BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23787_g2_i1 len=1213 path=[12307:0-28 6340:29-55 6367:56-279
151:280-1212]

Length=1213
                                                                      Score     E

ref|XP_009786393.1|  PREDICTED: laccase-4-like                          540   0.0      
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          538   0.0      
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          531   0.0      
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          531   0.0      
gb|AAC49538.1|  diphenol oxidase                                        524   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          529   0.0      
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          529   0.0      
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          528   0.0      
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          528   0.0      
gb|AAC49536.1|  diphenol oxidase                                        526   2e-180   Nicotiana tabacum [American tobacco]
ref|XP_004249583.1|  PREDICTED: laccase-4-like                          524   1e-179   
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          523   2e-179   
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          523   2e-179   
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          523   4e-179   
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             523   4e-179   Populus trichocarpa [western balsam poplar]
emb|CDP06511.1|  unnamed protein product                                523   5e-179   
emb|CAA74101.1|  laccase                                                516   9e-179   Populus trichocarpa [western balsam poplar]
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                521   1e-178   
emb|CAC14718.1|  laccase                                                515   1e-178   Populus trichocarpa [western balsam poplar]
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          521   2e-178   
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             521   2e-178   
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          521   2e-178   
ref|XP_006338994.1|  PREDICTED: laccase-4-like                          518   4e-177   
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          517   6e-177   
ref|XP_007026782.1|  Laccase/Diphenol oxidase family protein isof...    514   8e-177   
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          517   8e-177   
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          516   2e-176   
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    516   3e-176   
gb|KHG18161.1|  Laccase-4 -like protein                                 515   6e-176   
ref|XP_011019227.1|  PREDICTED: laccase-4-like                          504   1e-175   
ref|XP_002322962.2|  laccase family protein                             511   3e-174   Populus trichocarpa [western balsam poplar]
gb|KDP24484.1|  hypothetical protein JCGZ_25048                         508   4e-174   
ref|XP_004246339.1|  PREDICTED: laccase-4                               510   6e-174   
gb|KHG11130.1|  Laccase-4 -like protein                                 506   2e-173   
ref|XP_006363052.1|  PREDICTED: laccase-4-like                          508   4e-173   
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     507   8e-173   
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          507   8e-173   
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             507   9e-173   
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    506   2e-172   
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          506   2e-172   
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    505   3e-172   
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          505   3e-172   
ref|XP_002308209.2|  laccase family protein                             505   5e-172   Populus trichocarpa [western balsam poplar]
ref|XP_003516941.1|  PREDICTED: laccase-4-like                          503   3e-171   
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          502   7e-171   
ref|XP_002308208.2|  laccase family protein                             502   9e-171   Populus trichocarpa [western balsam poplar]
ref|XP_010923124.1|  PREDICTED: laccase-22                              501   1e-170   
ref|XP_010553253.1|  PREDICTED: laccase-4                               501   1e-170   
ref|XP_008785423.1|  PREDICTED: laccase-22                              501   1e-170   
ref|XP_008239590.1|  PREDICTED: laccase-4-like                          501   2e-170   
ref|XP_009358852.1|  PREDICTED: laccase-4-like                          499   6e-170   
ref|XP_007205010.1|  hypothetical protein PRUPE_ppa003646mg             499   1e-169   
ref|XP_003522150.1|  PREDICTED: laccase-4-like                          497   5e-169   
gb|EYU26646.1|  hypothetical protein MIMGU_mgv1a003805mg                496   1e-168   
ref|XP_009370205.1|  PREDICTED: laccase-4                               496   3e-168   
ref|XP_007134763.1|  hypothetical protein PHAVU_010G0738000g            494   3e-168   
ref|XP_010101806.1|  hypothetical protein L484_023595                   495   3e-168   
ref|XP_008388134.1|  PREDICTED: laccase-4-like                          495   3e-168   
ref|XP_008377498.1|  PREDICTED: laccase-4-like                          495   5e-168   
ref|XP_011035200.1|  PREDICTED: laccase-4                               494   1e-167   
ref|XP_004302643.1|  PREDICTED: laccase-4-like                          494   1e-167   
ref|XP_002278638.1|  PREDICTED: laccase-4                               493   3e-167   Vitis vinifera
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                    493   4e-167   
ref|XP_010256659.1|  PREDICTED: laccase-4                               491   1e-166   
ref|XP_003544873.2|  PREDICTED: laccase-4-like                          490   3e-166   
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          490   3e-166   
gb|KDP46534.1|  hypothetical protein JCGZ_08506                         489   6e-166   
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             489   8e-166   Populus trichocarpa [western balsam poplar]
ref|XP_002533894.1|  laccase, putative                                  488   2e-165   Ricinus communis
emb|CDX91428.1|  BnaC04g07220D                                          486   2e-164   
ref|XP_002520425.1|  laccase, putative                                  486   2e-164   Ricinus communis
ref|XP_003518300.1|  PREDICTED: laccase-4-like                          485   2e-164   
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          485   3e-164   
gb|KHG17519.1|  Laccase-4 -like protein                                 483   3e-164   
emb|CDX74915.1|  BnaA05g06610D                                          485   4e-164   
ref|XP_004500229.1|  PREDICTED: laccase-4-like                          484   7e-164   
ref|XP_008775059.1|  PREDICTED: laccase-22-like                         484   8e-164   
ref|XP_010517091.1|  PREDICTED: laccase-4-like                          484   1e-163   
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein            484   1e-163   
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             483   1e-163   
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             483   2e-163   
emb|CDX93330.1|  BnaC04g45660D                                          483   2e-163   
ref|XP_003551299.1|  PREDICTED: laccase-4-like                          482   4e-163   
ref|NP_565881.1|  laccase-4                                             482   4e-163   Arabidopsis thaliana [mouse-ear cress]
gb|KHN06247.1|  Laccase-4                                               482   4e-163   
ref|XP_003539958.2|  PREDICTED: laccase-4-like                          481   7e-163   
ref|XP_010509229.1|  PREDICTED: laccase-4-like                          481   7e-163   
ref|XP_010505418.1|  PREDICTED: laccase-4                               481   2e-162   
ref|XP_002879726.1|  IRX12/LAC4                                         480   2e-162   
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             479   5e-162   Populus trichocarpa [western balsam poplar]
ref|XP_010907627.1|  PREDICTED: laccase-22-like                         478   1e-161   
emb|CDY18406.1|  BnaA04g21810D                                          478   1e-161   
gb|KDO37344.1|  hypothetical protein CISIN_1g009854mg                   477   1e-161   
ref|XP_010104682.1|  hypothetical protein L484_022065                   478   2e-161   
ref|XP_009143427.1|  PREDICTED: laccase-4                               478   3e-161   
gb|KHG22893.1|  Laccase-4 -like protein                                 475   3e-161   
ref|XP_002280416.1|  PREDICTED: laccase-4                               477   3e-161   Vitis vinifera
ref|XP_007142229.1|  hypothetical protein PHAVU_008G263100g             476   6e-161   
gb|KEH34185.1|  laccase/diphenol oxidase family protein                 476   8e-161   
ref|XP_009141718.1|  PREDICTED: laccase-4-like                          476   1e-160   
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             475   2e-160   
ref|XP_007146741.1|  hypothetical protein PHAVU_006G065800g             475   2e-160   
gb|KHN04832.1|  Laccase-4                                               473   5e-160   
ref|XP_010104683.1|  hypothetical protein L484_022066                   473   1e-159   
ref|XP_011032153.1|  PREDICTED: laccase-4-like isoform X1               471   4e-159   
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2               472   4e-159   
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         471   1e-158   
ref|XP_006602641.1|  PREDICTED: laccase-4-like isoform X1               471   1e-158   
ref|XP_007140382.1|  hypothetical protein PHAVU_008G107100g             470   3e-158   
ref|XP_009384856.1|  PREDICTED: laccase-22-like                         468   1e-157   
ref|XP_009590412.1|  PREDICTED: laccase-4-like                          468   1e-157   
ref|XP_004490574.1|  PREDICTED: laccase-4-like                          468   1e-157   
ref|XP_003604619.1|  Laccase 1a                                         468   2e-157   
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg             467   4e-157   
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          466   7e-157   
ref|XP_004294236.1|  PREDICTED: laccase-4-like                          466   1e-156   
emb|CDP14064.1|  unnamed protein product                                464   4e-156   
ref|XP_008355354.1|  PREDICTED: laccase-4                               464   7e-156   
ref|XP_008220423.1|  PREDICTED: laccase-4                               462   4e-155   
ref|XP_009416212.1|  PREDICTED: laccase-22-like                         461   6e-155   
ref|XP_009346884.1|  PREDICTED: laccase-4-like                          461   1e-154   
ref|XP_009337309.1|  PREDICTED: laccase-4-like                          460   2e-154   
gb|AES98533.2|  laccase/diphenol oxidase family protein                 460   2e-154   
ref|XP_003615575.1|  Laccase 1a                                         460   4e-154   
ref|XP_010685615.1|  PREDICTED: laccase-4                               458   1e-153   
ref|XP_010676357.1|  PREDICTED: laccase-4-like                          457   2e-153   
gb|AAT75352.1|  laccase-like multicopper oxidase 19                     449   3e-153   Brassica napus [oilseed rape]
emb|CBI31539.3|  unnamed protein product                                456   4e-153   
ref|XP_002265173.1|  PREDICTED: laccase-4-like                          456   7e-153   Vitis vinifera
ref|XP_009374280.1|  PREDICTED: laccase-4-like                          455   2e-152   
gb|EPS60103.1|  laccase 1a                                              454   2e-152   
ref|XP_006287399.1|  hypothetical protein CARUB_v10000605mg             454   3e-152   
ref|XP_011084946.1|  PREDICTED: laccase-4-like                          454   4e-152   
ref|XP_008358974.1|  PREDICTED: laccase-4-like                          452   1e-151   
gb|KFK44563.1|  hypothetical protein AALP_AA1G273400                    452   2e-151   
ref|XP_002873023.1|  predicted protein                                  452   2e-151   
ref|XP_008457399.1|  PREDICTED: laccase-4                               452   3e-151   
ref|XP_010535416.1|  PREDICTED: laccase-16                              452   4e-151   
ref|XP_009767351.1|  PREDICTED: laccase-4-like                          442   8e-151   
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...    451   9e-151   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006398646.1|  hypothetical protein EUTSA_v10015593mg             450   2e-150   
ref|XP_010452014.1|  PREDICTED: laccase-10 isoform X1                   449   3e-150   
gb|EYU41257.1|  hypothetical protein MIMGU_mgv1a003880mg                449   3e-150   
emb|CDY48114.1|  BnaC02g03710D                                          449   6e-150   
ref|XP_004150626.1|  PREDICTED: laccase-4-like                          447   7e-150   
ref|XP_010543228.1|  PREDICTED: laccase-10                              448   7e-150   
ref|NP_195739.2|  laccase 10                                            448   7e-150   Arabidopsis thaliana [mouse-ear cress]
emb|CAB69847.1|  laccase-like protein                                   448   1e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CDY55905.1|  BnaAnng13970D                                          448   1e-149   
ref|XP_009125430.1|  PREDICTED: laccase-10                              447   1e-149   
gb|EPS65618.1|  hypothetical protein M569_09159                         446   2e-149   
dbj|BAJ98144.1|  predicted protein                                      447   3e-149   
ref|XP_010423919.1|  PREDICTED: laccase-10-like                         446   4e-149   
gb|KGN65788.1|  hypothetical protein Csa_1G528530                       446   5e-149   
ref|XP_010490598.1|  PREDICTED: laccase-10-like isoform X1              446   6e-149   
ref|XP_007220829.1|  hypothetical protein PRUPE_ppa027203mg             446   8e-149   
ref|XP_004506788.1|  PREDICTED: laccase-4-like                          446   8e-149   
ref|XP_003558760.1|  PREDICTED: laccase-22                              445   1e-148   
gb|AFN53658.1|  hypothetical protein                                    441   3e-148   
ref|XP_008233715.1|  PREDICTED: laccase-4-like                          444   5e-148   
ref|XP_006663136.1|  PREDICTED: laccase-22-like                         443   1e-147   
ref|XP_004980096.1|  PREDICTED: laccase-22-like                         444   1e-147   
gb|EMT26873.1|  Laccase-22                                              442   3e-147   
gb|EPS61127.1|  laccase 3                                               441   3e-147   
gb|KDO53232.1|  hypothetical protein CISIN_1g0093922mg                  437   4e-146   
ref|XP_009350996.1|  PREDICTED: laccase-4-like                          437   1e-145   
gb|KCW52562.1|  hypothetical protein EUGRSUZ_J01941                     436   2e-145   
ref|XP_009120399.1|  PREDICTED: laccase-16                              437   3e-145   
ref|XP_010033027.1|  PREDICTED: laccase-4-like                          436   5e-145   
ref|XP_009789474.1|  PREDICTED: laccase-4-like isoform X2               433   3e-144   
ref|XP_004159811.1|  PREDICTED: laccase-4-like                          426   4e-144   
gb|KDO69098.1|  hypothetical protein CISIN_1g008799mg                   433   4e-144   
ref|XP_006435668.1|  hypothetical protein CICLE_v10031134mg             433   5e-144   
ref|XP_009789473.1|  PREDICTED: laccase-4-like isoform X1               433   6e-144   
ref|XP_008392913.1|  PREDICTED: laccase-4-like                          433   7e-144   
ref|XP_011036009.1|  PREDICTED: laccase-4-like                          432   1e-143   
ref|XP_003544123.1|  PREDICTED: laccase-4-like                          432   2e-143   
gb|KHN20872.1|  Laccase-4                                               432   2e-143   
ref|XP_004308920.1|  PREDICTED: laccase-22-like                         431   4e-143   
ref|XP_007009094.1|  Laccase/Diphenol oxidase family protein            431   4e-143   
ref|XP_002316233.1|  hypothetical protein POPTR_0010s20050g             431   5e-143   Populus trichocarpa [western balsam poplar]
ref|XP_007141799.1|  hypothetical protein PHAVU_008G226700g             429   2e-142   
emb|CDX80325.1|  BnaC09g34170D                                          429   4e-142   
gb|AAK37829.1|AF132125_1  laccase                                       427   9e-142   Pinus taeda
ref|XP_008441433.1|  PREDICTED: laccase-4-like                          427   9e-142   
emb|CAA74103.1|  laccase                                                427   1e-141   Populus trichocarpa [western balsam poplar]
ref|XP_004138572.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     427   2e-141   
ref|XP_010067496.1|  PREDICTED: laccase-4-like                          427   2e-141   
ref|XP_006282033.1|  hypothetical protein CARUB_v10028274mg             426   2e-141   
gb|KGN45770.1|  hypothetical protein Csa_6G009490                       426   3e-141   
ref|XP_006840270.1|  hypothetical protein AMTR_s00045p00045490          426   3e-141   
gb|ACN39933.1|  unknown                                                 426   4e-141   Picea sitchensis
emb|CAC14719.1|  laccase                                                426   4e-141   Populus trichocarpa [western balsam poplar]
gb|AES99522.2|  laccase/diphenol oxidase family protein                 425   5e-141   
ref|XP_002311202.1|  laccase family protein                             426   5e-141   Populus trichocarpa [western balsam poplar]
ref|XP_004490949.1|  PREDICTED: laccase-4-like                          426   6e-141   
emb|CAA74102.1|  laccase                                                421   7e-141   Populus trichocarpa [western balsam poplar]
ref|XP_009589148.1|  PREDICTED: laccase-4-like                          424   2e-140   
ref|XP_011039810.1|  PREDICTED: laccase-4-like                          424   2e-140   
ref|XP_002866298.1|  hypothetical protein ARALYDRAFT_496014             423   2e-140   
gb|KHG28836.1|  Laccase-22                                              424   5e-140   
ref|XP_003616564.1|  Laccase                                            426   1e-139   
ref|XP_010924287.1|  PREDICTED: laccase-11-like                         421   4e-139   
ref|XP_008811561.1|  PREDICTED: laccase-11-like                         420   6e-139   
ref|XP_011080855.1|  PREDICTED: laccase-4                               420   7e-139   
ref|XP_006350822.1|  PREDICTED: laccase-4-like                          420   1e-138   
ref|NP_200699.1|  laccase 16                                            418   1e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454388.1|  PREDICTED: laccase-16                              419   2e-138   
gb|ABK28766.1|  unknown                                                 418   2e-138   
gb|ABE66261.1|  laccase/diphenol oxidase                                418   2e-138   
ref|XP_010543748.1|  PREDICTED: laccase-22-like                         418   3e-138   
sp|Q1PDH6.2|LAC16_ARATH  RecName: Full=Laccase-16; AltName: Full=...    418   5e-138   Arabidopsis thaliana [mouse-ear cress]
gb|KDP44830.1|  hypothetical protein JCGZ_01330                         415   7e-138   
ref|XP_010483503.1|  PREDICTED: laccase-16-like isoform X3              417   2e-137   
ref|XP_010483501.1|  PREDICTED: laccase-16-like isoform X1              417   2e-137   
ref|XP_010443638.1|  PREDICTED: laccase-16-like                         416   3e-137   
ref|XP_002530417.1|  laccase, putative                                  414   2e-136   Ricinus communis
ref|XP_004241179.1|  PREDICTED: laccase-4-like                          414   2e-136   
ref|XP_008797558.1|  PREDICTED: laccase-11-like                         421   1e-135   
ref|XP_010926015.1|  PREDICTED: laccase-11-like                         417   3e-134   
gb|KHN24301.1|  Laccase-4                                               406   5e-134   
emb|CDP09155.1|  unnamed protein product                                413   9e-134   
ref|XP_009392410.1|  PREDICTED: laccase-11                              407   1e-133   
ref|XP_006602642.1|  PREDICTED: laccase-4-like isoform X2               405   2e-133   
gb|KDP41783.1|  hypothetical protein JCGZ_26801                         414   5e-133   
ref|XP_008800741.1|  PREDICTED: laccase-11-like                         417   5e-133   
gb|AAK37830.1|AF132126_1  laccase                                       405   6e-133   Pinus taeda
gb|KDP29119.1|  hypothetical protein JCGZ_16508                         394   1e-131   
ref|XP_009378520.1|  PREDICTED: laccase-11-like                         401   2e-131   
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   401   2e-131   
ref|XP_008357173.1|  PREDICTED: laccase-11-like                         401   2e-131   
ref|XP_011088411.1|  PREDICTED: laccase-11-like                         401   3e-131   
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg             400   3e-131   
ref|XP_010107530.1|  hypothetical protein L484_024383                   399   1e-130   
gb|KHN41965.1|  Laccase-11                                              397   1e-130   
ref|XP_010543401.1|  PREDICTED: laccase-11-like                         399   1e-130   
ref|XP_003632636.1|  PREDICTED: laccase-11                              399   2e-130   
ref|XP_010098906.1|  hypothetical protein L484_006544                   398   2e-130   
ref|XP_010690098.1|  PREDICTED: laccase-4-like                          399   2e-130   
emb|CDO97037.1|  unnamed protein product                                397   6e-130   
ref|XP_010558158.1|  PREDICTED: laccase-11                              397   6e-130   
ref|XP_008246065.1|  PREDICTED: laccase-11-like                         389   2e-129   
ref|XP_009590676.1|  PREDICTED: laccase-11-like                         396   2e-129   
dbj|BAF01776.1|  laccase (diphenol oxidase)-like protein                387   3e-129   Arabidopsis thaliana [mouse-ear cress]
gb|KHN36103.1|  Laccase-11                                              395   4e-129   
sp|Q8RYM9.1|LAC2_ORYSJ  RecName: Full=Laccase-2; AltName: Full=Be...    395   5e-129   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ12812.1|  hypothetical protein OsJ_02731                          395   5e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007156958.1|  hypothetical protein PHAVU_002G031600g             395   6e-129   
ref|XP_002512915.1|  laccase, putative                                  394   7e-129   Ricinus communis
ref|XP_002305436.1|  hypothetical protein POPTR_0004s16370g             394   8e-129   Populus trichocarpa [western balsam poplar]
emb|CDY62896.1|  BnaAnng18410D                                          394   9e-129   
gb|EMS48198.1|  Laccase-22                                              393   1e-128   
ref|XP_009593896.1|  PREDICTED: laccase-11-like                         394   2e-128   
ref|XP_009764219.1|  PREDICTED: laccase-11-like                         394   2e-128   
ref|XP_009125488.1|  PREDICTED: laccase-11                              394   2e-128   
ref|XP_004969263.1|  PREDICTED: laccase-2-like                          394   2e-128   
ref|XP_009593898.1|  PREDICTED: laccase-11-like                         393   2e-128   
ref|XP_008236999.1|  PREDICTED: laccase-11-like                         393   3e-128   
emb|CDY44351.1|  BnaC02g03260D                                          393   4e-128   
ref|XP_009793780.1|  PREDICTED: laccase-11-like                         393   4e-128   
ref|XP_002519529.1|  laccase, putative                                  392   5e-128   Ricinus communis
ref|XP_004292037.1|  PREDICTED: laccase-11-like                         392   6e-128   
ref|XP_007156959.1|  hypothetical protein PHAVU_002G031700g             392   6e-128   
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             392   6e-128   
ref|XP_004972357.1|  PREDICTED: laccase-2-like                          392   8e-128   
ref|XP_002313847.2|  hypothetical protein POPTR_0009s10550g             392   1e-127   Populus trichocarpa [western balsam poplar]
ref|XP_009772835.1|  PREDICTED: laccase-11-like                         391   1e-127   
ref|XP_006878556.1|  hypothetical protein AMTR_s00011p00235480          391   2e-127   
ref|XP_004233973.1|  PREDICTED: laccase-11                              391   2e-127   
ref|XP_009340732.1|  PREDICTED: laccase-11-like                         390   2e-127   
ref|XP_010254791.1|  PREDICTED: laccase-11-like                         400   2e-127   
ref|XP_006340638.1|  PREDICTED: laccase-11-like                         391   2e-127   
gb|KHG01609.1|  Laccase-11 -like protein                                390   3e-127   
ref|XP_008352457.1|  PREDICTED: laccase-11-like                         390   5e-127   
ref|XP_010452196.1|  PREDICTED: laccase-11                              390   6e-127   
dbj|BAN10308.1|  laccase                                                389   7e-127   
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg             389   7e-127   
ref|XP_004232420.1|  PREDICTED: laccase-11                              389   8e-127   
ref|XP_011099634.1|  PREDICTED: laccase-11-like                         389   9e-127   
ref|XP_010490794.1|  PREDICTED: laccase-11-like                         389   9e-127   
ref|XP_011000403.1|  PREDICTED: laccase-11-like                         389   1e-126   
ref|XP_006401026.1|  hypothetical protein EUTSA_v10013285mg             387   1e-126   
ref|XP_004232419.1|  PREDICTED: laccase-11-like                         389   1e-126   
ref|XP_002873085.1|  hypothetical protein ARALYDRAFT_487097             389   1e-126   
ref|XP_003516567.1|  PREDICTED: laccase-11-like                         389   1e-126   
emb|CDY08537.1|  BnaA05g27730D                                          387   2e-126   
gb|KHN41966.1|  Laccase-11                                              389   2e-126   
ref|XP_007042164.1|  Laccase 11                                         397   2e-126   
emb|CDX70319.1|  BnaA10g26680D                                          389   2e-126   
ref|XP_004143251.1|  PREDICTED: laccase-11-like                         389   2e-126   
ref|XP_006300062.1|  hypothetical protein CARUB_v10016290mg             388   2e-126   
ref|XP_008449246.1|  PREDICTED: laccase-11                              388   2e-126   
gb|KDO70945.1|  hypothetical protein CISIN_1g008484mg                   382   2e-126   
ref|XP_010263632.1|  PREDICTED: laccase-11-like                         397   2e-126   
ref|XP_009122722.1|  PREDICTED: laccase-11-like                         388   3e-126   
gb|KDO70944.1|  hypothetical protein CISIN_1g008484mg                   384   3e-126   
ref|XP_003538856.1|  PREDICTED: laccase-11-like                         388   4e-126   
ref|XP_006287320.1|  hypothetical protein CARUB_v10000520mg             389   5e-126   
ref|XP_006340637.1|  PREDICTED: laccase-11-like                         387   6e-126   
ref|XP_008338318.1|  PREDICTED: laccase-11-like                         387   9e-126   
ref|NP_195946.2|  laccase 11                                            386   1e-125   
ref|XP_010423743.1|  PREDICTED: laccase-11-like                         386   1e-125   
ref|XP_007046899.1|  Laccase 11                                         386   2e-125   
emb|CAB86093.1|  laccase precursor-like                                 386   2e-125   
ref|XP_009371609.1|  PREDICTED: laccase-11-like                         386   2e-125   
emb|CDY10394.1|  BnaCnng02950D                                          386   3e-125   
emb|CDY01010.1|  BnaC05g41900D                                          385   3e-125   
ref|XP_006347000.1|  PREDICTED: laccase-11-like                         385   3e-125   
ref|XP_004292029.1|  PREDICTED: laccase-11-like                         385   3e-125   
ref|XP_004289138.1|  PREDICTED: laccase-11-like                         385   5e-125   
ref|XP_008385897.1|  PREDICTED: laccase-11-like                         385   5e-125   
gb|EYU42613.1|  hypothetical protein MIMGU_mgv1a003791mg                385   6e-125   
ref|XP_006398771.1|  hypothetical protein EUTSA_v10013135mg             384   8e-125   
gb|AES94995.2|  laccase/diphenol oxidase family protein                 384   1e-124   
ref|XP_007205004.1|  hypothetical protein PRUPE_ppa003572mg             384   1e-124   
ref|XP_003612037.1|  Laccase-11                                         384   1e-124   
ref|XP_009342664.1|  PREDICTED: laccase-11-like                         384   2e-124   
ref|XP_004300985.1|  PREDICTED: laccase-11-like                         383   2e-124   
ref|XP_002275392.1|  PREDICTED: laccase-11                              383   3e-124   
ref|XP_009146739.1|  PREDICTED: laccase-22-like                         383   3e-124   
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         382   6e-124   
ref|XP_004512055.1|  PREDICTED: laccase-11-like                         382   9e-124   
ref|XP_004146556.1|  PREDICTED: laccase-11-like                         381   1e-123   
ref|XP_004160985.1|  PREDICTED: laccase-11-like                         381   2e-123   
ref|XP_010494695.1|  PREDICTED: laccase-22-like                         380   2e-123   
ref|XP_008241697.1|  PREDICTED: laccase-11-like                         381   2e-123   
ref|XP_006466813.1|  PREDICTED: laccase-11-like                         381   2e-123   
ref|XP_006425656.1|  hypothetical protein CICLE_v10025287mg             381   2e-123   
ref|XP_010024157.1|  PREDICTED: laccase-11                              380   3e-123   
gb|ABK96121.1|  unknown                                                 370   4e-123   
ref|XP_008338086.1|  PREDICTED: laccase-11-like                         380   5e-123   
ref|XP_010679744.1|  PREDICTED: laccase-11                              379   6e-123   
ref|XP_010464832.1|  PREDICTED: laccase-22-like                         379   1e-122   
ref|XP_010486777.1|  PREDICTED: laccase-22-like isoform X1              379   1e-122   
emb|CBI17500.3|  unnamed protein product                                378   1e-122   
ref|XP_007204198.1|  hypothetical protein PRUPE_ppa003577mg             378   2e-122   
ref|XP_002266464.1|  PREDICTED: laccase-11                              377   3e-122   
ref|XP_010486778.1|  PREDICTED: laccase-22-like isoform X2              377   4e-122   
gb|KFK24777.1|  hypothetical protein AALP_AA8G023500                    377   5e-122   
gb|EYU40190.1|  hypothetical protein MIMGU_mgv1a003793mg                375   2e-121   
ref|XP_003612035.1|  Laccase-11                                         375   2e-121   
ref|XP_011025818.1|  PREDICTED: laccase-11-like                         375   2e-121   
ref|XP_002310245.1|  hypothetical protein POPTR_0007s13050g             375   4e-121   
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         375   7e-121   
gb|AFK41498.1|  unknown                                                 366   9e-121   
emb|CDP02005.1|  unnamed protein product                                370   2e-119   
gb|AAK37827.1|AF132123_1  laccase                                       369   2e-118   
gb|KFK27419.1|  hypothetical protein AALP_AA8G380300                    366   4e-118   
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 366   2e-117   
gb|AAT75349.1|  laccase-like multicopper oxidase 15                     358   2e-117   
gb|KHN07178.1|  Laccase-17                                              363   6e-117   
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              364   7e-117   
ref|XP_003532290.1|  PREDICTED: laccase-17-like isoform X1              363   1e-116   
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          362   5e-116   
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              362   5e-116   
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   361   9e-116   
gb|AAK37825.1|AF132121_1  laccase                                       361   9e-116   
gb|KDO37152.1|  hypothetical protein CISIN_1g040938mg                   358   1e-115   
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   361   1e-115   
gb|AAK37828.1|AF132124_1  laccase                                       360   3e-115   
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             360   3e-115   
gb|KHN14004.1|  Laccase-17                                              360   3e-115   
ref|XP_010107320.1|  hypothetical protein L484_009454                   360   4e-115   
ref|XP_006480875.1|  PREDICTED: laccase-17-like isoform X2              358   4e-115   
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             360   4e-115   
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         360   4e-115   
ref|XP_002531562.1|  laccase, putative                                  360   5e-115   
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         359   5e-115   
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         359   6e-115   
gb|KHN40289.1|  Laccase-17                                              356   7e-115   
gb|KHG14663.1|  Laccase-4                                               356   1e-114   
gb|EPS68485.1|  hypothetical protein M569_06281                         356   1e-114   
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              358   1e-114   
ref|XP_008785574.1|  PREDICTED: laccase-17-like                         358   3e-114   
ref|XP_008778578.1|  PREDICTED: laccase-10-like                         357   3e-114   
ref|XP_008778964.1|  PREDICTED: laccase-17-like                         357   4e-114   
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         357   5e-114   
ref|XP_006846061.1|  hypothetical protein AMTR_s00012p00061860          357   6e-114   
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         357   7e-114   
ref|XP_010922297.1|  PREDICTED: laccase-17-like                         357   9e-114   
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         356   1e-113   
emb|CBI30529.3|  unnamed protein product                                355   2e-113   
gb|KHF97742.1|  Laccase-17 -like protein                                355   3e-113   
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         354   5e-113   
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             354   7e-113   
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         353   9e-113   
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         353   1e-112   
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             353   1e-112   
ref|XP_002278232.1|  PREDICTED: laccase-17-like                         353   1e-112   
gb|AFR40701.1|  laccase                                                 340   2e-112   
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         353   2e-112   
emb|CAN60069.1|  hypothetical protein VITISV_012401                     352   2e-112   
ref|XP_007027504.1|  Laccase 11                                         350   4e-112   
gb|AFR40703.1|  laccase                                                 338   4e-112   
gb|AHX74225.1|  laccase                                                 345   5e-112   
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          352   6e-112   
ref|XP_010256874.1|  PREDICTED: laccase-17-like                         352   7e-112   
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             351   9e-112   
ref|XP_002282823.1|  PREDICTED: laccase-17                              351   1e-111   
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         351   1e-111   
gb|AFR40713.1|  laccase                                                 337   1e-111   
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          350   2e-111   
ref|XP_006846265.1|  hypothetical protein AMTR_s00012p00245710          350   2e-111   
gb|AFR40673.1|  laccase                                                 337   2e-111   
gb|ACN40347.1|  unknown                                                 350   2e-111   
gb|AFR40704.1|  laccase                                                 337   3e-111   
gb|AFR40676.1|  laccase                                                 336   3e-111   
gb|AFR40668.1|  laccase                                                 336   3e-111   
gb|AFR40702.1|  laccase                                                 336   4e-111   
ref|XP_010535559.1|  PREDICTED: laccase-17                              349   4e-111   
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          349   5e-111   
gb|AFV52381.1|  laccase                                                 348   8e-111   
gb|AFV52380.1|  laccase                                                 348   8e-111   
ref|XP_007016607.1|  Laccase 17                                         348   9e-111   
ref|XP_006846275.1|  hypothetical protein AMTR_s00012p00248430          348   1e-110   
gb|AFR40693.1|  laccase                                                 335   1e-110   
ref|XP_002282815.1|  PREDICTED: laccase-17                              348   1e-110   
gb|AFV52379.1|  laccase                                                 348   1e-110   
gb|EMS50562.1|  Laccase-12/13                                           346   1e-110   
gb|AFR40694.1|  laccase                                                 335   1e-110   
ref|XP_002531824.1|  laccase, putative                                  348   2e-110   
gb|AFR40706.1|  laccase                                                 334   2e-110   
gb|AFR40709.1|  laccase                                                 334   2e-110   
gb|AFR40700.1|  laccase                                                 334   3e-110   
gb|AAB17194.1|  laccase                                                 347   3e-110   
ref|XP_002278215.1|  PREDICTED: laccase-17                              347   3e-110   
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             347   3e-110   
gb|AFR40711.1|  laccase                                                 333   4e-110   
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         347   4e-110   
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          347   5e-110   
emb|CAN71338.1|  hypothetical protein VITISV_008643                     346   6e-110   
gb|AAK37823.1|  laccase                                                 346   8e-110   
gb|AAB17192.1|  laccase                                                 346   9e-110   
gb|AAB17193.1|  laccase                                                 346   1e-109   
ref|XP_007026974.1|  Laccase 17                                         346   1e-109   
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g             346   1e-109   
gb|AFR40691.1|  laccase                                                 332   1e-109   
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   345   1e-109   
gb|AFR40686.1|  laccase                                                 332   1e-109   
gb|AFR40677.1|  laccase                                                 332   2e-109   
gb|AFR40708.1|  laccase                                                 332   2e-109   
gb|AFR40707.1|  laccase                                                 332   2e-109   
ref|XP_002520232.1|  laccase, putative                                  345   2e-109   
gb|AFR40695.1|  laccase                                                 332   2e-109   
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         345   2e-109   
gb|KHN36104.1|  Laccase-11                                              344   4e-109   
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         344   4e-109   
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             345   4e-109   
ref|XP_010541373.1|  PREDICTED: laccase-17                              346   5e-109   
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g             343   8e-109   
ref|XP_007026975.1|  Laccase 17                                         343   9e-109   
gb|AFR40696.1|  laccase                                                 330   9e-109   
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         343   1e-108   
gb|AFR40684.1|  laccase                                                 330   1e-108   
ref|XP_006424707.1|  hypothetical protein CICLE_v10028090mg             343   1e-108   
gb|KDO73032.1|  hypothetical protein CISIN_1g008109mg                   343   1e-108   
gb|KDP35652.1|  hypothetical protein JCGZ_09090                         337   2e-108   
emb|CBI30528.3|  unnamed protein product                                361   2e-108   
gb|AFR40692.1|  laccase                                                 329   2e-108   
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             342   2e-108   
gb|AFR40698.1|  laccase                                                 329   2e-108   
gb|AFR40699.1|  laccase                                                 329   3e-108   
gb|AES79165.2|  laccase/diphenol oxidase family protein                 342   3e-108   
gb|EYU41744.1|  hypothetical protein MIMGU_mgv1a025875mg                341   3e-108   
gb|AFR40681.1|  laccase                                                 328   3e-108   
gb|AFR40666.1|  laccase                                                 328   4e-108   
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         342   4e-108   
ref|XP_006654510.1|  PREDICTED: laccase-12/13-like                      342   4e-108   
gb|AFR40679.1|  laccase                                                 328   4e-108   
ref|XP_009416147.1|  PREDICTED: laccase-4-like                          342   5e-108   
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                341   5e-108   
gb|AAU44018.1|  putative laccase                                        338   6e-108   
dbj|BAJ91763.1|  predicted protein                                      341   6e-108   
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         340   7e-108   
ref|XP_006646133.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-2-like     340   7e-108   
gb|AFR40683.1|  laccase                                                 328   8e-108   
ref|XP_010654259.1|  PREDICTED: laccase-2-like                          341   8e-108   
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                341   1e-107   
ref|XP_006603494.1|  PREDICTED: laccase-17-like                         338   1e-107   
gb|AFR40672.1|  laccase                                                 327   1e-107   
gb|AFR40685.1|  laccase                                                 327   1e-107   
emb|CBI30527.3|  unnamed protein product                                341   1e-107   
ref|XP_011002147.1|  PREDICTED: laccase-17-like                         340   1e-107   
ref|XP_009388612.1|  PREDICTED: laccase-4-like                          339   1e-107   
ref|XP_002271047.2|  PREDICTED: laccase-17                              341   1e-107   
emb|CBI31631.3|  unnamed protein product                                352   1e-107   
ref|NP_001055747.1|  Os05g0458600                                       340   2e-107   
ref|XP_007022468.1|  Laccase 17                                         340   2e-107   
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          340   2e-107   
ref|XP_003622947.1|  Laccase                                            339   2e-107   
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          340   2e-107   
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         340   2e-107   
ref|XP_006644993.1|  PREDICTED: laccase-4-like                          340   3e-107   
ref|XP_003616562.1|  Laccase                                            335   3e-107   
emb|CDX88735.1|  BnaA03g09140D                                          339   3e-107   
ref|XP_009131958.1|  PREDICTED: laccase-17                              339   3e-107   
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   339   3e-107   
ref|XP_002531565.1|  laccase, putative                                  339   4e-107   
ref|XP_007026973.1|  Laccase 17                                         339   6e-107   
ref|XP_011094887.1|  PREDICTED: laccase-17-like                         338   7e-107   



