN+ELFF +A H +
Sbjct  184   GLPPNMSDAHTINGKPGPLFPCSEKYTYAMEVEKGKTYLLRIINAALNDELFFSVANHTL  243

Query  1282  TVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATA  1103
             TVVE+DA Y KPF T+ I+IAPGQTTNV+V A+Q  G+Y +AA PFMDAP++VDN+TATA
Sbjct  244   TVVEIDAVYTKPFSTEAILIAPGQTTNVLVRANQIPGRYFMAARPFMDAPISVDNKTATA  303

Query  1102  TLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGL  923
                Y G   +    L   P  N T  A S+ + LRSLNS ++PANVP  VD +L +T GL
Sbjct  304   IFQYKGVSETVIPKLPDLPAPNDTEFALSYDNKLRSLNSPKYPANVPLKVDRNLFYTIGL  363

Query  922   GINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG  743
             GIN CP+C   NG+R+ ASLNN++FVMP TALLQAH+F IKGV+TTDFP  PP  FNYTG
Sbjct  364   GINACPTCL--NGTRLTASLNNISFVMPQTALLQAHYFNIKGVYTTDFPDKPPTPFNYTG  421

Query  742   AG-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNP  566
             A   ANL+TT GT+L ++++NSTV+LV+QDT ++  E+HP HLHG+NFF VG G+GNF+P
Sbjct  422   APLTANLKTTQGTRLSKVSFNSTVELVIQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDP  481

Query  565   KTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  386
             K DP K+NL+DP ERNT+G+P GGW AIRFRADNPGVWF HCHLE+HT WGLK AF+V++
Sbjct  482   KKDPAKYNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFFHCHLELHTGWGLKTAFVVED  541

Query  385   GKGPNES  365
             G G N +
Sbjct  542   GPGSNHN  548



>ref|XP_006428774.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
 ref|XP_006481839.1| PREDICTED: laccase-11-like [Citrus sinensis]
 gb|ESR42014.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
Length=562

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/541 (62%), Positives = 411/541 (76%), Gaps = 5/541 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             I   L    FPA  +  V+ Y+FDV + N++R+C+SKP VTVNG FPGPTIY RE D VL
Sbjct  15    IFCFLGFLSFPA--DAAVKKYQFDVQVNNVSRLCNSKPIVTVNGMFPGPTIYIREGDRVL  72

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             I V N  +YN+SIHWHG++Q R GWADGPAYITQCPI+ G+SY Y+F +TGQRGTL WHA
Sbjct  73    INVTNDAQYNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYTYDFNVTGQRGTLWWHA  132

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             HILWLR+TV+GA+VI+PK G  +PFP+P  E  ++L EWW SD E ++N+  K GL P  
Sbjct  133   HILWLRATVYGAVVIMPKEGTSFPFPQPYQETNIILGEWWNSDVETIVNQGNKLGLPPQT  192

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTING  GP+  CS +  + + VE+GK Y+LR++NAALN+ELFF IAGH MTVVE+D
Sbjct  193   SDAHTINGKSGPLFPCSEKHTFAMEVESGKTYLLRIVNAALNDELFFAIAGHNMTVVEID  252

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A Y KPF T  I+IAPGQTTNV+V ADQ   +Y +AA PFMDAP+ VDN+T TA L Y G
Sbjct  253   AVYTKPFTTQAILIAPGQTTNVLVKADQSPSRYFMAARPFMDAPIPVDNKTVTAILQYKG  312

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
                +   TL + P  + T  A ++  +LRSLN+ Q+PANVP  VD  L +T GLG NPCP
Sbjct  313   IPNTVLPTLPSLPAPSDTNFALNYSSNLRSLNTPQYPANVPLRVDRHLFYTIGLGQNPCP  372

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PAN  728
             SC+  NG+++ ASLNN+TFVMP   LLQAH+F I GVF TDFP  PP  FNYTGA   AN
Sbjct  373   SCQ--NGTQLTASLNNITFVMPKIGLLQAHYFNISGVFRTDFPDRPPVPFNYTGAPLTAN  430

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             L T+ GT+L ++A+NST++LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP K
Sbjct  431   LGTSLGTRLSKVAFNSTIELVLQDTNLLTVESHPFHLHGYNFFVVGSGIGNFDPKKDPAK  490

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             FNLVDP ERNT+G+P GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NGK P++
Sbjct  491   FNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSPDQ  550

Query  367   S  365
             S
Sbjct  551   S  551



>ref|XP_011000403.1| PREDICTED: laccase-11-like [Populus euphratica]
Length=561

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/527 (63%), Positives = 404/527 (77%), Gaps = 3/527 (1%)
 Frame = -3

Query  1942  ECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIH  1763
             E  V+ Y+FD+ +KN++R+C +KP VTVNG+FPGPT+YARE D VL+ V N+ KYN+SIH
Sbjct  26    EAAVKRYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTVYAREGDRVLVNVTNHAKYNMSIH  85

Query  1762  WHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALV  1583
             WHG++Q R GWADGPAYITQCPI+ GHSY Y+F +TGQRGTL WHAHILWLR+TV+GA+V
Sbjct  86    WHGLKQFRNGWADGPAYITQCPIKTGHSYTYDFNVTGQRGTLWWHAHILWLRATVYGAIV  145

Query  1582  ILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVA  1403
             I+PK G P+PFP+P  E +++  EWWK+D E +  +  K GL PN SDAHTING PGP+ 
Sbjct  146   IMPKPGTPFPFPQPHREEIIIFGEWWKNDVEDIEKQGNKLGLPPNASDAHTINGKPGPLF  205

Query  1402  NCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVI  1223
              CS +  + L VE  K Y+LR+INAALN+E FF IAGH MTVVE+DA Y KPF T  I I
Sbjct  206   PCSEKHTFTLEVEQAKTYLLRIINAALNDEFFFAIAGHNMTVVEIDAVYTKPFTTQAIQI  265

Query  1222  APGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPP  1043
             APGQTTNV+V A Q   +Y +AA PFMDAP+++DN+TATA L Y G   +    L   P 
Sbjct  266   APGQTTNVLVQAAQTPNRYFMAARPFMDAPLSIDNKTATAILQYKGIPNTVLPLLPQLPE  325

Query  1042  MNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASL  863
              N T  A S+   LRSLNS +F ANVP  VD  L +T GLGINPCP+C   NG+++ ASL
Sbjct  326   PNDTAFALSYNAKLRSLNSPKFQANVPLIVDRHLFYTIGLGINPCPTCL--NGTKLTASL  383

Query  862   NNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKLFRLAY  686
             NN+TFVMP   LLQAH+F IKGVF  DFP NPP  FNYTGA   ANL TT GT++ ++AY
Sbjct  384   NNITFVMPQIGLLQAHYFNIKGVFRLDFPDNPPTPFNYTGAPLTANLVTTLGTRVSKIAY  443

Query  685   NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGI  506
             NSTVQLVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP KFNLVDP ERNT+G+
Sbjct  444   NSTVQLVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPKRDPAKFNLVDPPERNTVGV  503

Query  505   PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             P GGW AIRFRADNPGVWFMHCHLE+HT WGLK AF+V+NGK P++S
Sbjct  504   PTGGWTAIRFRADNPGVWFMHCHLELHTGWGLKTAFVVENGKLPDQS  550



>ref|XP_009764219.1| PREDICTED: laccase-11-like [Nicotiana sylvestris]
Length=562

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/543 (61%), Positives = 416/543 (77%), Gaps = 5/543 (1%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             F +   L     PA  E  ++ Y+FD+ + N++R+C +KP VTVNG+FPGPTIY RE D 
Sbjct  13    FIVFAFLWLNCLPA--EAAIKKYQFDIQVANVSRLCHAKPIVTVNGRFPGPTIYIREGDR  70

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             V I V+N+ +YN+SIHWHG++Q R GWADGPAYITQCPI+ G+SY+Y+F +TGQRGTL W
Sbjct  71    VQINVINHAQYNISIHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWW  130

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHILWLR+TV+GA+VILP+ G P+PFP+PD E V+VL EWW +D E V N+    GL P
Sbjct  131   HAHILWLRATVYGAIVILPQQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGLPP  190

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             N+SDAHTING PGP+  CS +  Y + VE GK Y+LR+INAALN+ELFF +A H +TVVE
Sbjct  191   NMSDAHTINGKPGPLFPCSEKYTYAMEVEKGKTYLLRIINAALNDELFFSVANHTLTVVE  250

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             +DA Y KPF T+ I+IAPGQTTNV+V A+Q  G+Y +AA PFMDAP++VDN+TATA   Y
Sbjct  251   IDAVYTKPFSTNAILIAPGQTTNVLVRANQIPGRYFMAARPFMDAPISVDNKTATAIFQY  310

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
              G   +    L   P  N T  A S+ + LRSLNS ++PANVP  VD +L +T GLGIN 
Sbjct  311   KGVSETVIPKLPDLPAPNDTEFALSYDNKLRSLNSPKYPANVPLKVDRNLFYTIGLGINA  370

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-P  734
             CP+C   NG+R+ ASLNN++FVMP TALLQAH+F IKGV+TTDFP  PP  FNYTGA   
Sbjct  371   CPTCL--NGTRLTASLNNISFVMPQTALLQAHYFNIKGVYTTDFPDKPPTPFNYTGAPLT  428

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
             ANL+TT GT+L ++ +NSTV+LV+QDT ++  E+HP HLHG+NFF VG G+GNF+PK DP
Sbjct  429   ANLKTTQGTRLSKIVFNSTVELVIQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPKKDP  488