>ref|XP_009786393.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=556

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/306 (86%), Positives = 281/306 (92%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY+KPFKTDTIVIAPGQTTNVI+TA+Q +G+YMV ASPFMDAPIAVDN T TAT
Sbjct  241   VVEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVVASPFMDAPIAVDNATATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT  P +NATPVANNFVDSLRSLNSK +PAKVP+ VDHSL FTVGLG
Sbjct  301   LHYSGTLASSVTTLTNTPPKNATPVANNFVDSLRSLNSKKYPAKVPKNVDHSLFFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHFFGIKGV+TTDFP NPP  FNYTG 
Sbjct  361   INPCPSCKQGNGSRVVASINNVTFVMPTTALLQAHFFGIKGVYTTDFPQNPPIKFNYTGK  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP NL T++GTK+YRLPYNATVQLVLQDTGI+APENHPIHLHGFNFFAVG+G+GNFNPK
Sbjct  421   -PPVNLATTSGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPK FNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  480   TDPKNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_009593041.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/306 (86%), Positives = 280/306 (92%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNVI+ A+Q +G+YMV ASPFMDAPIAVDN T TAT
Sbjct  241   VVEVDATYVKPFKTDTIVIAPGQTTNVIVAANQGSGKYMVVASPFMDAPIAVDNATATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT  P +NATPVANNFVDSLRSLNSK +PAKVP+ VDHSL FTVGLG
Sbjct  301   LHYSGTLASSVTTLTNTPPKNATPVANNFVDSLRSLNSKKYPAKVPKNVDHSLFFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHFFGIKGV+TTDFP NPPF FNYTG 
Sbjct  361   INPCPSCKQGNGSRVVASINNVTFVMPTTALLQAHFFGIKGVYTTDFPQNPPFKFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPPANL T +GTK+YRLPYNATVQLVLQDTGI++PENHPIHLHGFNFFAVG+G+GNFN K
Sbjct  420   TPPANLSTMSGTKVYRLPYNATVQLVLQDTGIISPENHPIHLHGFNFFAVGKGLGNFNSK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  480   IDPKNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_004249084.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=556

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/306 (84%), Positives = 279/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTI+IAPGQTTNVI+TAD+ +G+YMVAASPFMDAPIAVDN T TAT
Sbjct  241   VVEVDATYVKPFKTDTIIIAPGQTTNVIVTADKGSGKYMVAASPFMDAPIAVDNVTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT+ P +NAT VANNF+DSLRSLNSK +PAKVP+ VDHSL FTVGLG
Sbjct  301   LHYSGTLASSITTLTKTPPKNATTVANNFIDSLRSLNSKKYPAKVPKKVDHSLFFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC SCK  NGSRVVAS+NNVTFVMPT A+LQAHFFGIKGV+TTDFP NPPF FNYTG 
Sbjct  361   VNPCSSCKQGNGSRVVASINNVTFVMPTVAILQAHFFGIKGVYTTDFPQNPPFKFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NL T +GTK+YRLPYNATVQLVLQDTGI++PENHPIHLHGFNFFAVG+GIGNFNPK
Sbjct  420   TPPTNLATMSGTKVYRLPYNATVQLVLQDTGIISPENHPIHLHGFNFFAVGKGIGNFNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNL+DPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  480   KDPNNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_009799024.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=557