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP  374
              K+NL+DP ERNT+G+P GGW AIRFRADNPGVWF HCHLE+HT WGLK AF+V++G G 
Sbjct  489   AKYNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFFHCHLELHTGWGLKTAFVVEDGPGS  548

Query  373   NES  365
             + +
Sbjct  549   DHN  551



>ref|XP_008236999.1| PREDICTED: laccase-11-like [Prunus mume]
Length=563

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/527 (64%), Positives = 405/527 (77%), Gaps = 3/527 (1%)
 Frame = -3

Query  1942  ECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIH  1763
             +  ++ Y+FDV +KN++R+C SKP VTVNG FPGPT+YARE DT+L+ V N+ +YN+SIH
Sbjct  28    KAALKTYQFDVQVKNVSRLCHSKPIVTVNGMFPGPTVYAREGDTLLVNVTNHAQYNMSIH  87

Query  1762  WHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALV  1583
             WHG++Q R GWADGPAYITQCPIR GHSY YN TITGQRGTL WHAHI WLR+TV+GA+V
Sbjct  88    WHGLKQYRNGWADGPAYITQCPIRTGHSYTYNITITGQRGTLWWHAHIFWLRATVYGAIV  147

Query  1582  ILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVA  1403
             ILPK G  +PF +P  EA +VL EWW +D E V+ +  K GL PN+SDAHTING PGP+ 
Sbjct  148   ILPKQGTGFPFLQPYKEANIVLGEWWNNDVEEVVKQGNKLGLPPNMSDAHTINGKPGPLF  207

Query  1402  NCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVI  1223
              CS +  Y L VE GK Y+LR+INAALN+ELFF IAGH +TVVE+DA Y KPF +  I+I
Sbjct  208   PCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAVYTKPFTSQAILI  267

Query  1222  APGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPP  1043
             APGQTTNV+V A+Q  G+Y +AA PFMDAPV++DN+TAT  L Y G   S    L   P 
Sbjct  268   APGQTTNVLVQANQAPGRYFMAARPFMDAPVSIDNKTATGILQYKGIPNSVQPVLPQLPA  327

Query  1042  MNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASL  863
             +N T  A SF   LRSLN+ QFPA+VP  VD  L +T GLGIN C +C   NG+++ ASL
Sbjct  328   LNDTAFALSFNAKLRSLNTAQFPASVPLKVDRHLFYTIGLGINQCTTCL--NGTQLTASL  385

Query  862   NNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKLFRLAY  686
             NN+TFVMP   LLQAH+F  KGVFTTDFP  PP  FNYTGA   ANL T  GT+L +L +
Sbjct  386   NNITFVMPQIGLLQAHYFNTKGVFTTDFPDRPPTPFNYTGAPLNANLGTKIGTRLSKLDF  445

Query  685   NSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGI  506
             NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK DP K+NLVDP ERNTIG+
Sbjct  446   NSTVELVLQDTNLLTVESHPFHLHGYNFFVVGTGVGNFDPKNDPAKYNLVDPPERNTIGV  505

Query  505   PAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             P GGWVAIRFRADNPGVWFMHCHLE+HT+WGLK AF+V+NGK  + S
Sbjct  506   PTGGWVAIRFRADNPGVWFMHCHLELHTSWGLKTAFVVENGKDSDHS  552



>ref|XP_007198990.1| hypothetical protein PRUPE_ppa003590mg [Prunus persica]
 gb|EMJ00189.1| hypothetical protein PRUPE_ppa003590mg [Prunus persica]
Length=563

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/546 (62%), Positives = 412/546 (75%), Gaps = 5/546 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCM--FPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARE  1820
             W    +L  C +  F    +  ++ Y+FDV +KN++R+C SKP VTVNG FPGPT+YARE
Sbjct  9     WGSSALLFLCLVGFFSTPAKAALKTYQFDVQVKNVSRLCHSKPIVTVNGMFPGPTVYARE  68

Query  1819  DDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGT  1640
              DT+L+ V N+ +YN+SIHWHG++Q R GWADGPAYITQCPI+ GHSY YN TITGQRGT
Sbjct  69    GDTLLVNVTNHAQYNMSIHWHGLKQYRNGWADGPAYITQCPIKTGHSYTYNITITGQRGT  128

Query  1639  LLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSG  1460
             L WHAHI WLR+TV+GA+VILPK G  +PF +P  EA +VL EWW +D E V+ +  K G
Sbjct  129   LWWHAHIFWLRATVYGAIVILPKQGTGFPFLQPYKEANIVLGEWWNNDVEEVVKQGNKLG  188

Query  1459  LAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMT  1280
             L PN+SDAHTING PGP+  CS +  Y L VE GK Y+LR+INAALN+ELFF IAGH +T
Sbjct  189   LPPNMSDAHTINGKPGPLFPCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLT  248

Query  1279  VVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATAT  1100
             VVE+DA Y KPF +  I+IAPGQTTNV+V A+Q  G+Y +AA PFMDAPV++DN+TAT  
Sbjct  249   VVEIDAVYTKPFTSQAILIAPGQTTNVLVQANQVPGRYFMAARPFMDAPVSIDNKTATGI  308

Query  1099  LHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
             L Y G   +    L   P +N T  A SF   LRSLN+ QFPA+VP  VD  L +T GLG
Sbjct  309   LQYKGIPNTVQPVLPQLPALNNTAFALSFNAKLRSLNTAQFPASVPLKVDRHLFYTIGLG  368

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
             IN C +C   NG+++ ASLNN+TFVMP   LLQAH+F  KGVFTTDFP  PP  FNYTG+
Sbjct  369   INQCTTCL--NGTQLTASLNNITFVMPQIGLLQAHYFNTKGVFTTDFPDRPPTPFNYTGS  426

Query  739   G-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
                ANL T  GT+L +LA+NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK
Sbjct  427   PLTANLGTKLGTRLSKLAFNSTVELVLQDTNLLTVESHPFHLHGYNFFVVGTGVGNFDPK  486

Query  562   TDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  383
              DP K+NLVDP ERNTIG+P GGWVA+RFRADNPGVWFMHCHLE+HT+WGLK AF+V+NG
Sbjct  487   KDPAKYNLVDPPERNTIGVPTGGWVALRFRADNPGVWFMHCHLELHTSWGLKTAFVVENG  546

Query  382   KGPNES  365
             K  + S
Sbjct  547   KDSDHS  552



>ref|XP_007046899.1| Laccase 11 [Theobroma cacao]
 gb|EOX91056.1| Laccase 11 [Theobroma cacao]
Length=562

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/541 (61%), Positives = 413/541 (76%), Gaps = 5/541 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
             +V  LA   FPA  E  V+ Y+FD+ +KN++R+C +KP VTVNG+FPGPTIY RE D V+
Sbjct  15    VVGFLAFISFPA--EAAVKKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYVREGDRVI  72

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             + V N+ KYN+SIHWHG++Q R GWADGPAYITQCPI+ G+SY Y+F +TGQRGTL WHA
Sbjct  73    VNVTNHAKYNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYSYDFNVTGQRGTLWWHA  132

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             HILWLR+TV+GA+VI+PK G P+PFP P+ E +++L EWW  D E ++ +    GL PN+
Sbjct  133   HILWLRATVYGAIVIMPKEGTPFPFPHPNMEQIIILGEWWHKDVEEIVKQGTNMGLPPNM  192

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTING PGP+  CS +  + + VE+GK Y+LR+INAALN+ELFF IAGH MTVVEVD
Sbjct  193   SDAHTINGKPGPLFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIAGHNMTVVEVD  252

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A Y KPF T  I+IAPGQTTNV+V A+Q  G+Y +A+ PFMDAP+ +DN+TAT  L Y G
Sbjct  253   AVYTKPFITQAILIAPGQTTNVLVRANQMPGRYFMASRPFMDAPLPIDNKTATGILQYKG  312

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
                +   TL   P  N T  A S+   LRSLNS +FPANVP  VD  L +T G G + CP
Sbjct  313   IPNTVLPTLPQLPDPNDTTFALSYNKKLRSLNSAKFPANVPLKVDRKLFYTIGFGKDTCP  372

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PAN  728
             +C   NG+R++ASLNN++FVMP   LLQAH+F +KGVF TDFP  PP  FNYTGA   AN
Sbjct  373   TCL--NGTRLLASLNNISFVMPEVGLLQAHYFNMKGVFRTDFPDKPPKPFNYTGAPLTAN  430

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             L T  GT+L ++A+NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+P  DP K
Sbjct  431   LGTAHGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPVKDPAK  490

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             +NLVDPVERNT+G+P GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V++G G ++
Sbjct  491   YNLVDPVERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTGWGLKMAFVVEDGPGADQ  550

Query  367   S  365
             S
Sbjct  551   S  551



>ref|XP_007200216.1| hypothetical protein PRUPE_ppa015544mg [Prunus persica]
 gb|EMJ01415.1| hypothetical protein PRUPE_ppa015544mg [Prunus persica]
Length=563

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/546 (62%), Positives = 411/546 (75%), Gaps = 5/546 (1%)
 Frame = -3

Query  1993  WFRIVVLLACCM--FPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYARE  1820
             W    +L  C +  F    +  ++ Y+FDV +KN++R+C SKP VTVNG FPGPT+YARE
Sbjct  9     WGSSALLFLCLVGFFSTPAKAALKTYQFDVQVKNVSRLCHSKPIVTVNGMFPGPTVYARE  68