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/306 (85%), Positives = 277/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNVI+TA+Q +G+YMVAASPFMDAPIAVDN T  AT
Sbjct  242   VVEVDATYVKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTAIAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G Q     +LT  P +NATPVAN F+DSLRSLNSK +PA VP+ +DHSL FTVGLG
Sbjct  302   LHYSGTQGNNRISLTSTPPKNATPVANTFLDSLRSLNSKKYPANVPKKIDHSLFFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK  NGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFP NPPFAFNYTG 
Sbjct  362   INPCPSCKQGNGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNYTG-  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T PANL T+ GTK+YRL YN TVQLVLQDTGI+APENHPIHLHGFNF+ VG+GIGNFNPK
Sbjct  421   TGPANLATTNGTKVYRLRYNDTVQLVLQDTGIIAPENHPIHLHGFNFYLVGKGIGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPK FNLVDPVERNT+GVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA+LVDNG
Sbjct  481   TDPKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAWLVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>gb|AAC49538.1| diphenol oxidase, partial [Nicotiana tabacum]
Length=409

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/306 (85%), Positives = 277/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNVI+TADQ+ G+YMVAASPFMDAPIAVDN T TAT
Sbjct  94    VVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQSFGKYMVAASPFMDAPIAVDNITATAT  153

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   T  TTLT  P QNAT VANNF+D+L+SLNSK +PAKVPQTVDHSL FT GLG
Sbjct  154   LHYSGALGTSPTTLTSTPPQNATSVANNFLDALKSLNSKKYPAKVPQTVDHSLFFTAGLG  213

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK ANGSRVVASVNNVTFVMPT ALLQAHFFGI GVFTTDFP NPPF FNYTG 
Sbjct  214   INPCPTCKQANGSRVVASVNNVTFVMPTVALLQAHFFGINGVFTTDFPANPPFVFNYTG-  272

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NL T+ GTK+YRLPYNATVQLVLQDTGI+APENHPIHLHGFNFF VG+G+GNFN K
Sbjct  273   TPPTNLATTNGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFNFFLVGKGLGNFNSK  332

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPK FNL+DPVERNTIGVP+GGWVAIR+ ADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  333   TDPKNFNLIDPVERNTIGVPSGGWVAIRWLADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  392

Query  312   KGPNES  295
             KGP ES
Sbjct  393   KGPKES  398



>ref|XP_006349470.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=556

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/306 (84%), Positives = 279/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTI+IAPGQTTNVI+TA++ +G+YMVAASPFMDAPIAVDN T TAT
Sbjct  241   VVEVDATYVKPFKTDTIIIAPGQTTNVIVTANKGSGKYMVAASPFMDAPIAVDNVTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT  P +NATPVANNF+DSLRSLNSK +PAKVP+ VDHSL FTVGLG
Sbjct  301   LHYSGTLASSITTLTNTPPKNATPVANNFIDSLRSLNSKKYPAKVPKKVDHSLFFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC SCK  NGSRVVAS+NNVTFVMPT A+LQAHFFGIKGV+TTDFP NPPF FNYTG 
Sbjct  361   VNPCSSCKQGNGSRVVASINNVTFVMPTVAILQAHFFGIKGVYTTDFPQNPPFKFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NL T +GTK+Y LPYNATVQLVLQDTGI++PENHPIHLHGFNFFAVG+GIGNFNPK
Sbjct  420   TPPTNLATMSGTKVYLLPYNATVQLVLQDTGIISPENHPIHLHGFNFFAVGKGIGNFNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP  FNL+DPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  480   TDPNNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_011077581.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=557

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/306 (85%), Positives = 278/306 (91%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             +VEVDATYVKPFKTDTIVIAPGQTTN I+T D+A G+YMVAASPFMD P+ AVDN T TA
Sbjct  241   IVEVDATYVKPFKTDTIVIAPGQTTNAILTTDRAVGKYMVAASPFMDTPVVAVDNLTATA  300

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY+G  ++  TT TR P+QNATPVANNF +SLRSLNS  +PAKVPQ VDHSL FTVGL
Sbjct  301   TLHYSGTLSSSLTTFTRPPAQNATPVANNFTNSLRSLNSNKYPAKVPQKVDHSLFFTVGL  360

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPCP+CK  NGSRVVA+VNNVTFVMPT ALLQAHFF IKGVFTTDFPGNPPFAFNYTG
Sbjct  361   GINPCPTCKATNGSRVVAAVNNVTFVMPTIALLQAHFFNIKGVFTTDFPGNPPFAFNYTG  420

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             S PPANL T+ GTKLYRLPYNATVQ+VLQDTGI+APENHPIHLHGFNFF VGRG+GNFNP
Sbjct  421   S-PPANLGTTNGTKLYRLPYNATVQVVLQDTGIIAPENHPIHLHGFNFFVVGRGLGNFNP  479

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDPK FNLVDPVERNTIGVP+GGWVAIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVDN
Sbjct  480   KTDPKTFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDN  539

Query  315   GKGPNE  298
             GKGPNE
Sbjct  540   GKGPNE  545



>ref|XP_009787551.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=554

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/306 (84%), Positives = 278/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNVI+TADQ+ G+YMVAASPFMDAPIAVDN T TAT
Sbjct  239   VVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQSFGKYMVAASPFMDAPIAVDNITATAT  298

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT  P QNAT VANNF+D+L+SLNSK +PAKVPQTVDHSL FTVGLG
Sbjct  299   LHYSGALGSSPTTLTSTPPQNATSVANNFLDALKSLNSKKYPAKVPQTVDHSLFFTVGLG  358

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK ANGSRVVASVNNVTF+MPT ALLQAHFFGI GVFTTDFP NPPF FNYTG 
Sbjct  359   INPCPTCKQANGSRVVASVNNVTFIMPTVALLQAHFFGINGVFTTDFPANPPFVFNYTG-  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P NL T+ GTK+YRLPYNATVQLVLQDTGI+APENHPIHLHGFNFF VG+G+GNFN K
Sbjct  418   TSPTNLATTKGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFNFFLVGKGLGNFNSK  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPK FNL+DPVERNTIGVP+GGWVAIR+RADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  478   TDPKNFNLIDPVERNTIGVPSGGWVAIRWRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  537

Query  312   KGPNES  295
             KG NES
Sbjct  538   KGSNES  543



>ref|XP_009624727.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/306 (84%), Positives = 275/306 (90%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY+KPFKTDTIVIAPGQTTNVI+TA+Q +G+YMVAASPFMDAPIAVDN T  AT
Sbjct  242   VVEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTAIAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G Q     +LT  P +NATPVAN F+DSLRSLNSK +PAKVP+ +DHSL FTVGLG
Sbjct  302   LHYSGTQGNSHISLTSTPPKNATPVANTFLDSLRSLNSKKYPAKVPKKIDHSLFFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVASVNNVTFVMPT ALLQAHFFGIKGVFTTDFP NPPFAFNYTG 
Sbjct  362   INPCPTCKQGNGSRVVASVNNVTFVMPTVALLQAHFFGIKGVFTTDFPANPPFAFNYTG-  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P NL T  GTK+YRL YN TVQLVLQDTGI+APENHPIHLHGFNFF VG+GIGNFNPK
Sbjct  421   TGPTNLATMNGTKVYRLRYNDTVQLVLQDTGIIAPENHPIHLHGFNFFLVGKGIGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPK FNLVDPVERNT+GVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA+LVDNG
Sbjct  481   TDPKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAWLVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>gb|AAC49536.1| diphenol oxidase [Nicotiana tabacum]
Length=557

 Score =   526 bits (1356),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 256/306 (84%), Positives = 274/306 (90%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY+KPFKTDTIVIAPGQTTNVI+TA+Q +G+YMVAASPFMDAPIAVDN T  AT
Sbjct  242   VVEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTAIAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G Q     +LT  P +NATPVAN F+DSLRSLNSK +PAKVP+ +DHSL FTVGLG
Sbjct  302   LHYSGTQGNSHISLTSTPPKNATPVANTFLDSLRSLNSKKYPAKVPKKIDHSLFFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVASVNNVTFVMPT ALLQAHFFG KGVFTTDFP NPPFAFNYTG 
Sbjct  362   INPCPTCKQGNGSRVVASVNNVTFVMPTVALLQAHFFGTKGVFTTDFPANPPFAFNYTG-  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P NL T  GTK+YRL YN TVQLVLQDTGI+APENHPIHLHGFNFF VG+GIGNFNPK
Sbjct  421   TGPTNLATMNGTKVYRLRYNDTVQLVLQDTGIIAPENHPIHLHGFNFFLVGKGIGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPK FNLVDPVERNT+GVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA+LVDNG
Sbjct  481   TDPKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAWLVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>ref|XP_004249583.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=557

 Score =   524 bits (1350),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 254/306 (83%), Positives = 276/306 (90%), Gaps = 0/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK+DTI+IAPGQTTNVI+TADQ  G+YM+ ASPFMD+PI VDN T TAT
Sbjct  241   VVEVDATYVKPFKSDTILIAPGQTTNVILTADQKFGKYMMIASPFMDSPITVDNVTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG  ++   TLT  P QNAT VANNF+DSL+SLNSK +PAKVP  VDHSLLFTVGLG
Sbjct  301   LHYTGALSSAPMTLTSAPPQNATLVANNFIDSLKSLNSKKYPAKVPNNVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+C PANGSRVVAS+NNVTFVMPTTALLQAHFFGIK VFTTDFPGNPPF FNYT +
Sbjct  361   INPCPTCIPANGSRVVASINNVTFVMPTTALLQAHFFGIKNVFTTDFPGNPPFIFNYTST  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP +L T+ GTKLYRL Y+ATVQLVLQDTGI+APENHPIHLHGFNFFAVG+G+GNFNPK
Sbjct  421   LPPPSLATTNGTKLYRLRYDATVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNL+DPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  481   IDTKNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>ref|XP_009593274.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=554

 Score =   523 bits (1348),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 259/306 (85%), Positives = 277/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNVI+TADQ+ G+YMVAASPFMDAPIAVDN T TAT
Sbjct  239   VVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQSFGKYMVAASPFMDAPIAVDNITATAT  298

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   T  TTLT  P QNAT VANNF+D+L+SLNSK +PAKVPQTVDHSL FT GLG
Sbjct  299   LHYSGALGTSPTTLTSTPPQNATSVANNFLDALKSLNSKKYPAKVPQTVDHSLFFTAGLG  358

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK ANGSRVVASVNNVTFVMPT ALLQAHFFGI GVFTTDFP NPPF FNYTG 
Sbjct  359   INPCPTCKQANGSRVVASVNNVTFVMPTVALLQAHFFGINGVFTTDFPANPPFVFNYTG-  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NL T+ GTK+YRLPYNATVQLVLQDTGI+APENHPIHLHGFNFF VG+G+GNFN K
Sbjct  418   TPPTNLATTKGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFNFFLVGKGLGNFNSK  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPK FNL+DPVERNTIGVP+GGWVAIR+ ADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  478   TDPKNFNLIDPVERNTIGVPSGGWVAIRWLADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  537

Query  312   KGPNES  295
             KGP ES
Sbjct  538   KGPKES  543



>ref|XP_010044090.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044092.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044093.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86096.1| hypothetical protein EUGRSUZ_B02797 [Eucalyptus grandis]
 gb|KCW86097.1| hypothetical protein EUGRSUZ_B02798 [Eucalyptus grandis]
 gb|KCW86098.1| hypothetical protein EUGRSUZ_B02799 [Eucalyptus grandis]
Length=556

 Score =   523 bits (1348),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 253/306 (83%), Positives = 280/306 (92%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDTIVIAPGQTTN +I+ADQ++G+Y+VAASPFMD+PI VDN T TAT
Sbjct  241   IVEVDATYVKPFKTDTIVIAPGQTTNALISADQSSGKYLVAASPFMDSPITVDNMTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G     +TTLT+ P QNAT VANNF++SLRSLNSK +PAKVP TVDH+LLFTVGLG
Sbjct  301   LHYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKIYPAKVPLTVDHNLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFT+DFPGNPP  FNYTGS
Sbjct  361   INPCPSCKAGNGSRVVASMNNVTFVMPTTALLQAHFFNISGVFTSDFPGNPPTTFNYTGS  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP NL+T++GTK+YRL YN+TVQLVLQDTGI+APENHPIHLHGFNFFAVG+G+GN+NPK
Sbjct  421   -PPTNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNYNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  480   VDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_010044089.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86095.1| hypothetical protein EUGRSUZ_B02796 [Eucalyptus grandis]
Length=556

 Score =   523 bits (1347),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 252/306 (82%), Positives = 280/306 (92%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDTIVIAPGQTTN +I+ DQ++G+YMVAASPFMD+PIAVDN T TAT
Sbjct  241   IVEVDATYVKPFKTDTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G     +TTLT+ P QNAT VANNFV+SLRSLNSK +PAK+P TVDHSLLFTVGLG
Sbjct  301   LHYSGTLAATSTTLTKTPPQNATAVANNFVNSLRSLNSKRYPAKIPLTVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK  NGSRVVAS+NNVTFVMPTTA+LQAHFF   GVFT+DFPGNPP  FNYTGS
Sbjct  361   INPCPSCKAGNGSRVVASMNNVTFVMPTTAILQAHFFNKSGVFTSDFPGNPPTIFNYTGS  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP+NL+T++GTK+YRL YN+TVQLVLQDTGI+APENHPIHLHGFNFFA+G+G+GN+NPK
Sbjct  421   -PPSNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAIGKGLGNYNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  480   VDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_002322961.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
 gb|EEF04722.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
Length=557

 Score =   523 bits (1347),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 252/306 (82%), Positives = 277/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++T ++  G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  242   VVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  +   TTLT  P +NAT +AN F +SLRSLNSKTFPAKVP TVDHSL FTVGLG
Sbjct  302   LHYSGALSNSPTTLTIPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FNYTG 
Sbjct  362   INPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYTG-  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT++GTK YRLPYN+TVQLV+QDTGI++PENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  421   TPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPKKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  481   TDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>emb|CDP06511.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   523 bits (1347),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 255/306 (83%), Positives = 277/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTI++APGQTTNVI+TADQ+AG+YMV+AS FMD+ IAVDN + TAT
Sbjct  246   VVEVDATYVKPFKTDTILVAPGQTTNVIVTADQSAGKYMVSASTFMDSTIAVDNTSATAT  305

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  ++  TT T  P+ NATPVAN F +SLRSLNS+ +PA+VPQTVDHSL F V LG
Sbjct  306   LHYSGTLSSSPTTFTTAPALNATPVANKFTNSLRSLNSEKYPAQVPQTVDHSLFFVVSLG  365

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK ANGSRVVASVNNVTFVMPT ALLQAHFF I GVFTTDFPGNPP  FNYTG 
Sbjct  366   INPCPTCKAANGSRVVASVNNVTFVMPTVALLQAHFFNINGVFTTDFPGNPPSPFNYTG-  424

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPPANLQT  GTK+YRLPYNATVQ+VLQDTGIVAPENHPIHLHGFNFFAVGRG+GNF+PK
Sbjct  425   TPPANLQTKNGTKVYRLPYNATVQVVLQDTGIVAPENHPIHLHGFNFFAVGRGLGNFDPK  484

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPKKFNLVDPVERNTIGVP GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  485   TDPKKFNLVDPVERNTIGVPTGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  544

Query  312   KGPNES  295
             KG NES
Sbjct  545   KGTNES  550



>emb|CAA74101.1| laccase [Populus trichocarpa]
Length=407

 Score =   516 bits (1330),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 249/306 (81%), Positives = 274/306 (90%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPG TTNV++T ++   + +VAASPFMDAPIAVDN T TAT
Sbjct  89    VVEVDATYVKPFKTDTVLIAPGHTTNVLVTTNKNTCKILVAASPFMDAPIAVDNMTATAT  148

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  +   TTLT  P +NAT +AN F +SLRSLNSKTFPAKVP TVDHSL FTVGLG
Sbjct  149   LHYSGALSNSPTTLTIPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVGLG  208

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FNYTG 
Sbjct  209   INPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYTG-  267

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT++GTK YRLPYN+TVQLV+QDTGI++PENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  268   TPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNPK  327

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPKKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  328   TDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  387

Query  312   KGPNES  295
             KGPNES
Sbjct  388   KGPNES  393



>gb|EYU41858.1| hypothetical protein MIMGU_mgv1a003895mg [Erythranthe guttata]
Length=557

 Score =   521 bits (1343),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 254/307 (83%), Positives = 277/307 (90%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             VVEVDATYVKPFKTDTI+IAPGQTTNVI+TADQ AG+YMVAASPFMD P+ AVDN+T TA
Sbjct  241   VVEVDATYVKPFKTDTILIAPGQTTNVIVTADQGAGKYMVAASPFMDTPVVAVDNKTATA  300

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G      T+ T  P QNATPVANNFV+SLRSLNSK +PAKVP  +DHSLLFTVGL
Sbjct  301   TIHYSGTLANSPTSFTATPPQNATPVANNFVNSLRSLNSKKYPAKVPMKIDHSLLFTVGL  360

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN CPSCK  NGSRVVASVNNVTFVMPT ALLQAH   IKGVFT+DFPGNPP AFNYTG
Sbjct  361   GINRCPSCKAGNGSRVVASVNNVTFVMPTVALLQAHVQNIKGVFTSDFPGNPPHAFNYTG  420

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             + PPANL T+TGTK+YRLPYNATVQ+VLQDTGI+APENHP+HLHGFNFFAVGRG+GN+NP
Sbjct  421   A-PPANLSTTTGTKVYRLPYNATVQVVLQDTGIIAPENHPVHLHGFNFFAVGRGLGNYNP  479

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDP  FNLVDPVERNTIGVP+GGWVAIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVDN
Sbjct  480   KTDPNNFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDN  539

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  540   GKGPNQS  546



>emb|CAC14718.1| laccase [Populus trichocarpa]
Length=396

 Score =   515 bits (1327),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 249/306 (81%), Positives = 274/306 (90%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPG TTNV++T ++   + +VAASPFMDAPIAVDN T TAT
Sbjct  78    VVEVDATYVKPFKTDTVLIAPGHTTNVLVTTNKNTCKILVAASPFMDAPIAVDNMTATAT  137

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  +   TTLT  P +NAT +AN F +SLRSLNSKTFPAKVP TVDHSL FTVGLG
Sbjct  138   LHYSGALSNSPTTLTIPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVGLG  197

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FNYTG 
Sbjct  198   INPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYTG-  256

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT++GTK YRLPYN+TVQLV+QDTGI++PENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  257   TPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNPK  316

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPKKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  317   TDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  376

Query  312   KGPNES  295
             KGPNES
Sbjct  377   KGPNES  382



>ref|XP_011094977.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=558

 Score =   521 bits (1343),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 252/307 (82%), Positives = 277/307 (90%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             VVEVDATYVKPFKTDT++IAPGQTTNVI+ ADQ AG+YM+AASPF+D PI AVDN T TA
Sbjct  242   VVEVDATYVKPFKTDTVLIAPGQTTNVIVVADQGAGKYMLAASPFLDTPIVAVDNMTATA  301

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY+G   +  TT T  P++NATPVANNFV+SLRSLNSK +PAKVPQ VDHSL FTVGL
Sbjct  302   TLHYSGTLASSPTTFTSTPARNATPVANNFVNSLRSLNSKKYPAKVPQKVDHSLFFTVGL  361

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPCPSCK  NGSR VAS+NNVTFVMPT ALLQAH   IKGVFTTDFP NPPFAFNYTG
Sbjct  362   GINPCPSCKAGNGSRAVASINNVTFVMPTIALLQAHVLKIKGVFTTDFPANPPFAFNYTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              TPPANL T+TGTK+Y+LPYN+TVQ+VLQDTGI+APENHP+HLHGFNFFAVGRG+GNFNP
Sbjct  422   -TPPANLATTTGTKVYKLPYNSTVQVVLQDTGIIAPENHPVHLHGFNFFAVGRGLGNFNP  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDPK FNL+DPVERNTIGVP+GGWVAIRF ADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  481   KTDPKNFNLIDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVEN  540

Query  315   GKGPNES  295
             G GPNES
Sbjct  541   GNGPNES  547



>ref|XP_006429309.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
 ref|XP_006480970.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR42549.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
Length=555

 Score =   521 bits (1343),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 250/306 (82%), Positives = 277/306 (91%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNV+++AD+ +G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  241   VVEVDATYVKPFKTDTIVIAPGQTTNVLLSADKTSGKYLVAASPFMDAPIAVDNATATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   + ATTLT  P +N T +AN F+DSLRSLNSK +PAKVPQTVDH+LLFTVGLG
Sbjct  301   LHYSGTLASSATTLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKVPQTVDHNLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHFF I GVFTTDFPGNPP  +N+TG+
Sbjct  361   VNPCPSCKAGNGSRVVASINNVTFVMPTIALLQAHFFNISGVFTTDFPGNPPHTYNFTGT  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NLQTS GTK YRL YN+TVQL+LQDTGI+APENHP+HLHGFNFFAVG+G+GNFNPK
Sbjct  421   --PKNLQTSNGTKAYRLAYNSTVQLILQDTGIIAPENHPVHLHGFNFFAVGKGLGNFNPK  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNTIGVP+GGWVAIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  479   KDPKKFNLVDPVERNTIGVPSGGWVAIRFSADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  538