Query  1819  DDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGT  1640
              DT+L+ V N+ KYN+SIHWHG++Q R GWADGPAYITQCPI+ GHSY YN TITGQRGT
Sbjct  69    GDTLLVNVTNHAKYNMSIHWHGLKQYRNGWADGPAYITQCPIKTGHSYTYNITITGQRGT  128

Query  1639  LLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSG  1460
             L WHAHI WLR+TV+GA+VILPK G  +PF +P  EA +VL EWW +D E V+ +  K G
Sbjct  129   LWWHAHIFWLRATVYGAIVILPKQGTGFPFLQPYKEANIVLGEWWNNDVEEVVKQGNKLG  188

Query  1459  LAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMT  1280
             L PN+SDAHTING PGP+  CS +  Y L VE GK Y+LR+INAALN+ELFF IAGH +T
Sbjct  189   LPPNMSDAHTINGKPGPLFPCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLT  248

Query  1279  VVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATAT  1100
             VVE+DA Y KPF +  ++IAPGQTTNV++ A+Q  G+Y +A+ PFMDAPV++DN+TAT  
Sbjct  249   VVEIDAVYTKPFISQALLIAPGQTTNVLIQANQAPGRYFMASRPFMDAPVSIDNKTATGI  308

Query  1099  LHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLG  920
             L Y G   +    L   P +N T  A SF   LRSLN+ QFPA+VP  VD  L +T GLG
Sbjct  309   LQYKGIPNTVQPVLPQLPALNDTAFALSFNAKLRSLNTAQFPASVPLKVDRHLFYTIGLG  368

Query  919   INPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGA  740
             IN C +C   NG+++ ASLNN+TFVMP   LLQAH+F  KGVFTTDFP  PP  FNYTGA
Sbjct  369   INQCTTCL--NGTQLTASLNNITFVMPQIGLLQAHYFNTKGVFTTDFPDRPPTPFNYTGA  426

Query  739   G-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  563
                ANL T  GT+L +LA+NSTV+LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK
Sbjct  427   PLNANLGTKIGTRLSKLAFNSTVELVLQDTNLLTVESHPFHLHGYNFFVVGTGVGNFDPK  486

Query  562   TDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  383
              DP K+NLVDP ERNTI +P GGWVAIRFRADNPGVWFMHCHLE+HT+WGLK AF+V+NG
Sbjct  487   KDPAKYNLVDPPERNTIAVPTGGWVAIRFRADNPGVWFMHCHLELHTSWGLKTAFVVENG  546

Query  382   KGPNES  365
             K  + S
Sbjct  547   KDSDHS  552



>ref|XP_004233973.1| PREDICTED: laccase-11 [Solanum lycopersicum]
Length=563

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/539 (61%), Positives = 413/539 (77%), Gaps = 5/539 (1%)
 Frame = -3

Query  1990  FRIVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDT  1811
             F +   L C   PA  E  ++ Y+FD+ + N++R+C +KP VTVNG+FPGPTIYARE D 
Sbjct  14    FLVYGFLWCSCQPA--EAAIKKYQFDIQVANVSRLCHAKPMVTVNGRFPGPTIYAREGDR  71

Query  1810  VLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLW  1631
             V I V N+ +YN+SIHWHG++Q R GWADGPAYITQCPI+ G+SY+Y+F +TGQRGTL W
Sbjct  72    VQINVTNHAQYNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWW  131

Query  1630  HAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAP  1451
             HAHILWLR+TV+GA+VILP  G P+PFP+PD E V+VL EWW +D E V N+    G+ P
Sbjct  132   HAHILWLRATVYGAIVILPSQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGIPP  191

Query  1450  NVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVE  1271
             N+SDAHTING PGP+  CS +  + + VE GK Y+LR++NAALN+ELFF IA H +TVVE
Sbjct  192   NMSDAHTINGKPGPLFPCSEKYTFAMEVEKGKTYLLRIVNAALNDELFFTIANHTLTVVE  251

Query  1270  VDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHY  1091
             +DA Y KPF T+ I+IAPGQTTNV+V A+Q  G+Y +AA PFMDAPV VDN+TATA   Y
Sbjct  252   IDAVYTKPFSTEAILIAPGQTTNVLVRANQVPGRYFMAARPFMDAPVPVDNKTATAIFQY  311

Query  1090  TGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINP  911
              G   +    L   P  N T  A S+   LRSLNS+++PANVP  VD +L +T GLGIN 
Sbjct  312   KGIPETVLPKLPNLPAPNDTEFALSYDKKLRSLNSQKYPANVPLKVDRNLFYTIGLGINA  371

Query  910   CPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-P  734
             CP+C   NG+R  ASLNN++FVMP TALLQAH+F IKGV+TTDFP  PP  FNYTGA   
Sbjct  372   CPTCI--NGTRFSASLNNISFVMPKTALLQAHYFNIKGVYTTDFPDKPPTPFNYTGAPLT  429