Query  312   KGPNES  295
             KGPNES
Sbjct  539   KGPNES  544



>ref|XP_010044088.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86094.1| hypothetical protein EUGRSUZ_B02795 [Eucalyptus grandis]
Length=556

 Score =   521 bits (1342),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 251/306 (82%), Positives = 280/306 (92%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDTIVIAPGQTTN +I+ DQ++G+YMVAASPFMD+PIAVDN T TAT
Sbjct  241   IVEVDATYVKPFKTDTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G     +TTLT+ P QNAT VANNFV+SLRSLNSK +PAK+P TVDHSLLFTVGLG
Sbjct  301   LHYSGTLAATSTTLTKTPPQNATAVANNFVNSLRSLNSKRYPAKIPLTVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK  NGSRVVAS+NNVTFVMPTTA+LQAHFF   GVFT+DFPGNPP  FNYTGS
Sbjct  361   INPCPSCKAGNGSRVVASMNNVTFVMPTTAILQAHFFNKSGVFTSDFPGNPPTIFNYTGS  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP+NL+T++GTK+YRL YN+TVQLVLQDTGI+APENHPIHLHGFNFFA+G+G+GN+NPK
Sbjct  421   -PPSNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAIGKGLGNYNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  480   VDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGP+ES
Sbjct  540   KGPSES  545



>ref|XP_006338994.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=557

 Score =   518 bits (1334),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 250/306 (82%), Positives = 272/306 (89%), Gaps = 0/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTI+IAPGQTTNV++TADQ  G+YMV ASPFMD+P+ VDN T TAT
Sbjct  241   VVEVDATYVKPFKTDTILIAPGQTTNVLLTADQNFGKYMVVASPFMDSPVTVDNVTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG  +    TLT  P QNAT VANNF+ SL+SLNSK +PAKVP+ +DHSLLFTVGLG
Sbjct  301   LHYTGALSNAPMTLTSAPPQNATSVANNFIHSLKSLNSKKYPAKVPKNIDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+C P+NG RVVAS+NNVTFVMP TALLQAHFFGIK VFT DFPGNPPF FNYT +
Sbjct  361   INPCPTCIPSNGIRVVASINNVTFVMPKTALLQAHFFGIKNVFTMDFPGNPPFVFNYTST  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP +L T  GTKLYRL YNATVQLVLQDTGI+APENHPIHLHGFNFFAVG+G+GNFNPK
Sbjct  421   VPPPSLATMNGTKLYRLRYNATVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TD K FNL+DPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  481   TDTKNFNLMDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>ref|XP_010044087.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86093.1| hypothetical protein EUGRSUZ_B02794 [Eucalyptus grandis]
Length=556

 Score =   517 bits (1332),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 249/306 (81%), Positives = 279/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKT+TIVIAPGQTTN +I+ DQ++G+YMVAASPFMD+PIAVDN T TAT
Sbjct  241   IVEVDATYVKPFKTNTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G     +TTLT+ P QNAT VANNF++SLRSLNSK +PAKVP TVDHSLLFTVGLG
Sbjct  301   LHYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKRYPAKVPLTVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSCK  NGSRVVAS+NNVTFVMP+TALLQAHFF I GVFT+DFPGNP   FNYTGS
Sbjct  361   VNPCPSCKAGNGSRVVASMNNVTFVMPSTALLQAHFFNISGVFTSDFPGNPRTTFNYTGS  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP+NL+T++GTK++RL YN+TVQLVLQDTGI+APENHPIHLHGFNFF VG+G+GN+NPK
Sbjct  421   -PPSNLRTTSGTKVFRLHYNSTVQLVLQDTGIIAPENHPIHLHGFNFFTVGKGLGNYNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  480   VDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_007026782.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY07284.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
Length=490

 Score =   514 bits (1325),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 244/306 (80%), Positives = 279/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKT T++IAPGQTTNV+++AD+++G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  175   VVEVDATYVKPFKTKTVIIAPGQTTNVLVSADKSSGKYLVAASPFMDAPIAVDNLTATAT  234

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G      TTLT +P +NATPVANNF++SLR+LNSK +PA VPQ++DH+L FTVGLG
Sbjct  235   LHYSGTLANTPTTLTSLPPKNATPVANNFINSLRALNSKQYPALVPQSIDHNLFFTVGLG  294

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSR VAS+NNVTFVMPTTALLQAHFF I GVFTTDFP NPP  FNY+G 
Sbjct  295   INPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHFFNISGVFTTDFPANPPNVFNYSG-  353

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT+ GTK++RL YN+TVQLVLQDTGI+APENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  354   TPPTNLQTTNGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPK  413

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP+ FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWF+HCHLE+HTTWGLKMAFLVDNG
Sbjct  414   TDPQNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFLHCHLEVHTTWGLKMAFLVDNG  473

Query  312   KGPNES  295
             KGPN+S
Sbjct  474   KGPNQS  479



>ref|XP_010041000.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW44721.1| hypothetical protein EUGRSUZ_L01734 [Eucalyptus grandis]
Length=556

 Score =   517 bits (1332),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 249/306 (81%), Positives = 279/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKT+TIVIAPGQTTN +I+ DQ++G+YMVAASPFMD+PIAVDN T TAT
Sbjct  241   IVEVDATYVKPFKTNTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G     +TTLT+ P QNAT VANNF++SLRSLNSK +PAKVP TVDHSLLFTVGLG
Sbjct  301   LHYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKRYPAKVPLTVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSCK  NGSRVVAS+NNVTFVMP+TALLQAHFF I GVFT+DFPGNP   FNYTGS
Sbjct  361   VNPCPSCKAGNGSRVVASMNNVTFVMPSTALLQAHFFNISGVFTSDFPGNPRTTFNYTGS  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP+NL+T++GTK++RL YN+TVQLVLQDTGI+APENHPIHLHGFNFF VG+G+GN+NPK
Sbjct  421   -PPSNLRTTSGTKVFRLHYNSTVQLVLQDTGIIAPENHPIHLHGFNFFTVGKGLGNYNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  480   VDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_011003662.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=557

 Score =   516 bits (1329),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 249/306 (81%), Positives = 275/306 (90%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKT T++IAPGQTTNV++T ++  G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  242   LVEVDATYVKPFKTSTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  +   TTLT  P +NAT +AN F +SLRSLNSKTFPAKVP TVDHSL FTVGLG
Sbjct  302   LHYSGALSNSPTTLTVPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FNYTG 
Sbjct  362   INPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYTG-  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT++GTK YRLPYN+TVQLV+QDTGI++PENHPIHLHGFNFFAVG G+GN+NPK
Sbjct  421   TPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGGGVGNYNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPKKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  481   TDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>ref|XP_007026781.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY07283.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
Length=556

 Score =   516 bits (1328),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 244/306 (80%), Positives = 279/306 (91%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKT T++IAPGQTTNV+++AD+++G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  241   VVEVDATYVKPFKTKTVIIAPGQTTNVLVSADKSSGKYLVAASPFMDAPIAVDNLTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G      TTLT +P +NATPVANNF++SLR+LNSK +PA VPQ++DH+L FTVGLG
Sbjct  301   LHYSGTLANTPTTLTSLPPKNATPVANNFINSLRALNSKQYPALVPQSIDHNLFFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSR VAS+NNVTFVMPTTALLQAHFF I GVFTTDFP NPP  FNY+G 
Sbjct  361   INPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHFFNISGVFTTDFPANPPNVFNYSG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT+ GTK++RL YN+TVQLVLQDTGI+APENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  420   TPPTNLQTTNGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP+ FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWF+HCHLE+HTTWGLKMAFLVDNG
Sbjct  480   TDPQNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFLHCHLEVHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPN+S
Sbjct  540   KGPNQS  545



>gb|KHG18161.1| Laccase-4 -like protein [Gossypium arboreum]
Length=556

 Score =   515 bits (1326),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 248/306 (81%), Positives = 274/306 (90%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK DT+VIAPGQTTNV+++ADQ +G+YMVAASPFMDAP+AVDN T TAT
Sbjct  241   VVEVDATYVKPFKIDTVVIAPGQTTNVLVSADQNSGKYMVAASPFMDAPVAVDNLTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G      T+LT  P QNAT VANNF+DSLRSLNSK FPA VP T+DH+L FTVGLG
Sbjct  301   LHYSGTLDNTPTSLTTPPPQNATSVANNFIDSLRSLNSKQFPALVPPTIDHNLYFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK  NGSRVVAS+NNVTF MPTTALLQAHFF I GVFTTDFP  PP  FNYTG 
Sbjct  361   VNPCPTCKAGNGSRVVASINNVTFTMPTTALLQAHFFNISGVFTTDFPSTPPHVFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT  GTK++RL YN+TVQLVLQDTGI+APENHPIHLHGFNFFAVG+G+GN+NPK
Sbjct  420   TPPKNLQTRNGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGKGLGNYNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP+KFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  480   TDPQKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPN+S
Sbjct  540   KGPNQS  545



>ref|XP_011019227.1| PREDICTED: laccase-4-like, partial [Populus euphratica]
Length=315

 Score =   504 bits (1299),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 243/305 (80%), Positives = 270/305 (89%), Gaps = 1/305 (0%)
 Frame = -2

Query  1209  VEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTATL  1030
             VEVDATYVKPFKTDT++IAPGQTTNV++T ++  G+Y+VAASPFMD+PIAVDN T TATL
Sbjct  1     VEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDSPIAVDNMTATATL  60

Query  1029  HYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLGI  850
              Y+G      TTLT  P +NAT VAN F++SLRSLNS+ FPAKVP  VDH+L FTVGLG+
Sbjct  61    QYSGALANSPTTLTTPPPKNATAVANQFINSLRSLNSRKFPAKVPLNVDHNLFFTVGLGV  120

Query  849   NPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGST  670
             NPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FNYTG T
Sbjct  121   NPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYTG-T  179

Query  669   PPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPKT  490
             PP NLQT +GTK+YRL YN+TVQLV+QDTGI++PENHPIHLHGFNFFAVGRG+GN+NPKT
Sbjct  180   PPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNPKT  239

Query  489   DPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGK  310
             D KKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNGK
Sbjct  240   DTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGK  299

Query  309   GPNES  295
             GP ES
Sbjct  300   GPKES  304



>ref|XP_002322962.2| laccase family protein [Populus trichocarpa]
 gb|EEF04723.2| laccase family protein [Populus trichocarpa]
Length=564

 Score =   511 bits (1315),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 246/306 (80%), Positives = 274/306 (90%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDT++IAPGQTTNV++T ++  G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  249   LVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATAT  308

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  +   TTLT  P +NAT VAN F +SLRSLNSK FPAKVP TVDH+L FTVGLG
Sbjct  309   LHYSGALSGTPTTLTIPPPKNATAVANQFTNSLRSLNSKRFPAKVPLTVDHNLFFTVGLG  368

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FNYTG 
Sbjct  369   INPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPSKPPHVFNYTG-  427

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT++GTK+YRL YN+TV+LV+QDTGI++PENHPIHLHGFNFF VGRG+GN+NPK
Sbjct  428   TPPTNLQTTSGTKVYRLRYNSTVELVMQDTGIISPENHPIHLHGFNFFGVGRGVGNYNPK  487

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPKKFNLVDPVERNTIGVP+GGWVAIRFR DNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  488   TDPKKFNLVDPVERNTIGVPSGGWVAIRFRVDNPGVWFMHCHLEVHTTWGLKMAFLVDNG  547

Query  312   KGPNES  295
             KGPNES
Sbjct  548   KGPNES  553



>gb|KDP24484.1| hypothetical protein JCGZ_25048 [Jatropha curcas]
Length=486

 Score =   508 bits (1307),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 240/306 (78%), Positives = 275/306 (90%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++TADQ++G+Y+VAA+PFMDAP+AVDN+T TAT
Sbjct  171   VVEVDATYVKPFKTDTVLIAPGQTTNVLVTADQSSGKYLVAAAPFMDAPVAVDNKTATAT  230

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+   ++  T LT+ P QNAT VAN F++SLRSLNSK +PAKVP  +DH+LLFTVGLG
Sbjct  231   LHYSAALSSTTTILTKPPPQNATAVANKFINSLRSLNSKKYPAKVPLKIDHNLLFTVGLG  290

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP NPP  FN+TG 
Sbjct  291   VNPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNINGVFTTDFPANPPHVFNFTGK  350

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               PANLQT  GT++Y+L YN TVQLV+QDTGI+APENHP+HLHGFNFFAVGRGIG++NPK
Sbjct  351   G-PANLQTKNGTRVYKLKYNETVQLVMQDTGIIAPENHPVHLHGFNFFAVGRGIGSYNPK  409

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP+ FNLVDP ERNTIGVP GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  410   TDPQNFNLVDPPERNTIGVPTGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  469

Query  312   KGPNES  295
             KGPNES
Sbjct  470   KGPNES  475



>ref|XP_004246339.1| PREDICTED: laccase-4 [Solanum lycopersicum]
Length=561

 Score =   510 bits (1313),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 242/309 (78%), Positives = 274/309 (89%), Gaps = 3/309 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY+KPF+TDTIVIAPGQTTNVI+ A++ +G+YMV ASPFMDAPIAVDN T  AT
Sbjct  242   VVEVDATYIKPFQTDTIVIAPGQTTNVIVNANKNSGKYMVVASPFMDAPIAVDNVTAIAT  301

Query  1032  LHYTGVQt---tlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTV  862
             LHY+G  +   +   T T  P +NATP+ANNF+D+LRSLNSK +PAKVP  +DHSLLFTV
Sbjct  302   LHYSGTLSNNPSTTLTSTNTPPKNATPIANNFLDALRSLNSKKYPAKVPIKIDHSLLFTV  361

Query  861   GLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNY  682
             GLGINPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHF GIKGVFT DFPGNPP  +NY
Sbjct  362   GLGINPCPSCKQGNGSRVVASINNVTFVMPTIALLQAHFSGIKGVFTADFPGNPPVVYNY  421

Query  681   TGSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNF  502
             T +TPPAN+ T++GTK+Y+L YN TVQLVLQDTGI+APENHPIHLHGFNF+ VG+G+GN+
Sbjct  422   TSTTPPANMGTTSGTKVYKLSYNDTVQLVLQDTGIIAPENHPIHLHGFNFYQVGKGLGNY  481

Query  501   NPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV  322
             NPK DPK FNLVDPVERNT+GVP+GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV
Sbjct  482   NPKVDPKNFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV  541

Query  321   DNGKGPNES  295
             +NGKGPNES
Sbjct  542   ENGKGPNES  550



>gb|KHG11130.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   506 bits (1304),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 243/306 (79%), Positives = 275/306 (90%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK DT+VIAPGQTTNV+++ADQ++G+Y+VAASPFMDAP+AVDN T TAT
Sbjct  188   VVEVDATYVKPFKIDTVVIAPGQTTNVLLSADQSSGKYLVAASPFMDAPVAVDNLTATAT  247

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G      TTLT  P +NAT VAN F++SLR+LNSK FPA VPQT+DHSL FTVGLG
Sbjct  248   VHYSGTLANTPTTLTAPPPKNATAVANKFINSLRALNSKQFPALVPQTIDHSLYFTVGLG  307

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSR VASVNN+TF MPTTALLQAHFF I GVFTTDFP NPP  FNY+G 
Sbjct  308   INPCPTCKAGNGSRAVASVNNLTFTMPTTALLQAHFFNISGVFTTDFPANPPHKFNYSG-  366

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NL+T TGTK++RL YN+TVQLVLQDTGI+APENHPIHLHGFNFF+VG+G+GN+NPK
Sbjct  367   TPPTNLKTMTGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFNFFSVGKGLGNYNPK  426

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP+ FNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  427   TDPQNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  486

Query  312   KGPNES  295
             KGPN+S
Sbjct  487   KGPNQS  492



>ref|XP_006363052.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=561

 Score =   508 bits (1307),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 241/309 (78%), Positives = 271/309 (88%), Gaps = 3/309 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY+KPF+TDTIVIAPGQTTNVI+ A++ +G+YMV ASPFMD+PIAVDN T  AT
Sbjct  242   VVEVDATYIKPFQTDTIVIAPGQTTNVIVNANKNSGKYMVVASPFMDSPIAVDNVTAIAT  301

Query  1032  LHYTGV---QttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTV  862
             LHY+       +   T T  P +NATP+ANNF+DSLRSLNSK +PAKVP  +DHSLLFTV
Sbjct  302   LHYSATLTNNPSTTLTSTNTPPKNATPIANNFLDSLRSLNSKKYPAKVPIKIDHSLLFTV  361

Query  861   GLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNY  682
              LGINPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHF GIKGVFT DFPGNPPF +NY
Sbjct  362   SLGINPCPSCKQGNGSRVVASINNVTFVMPTIALLQAHFSGIKGVFTADFPGNPPFVYNY  421

Query  681   TGSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNF  502
             T +TPPAN+ T++GTK+Y+L YN TVQLVLQDTGI+APENHPIHLHGFNF+ VG+G+GN+
Sbjct  422   TNTTPPANMGTTSGTKVYKLSYNDTVQLVLQDTGIIAPENHPIHLHGFNFYQVGKGLGNY  481

Query  501   NPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV  322
             NPK DPK FNLVDPVERNT+GVP+GGWVAIRFR DNPGVWFMHCHLEIHTTWGLKMAFLV
Sbjct  482   NPKVDPKNFNLVDPVERNTVGVPSGGWVAIRFRTDNPGVWFMHCHLEIHTTWGLKMAFLV  541

Query  321   DNGKGPNES  295
             DNGKGPNES
Sbjct  542   DNGKGPNES  550



>ref|XP_008442464.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis melo]
Length=559

 Score =   507 bits (1305),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 246/306 (80%), Positives = 272/306 (89%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++TA+Q +G+YMVA SPFMDAP+AVDN+T TAT
Sbjct  244   VVEVDATYVKPFKTDTVIIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HYTG   T  TT T  P QNAT +AN F++SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  304   VHYTGTLATSLTTSTNPPPQNATQIANAFINSLRSLNSKKYPANVPLTIDHHLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK ANGSRVVAS+NNVTFVMPTTALLQAHFF  KGVFTTDFP  PP  FNY+G 
Sbjct  364   INPCPTCKAANGSRVVASINNVTFVMPTTALLQAHFFKTKGVFTTDFPXKPPHKFNYSGP  423

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NLQT+T TKLY+L YN+TV+LVLQDTGI+APENHPIHLHGFNFF VGRGIGNFNPK
Sbjct  424   G-PKNLQTTTATKLYKLQYNSTVELVLQDTGIIAPENHPIHLHGFNFFEVGRGIGNFNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPKKFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV+NG
Sbjct  483   TDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVENG  542

Query  312   KGPNES  295
             KGPN+S
Sbjct  543   KGPNQS  548



>ref|XP_008449180.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=556

 Score =   507 bits (1305),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 247/306 (81%), Positives = 273/306 (89%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTN +ITADQ +G+Y+VAASPFMD+PIAVDN T TAT
Sbjct  241   VVEVDATYVKPFKTDTIVIAPGQTTNALITADQTSGKYLVAASPFMDSPIAVDNNTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+    T ATTLT  P QNATPVANNF+DSLRSLNS T+PAKVP T+DH+L FTVGLG
Sbjct  301   LHYSDTLATTATTLTVPPPQNATPVANNFIDSLRSLNSNTYPAKVPLTIDHNLYFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSR VAS+NNVTFVMPTTALLQAH+F I GVFTTDFP NPP  FNYTGS
Sbjct  361   INPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHYFNINGVFTTDFPANPPHVFNYTGS  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P +NLQT+ GTKLY+L +N+TV+LVLQDTGI+A ENHPIHLHGFNFF VGRGIGN++ K
Sbjct  421   GP-SNLQTTRGTKLYKLKFNSTVELVLQDTGIIAAENHPIHLHGFNFFVVGRGIGNYDAK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  480   NDPKSFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_006387495.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
 gb|ERP46409.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
Length=559