Query  733   ANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDP  554
             ANL+TT GT+L ++A+NSTV+LV+QDT ++  E+HP HLHG+NFF VG G+GNF+PK DP
Sbjct  430   ANLRTTQGTRLGKIAFNSTVELVIQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPKKDP  489

Query  553   KKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKG  377
              K+NL+DP ERNT+G+P GGW AIRFRADNPGVWF HCHLE+HT WGLK AF+V++G G
Sbjct  490   AKYNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFCHCHLELHTGWGLKTAFVVEDGPG  548



>ref|XP_004146556.1| PREDICTED: laccase-11-like [Cucumis sativus]
 gb|KGN53314.1| hypothetical protein Csa_4G046770 [Cucumis sativus]
Length=563

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/554 (60%), Positives = 418/554 (75%), Gaps = 8/554 (1%)
 Frame = -3

Query  2008  MMECSWF--RIVVL-LACC--MFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFP  1844
             M    WF  R+  L +A C  +    VE  ++ Y+FDV ++N++R+C +KP VTVNGKFP
Sbjct  1     MASLVWFVHRLTFLFVASCIGLISFSVEAAIKRYQFDVQVQNISRLCHAKPIVTVNGKFP  60

Query  1843  GPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNF  1664
             GPTIY +E D VL+ V N+ +YN+SIHWHG++Q R GWADGPAYITQCPI+ G+SY Y+F
Sbjct  61    GPTIYVQEGDRVLVNVTNHAQYNMSIHWHGLKQYRNGWADGPAYITQCPIQRGNSYTYDF  120

Query  1663  TITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAV  1484
              +TGQRGTL WHAHILWLR+TV+GA+VILPK G PYPFP+P+ E  ++L EWW +D EAV
Sbjct  121   NVTGQRGTLWWHAHILWLRATVYGAIVILPKQGTPYPFPQPNGEFEILLGEWWNNDVEAV  180

Query  1483  INEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFF  1304
             +N+  + GL PN+SDAHTING PGP+  CS +  + + VEAGK Y+LR+INAALN+ELFF
Sbjct  181   VNQGSRMGLPPNMSDAHTINGKPGPLFPCSEKHTFAMEVEAGKTYLLRIINAALNDELFF  240

Query  1303  KIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAV  1124
              IAGH MTVVEVDA Y KPF T  I+IAPGQTTNV++ A+Q   +Y +A+  FMD P+ V
Sbjct  241   AIAGHSMTVVEVDAVYTKPFTTQAILIAPGQTTNVLLQANQAPNRYFMASRSFMDVPIPV  300

Query  1123  DNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHS  944
             DN+TAT  L Y G   +   TL   P  N T  A S+   L+SLNS Q+PANVP  VD  
Sbjct  301   DNKTATGILQYRGIPNTVLPTLPQLPASNDTSFALSYNKKLKSLNSPQYPANVPLKVDRK  360

Query  943   LLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPP  764
             L +T GLG N CP+C   NG+++VASLNN++FVMP   LLQ+H+F I GVF TDFP  PP
Sbjct  361   LFYTIGLGQNECPTCL--NGTQLVASLNNISFVMPQIGLLQSHYFNIGGVFRTDFPDRPP  418

Query  763   FAFNYTGAG-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGK  587
               FNYTGA   ANL+T  GT+L ++A+NSTV+LVLQDT ++  E+HP HLHG+NFF VG 
Sbjct  419   TPFNYTGAPLTANLRTAVGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGYNFFVVGT  478

Query  586   GLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLK  407
             G+GNF+P  DP K+NLVDPVERNT+G+P GGW AIRFRADNPGVWFMHCHLEVHT WGLK
Sbjct  479   GIGNFDPAKDPAKYNLVDPVERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTGWGLK  538

Query  406   MAFLVDNGKGPNES  365
              AF+V++G G ++S
Sbjct  539   TAFVVEDGPGKDQS  552



>ref|XP_002519529.1| laccase, putative [Ricinus communis]
 gb|EEF42943.1| laccase, putative [Ricinus communis]
Length=559

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/541 (61%), Positives = 406/541 (75%), Gaps = 5/541 (1%)
 Frame = -3

Query  1984  IVVLLACCMFPAIVECRVRHYKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVL  1805
              +  L    FPA  E  V+ Y+FD+ +KN++R+C++KP VTVNG FPGPTIYARE D V 
Sbjct  12    FLCFLGFLSFPA--EAAVKKYQFDIQVKNVSRLCNAKPIVTVNGMFPGPTIYAREGDQVF  69

Query  1804  IRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHA  1625
             + V N+  YN+SIHWHG++Q R GWADGPAYITQCPIR G+SY Y F +TGQRGTL WHA
Sbjct  70    VNVTNHAHYNMSIHWHGLKQFRNGWADGPAYITQCPIRTGNSYTYAFNVTGQRGTLWWHA  129

Query  1624  HILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNV  1445
             HILWLR+TV+GA++I+PK G  +PFP+P  E  ++L EWW SD E ++N+A K GL P  
Sbjct  130   HILWLRATVYGAIIIMPKQGTAFPFPQPYQETNIILGEWWNSDVETIVNQANKLGLPPPT  189

Query  1444  SDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVD  1265
             SDAHTING PGP+  C+ +  + + VE+GK Y+LR+INAALN+ELFF IAGH MTVVE+D
Sbjct  190   SDAHTINGKPGPLFPCAEKHTFAMEVESGKTYLLRIINAALNDELFFAIAGHNMTVVEID  249

Query  1264  ATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTG  1085
             A Y KPF T+ I+IAPGQTTNV+V ADQ   +Y +A  PFMDAPV VDN+T  A L Y G
Sbjct  250   AVYTKPFITNAILIAPGQTTNVLVKADQIPSRYFMAGRPFMDAPVPVDNKTVAAILQYKG  309

Query  1084  TLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCP  905
                +    L T P  N T  A  +   LRSLN+ QFPA VP  VD  L +T GLG NPCP
Sbjct  310   IPNTVLPILPTMPAPNDTKFALDYNKKLRSLNTPQFPALVPLQVDRHLFYTVGLGQNPCP  369

Query  904   SCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PAN  728
             +C+  NG+R+ ASLNN+TFVMP   LLQAH+F I GVF TDFP  PP  FNYTGA   AN
Sbjct  370   TCQ--NGTRLTASLNNITFVMPKIGLLQAHYFNISGVFRTDFPDRPPVPFNYTGAPLTAN  427

Query  727   LQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKK  548
             + T++GT+L ++A+NS ++LVLQDT ++  E+HP HLHGFNFF VG G+GNF+P  DP K
Sbjct  428   IATSSGTRLSKVAFNSAIELVLQDTNLLTVESHPFHLHGFNFFVVGSGIGNFDPAKDPAK  487

Query  547   FNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNE  368
             FNLVDP ERNT+G+P GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NGK P +
Sbjct  488   FNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKLPEQ  547

Query  367   S  365
             S
Sbjct  548   S  548



>ref|XP_011099634.1| PREDICTED: laccase-11-like [Sesamum indicum]
Length=565

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/556 (60%), Positives = 413/556 (74%), Gaps = 10/556 (2%)
 Frame = -3

Query  2008  MMECSWFRIVVLLACCMFPAI-------VECRVRHYKFDVVMKNMTRVCSSKPTVTVNGK  1850
             M+    F + +LL  C   A        VE  V+ Y+FD+ +KN++R+C +KP VTVNG 
Sbjct  1     MISQKKFSLRLLLTICTVFAFLCFVSSPVEAAVKRYQFDIQVKNVSRLCHAKPIVTVNGM  60

Query  1849  FPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGHSYMY  1670
             FPGPTIY RE D VL+ V N+ +YN+SIHWHG++Q R GWADGPAYITQCPI  G SY+Y
Sbjct  61    FPGPTIYVREGDRVLVNVTNHAQYNMSIHWHGLKQYRNGWADGPAYITQCPIMMGSSYVY  120

Query  1669  NFTITGQRGTLLWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTE  1490
             +F +TGQRGTL WHAHILWLR+TV+GA+VI+PK G P+PFP+PD E V++L EWW +D E
Sbjct  121   DFNVTGQRGTLWWHAHILWLRATVYGAIVIMPKQGTPFPFPQPDREEVILLGEWWNADVE  180

Query  1489  AVINEALKSGLAPNVSDAHTINGHPGPVANCSTQGGYRLSVEAGKRYMLRVINAALNEEL  1310
             AV  +    GL PN+SDAHTING PGP+  CS +  + + VE GK Y+LR+INAALN+EL
Sbjct  181   AVEKQGNSLGLPPNMSDAHTINGKPGPLFPCSEKYTFAMEVEQGKTYLLRLINAALNDEL  240

Query  1309  FFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQGSGQYMVAASPFMDAPV  1130
             FF IAGH MTVVE+DA Y KPF T  ++IAPGQTTNV+V A+Q  G+Y +A  PFMD P+
Sbjct  241   FFAIAGHNMTVVEIDAVYTKPFSTQALLIAPGQTTNVLVRANQIPGRYFMATRPFMDVPI  300

Query  1129  AVDNQTATATLHYTGTLASGPTTLTTAPPMNATPVANSFVDSLRSLNSKQFPANVPQTVD  950
              +DN+TATA L Y G   +   TL   P  N +  A S+ + LRSLNS QFPA VP  VD
Sbjct  301   PIDNKTATAILQYKGIPNTIIPTLPNLPRPNDSAFAFSYEEKLRSLNSPQFPAKVPLKVD  360