 Score =   507 bits (1305),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 245/306 (80%), Positives = 270/306 (88%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++T ++  G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  244   VVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y+G      TTLT  P +NAT VAN F +SLRSLNS+ FPAKVP  VDH+L FTVGLG
Sbjct  304   LQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FNYTG 
Sbjct  364   VNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYTG-  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT +GTK+YRL YN+TVQLV+QDTGI++PENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  423   TPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TD KKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  483   TDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  542

Query  312   KGPNES  295
             KGP ES
Sbjct  543   KGPKES  548



>ref|XP_011019150.1| PREDICTED: laccase-4 isoform X1 [Populus euphratica]
Length=559

 Score =   506 bits (1303),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 243/306 (79%), Positives = 270/306 (88%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++T ++  G Y+VAASPFMD+PIAVDN T TAT
Sbjct  244   VVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGNYLVAASPFMDSPIAVDNMTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y+G      TTLT  P +NAT VAN F++SLRSLNS+ FPAKVP  VDH+L FTVGLG
Sbjct  304   LQYSGALANSPTTLTTPPPKNATAVANQFINSLRSLNSRKFPAKVPMNVDHNLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FNY+G 
Sbjct  364   VNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYSG-  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT +GTK+YRL YN+TVQLV+QDTGI++PENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  423   TPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TD KKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  483   TDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  542

Query  312   KGPNES  295
             KGP ES
Sbjct  543   KGPKES  548



>ref|XP_004137913.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN58791.1| hypothetical protein Csa_3G732490 [Cucumis sativus]
Length=559

 Score =   506 bits (1303),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/306 (80%), Positives = 271/306 (89%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++TA+Q +G+YMVA SPFMDAP+AVDN+T TAT
Sbjct  244   VVEVDATYVKPFKTDTVLIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HYTG   T  TT T  P QNAT +AN F +SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  304   VHYTGTLATSLTTSTNPPPQNATQIANAFTNSLRSLNSKKYPANVPLTIDHHLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK ANGSRVVAS+NNVTFVMPTTALLQAHFF  KGVFTTDFPGNPP  FNY+G 
Sbjct  364   INPCPTCKAANGSRVVASINNVTFVMPTTALLQAHFFKTKGVFTTDFPGNPPHKFNYSGP  423

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NLQT + TKLY+L YN+TV+LVLQDTGI+APENHPIHLHGFNFF VGRGIGNFNPK
Sbjct  424   G-PKNLQTISATKLYKLQYNSTVELVLQDTGIIAPENHPIHLHGFNFFEVGRGIGNFNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP KFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV+NG
Sbjct  483   TDPTKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVENG  542

Query  312   KGPNES  295
             KGPN+S
Sbjct  543   KGPNQS  548



>ref|XP_011019151.1| PREDICTED: laccase-4 isoform X2 [Populus euphratica]
Length=558

 Score =   505 bits (1301),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 243/306 (79%), Positives = 270/306 (88%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++T ++  G Y+VAASPFMD+PIAVDN T TAT
Sbjct  243   VVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGNYLVAASPFMDSPIAVDNMTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y+G      TTLT  P +NAT VAN F++SLRSLNS+ FPAKVP  VDH+L FTVGLG
Sbjct  303   LQYSGALANSPTTLTTPPPKNATAVANQFINSLRSLNSRKFPAKVPMNVDHNLFFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FNY+G 
Sbjct  363   VNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYSG-  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT +GTK+YRL YN+TVQLV+QDTGI++PENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  422   TPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNPK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TD KKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  482   TDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  541

Query  312   KGPNES  295
             KGP ES
Sbjct  542   KGPKES  547



>ref|XP_004163861.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=559

 Score =   505 bits (1301),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 245/306 (80%), Positives = 271/306 (89%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++TA+Q +G+YMVA SPFMDAP+AVDN+T TAT
Sbjct  244   VVEVDATYVKPFKTDTVLIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HYTG   T  TT T  P QNAT +AN F +SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  304   VHYTGTLATSLTTSTNPPPQNATQIANAFTNSLRSLNSKKYPANVPLTIDHHLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK ANGSRVVAS+NNVTFVMPTTALLQ HFF  KGVFTTDFPGNPP  FNY+G 
Sbjct  364   INPCPTCKAANGSRVVASINNVTFVMPTTALLQGHFFKTKGVFTTDFPGNPPHKFNYSGP  423

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NLQT++ TKLY+L YN+TV+LVLQDTGI+APENHPIHLHGFNFF VGRGIGNFNPK
Sbjct  424   G-PKNLQTTSATKLYKLQYNSTVELVLQDTGIIAPENHPIHLHGFNFFEVGRGIGNFNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP KFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV+NG
Sbjct  483   TDPTKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVENG  542

Query  312   KGPNES  295
             KGPN+S
Sbjct  543   KGPNQS  548



>ref|XP_002308209.2| laccase family protein [Populus trichocarpa]
 gb|EEE91732.2| laccase family protein [Populus trichocarpa]
Length=559

 Score =   505 bits (1300),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 244/306 (80%), Positives = 269/306 (88%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++T ++  G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  244   VVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y+G      TTLT  P +NAT VAN F +SLRSLNS+ FPAKVP  VDH+L FTVGLG
Sbjct  304   LQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHF  I GVFTTDFP  PP  FNYTG 
Sbjct  364   VNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFLNISGVFTTDFPAKPPHVFNYTG-  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT +GTK+YRL YN+TVQLV+QDTGI++PENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  423   TPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TD KKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  483   TDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  542

Query  312   KGPNES  295
             KGP ES
Sbjct  543   KGPKES  548



>ref|XP_003516941.1| PREDICTED: laccase-4-like [Glycine max]
Length=557

 Score =   503 bits (1295),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 241/306 (79%), Positives = 267/306 (87%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK +TIVIAPGQTTNV++ A+Q +G+Y+VAASPFMDAP+AVDN T TAT
Sbjct  242   VVEVDATYVKPFKIETIVIAPGQTTNVLLNANQKSGKYLVAASPFMDAPVAVDNLTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG      T LT  P +NAT +ANNF+ SLR LNSK +P  VP TVDHSL+FTVGLG
Sbjct  302   LHYTGTLAATPTILTTPPPKNATQIANNFISSLRGLNSKKYPVNVPLTVDHSLIFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK ANGSRVVA++NNVTF+MPT ALLQAH+F IKGVFTTDFP NPP  FNY+G 
Sbjct  362   INPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTTDFPANPPHVFNYSGP  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               PANL T TGTK+YRLP+NATVQ+VLQDTGI+APENHP+HLHGFNFF VGRG+GNFNPK
Sbjct  422   G-PANLNTETGTKVYRLPFNATVQVVLQDTGIIAPENHPVHLHGFNFFVVGRGVGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTIGVPAGGW A RFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  481   IDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  540

Query  312   KGPNES  295
             KGP +S
Sbjct  541   KGPKQS  546



>ref|XP_004147923.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004165325.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN54357.1| hypothetical protein Csa_4G308480 [Cucumis sativus]
Length=556

 Score =   502 bits (1292),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 244/306 (80%), Positives = 271/306 (89%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTI+IAPGQTTN +ITADQ +G+Y+VAASPFMD+PIAVDN T TAT
Sbjct  241   VVEVDATYVKPFKTDTILIAPGQTTNALITADQTSGKYLVAASPFMDSPIAVDNNTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY G   T A TLT  P QNATPVANNF+DSLRSLNS T+PAKVP T+DH+L FTVGLG
Sbjct  301   LHYAGTLATTAATLTAPPPQNATPVANNFIDSLRSLNSNTYPAKVPLTIDHNLYFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSR VAS+NNVTFVMPTTALLQAH+F I GVFTTDFP NPP  FNYTGS
Sbjct  361   INPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHYFNINGVFTTDFPANPPHVFNYTGS  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P+NLQT+ GTKLY+L +N+TV+LVLQDTGI+  ENHPIHLHGFNFF VGRGIGN++ K
Sbjct  421   G-PSNLQTTRGTKLYKLKFNSTVELVLQDTGILTAENHPIHLHGFNFFVVGRGIGNYDAK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  480   NDPKSFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  539

Query  312   KGPNES  295
             KGPN+S
Sbjct  540   KGPNQS  545



>ref|XP_002308208.2| laccase family protein [Populus trichocarpa]
 gb|EEE91731.2| laccase family protein [Populus trichocarpa]
Length=558

 Score =   502 bits (1292),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 242/306 (79%), Positives = 268/306 (88%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDT++IAPGQTTNV++T ++  G+Y+VAASPFMD+PIAVDN T TAT
Sbjct  243   VVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDSPIAVDNMTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y+G      TTLT  P +NAT VAN F +SLRSLNS+ FPAKVP  VDH+L FTV LG
Sbjct  303   LQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTVSLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHF  I GVFTTDFP  PP  FNYTG 
Sbjct  363   VNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFLNISGVFTTDFPAKPPHVFNYTG-  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT +GTK+YRL YN+TVQLV+QDTGI++PENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  422   TPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFNFFAVGRGVGNYNPK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TD KKFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  482   TDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  541

Query  312   KGPNES  295
             KGP ES
Sbjct  542   KGPKES  547



>ref|XP_010923124.1| PREDICTED: laccase-22 [Elaeis guineensis]
Length=554

 Score =   501 bits (1291),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 242/306 (79%), Positives = 272/306 (89%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY KPFKTDTI+I PGQTTNV++TAD+ AG+Y+V ASPFMD+PIAVDNQT  AT
Sbjct  241   VVEVDATYTKPFKTDTILITPGQTTNVLLTADRGAGRYLVTASPFMDSPIAVDNQTAMAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HYT   +T   T T+ P QNATPVA+NF+DSLRSLNSK +PA+VP TVDHSLLFTVGLG
Sbjct  301   VHYTNTVSTTVLTTTKPPPQNATPVASNFIDSLRSLNSKKYPARVPLTVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C   NGSRVVA VNNVTF MPTTA+LQAH+F I GVFT DFPG PP AFNY+GS
Sbjct  361   VNPCPTC--VNGSRVVADVNNVTFSMPTTAILQAHYFNISGVFTADFPGKPPIAFNYSGS  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P +NL T TGT++YRLP+N+TVQLVLQDTGI+APENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  419   GP-SNLGTMTGTRVYRLPFNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPK  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             T P KFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  478   TSPSKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  537

Query  312   KGPNES  295
             KGPNES
Sbjct  538   KGPNES  543



>ref|XP_010553253.1| PREDICTED: laccase-4 [Tarenaya hassleriana]
Length=559

 Score =   501 bits (1291),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 238/306 (78%), Positives = 271/306 (89%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFKTDT++IAPGQTTNV++TA ++AG+Y+V  SPFMDAPIAVDN T TAT
Sbjct  244   VVEVDALYVKPFKTDTVLIAPGQTTNVLLTASKSAGKYLVTVSPFMDAPIAVDNVTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++ AT LT  P QN+T ++NNF +SLRSLNSK +PA VP+ VDH L FTVGLG
Sbjct  304   VHYSGTLSSSATVLTLPPPQNSTAISNNFTNSLRSLNSKKYPALVPKEVDHHLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK ANGSRVVAS+NNVTF MPTTALLQAH+F I GVFTTDFP NPP  +NYTGS
Sbjct  364   VNPCPTCKAANGSRVVASINNVTFTMPTTALLQAHYFNISGVFTTDFPKNPPHVYNYTGS  423

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PPANL T  GT+LY+LPYNATV++VLQDTGI++PENHP+HLHGFNFF VGRGIGNFNPK
Sbjct  424   -PPANLATEKGTRLYKLPYNATVEVVLQDTGIISPENHPVHLHGFNFFQVGRGIGNFNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNL DPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  483   KDPKSFNLDDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  542

Query  312   KGPNES  295
             KGPNES
Sbjct  543   KGPNES  548



>ref|XP_008785423.1| PREDICTED: laccase-22 [Phoenix dactylifera]
Length=554

 Score =   501 bits (1290),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 238/306 (78%), Positives = 267/306 (87%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY KPFKTDTI+I PGQTTNV++TADQ AG+Y+V ASPFMD+PIAVDNQT  A 
Sbjct  241   VVEVDATYTKPFKTDTILITPGQTTNVLLTADQGAGRYLVTASPFMDSPIAVDNQTAMAV  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HYT      A T  + P QNATPVA+NF+DSLRSLNSK +PA+VP TVDHSLLFTVGLG
Sbjct  301   VHYTNTVAASALTAIKPPPQNATPVASNFIDSLRSLNSKQYPARVPSTVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C   NGSRVVA +NNV+F MPTTA+LQAH+F + GVFT DFPG PP AFNYTGS
Sbjct  361   VNPCPTC--VNGSRVVADMNNVSFTMPTTAILQAHYFNVSGVFTDDFPGKPPIAFNYTGS  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P  NL T TGT++YRLP+N+TVQLVLQDTGI+APENHPIHLHGFNFFAVGRG+GN+NPK
Sbjct  419   GP-RNLGTMTGTRVYRLPFNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPK  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
               P KFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  478   RSPSKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  537

Query  312   KGPNES  295
             KGPNES
Sbjct  538   KGPNES  543



>ref|XP_008239590.1| PREDICTED: laccase-4-like [Prunus mume]
Length=559

 Score =   501 bits (1290),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 246/308 (80%), Positives = 275/308 (89%), Gaps = 3/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDTIVIAPGQTTN +ITA+Q +G+Y+VAASPFMD+PIAVDN T TAT
Sbjct  242   IVEVDATYVKPFKTDTIVIAPGQTTNALITANQNSGKYLVAASPFMDSPIAVDNLTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   T  TTLT  P QNAT VANNF++SL+SLNSK FPAKVP  VDH+LLFTVGLG
Sbjct  302   LHYSGTLATTPTTLTNPPPQNATQVANNFINSLKSLNSKKFPAKVPLKVDHNLLFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVASVNNVTFVMPTTALLQAH F I GVFTTDFPGNPP  FN++G 
Sbjct  362   INPCPTCKAGNGSRVVASVNNVTFVMPTTALLQAHVFNISGVFTTDFPGNPPNTFNFSGG  421

Query  672   TPPAN--LQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
              PPAN  + T+ GTKLYRL YN+TVQLVLQDTG +APENHP+HLHGFNF++VGRG+GN+N
Sbjct  422   -PPANASMATTNGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHGFNFYSVGRGVGNYN  480

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PK DPKKFNLVDPVERNT+GVP+GGW AIRF+ADNPGVWF+HCHLE+HTTWGLKMAFLVD
Sbjct  481   PKKDPKKFNLVDPVERNTVGVPSGGWAAIRFQADNPGVWFLHCHLEVHTTWGLKMAFLVD  540

Query  318   NGKGPNES  295
             NGKGPNES
Sbjct  541   NGKGPNES  548



>ref|XP_009358852.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=559

 Score =   499 bits (1286),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 245/308 (80%), Positives = 273/308 (89%), Gaps = 3/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDTIVIAPGQTTN ++TA+Q +G+YM+AASPFMD+PIAVDN T TAT
Sbjct  242   IVEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMMAASPFMDSPIAVDNLTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   +  TTLT  P QNAT VAN+F++SL++LNS  FPAKVP  +DH+LLFTVGLG
Sbjct  302   LHYTGTLASTPTTLTSPPPQNATQVANSFINSLKALNSNKFPAKVPLKIDHNLLFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK  NGSRVVASVNNVTFVMPTTALLQAHFF   GVFTTDFPGNPP AFNY+G 
Sbjct  362   INPCPSCKAGNGSRVVASVNNVTFVMPTTALLQAHFFNKSGVFTTDFPGNPPMAFNYSGG  421

Query  672   TPPAN--LQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
              PPAN  L T+ GT+LYRL YN+TVQLVLQDTG +APENHPIHLHG+NFF+VGRG+GN+N
Sbjct  422   -PPANSSLATTNGTRLYRLAYNSTVQLVLQDTGTIAPENHPIHLHGYNFFSVGRGVGNYN  480

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PKTDPKKFNLVDPVERNT  VP+GGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVD
Sbjct  481   PKTDPKKFNLVDPVERNTANVPSGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFLVD  540

Query  318   NGKGPNES  295
             NGKGPN+S
Sbjct  541   NGKGPNQS  548



>ref|XP_007205010.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
 gb|EMJ06209.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
Length=559

 Score =   499 bits (1284),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 244/308 (79%), Positives = 274/308 (89%), Gaps = 3/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDTIVIAPGQTTN +ITA+Q +G+Y+VAASPFMD+PIAVDN T TAT
Sbjct  242   IVEVDATYVKPFKTDTIVIAPGQTTNALITANQNSGKYLVAASPFMDSPIAVDNLTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   T  TTLT  P QNAT VANNF++SL+SLNSK FPAKVP  +DH+LLFTVGLG
Sbjct  302   LHYSGTLATTPTTLTNPPPQNATQVANNFINSLKSLNSKKFPAKVPLKIDHNLLFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVASVNNVTFVMPTTALLQAH F I GVFTTDFPGNPP  FN++G 
Sbjct  362   INPCPTCKAGNGSRVVASVNNVTFVMPTTALLQAHVFNISGVFTTDFPGNPPNTFNFSGG  421

Query  672   TPPAN--LQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
              P AN  + T+ GTKLYRL YN+TVQLVLQDTG +APENHP+HLHG+NF+AVGRG+GN+N
Sbjct  422   -PSANASMATTNGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHGYNFYAVGRGVGNYN  480

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PK DPKKFNLVDPVERNT+GVP+GGW AIRF+ADNPGVWF+HCHLE+HTTWGLKMAFLVD
Sbjct  481   PKKDPKKFNLVDPVERNTVGVPSGGWAAIRFQADNPGVWFLHCHLEVHTTWGLKMAFLVD  540

Query  318   NGKGPNES  295
             NGKGPNES
Sbjct  541   NGKGPNES  548



>ref|XP_003522150.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN02155.1| Laccase-4 [Glycine soja]
Length=557

 Score =   497 bits (1280),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 239/306 (78%), Positives = 265/306 (87%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK +TI+IAPGQTTNV++ ADQ  G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  242   VVEVDATYVKPFKIETILIAPGQTTNVLLNADQKFGKYLVAASPFMDAPIAVDNLTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG      T LT  P +N+T +ANNF+ SLR LNSK +P  VP TVDHSL FTVGLG
Sbjct  302   LHYTGTLAATPTILTTPPPKNSTQIANNFISSLRGLNSKKYPVNVPLTVDHSLFFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PCPSCK ANGSRVVA++NNVTF+MPT ALLQAH+F IKGVFTTDFP NPP  FNY+G 
Sbjct  362   ISPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTTDFPANPPHLFNYSGP  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               PANL T TGTK+YR+P+NATVQ+VLQDTGI+APENHP+HLHGFNFF VGRG+GNFNPK
Sbjct  422   G-PANLNTETGTKVYRVPFNATVQVVLQDTGIIAPENHPVHLHGFNFFVVGRGVGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTIGVPAGGW A RFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  481   IDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  540

Query  312   KGPNES  295
             KGP +S
Sbjct  541   KGPKQS  546



>gb|EYU26646.1| hypothetical protein MIMGU_mgv1a003805mg [Erythranthe guttata]
Length=563

 Score =   496 bits (1278),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/307 (79%), Positives = 266/307 (87%), Gaps = 1/307 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VV+VDATYVKPFKT TIVIAPGQTT  I+TAD+  G+Y+VAAS FMD P +AVDN T TA
Sbjct  246   VVDVDATYVKPFKTGTIVIAPGQTTTAILTADRNTGKYIVAASTFMDTPGVAVDNTTATA  305

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY+G  +T  TT T  P QNATPVANNFV+SLRSLNSK +PAKVPQ VD SLLFT+GL
Sbjct  306   TLHYSGTLSTSPTTFTAPPPQNATPVANNFVNSLRSLNSKNYPAKVPQKVDRSLLFTIGL  365

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPC +CK  NGSRVVA +NNVTFVMP  ALLQAH F IKGVFTTDFPGNPP +FNYTG
Sbjct  366   GINPCATCKAGNGSRVVADINNVTFVMPKIALLQAHVFNIKGVFTTDFPGNPPVSFNYTG  425

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+N  T  GTKLYR+PYN T+Q+VLQDTGI+APENHPIHLHGFNFF VGRG+GNFN 
Sbjct  426   GPPPSNFGTRNGTKLYRVPYNTTIQVVLQDTGIIAPENHPIHLHGFNFFVVGRGLGNFNS  485

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDPK+FNLVDPVERNTIGVP+GGWVAIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVDN
Sbjct  486   KTDPKQFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDN  545