Query  949   HSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFVMPTTALLQAHFFGIKGVFTTDFPAN  770
               L +T GLG N CPSC   NG+R+ ASLNN++FVMP   LLQAH+F +KGV+TTDFP N
Sbjct  361   RHLFYTIGLGRNACPSCI--NGTRLTASLNNISFVMPQVGLLQAHYFNMKGVYTTDFPDN  418

Query  769   PPFAFNYTGAG-PANLQTTTGTKLFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAV  593
             PP  FNYTGA   ANL T+ GT+L R+++NSTV+LVLQDT ++  E+HP HLHG+NFF V
Sbjct  419   PPTPFNYTGAPLTANLGTSKGTRLSRISFNSTVELVLQDTNLLTVESHPFHLHGYNFFVV  478

Query  592   GKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWVAIRFRADNPGVWFMHCHLEVHTTWG  413
             G G+GNF+P  DP K+NLVDP ERNT+G+P GGW AIRFRADNPGVWF HCHLE+HT WG
Sbjct  479   GTGIGNFDPTKDPAKYNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFFHCHLELHTGWG  538

Query  412   LKMAFLVDNGKGPNES  365
             LK AF+V +G GP++ 
Sbjct  539   LKTAFVVGDGPGPDQK  554



>ref|XP_008800741.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=973

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/521 (63%), Positives = 406/521 (78%), Gaps = 3/521 (1%)
 Frame = -3

Query  1924  YKFDVVMKNMTRVCSSKPTVTVNGKFPGPTIYAREDDTVLIRVVNYVKYNVSIHWHGIRQ  1745
             ++ DVV+KN++R+C +KP VTVNG+FPGPT+YARE D V+I V NY +YN+SIHWHG++Q
Sbjct  444   HREDVVLKNVSRLCHAKPIVTVNGRFPGPTVYAREGDRVIINVTNYAQYNISIHWHGVKQ  503

Query  1744  LRTGWADGPAYITQCPIRPGHSYMYNFTITGQRGTLLWHAHILWLRSTVHGALVILPKLG  1565
              R GWADGPAYITQCPI+ G SY Y+F +TGQRGTL WHAHILWLR+T+HGA+VI+PK G
Sbjct  504   FRNGWADGPAYITQCPIQSGRSYTYDFNVTGQRGTLWWHAHILWLRATIHGAIVIMPKEG  563

Query  1564  VPYPFPKPDHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVANCSTQG  1385
             VPYPFP+P  E  +VL EWW +D E V  +    GL PN+SDAHTING PGP+  CS + 
Sbjct  564   VPYPFPQPHAETELVLGEWWHADVEEVEKQGSMLGLPPNMSDAHTINGKPGPLFPCSEKH  623

Query  1384  GYRLSVEAGKRYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTT  1205
              + + VE GK Y+LR++NAALN++LFF +A H MTVVE+D  Y KPF T+ I IAPGQTT
Sbjct  624   TFAMEVEWGKTYLLRIVNAALNDDLFFAVASHDMTVVEIDGVYCKPFTTEAIQIAPGQTT  683

Query  1204  NVIVTADQGSGQYMVAASPFMDAPVAVDNQTATATLHYTGTLASGPTTLTTAPPMNATPV  1025
             NV+V AD+  G+Y +AA PFMDAP+AVDN+TATA L Y G   +    L   P  N T  
Sbjct  684   NVLVKADKAPGRYFMAARPFMDAPIAVDNKTATAILQYKGIPTTIIPILPQLPAPNDTEF  743

Query  1024  ANSFVDSLRSLNSKQFPANVPQTVDHSLLFTAGLGINPCPSCKAGNGSRVVASLNNVTFV  845
              + F++ LRSLNS QFPANVP++VD  L +TA LG++ CP+C   NG+R+ ASLNN+TFV
Sbjct  744   VHDFLNKLRSLNSPQFPANVPRSVDRHLFYTASLGVDSCPTCL--NGTRLTASLNNITFV  801

Query  844   MPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTGAG-PANLQTTTGTKLFRLAYNSTVQL  668
             MP   LLQAH+F +KGVF  DFP  P   FNYTGA   ANL T+ GT+L R+ YN+TV+L
Sbjct  802   MPKIGLLQAHYFNVKGVFRLDFPDKPATTFNYTGAPLTANLGTSLGTRLSRIPYNTTVEL  861

Query  667   VLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPKTDPKKFNLVDPVERNTIGIPAGGWV  488
             VLQDT ++A E+HP HLHG+NFF VG+G+GNF+PK DP ++NLVDP ERNT+G+P GGW 
Sbjct  862   VLQDTNLLAAESHPFHLHGYNFFVVGRGIGNFDPKKDPAQYNLVDPPERNTVGVPTGGWT  921

Query  487   AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  365
             AIRFRADNPGVWFMHCHLE+HT+WGLKMAF+V+NG GP +S
Sbjct  922   AIRFRADNPGVWFMHCHLELHTSWGLKMAFVVENGNGPEQS  962



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6220794396204