Query  315   GKGPNES  295
             GK PNES
Sbjct  546   GKSPNES  552



>ref|XP_009370205.1| PREDICTED: laccase-4 [Pyrus x bretschneideri]
Length=559

 Score =   496 bits (1276),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 247/307 (80%), Positives = 273/307 (89%), Gaps = 1/307 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDTIVIAPGQTTN ++TA+Q +G+YMVAASPFMD+PIAVDN T TAT
Sbjct  242   IVEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMVAASPFMDSPIAVDNLTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   T  TTLT  P QNAT VAN+F++SL++LNSK FPAKVP  +DH+LLFTVGLG
Sbjct  302   LHYTGTLATTPTTLTSAPPQNATQVANSFINSLKALNSKKFPAKVPLKIDHNLLFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             IN CPSCK ANGSRVVASVNNVTFVMPTTALLQAHFF   GVFTTDFPGNPP AFN++G 
Sbjct  362   INSCPSCKAANGSRVVASVNNVTFVMPTTALLQAHFFNKSGVFTTDFPGNPPTAFNFSGG  421

Query  672   TPP-ANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              P  A+L T++GTKLYRL YN+TVQLVLQDTG +APENHP+HLHGFNFF+VGRGIGN+N 
Sbjct  422   LPANASLATTSGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHGFNFFSVGRGIGNYNS  481

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDPKKFNLVDPVERNT  VP GGWVAIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVDN
Sbjct  482   KTDPKKFNLVDPVERNTANVPTGGWVAIRFIADNPGVWFMHCHLEVHTTWGLKMAFLVDN  541

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  542   GKGPNQS  548



>ref|XP_007134763.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
 gb|ESW06757.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
Length=527

 Score =   494 bits (1272),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 239/306 (78%), Positives = 266/306 (87%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK +TIVIAPGQTTNV+++ADQ +G+Y+VAASPFM+AP+AVDN T TAT
Sbjct  212   VVEVDATYVKPFKIETIVIAPGQTTNVLLSADQKSGKYLVAASPFMNAPVAVDNLTATAT  271

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   T  T LT  P +NAT VA NF+ SLR LNSK +P  VP TVDHSL FT GLG
Sbjct  272   LHYTGTLATTPTVLTTPPPKNATQVATNFISSLRGLNSKKYPVNVPLTVDHSLFFTAGLG  331

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK ANGSRVVAS+NNVTF+MPT ALLQAH+F IKGVFTTDFP NPP  FNY+G 
Sbjct  332   INPCPSCKAANGSRVVASINNVTFLMPTIALLQAHYFNIKGVFTTDFPANPPHVFNYSGP  391

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               PANL T TGTK+Y+LP+NATVQ+VLQDTGI+APENHP+HLHGFNFF VGRGIGN+NP 
Sbjct  392   G-PANLNTETGTKVYKLPFNATVQVVLQDTGIIAPENHPVHLHGFNFFVVGRGIGNYNPN  450

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPK FNLVDPVERNT+GVPAGGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  451   TDPKNFNLVDPVERNTVGVPAGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  510

Query  312   KGPNES  295
             KG  +S
Sbjct  511   KGSKQS  516



>ref|XP_010101806.1| hypothetical protein L484_023595 [Morus notabilis]
 gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis]
Length=558

 Score =   495 bits (1275),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 243/306 (79%), Positives = 264/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPF  DTIVIAPGQTTN +ITADQ +G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  243   VVEVDATYVKPFSIDTIVIAPGQTTNALITADQNSGKYLVAASPFMDAPIAVDNATATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY G     ATTLT  P QNAT VAN F + L+SLNS TFPAKVP +VDH+L FTV LG
Sbjct  303   LHYAGTLANAATTLTVPPPQNATQVANKFTNGLKSLNSNTFPAKVPLSVDHNLFFTVSLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CK  NGSRVVAS+NNVTFVMPTTALLQAH+F  KGVFTTDFP NPP  FNY+G 
Sbjct  363   INPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHYFKTKGVFTTDFPANPPNVFNYSG-  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPPA+L T+ GTKLYR+ YN TVQLVLQDTGI+APENHP+HLHGFNFF VGRG GN+NPK
Sbjct  422   TPPASLATTNGTKLYRIKYNETVQLVLQDTGIIAPENHPVHLHGFNFFVVGRGTGNYNPK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  482   KDQKSFNLVDPVERNTVGVPSGGWTAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  541

Query  312   KGPNES  295
             KGPNES
Sbjct  542   KGPNES  547



>ref|XP_008388134.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   495 bits (1275),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 244/308 (79%), Positives = 270/308 (88%), Gaps = 3/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDTIVIAPGQTTN ++TA+Q +G+YMVAASPFMD+PIAVDN T TAT
Sbjct  242   IVEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMVAASPFMDSPIAVDNLTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   +  TTLT  P QNAT VAN+F++SL++LNS  FPAKVP  +DH+LLFTVGLG
Sbjct  302   LHYTGTLASTPTTLTSPPPQNATQVANSFINSLKALNSNNFPAKVPLKIDHNLLFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK  NGSRVV SVNNV+FVMPTTALLQAH F   GVFTTDFPGNPP AFNY+G 
Sbjct  362   INPCPSCKAGNGSRVVGSVNNVSFVMPTTALLQAHVFNKSGVFTTDFPGNPPTAFNYSGG  421

Query  672   TPPAN--LQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
              PPAN  L T+ GTKLYRL YN+TVQLVLQDTG +APENHPIHLHGFNFF VGRG+GN+N
Sbjct  422   -PPANASLATTNGTKLYRLAYNSTVQLVLQDTGTIAPENHPIHLHGFNFFCVGRGVGNYN  480

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PKTDPKKFNLVDPVERNT  +P+GGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVD
Sbjct  481   PKTDPKKFNLVDPVERNTANIPSGGWTAIRFVADNPGVWFMHCHLEVHTTWGLKMAFLVD  540

Query  318   NGKGPNES  295
             NGKGPN+S
Sbjct  541   NGKGPNQS  548



>ref|XP_008377498.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   495 bits (1274),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 246/307 (80%), Positives = 273/307 (89%), Gaps = 1/307 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPFKTDTIVIAPGQTTN ++TA+Q +G+YM++ASPFMD+PIAVDN T TAT
Sbjct  242   IVEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMLSASPFMDSPIAVDNLTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   T  TTLT  P QNAT VAN+F++SL++LNSK FPAKVP  +DH+LLFTVGLG
Sbjct  302   LHYTGTLATTPTTLTSPPPQNATQVANSFINSLKALNSKKFPAKVPLKIDHNLLFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             IN CPSCK ANGSRVVASVNNVTFVMPTTALLQAHFF   GVFTTDFPGNPP AFN++G 
Sbjct  362   INSCPSCKAANGSRVVASVNNVTFVMPTTALLQAHFFNKSGVFTTDFPGNPPTAFNFSGG  421

Query  672   TPP-ANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              P  A+L T+ GTKLYRL YN+TVQLVLQDTG +APENHP+HLHGFNFF+VGRGIGN+NP
Sbjct  422   LPANASLATTRGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHGFNFFSVGRGIGNYNP  481

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDPKKFNLVDPVERNT  VP GGWVAIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVDN
Sbjct  482   KTDPKKFNLVDPVERNTANVPTGGWVAIRFIADNPGVWFMHCHLEVHTTWGLKMAFLVDN  541

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  542   GKGPNQS  548



>ref|XP_011035200.1| PREDICTED: laccase-4 [Populus euphratica]
Length=556

 Score =   494 bits (1271),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 245/306 (80%), Positives = 266/306 (87%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK DTIVIAPGQTTNV++TA++ +G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  243   VVEVDATYVKPFKIDTIVIAPGQTTNVLVTANRGSGRYLVAASPFMDAPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   + ATTLT  P+QNATPVA NF D+LRSLNS  +PA+VP  +DHSL FTVGLG
Sbjct  303   LHYSGTLASSATTLTVPPAQNATPVATNFTDALRSLNSIKYPARVPLKIDHSLFFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRVVA  NNVTFVMPT ALLQAHFF IKGVFT DFPGNPP  FNYTG 
Sbjct  363   VNPCATC--VNGSRVVADFNNVTFVMPTIALLQAHFFNIKGVFTDDFPGNPPTPFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P N QT  GTKLYRL YN+TVQLVLQDTG++ PENHPIHLHGFNFF VGRGIGNFNPK
Sbjct  420   TQPTNFQTVNGTKLYRLAYNSTVQLVLQDTGMLTPENHPIHLHGFNFFEVGRGIGNFNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNTIGVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  480   RDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_004302643.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   494 bits (1271),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 240/308 (78%), Positives = 272/308 (88%), Gaps = 2/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             +VEVDATYVKPFKTDTIVIAPGQTTN +ITA+Q +G+Y+V ASPF+D P IAVDN T TA
Sbjct  243   IVEVDATYVKPFKTDTIVIAPGQTTNALITANQKSGKYLVTASPFLDTPGIAVDNLTSTA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   TTLT  P QNAT VAN+F DSLRSLN+  FPAKVP  +DH+LLFT+GL
Sbjct  303   TVHYSGTLSNSPTTLTSPPPQNATQVANSFTDSLRSLNTMKFPAKVPLKIDHNLLFTIGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPCPSCK  NGSRVVAS+NNVTFVMPTTALLQAHFF  KGVFTTDFP NPP AFN++G
Sbjct  363   GINPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFKTKGVFTTDFPANPPNAFNFSG  422

Query  675   STPP-ANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
               P  ++L T+ GTK+YRL YN+TVQLVLQDTGI+APENHP+HLHGFNFFA+GRG+GN+N
Sbjct  423   GLPANSSLATTNGTKVYRLAYNSTVQLVLQDTGIIAPENHPVHLHGFNFFAIGRGLGNYN  482

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PKTDPK FNLVDPVERNTIGVP+GGWVAIRF ADNPGVWFMHCHLE+HT+WGLKMAFLVD
Sbjct  483   PKTDPKNFNLVDPVERNTIGVPSGGWVAIRFIADNPGVWFMHCHLEVHTSWGLKMAFLVD  542

Query  318   NGKGPNES  295
             NGKGPN+S
Sbjct  543   NGKGPNQS  550



>ref|XP_002278638.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI30423.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   493 bits (1268),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 236/306 (77%), Positives = 269/306 (88%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFK DT+VIAPGQTTN +ITADQ++G+Y++AASPFMD+PIAVDN T TAT
Sbjct  242   VVEVDAVYTKPFKIDTLVIAPGQTTNALITADQSSGKYLMAASPFMDSPIAVDNLTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  T+LT  P  NAT VAN FV+SLRSLNSK +PAKVP TVDHSL  TVGLG
Sbjct  302   LHYSGTLASSPTSLTSPPPPNATAVANKFVNSLRSLNSKKYPAKVPLTVDHSLFITVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   NGSR VAS+NNVTFVMPTTA+LQAH+F I GV+TTDFP NPP AFNYTGS
Sbjct  362   INPCATCVAGNGSRAVASMNNVTFVMPTTAILQAHYFNISGVYTTDFPANPPVAFNYTGS  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               PANLQT+ GTK+YR+PYN+TVQ+VLQDTGI+A ENHP+HLHGFNFFAVG+G+GN+NPK
Sbjct  422   --PANLQTTNGTKVYRVPYNSTVQVVLQDTGIIATENHPVHLHGFNFFAVGKGLGNYNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP+ FNL+DPVERNTIGVP+GGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  480   TDPQNFNLIDPVERNTIGVPSGGWTAIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPN+S
Sbjct  540   KGPNQS  545



>gb|KFK36706.1| hypothetical protein AALP_AA4G158700 [Arabis alpina]
Length=560

 Score =   493 bits (1268),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 233/306 (76%), Positives = 267/306 (87%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DT++IAPGQTTNV++TA ++AG+Y+VAASPFMDAPIAVDN T TAT
Sbjct  245   VVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVAASPFMDAPIAVDNVTATAT  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  ++  T LT  P QNAT +ANNF +SLRSLNSK +PA VP T+DH LLFTVGLG
Sbjct  305   LHYSGTLSSSPTILTLPPPQNATSIANNFTNSLRSLNSKKYPAIVPTTIDHHLLFTVGLG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK  NGSRVVAS+NNVTF+MP TALL AH+F I GVFTTDFP NPP  FNY+G 
Sbjct  365   LNPCPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGG  424

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG++APENHP+HLHGFNFF VGRG+GNFNPK
Sbjct  425   S-VTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPVHLHGFNFFEVGRGLGNFNPK  483

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNT+GVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  484   KDPNNFNLVDPVERNTVGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  543

Query  312   KGPNES  295
             KGPN+S
Sbjct  544   KGPNQS  549



>ref|XP_010256659.1| PREDICTED: laccase-4 [Nelumbo nucifera]
Length=554

 Score =   491 bits (1264),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 240/306 (78%), Positives = 267/306 (87%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTIVIAPGQTTNV++   + +G+Y+VAASPFMD+PIAVDN T TAT
Sbjct  241   VVEVDAVYTKPFKTDTIVIAPGQTTNVLLETGRGSGKYLVAASPFMDSPIAVDNMTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   T ATTLT  P QNATPVA+NF+DSLRSLNSK +P KVP TVDHSLLFTVGLG
Sbjct  301   LHYSGTLATSATTLTNPPPQNATPVASNFIDSLRSLNSKEYPVKVPLTVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG RV+A +NNV+FVMPTTALLQAH+  I GVFT DFP NPP +FNYTG 
Sbjct  361   VNPCSTC--PNGIRVIADINNVSFVMPTTALLQAHYLNISGVFTDDFPANPPISFNYTG-  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T PANLQT  GTKLYRL YN TVQLVLQDTG++APENHP+HLHGFNFFAVGRG+GN+NPK
Sbjct  418   TQPANLQTMNGTKLYRLRYNDTVQLVLQDTGMIAPENHPVHLHGFNFFAVGRGLGNYNPK  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP KFNLVDP+ERNTIGVP+GGW  IRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  478   TDPAKFNLVDPIERNTIGVPSGGWTVIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  537

Query  312   KGPNES  295
             KGPNES
Sbjct  538   KGPNES  543



>ref|XP_003544873.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN40048.1| Laccase-4 [Glycine soja]
Length=557

 Score =   490 bits (1261),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 233/306 (76%), Positives = 266/306 (87%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTIVIAPGQTTNV++ A++AAG+Y+VAA+PFMD+PI VDN T TAT
Sbjct  243   VVEVDAVYTKPFKTDTIVIAPGQTTNVLLKANRAAGKYLVAATPFMDSPITVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   +  TTLT +P +NATPVA NF DSLRSLNSK +PA+VPQ VDHSL FTV LG
Sbjct  303   LHYTGSLGSTITTLTSLPPKNATPVATNFTDSLRSLNSKKYPARVPQKVDHSLFFTVSLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C  ANGS+VVA++NNVTFVMP  +LLQAHFF I GVFT DFPG PP  +++TG+
Sbjct  363   VNPCPTC--ANGSKVVAAINNVTFVMPKVSLLQAHFFNISGVFTDDFPGKPPVVYDFTGT  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NL+T+ GT++YRL YN+TVQLVLQDTG++ PENHPIHLHGFNFF VGRG GNFNPK
Sbjct  421   QQPTNLRTNRGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  481   KDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>ref|XP_010262771.1| PREDICTED: laccase-4-like [Nelumbo nucifera]
Length=555

 Score =   490 bits (1261),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 241/307 (79%), Positives = 271/307 (88%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             VVEVDA Y KPFKTDT++IAPGQTTNV++TA +++G+Y+VAASPFMD P+ AVDN T TA
Sbjct  241   VVEVDAVYTKPFKTDTVLIAPGQTTNVLLTAGRSSGKYLVAASPFMDTPVVAVDNMTATA  300

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY+G   T ATTLT  P QNATPVA NF+DSLRSLNSK +PAKVPQTVDHSLLF+VGL
Sbjct  301   TLHYSGSLATSATTLTNPPPQNATPVATNFMDSLRSLNSKQYPAKVPQTVDHSLLFSVGL  360

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPC +C   NGSRVVA +NNV+FVMPTTALLQAHFF I GVFT DFP NPP A+NYTG
Sbjct  361   GVNPCSTCP--NGSRVVADINNVSFVMPTTALLQAHFFNISGVFTDDFPANPPIAYNYTG  418

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T PANLQT  GTK+YRL YN TVQ+VLQDTG++APENHPIHLHGFNFFAVGRG+GN+NP
Sbjct  419   -TQPANLQTINGTKVYRLRYNDTVQVVLQDTGMIAPENHPIHLHGFNFFAVGRGLGNYNP  477

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K DP KFNLVDP+ERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  478   KKDPAKFNLVDPIERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDN  537

Query  315   GKGPNES  295
             GKG N+S
Sbjct  538   GKGTNQS  544



>gb|KDP46534.1| hypothetical protein JCGZ_08506 [Jatropha curcas]
Length=563

 Score =   489 bits (1260),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 235/306 (77%), Positives = 268/306 (88%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNV++TAD+ +G+Y+VAASPFMDAPIAVDN T +AT
Sbjct  250   VVEVDATYVKPFKTDTIVIAPGQTTNVLLTADRTSGKYLVAASPFMDAPIAVDNVTASAT  309

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  ++ AT LT  P QNATP+A  F +SLRSLNSK +PA VP  +DH L FT+GLG
Sbjct  310   LHYSGALSSAATILTVPPPQNATPIAATFANSLRSLNSKKYPANVPLKIDHFLFFTIGLG  369

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C  A G+RVVA +NNVTFVMPT +LLQAHFF I GVFT DFPGNPP  FNYTG 
Sbjct  370   VNPCATC--ATGNRVVADINNVTFVMPTISLLQAHFFNISGVFTDDFPGNPPVQFNYTG-  426

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P+N+QT+ GT+LYRL YN+TVQ+VLQDTG++APENHPIHLHGFNFF VGRG+GNFNPK
Sbjct  427   TQPSNVQTNNGTRLYRLAYNSTVQIVLQDTGMIAPENHPIHLHGFNFFEVGRGVGNFNPK  486

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  487   KDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  546

Query  312   KGPNES  295
             KGPNE 
Sbjct  547   KGPNEC  552



>ref|XP_002299828.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
 gb|EEE84633.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
Length=557

 Score =   489 bits (1259),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 240/306 (78%), Positives = 265/306 (87%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK DTIVIAPGQTTNV++TA++ +G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  244   VVEVDATYVKPFKIDTIVIAPGQTTNVLVTANRGSGKYLVAASPFMDAPIAVDNVTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT  P+QNATPVA NF D+LRSLNS  +PA+VP  +DHSL FT+GLG
Sbjct  304   LHYSGTLASTTTTLTVPPAQNATPVATNFTDALRSLNSIKYPARVPLKIDHSLFFTIGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG+RVVA +NNVTFVMPT ALLQAHFF IKGVFT DFPGNPP  FNYTG 
Sbjct  364   VNPCATC--VNGNRVVADINNVTFVMPTIALLQAHFFNIKGVFTDDFPGNPPTPFNYTG-  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P N QT  GTKLYRL YN+TVQLVLQDTG++ PENHP+HLHGFNFF VGRGIGNFNPK
Sbjct  421   TQPKNFQTVNGTKLYRLAYNSTVQLVLQDTGMLTPENHPVHLHGFNFFEVGRGIGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNL DPVERNTIGVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  481   RDPKKFNLADPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>ref|XP_002533894.1| laccase, putative [Ricinus communis]
 gb|EEF28494.1| laccase, putative [Ricinus communis]
Length=556

 Score =   488 bits (1256),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 231/306 (75%), Positives = 265/306 (87%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA YVKP KTDT+++APGQTTNV++TA++ +G+Y+V ASPFMDAP+AVDN+T TAT
Sbjct  241   VVEIDACYVKPLKTDTVLLAPGQTTNVLVTANKNSGKYLVTASPFMDAPVAVDNRTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TT+   P QNA+ VANNF++SLRSLNS+ +PA+VP  VDH+LLFTVGLG
Sbjct  301   LHYSGTLASAPTTVATPPPQNASAVANNFINSLRSLNSQKYPARVPLKVDHNLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             IN CPSCK ANGSRVVAS+NNVTFVMPTTALLQAHFF I GVFTTDFP  PP  FN+TGS
Sbjct  361   INACPSCKAANGSRVVASINNVTFVMPTTALLQAHFFKISGVFTTDFPSKPPHVFNFTGS  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NL T   TK+YRL YN TVQLV+QDTG++APE+HPIHLHGFNFF VGRG+GN+NP 
Sbjct  421   G-PKNLNTVRATKVYRLKYNDTVQLVMQDTGVIAPESHPIHLHGFNFFVVGRGLGNYNPN  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP+ FNLVDP ERNTIGVP GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  480   TDPQNFNLVDPAERNTIGVPTGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>emb|CDX91428.1| BnaC04g07220D [Brassica napus]
Length=558

 Score =   486 bits (1250),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/306 (76%), Positives = 264/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFKTDTI+IAPGQTTNV++T  ++AG+Y+V ASPFMD+PIAVDN T TAT
Sbjct  243   VVEVDAVYVKPFKTDTILIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  TTLT  P QNAT +ANNF +SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  303   VHYSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK  NGSRVVAS+NNVTF MP TALL AH+F I GVFTTDFP NPP  FNY+G 
Sbjct  363   LNPCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGG  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG++APENHPIHLHGFNFF VGRG+GNFN K
Sbjct  423   S-VTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGFNFFEVGRGLGNFNAK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNTIGVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  482   KDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  541

Query  312   KGPNES  295
             KGPN+S
Sbjct  542   KGPNQS  547



>ref|XP_002520425.1| laccase, putative [Ricinus communis]
 gb|EEF41838.1| laccase, putative [Ricinus communis]
Length=556

 Score =   486 bits (1250),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 234/306 (76%), Positives = 266/306 (87%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNV++TA +++G+Y+VAASPFMDAPIAVDN T  AT
Sbjct  243   VVEVDATYVKPFKTDTIVIAPGQTTNVLLTAGRSSGKYLVAASPFMDAPIAVDNVTAVAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  ++ ATTLT  P +NAT +A+NF ++LRSLNSK +PA VP  +DHSL FT+GLG
Sbjct  303   LHYSGTLSSSATTLTATPPKNATSIASNFTNALRSLNSKKYPANVPLKIDHSLFFTIGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRVVA +NNVTFVMPT  LLQAHFF I GVFT DFP NPP ++NYTG 
Sbjct  363   VNPCATC--VNGSRVVADINNVTFVMPTIGLLQAHFFNISGVFTDDFPSNPPVSYNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P N QT+TGT+LYRL YN+TVQLVLQDTG++ PENHPIHLHGFNFF VGRG+GNFNPK
Sbjct  420   TQPTNFQTTTGTRLYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFQVGRGVGNFNPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNT GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  480   KDPKNFNLVDPVERNTAGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_003518300.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN46170.1| Laccase-4 [Glycine soja]
Length=557

 Score =   485 bits (1249),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/306 (75%), Positives = 265/306 (87%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTIVIAPGQTT+V++ A++AAG+Y+VAA+PFMD+PIAVDN T TAT
Sbjct  243   VVEVDAVYTKPFKTDTIVIAPGQTTSVLLKANRAAGKYLVAATPFMDSPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   +  TTLT +P +NATPVA NF DSLRSLNSK +PA+VPQ VDHSL FT+ LG
Sbjct  303   LHYTGSLGSTITTLTSLPPKNATPVATNFTDSLRSLNSKKYPARVPQKVDHSLFFTISLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C   NGS+VVA++NNVTFVMP  +LLQAHFF I GVF  DFPG PP  +++TG+
Sbjct  363   VNPCPTC--VNGSKVVAAINNVTFVMPKVSLLQAHFFNISGVFIDDFPGKPPVVYDFTGT  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NL+T+ GT++YRL YN+TVQLVLQDTG++ PENHP+HLHGFNFF VGRG GNFNPK
Sbjct  421   QQPTNLRTNRGTRVYRLAYNSTVQLVLQDTGMITPENHPLHLHGFNFFVVGRGQGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  481   KDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNG  540

Query  312   KGPNES  295
             KGPNES
Sbjct  541   KGPNES  546



>ref|XP_010529771.1| PREDICTED: laccase-4-like [Tarenaya hassleriana]
Length=559

 Score =   485 bits (1249),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 230/306 (75%), Positives = 266/306 (87%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFKTDT++IAPGQTTNV++TA + AG+++V  SPFMD+PIAVDN T TAT
Sbjct  244   VVEVDAVYVKPFKTDTVLIAPGQTTNVLLTAVKPAGKFLVTVSPFMDSPIAVDNVTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T LT  P QN+T +A+ F  SLRSLNS  +PA VP+ +DH L FTVGLG
Sbjct  304   VHYSGTLSSSPTVLTLPPPQNSTAMADAFTSSLRSLNSVKYPALVPKKIDHHLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+CKPANGSRVVAS+NNVTF MPTTALLQAH+F + GVFTTDFP NPP  FNYTG+
Sbjct  364   INPCPTCKPANGSRVVASINNVTFSMPTTALLQAHYFNVNGVFTTDFPKNPPHVFNYTGA  423

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PPANL T  GT+LY+LPYNATV+LVLQDT +++PENHP+HLHGFNFF VGRG+GNFNP 
Sbjct  424   -PPANLATDKGTRLYKLPYNATVELVLQDTVVISPENHPLHLHGFNFFQVGRGLGNFNPN  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK+FNL DPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  483   KDPKRFNLDDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  542

Query  312   KGPNES  295
             KGPNES
Sbjct  543   KGPNES  548



>gb|KHG17519.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   483 bits (1243),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 240/306 (78%), Positives = 263/306 (86%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNV++T  +  G+YMVAAS FMDAPIAVDN T TAT
Sbjct  190   VVEVDATYVKPFKTDTIVIAPGQTTNVLVTTHRGGGKYMVAASTFMDAPIAVDNVTATAT  249

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  T+ ATTLT  P +NAT VA NF+ SLRSLNSK +PA VP  +DHSLLFTVGLG
Sbjct  250   LHYSGSLTSAATTLTSTPPKNATSVATNFISSLRSLNSKQYPANVPLKIDHSLLFTVGLG  309

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C   NGSRVVAS+NNVTFVMP  +LLQAHFF I GVFT+DFPGNPP  FNYT S
Sbjct  310   VNPCPTC--VNGSRVVASINNVTFVMPKISLLQAHFFNISGVFTSDFPGNPPAPFNYT-S  366

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T   N  T  GT+LYRL YN TVQLVLQDTG++ PENHP+HLHGFNFF VGRG+GNFNPK
Sbjct  367   TQVTNFATKQGTRLYRLAYNDTVQLVLQDTGMITPENHPLHLHGFNFFEVGRGLGNFNPK  426

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  427   EDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  486

Query  312   KGPNES  295
             KGPNES
Sbjct  487   KGPNES  492



>emb|CDX74915.1| BnaA05g06610D [Brassica napus]
Length=558

 Score =   485 bits (1248),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 231/306 (75%), Positives = 264/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFKTDT++IAPGQTTNV++T  ++AG+Y+V ASPFMD+PIAVDN T TAT
Sbjct  243   VVEVDAVYVKPFKTDTVLIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  TTLT  P QNAT +ANNF +SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  303   VHYSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK  NGSRVVAS+NNVTF MP TALL AH+F I GVFTTDFP NPP  FNY+G 
Sbjct  363   LNPCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGG  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG++APENHPIHLHGFNFF VGRG+GNFN K
Sbjct  423   S-VTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGFNFFEVGRGLGNFNAK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNTIGVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  482   KDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  541

Query  312   KGPNES  295
             KGPN+S
Sbjct  542   KGPNQS  547



>ref|XP_004500229.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=556

 Score =   484 bits (1246),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 233/306 (76%), Positives = 263/306 (86%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPF+TDTIVIAPGQTTNV++TA    G+Y+VAASPFMDAPI VDN+T TAT
Sbjct  243   VVEVDATYVKPFQTDTIVIAPGQTTNVLLTAKHTTGKYLVAASPFMDAPIVVDNKTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G   +  TTLT +P +NATP+A  F DSLRSLNSK +PAKVP  +DH+LLFTV LG
Sbjct  303   IHYSGTLGSTITTLTSLPPKNATPLATTFTDSLRSLNSKKYPAKVPLKIDHNLLFTVSLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+C   N SRVVA++NNVTFVMP  ALLQAHFF IKGVF+ DFPGNPP  +N+TG 
Sbjct  363   INPCPTC--VNNSRVVAAINNVTFVMPKIALLQAHFFNIKGVFSEDFPGNPPIVYNFTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P N  T+ GT+LY+L YN+TVQLVLQDTG++ PENHPIHLHGFNFF VGRG GN+NP+
Sbjct  420   TQPTNFGTTKGTRLYKLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQGNYNPR  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D KKFNLVDPVERNTIGVPAGGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  480   KDAKKFNLVDPVERNTIGVPAGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_008775059.1| PREDICTED: laccase-22-like [Phoenix dactylifera]
Length=554

 Score =   484 bits (1245),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 231/306 (75%), Positives = 263/306 (86%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTI+I PGQTTNV++TADQ AG Y+V ASPFMD+PIAVDN+T  AT
Sbjct  241   VVEVDACYTKPFKTDTILITPGQTTNVLLTADQGAGSYLVTASPFMDSPIAVDNKTAMAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HYT    T   T T  P QNATPVA+ F+DSLRSLNS+ +PA+VP TVDHSLLFTVGLG
Sbjct  301   VHYTNSVATADLTTTNPPPQNATPVASKFIDSLRSLNSEQYPARVPLTVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C   NGSRVVA +NNV+F MPTTA+LQAH+F I GVF  DFPG PP AFNYTG 
Sbjct  361   VNPCPTC--VNGSRVVADMNNVSFTMPTTAILQAHYFNISGVFADDFPGKPPIAFNYTGG  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P  N+QT +GT++YRL +N+TVQLVLQDTGI+APENHPIHLHGFNFFAVGRG+GN+NP 
Sbjct  419   GP-KNMQTMSGTRVYRLAFNSTVQLVLQDTGIIAPENHPIHLHGFNFFAVGRGLGNYNPN  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             T P KFNLVDPVERNTIGVP+GGW AIRF+ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  478   TSPSKFNLVDPVERNTIGVPSGGWTAIRFQADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  537

Query  312   KGPNES  295
             +GPNES
Sbjct  538   EGPNES  543



>ref|XP_010517091.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   484 bits (1245),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 229/306 (75%), Positives = 263/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DT++IAPGQTTNV++TA ++AG+Y+V ASPFMDAPIAVDN T TAT
Sbjct  243   VVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T  T  P QNAT +ANNF +SLRSLNSK +PA VP T+DH LLFTVGLG
Sbjct  303   VHYSGTLSSSPTVRTLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK  NGSRVVAS+NNVTFVMP TALL AH+F   GVFTTDFP NPP  FNY+G 
Sbjct  363   LNPCPTCKAGNGSRVVASINNVTFVMPKTALLSAHYFKKSGVFTTDFPKNPPHVFNYSGG  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG+++PENHP+HLHGFNFF VGRG+GNFN  
Sbjct  423   S-VTNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFNFFQVGRGLGNFNST  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  482   KDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  541

Query  312   KGPNES  295
             KGPN+S
Sbjct  542   KGPNQS  547



>ref|XP_007016183.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY33802.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=557

 Score =   484 bits (1245),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 240/306 (78%), Positives = 265/306 (87%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKT+TIVI PGQTTNV++TA + AG+Y+VAASPFMDAPI VDN T TAT
Sbjct  244   VVEVDATYVKPFKTETIVITPGQTTNVLLTAHRGAGKYLVAASPFMDAPIVVDNVTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  T+ ATTLT +P +NAT VA NF ++LRSLNSK +PA VP  +DHSLLFTVGLG
Sbjct  304   LHYSGSLTSTATTLTSLPPKNATSVATNFTNALRSLNSKQYPANVPLKIDHSLLFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSC   NGSRVVAS+NNVTFVMP  +LLQAHFF I GVFTTDFPGNPP  FNYT S
Sbjct  364   INPCPSC--VNGSRVVASINNVTFVMPKISLLQAHFFNISGVFTTDFPGNPPVPFNYT-S  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T   N QT  GTKLYRL YN+TVQLVLQDTG++ PENHP+HLHGFNFF VGRG+GNFNPK
Sbjct  421   TQLTNFQTKQGTKLYRLAYNSTVQLVLQDTGMITPENHPLHLHGFNFFEVGRGLGNFNPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D KKFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  481   KDTKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  540

Query  312   KGPNES  295
              GPNE+
Sbjct  541   NGPNET  546



>ref|XP_006293932.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
 gb|EOA26830.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
Length=558

 Score =   483 bits (1244),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 230/306 (75%), Positives = 265/306 (87%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DT++IAPGQTTNV++TA ++AG+++V ASPFMDAPIAVDN T TAT
Sbjct  243   VVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKFLVTASPFMDAPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T LT  P QNAT VANNF +SLRSLNSK +PA VP T+DH LLFTVGLG
Sbjct  303   VHYSGTLSSSPTVLTLPPPQNATSVANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +N CP+CK  NGSRVVAS+NNVTF+MP TALL AH+F   GVFTTDFP NPP  FNY+G 
Sbjct  363   LNACPTCKAGNGSRVVASINNVTFIMPKTALLSAHYFNKSGVFTTDFPKNPPHVFNYSGG  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG+++PENHP+HLHGFNFF VGRG+GNFN K
Sbjct  423   S-VTNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFNFFQVGRGLGNFNSK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP  FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  482   TDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  541

Query  312   KGPNES  295
             KGPN+S
Sbjct  542   KGPNQS  547



>ref|XP_006411009.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
 gb|ESQ52462.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
Length=557

 Score =   483 bits (1244),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/306 (75%), Positives = 265/306 (87%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DT++IAPGQTTNV++TA ++AG+Y+V ASPFMDAP+AVDN T TAT
Sbjct  242   VVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPVAVDNVTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  TTLT  P QNAT VANNF +SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  302   VHYSGTLSSSPTTLTLPPPQNATSVANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +N CP+CK  NGSRVVAS+NNVTF+MP TALL AH+F I GVFTTDFP NPP  FNY+G 
Sbjct  362   LNSCPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGG  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG++APENHPIHLHG+NFF VGRG+GNF+PK
Sbjct  422   S-VTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGYNFFEVGRGLGNFDPK  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNT+GVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  481   KDPNNFNLVDPVERNTVGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  540

Query  312   KGPNES  295
             KGPN+S
Sbjct  541   KGPNQS  546



>emb|CDX93330.1| BnaC04g45660D [Brassica napus]
Length=560

 Score =   483 bits (1243),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/306 (75%), Positives = 261/306 (85%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DTIVIAPGQTTNV++TA ++ G+Y+V ASPFMD+PIAVDN T TAT
Sbjct  245   VVEVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATAT  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T LT  P QNAT VA NF +SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  305   VHYSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK  NGSRVVAS+NNVTFVMP  ALL AH+F I GVFT DFP NPP  FNY+G 
Sbjct  365   LNPCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTPDFPKNPPHVFNYSGG  424

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTGI+APENHPIHLHG+NFF VGRG+GNFNPK
Sbjct  425   S-VTNMATETGTRLYKLPYNATVQLVLQDTGIIAPENHPIHLHGYNFFEVGRGLGNFNPK  483

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNTIGVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  484   KDPNNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  543

Query  312   KGPNES  295
             KGPN+S
Sbjct  544   KGPNQS  549



>ref|XP_003551299.1| PREDICTED: laccase-4-like [Glycine max]
Length=556

 Score =   482 bits (1241),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 233/306 (76%), Positives = 262/306 (86%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTIVIAPGQTTNV++T   AAG+Y+VAASPFMDAPIAVDN+T TAT
Sbjct  243   VVEVDAVYTKPFKTDTIVIAPGQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT +P +NATP+A +F DSLRSLNSK +PA+VP  +DH+LLFTV LG
Sbjct  303   LHYSGTLGSTITTLTSMPPKNATPLATSFTDSLRSLNSKKYPARVPLKIDHNLLFTVSLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   N SRVVA +NNVTFVMP  +LLQAHFF IKGVFT DFPGNPP  +N+TG 
Sbjct  363   INPCATC--VNNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVVYNFTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P+NL+T  GT++YRL YN+TVQLVLQDTG++ PENHPIHLHGFNFF VGRG  NFNP 
Sbjct  420   TQPSNLRTMKGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQRNFNPT  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+GVPAGGW AIRFR DNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  480   KDPKKFNLVDPVERNTVGVPAGGWTAIRFRTDNPGVWFMHCHLEIHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|NP_565881.1| laccase-4 [Arabidopsis thaliana]
 sp|O80434.2|LAC4_ARATH RecName: Full=Laccase-4; AltName: Full=Benzenediol:oxygen oxidoreductase 
4; AltName: Full=Diphenol oxidase 4; AltName: Full=Protein 
IRREGULAR XYLEM 12; AltName: Full=Urishiol oxidase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96573.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL36080.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL38363.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAC27158.2| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAM47955.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AEC09487.1| laccase-4 [Arabidopsis thaliana]
Length=558

 Score =   482 bits (1241),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 229/306 (75%), Positives = 263/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFKTDT++IAPGQTTNV++TA ++AG+Y+V ASPFMDAPIAVDN T TAT
Sbjct  243   VVEVDAVYVKPFKTDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T LT  P QNAT +ANNF +SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  303   VHYSGTLSSSPTILTLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +N CP+CK  NGSRVVAS+NNVTF+MP TALL AH+F   GVFTTDFP NPP  FNY+G 
Sbjct  363   LNACPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNTSGVFTTDFPKNPPHVFNYSGG  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG++APENHP+HLHGFNFF VGRG+GNFN  
Sbjct  423   S-VTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPVHLHGFNFFEVGRGLGNFNST  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTIGVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  482   KDPKNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  541

Query  312   KGPNES  295
             KGPN+S
Sbjct  542   KGPNQS  547



>gb|KHN06247.1| Laccase-4 [Glycine soja]
Length=556

 Score =   482 bits (1241),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 233/306 (76%), Positives = 262/306 (86%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTIVIAPGQTTNV++T   AAG+Y+VAASPFMDAPIAVDN+T TAT
Sbjct  243   VVEVDAVYTKPFKTDTIVIAPGQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT +P +NATP+A +F DSLRSLNSK +PA+VP  +DH+LLFTV LG
Sbjct  303   LHYSGTLGSTITTLTSMPPKNATPLATSFTDSLRSLNSKKYPARVPLKIDHNLLFTVSLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   N SRVVA +NNVTFVMP  +LLQAHFF IKGVFT DFPGNPP  +N+TG 
Sbjct  363   INPCATC--VNNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVVYNFTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P+NL+T  GT++YRL YN+TVQLVLQDTG++ PENHPIHLHGFNFF VGRG  NFNP 
Sbjct  420   TQPSNLRTMKGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQRNFNPT  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+GVPAGGW AIRFR DNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  480   KDPKKFNLVDPVERNTVGVPAGGWTAIRFRTDNPGVWFMHCHLEIHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_003539958.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN07789.1| Laccase-4 [Glycine soja]
Length=556

 Score =   481 bits (1239),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 233/306 (76%), Positives = 260/306 (85%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KP KTDTIVIAPGQTTNV++T   A G+Y+VAASPFMDAPIAVDN+T TAT
Sbjct  243   VVEVDAVYTKPLKTDTIVIAPGQTTNVLLTTKHATGKYLVAASPFMDAPIAVDNKTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY G   +  TTLT +P +NATPVA  F+DSLRSLNSK  PA+VP  +DH+LLFTV LG
Sbjct  303   LHYLGTLGSTITTLTSMPPKNATPVATTFIDSLRSLNSKEHPARVPLKIDHNLLFTVSLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   N SRVVA +NNVTFVMP  +LLQAHFF IKGVFT DFPGNPP  +N+TG 
Sbjct  363   VNPCATC--VNNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVVYNFTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P+NL+T  GT++YRL YN+TVQLVLQDTG++ PENHPIHLHGFNFF VGRG GNFNP 
Sbjct  420   TQPSNLKTMKGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGRGQGNFNPT  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+GVPAGGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  480   KDPKKFNLVDPVERNTVGVPAGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_010509229.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   481 bits (1239),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 228/306 (75%), Positives = 262/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DT++IAPGQTTNV++TA ++AG+Y+V ASPFMDAPIAVDN T TAT
Sbjct  243   VVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T  T  P QNAT +ANNF +SLRSLNSK +PA VP T+DH LLFTVGLG
Sbjct  303   VHYSGTLSSSPTVRTLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +N CP+CK  NGSRVVAS+NNVTFVMP TALL AH+F   GVFTTDFP NPP  FNY+G 
Sbjct  363   LNACPTCKAGNGSRVVASINNVTFVMPKTALLSAHYFNKSGVFTTDFPKNPPHVFNYSGG  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG+++PENHP+HLHGFNFF VGRG+GNFN  
Sbjct  423   S-VKNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFNFFQVGRGLGNFNST  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  482   KDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  541

Query  312   KGPNES  295
             KGPN+S
Sbjct  542   KGPNQS  547



>ref|XP_010505418.1| PREDICTED: laccase-4 [Camelina sativa]
Length=558

 Score =   481 bits (1237),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/306 (74%), Positives = 262/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DT++IAPGQTTNV++TA ++AG+Y+V ASPFMDAPIAVDN T TAT
Sbjct  243   VVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T  T  P QNAT +ANNF +SLRSLNSK +PA VP T+DH LLFTVGLG
Sbjct  303   VHYSGTLSSSPTVRTLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +N CP+CK  NGSRVVAS+NNVTFVMP TALL AH+F   GVFTTDFP NPP  FNY+G 
Sbjct  363   LNACPTCKAGNGSRVVASINNVTFVMPKTALLSAHYFNKSGVFTTDFPKNPPHVFNYSGG  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG+++PENHP+HLHGFNFF +GRG+GNFN  
Sbjct  423   S-VTNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFNFFQIGRGLGNFNST  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  482   KDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  541

Query  312   KGPNES  295
             KGPN+S
Sbjct  542   KGPNQS  547



>ref|XP_002879726.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55985.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score =   480 bits (1236),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/306 (74%), Positives = 262/306 (86%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFKTDT++IAPGQTTNV++TA ++AG+Y+V ASPFMDAPIAVDN T TAT
Sbjct  242   VVEVDAVYVKPFKTDTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATAT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T LT  P QNAT +ANNF  SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  302   VHYSGTLSSSPTILTLPPPQNATSIANNFTKSLRSLNSKKYPALVPTTIDHHLFFTVGLG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +N CP+CK  NGSRVVAS+NNVTF+MP TALL AH+F   GVFTTDFP NPP  FNY+G 
Sbjct  362   LNACPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNTSGVFTTDFPKNPPHVFNYSGG  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG+++PENHP+HLHGFNFF VGRG+GNFN  
Sbjct  422   S-VTNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPVHLHGFNFFEVGRGLGNFNST  480

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNL+DPVERNTIGVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  481   KDPKNFNLIDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  540

Query  312   KGPNES  295
             KGPN+S
Sbjct  541   KGPNQS  546



>ref|XP_002314124.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
 gb|EEE88079.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
Length=556

 Score =   479 bits (1233),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 235/306 (77%), Positives = 261/306 (85%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK DT+VIAPGQTTNV++TA++ +GQY+VAASPFMDAPIAVDN T TAT
Sbjct  243   VVEVDATYVKPFKIDTVVIAPGQTTNVLVTANRGSGQYLVAASPFMDAPIAVDNVTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT  P++NATPVA NF ++LRSLNS  +PA+VP  +DHSL FTVGLG
Sbjct  303   LHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARVPLKIDHSLFFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRVVA +NNVTFVMPT ALLQAH F I GVFT DFP NPP  FNYTG 
Sbjct  363   VNPCATC--INGSRVVADINNVTFVMPTIALLQAHVFNISGVFTDDFPANPPTPFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P N QT  GTKLYRL YN TVQLVLQDTG++ PENHP+HLHGFNFF VGRG+GNF+P 
Sbjct  420   TQPTNFQTVKGTKLYRLAYNNTVQLVLQDTGMLTPENHPVHLHGFNFFEVGRGVGNFDPN  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNTIGVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  480   KDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_010907627.1| PREDICTED: laccase-22-like [Elaeis guineensis]
Length=554

 Score =   478 bits (1231),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 229/306 (75%), Positives = 265/306 (87%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+Y KP+KTDTI+I PGQTTNV++TAD+ AG+Y+V AS FMD+PIAVDNQT  AT
Sbjct  241   VVEVDASYTKPYKTDTILITPGQTTNVLLTADREAGRYLVTASTFMDSPIAVDNQTAMAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HYT   +T   T T  P QNATPVA+NF+DSLRSLNS+ +PA+VP TVDHSLLFTVGLG
Sbjct  301   VHYTNTLSTSILTTTDPPPQNATPVASNFIDSLRSLNSEQYPARVPLTVDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C   NGSRVVA +NNV+F MPTTA+LQAH+F I GVFT DFPG PP  FNYTGS
Sbjct  361   VNPCPTC--VNGSRVVADMNNVSFTMPTTAILQAHYFNISGVFTDDFPGKPPIDFNYTGS  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P  NL T TGT++YRLP+N++VQ+VLQDTGI+APENHP+HLHGFNFFAVGRG+GN+NP 
Sbjct  419   GP-KNLGTMTGTRVYRLPFNSSVQVVLQDTGIIAPENHPLHLHGFNFFAVGRGLGNYNPN  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             T P KFNLVDPVERNTIGVP+GGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  478   TSPYKFNLVDPVERNTIGVPSGGWTAIRFSADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  537

Query  312   KGPNES  295
              GP+ES
Sbjct  538   IGPDES  543



>emb|CDY18406.1| BnaA04g21810D [Brassica napus]
Length=559

 Score =   478 bits (1231),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 229/306 (75%), Positives = 260/306 (85%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DTIVIAPGQTTNV++TA ++ G+Y+V ASPFMD+PIAVDN T TAT
Sbjct  244   VVEVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T LT  P QNAT VA NF +SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  304   VHYSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK  NGSRVVAS+NNVTFVMP  ALL AH+F I GVFT DFP  PP  FNY+G 
Sbjct  364   LNPCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTPDFPKIPPHVFNYSGG  423

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG++APENHPIHLHG+NFF VGRG+GNFNPK
Sbjct  424   S-LTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGYNFFEVGRGLGNFNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNTIGVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  483   KDPNNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  542

Query  312   KGPNES  295
             KGPN+S
Sbjct  543   KGPNQS  548



>gb|KDO37344.1| hypothetical protein CISIN_1g009854mg [Citrus sinensis]
Length=524

 Score =   477 bits (1228),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 232/307 (76%), Positives = 266/307 (87%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA YVKPFKT+T++IAPGQTTNV+++A  A G+Y+VAASPF+D P I VDN+T TA
Sbjct  210   VVEVDAAYVKPFKTETVLIAPGQTTNVLLSAAHATGKYLVAASPFLDTPAILVDNKTATA  269

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G   + ATTLT  P +NATPVA NF  SLRSLNSK +PA+VP  +DHSL FT+GL
Sbjct  270   TVHYSGTLGSTATTLTVPPPRNATPVAANFTASLRSLNSKKYPARVPLKIDHSLFFTIGL  329

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPC +C   NGSRVVA +NNVTFVMPT +LLQAHFF I GVFT DFPGNPP  +N+TG
Sbjct  330   GINPCATC--VNGSRVVADINNVTFVMPTISLLQAHFFKIGGVFTDDFPGNPPVTYNFTG  387

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T PAN QT+ GT++YRLPYN+TVQLVLQDTG++APENHP+HLHGFNFF VGRG+GNFN 
Sbjct  388   -TQPANFQTNNGTRIYRLPYNSTVQLVLQDTGMIAPENHPLHLHGFNFFEVGRGLGNFNS  446

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K DPKKFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  447   KKDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFIVDN  506

Query  315   GKGPNES  295
             GKGPNES
Sbjct  507   GKGPNES  513



>ref|XP_010104682.1| hypothetical protein L484_022065 [Morus notabilis]
 gb|EXC01488.1| hypothetical protein L484_022065 [Morus notabilis]
Length=556

 Score =   478 bits (1229),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 226/306 (74%), Positives = 261/306 (85%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKT T++IAPGQTTNV++ AD+ AG+Y+VAA+PFMDAPIAVDN+T TAT
Sbjct  243   VVEVDAVYTKPFKTGTVIIAPGQTTNVLLNADRKAGRYLVAATPFMDAPIAVDNKTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  ++  T LT +P QNAT +A NF  SLRSLNSK +PA+VP  +DHSLLFT+GLG
Sbjct  303   LHYSGTLSSSRTILTALPPQNATSIATNFTSSLRSLNSKKYPARVPLKIDHSLLFTIGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRVVA +NNVTFVMP  ALLQAHFF I GVFT DFPG PP  FNYTG 
Sbjct  363   VNPCKTC--VNGSRVVADINNVTFVMPNIALLQAHFFNISGVFTDDFPGKPPVPFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P+N  T+ GT+LYRL YN+TVQLVLQDTG++ PENHPIHLHGFNFF VG+G+GNF+P 
Sbjct  420   TQPSNFATTQGTRLYRLAYNSTVQLVLQDTGMITPENHPIHLHGFNFFVVGKGLGNFHPN  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTIGVP+GGW AIRF+ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  480   KDPKNFNLVDPVERNTIGVPSGGWTAIRFKADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNE+
Sbjct  540   KGPNET  545



>ref|XP_009143427.1| PREDICTED: laccase-4 [Brassica rapa]
Length=561

 Score =   478 bits (1229),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 230/309 (74%), Positives = 264/309 (85%), Gaps = 4/309 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKT---DTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTG  1042
             VVEVDA +VKPFKT   DT++IAPGQTTNV++T  ++AG+Y+V ASPFMD+PIAVDN T 
Sbjct  243   VVEVDAVFVKPFKTATTDTVLIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTA  302

Query  1041  TATLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTV  862
             TAT+HY+G  ++  TTLT  P QNAT +ANNF +SLRSLNSK +PA VP T+DH L FTV
Sbjct  303   TATVHYSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTV  362

Query  861   GLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNY  682
             GLG+NPCP+CK  NGSRVVAS+NNVTF MP TALL AH+F I GVFTTDFP NPP  FNY
Sbjct  363   GLGLNPCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNY  422

Query  681   TGSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNF  502
             +G +   N+ T TGT+LY+LPYNATVQLVLQDTG++APENHPIHLHGFNFF VGRG+GNF
Sbjct  423   SGGS-VTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGFNFFEVGRGLGNF  481

Query  501   NPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV  322
             N K DP  FNLVDPVERNTIGVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV
Sbjct  482   NAKKDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLV  541

Query  321   DNGKGPNES  295
             +NGKGPN+S
Sbjct  542   ENGKGPNQS  550



>gb|KHG22893.1| Laccase-4 -like protein [Gossypium arboreum]
Length=486

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 236/306 (77%), Positives = 260/306 (85%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVI+PGQTTNV++T  + AG+Y+VAASPFMDAPIAVDN T TAT
Sbjct  173   VVEVDATYVKPFKTDTIVISPGQTTNVLVTTHRRAGKYLVAASPFMDAPIAVDNLTATAT  232

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY G  T+ ATTL   P +NAT VA NF ++LRSLNS+ +PAKVP  +DHSLLFT+GLG
Sbjct  233   LHYAGSLTSSATTLVSPPPKNATSVAANFTNALRSLNSEKYPAKVPLKIDHSLLFTIGLG  292

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   NGSRVVASVNN+TFVMP TALLQAHFF I GVF T+FPG PP  FNYT S
Sbjct  293   INPCSTC--VNGSRVVASVNNITFVMPKTALLQAHFFNINGVFATNFPGRPPVPFNYT-S  349

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 NL T   TKLYRL YN TVQLVLQDTG++ PENHPIHLHGFNFF VGRG+GNF+PK
Sbjct  350   IQLTNLGTKQATKLYRLGYNDTVQLVLQDTGMITPENHPIHLHGFNFFEVGRGVGNFDPK  409

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  410   KDPKNFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  469

Query  312   KGPNES  295
             KGPNES
Sbjct  470   KGPNES  475



>ref|XP_002280416.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI16002.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   477 bits (1228),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 229/306 (75%), Positives = 262/306 (86%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY KPF TDT++IAPGQTTNV++TA   AG+Y+V AS FMD+PIAVDN T TAT
Sbjct  241   VVEVDATYTKPFSTDTVLIAPGQTTNVLLTAGLGAGKYLVTASSFMDSPIAVDNMTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             + Y+G  ++  TT+T  P QNAT VA  F DSLRSLNSK +PA+VP   DHSLLFTVGLG
Sbjct  301   VQYSGTLSSTPTTITNPPPQNATSVATKFTDSLRSLNSKKYPARVPLATDHSLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   NG +VVA++NNVTFVMPTTALLQAH+F +KGV+T DFPGNPP AFNYTG 
Sbjct  361   INPCATC--VNGGKVVANINNVTFVMPTTALLQAHYFKMKGVYTDDFPGNPPIAFNYTG-  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P N QT  GT+LYRL YN+TVQLVLQDTG++APE HP+HLHGFNFF +GRG+GN+NPK
Sbjct  418   TQPTNFQTMNGTRLYRLAYNSTVQLVLQDTGMIAPERHPVHLHGFNFFVIGRGLGNYNPK  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  478   KDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  537

Query  312   KGPNES  295
             KGPNES
Sbjct  538   KGPNES  543



>ref|XP_007142229.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
 gb|ESW14223.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
Length=555

 Score =   476 bits (1226),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 226/306 (74%), Positives = 262/306 (86%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KP KT+TIVIAPGQTTNV++ A++A G+Y+VAA+PFMD+PIAVDN T TAT
Sbjct  241   VVEVDAVYTKPLKTNTIVIAPGQTTNVLLKANRATGKYLVAATPFMDSPIAVDNVTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  ++  TTLT +P +NATPVA  F DSLRSLNSK +PA+VP  VDH+L FTV LG
Sbjct  301   LHYSGSLSSTITTLTSLPPKNATPVATTFTDSLRSLNSKNYPARVPTKVDHNLFFTVSLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C   NGSRVVA++NNVTFVMP  +LLQAHFF I GVFT DFP  P   +++TG+
Sbjct  361   VNPCPTC--VNGSRVVAAINNVTFVMPKISLLQAHFFNISGVFTDDFPRKPSVVYDFTGT  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               PANL+T+ GT++YRL YN+TVQLVLQDTG++ PENHP+HLHGFNFF VGRG GNFNPK
Sbjct  419   QQPANLRTNRGTRVYRLAYNSTVQLVLQDTGMITPENHPVHLHGFNFFVVGRGQGNFNPK  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG
Sbjct  479   RDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  538

Query  312   KGPNES  295
             KGPNES
Sbjct  539   KGPNES  544



>gb|KEH34185.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=556

 Score =   476 bits (1226),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 234/306 (76%), Positives = 258/306 (84%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTDTIVIAPGQTTNV++TA    G ++VAASPFMDAPI VDN+T TAT
Sbjct  243   VVEVDATYVKPFKTDTIVIAPGQTTNVLVTAKHKIGNFLVAASPFMDAPIVVDNKTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT +P  NAT VAN F DSLRSLNSK FPAKVP  +DH+LLFTV LG
Sbjct  303   LHYSGTLGSSLTTLTSLPPTNATSVANTFTDSLRSLNSKKFPAKVPLKIDHNLLFTVSLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   N SRVVA +NNVTFVMP  ALLQAHFF IKGVFT DFPGNPP  +N+TGS
Sbjct  363   VNPCATC--VNNSRVVADINNVTFVMPKIALLQAHFFKIKGVFTDDFPGNPPVVYNFTGS  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 NL T+ GT+LYRL YN+TVQLVLQDTG++ PENHPIHLHGFNFF VGRG GNF+ K
Sbjct  421   QV-TNLATTKGTRLYRLAYNSTVQLVLQDTGMLTPENHPIHLHGFNFFVVGRGQGNFDSK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D KKFNLVDPVERNT+GVPAGGW AIRF+ADNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  480   KDVKKFNLVDPVERNTVGVPAGGWTAIRFKADNPGVWFMHCHLEIHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_009141718.1| PREDICTED: laccase-4-like [Brassica rapa]
Length=559

 Score =   476 bits (1224),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 228/306 (75%), Positives = 259/306 (85%), Gaps = 1/306 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DTIVIAPGQTTNV++TA ++ G+Y+V ASPFMD+PIAVDN T TAT
Sbjct  244   VVEVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G  ++  T LT  P QNAT VA NF +SLRSLNSK +PA VP T+DH L FTVGLG
Sbjct  304   VHYSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+CK  NGSRVVAS+NNVTFVMP  ALL AH+F I GVFT DFP  PP  FNY+G 
Sbjct  364   LNPCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTPDFPKIPPHVFNYSGG  423

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +   N+ T TGT+LY+LPYNATVQLVLQDTG++APENHPIHLHG+NFF VGRG+GNFNPK
Sbjct  424   S-LTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGYNFFEVGRGLGNFNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  F LVDPVERNTIGVP+GGWV IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  483   KDPNNFYLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  542

Query  312   KGPNES  295
             KGPN+S
Sbjct  543   KGPNQS  548



>ref|XP_006425016.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
 ref|XP_006488481.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR38256.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
Length=557

 Score =   475 bits (1223),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 231/307 (75%), Positives = 265/307 (86%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA YVKPF T+T++IAPGQTTNV+++A  A G+Y+VAASPF+D P I VDN+T TA
Sbjct  243   VVEVDAAYVKPFNTETVLIAPGQTTNVLLSAAHATGKYLVAASPFLDTPAILVDNKTATA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G   + ATTLT  P +NATPVA NF  SLRSLNSK +PA+VP  +DHSL FT+GL
Sbjct  303   TVHYSGTLGSTATTLTVPPPRNATPVAANFTASLRSLNSKKYPARVPLKIDHSLFFTIGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPC +C   NGSRVVA +NNVTFVMPT +LLQAHFF I GVFT DFPGNPP  +N+TG
Sbjct  363   GINPCATC--VNGSRVVADINNVTFVMPTISLLQAHFFKIGGVFTDDFPGNPPVTYNFTG  420

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T PAN QT+ GT++YRLPYN+TVQLVLQDTG++APENHP+HLHGFNFF VGRG+GNFN 
Sbjct  421   -TQPANFQTNNGTRIYRLPYNSTVQLVLQDTGMIAPENHPLHLHGFNFFEVGRGLGNFNS  479

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K DPKKFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  480   KKDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFIVDN  539

Query  315   GKGPNES  295
             GKGPNES
Sbjct  540   GKGPNES  546



>ref|XP_007146741.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
 gb|ESW18735.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
Length=556

 Score =   475 bits (1223),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 233/306 (76%), Positives = 262/306 (86%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTIVI PGQTTNV++TA  AAG+Y+VAASPFMDAPIAVDN+T TAT
Sbjct  243   VVEVDAVYTKPFKTDTIVITPGQTTNVLLTAKHAAGKYLVAASPFMDAPIAVDNKTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  ++  TTLT +P +N+T +A +F DSLRSLNSK +PA+VP  +D +LLFTV LG
Sbjct  303   LHYSGTLSSSLTTLTSLPPKNSTILATSFTDSLRSLNSKKYPARVPLKIDRNLLFTVSLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   N SRVVA +NNVTFVMP  +LLQAHFF IKGVFT DFPGNPP  +N+TG 
Sbjct  363   INPCATC--VNNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVFYNFTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P+NL T  GT+LYRL YN+TVQLVLQDTG++ PENHPIHLHGFNFF VGRG GNFNP 
Sbjct  420   TQPSNLNTVNGTRLYRLAYNSTVQLVLQDTGMLTPENHPIHLHGFNFFVVGRGQGNFNPT  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+GVPAGGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  480   KDPKKFNLVDPVERNTVGVPAGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>gb|KHN04832.1| Laccase-4 [Glycine soja]
Length=524

 Score =   473 bits (1218),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 227/306 (74%), Positives = 253/306 (83%), Gaps = 26/306 (8%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFK +TIVIAPGQTTNV++ A+Q +G+Y+VAASPFMDAP+AV        
Sbjct  234   VVEVDATYVKPFKIETIVIAPGQTTNVLLNANQKSGKYLVAASPFMDAPVAV--------  285

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
                              P +NAT +ANNF+ SLR LNSK +P  VP TVDHSL+FTVGLG
Sbjct  286   -----------------PPKNATQIANNFISSLRGLNSKKYPVNVPLTVDHSLIFTVGLG  328

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSCK ANGSRVVA++NNVTF+MPT ALLQAH+F IKGVFTTDFP NPP  FNY+G 
Sbjct  329   INPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTTDFPANPPHVFNYSGP  388

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P ANL T TGTK+YRLP+NATVQ+VLQDTGI+APENHP+HLHGFNFF VGRG+GNFNPK
Sbjct  389   GP-ANLNTETGTKVYRLPFNATVQVVLQDTGIIAPENHPVHLHGFNFFVVGRGVGNFNPK  447

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTIGVPAGGW A RFRADNPGVWFMHCHLE+HTTWGLKMAFLVDNG
Sbjct  448   IDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  507

Query  312   KGPNES  295
             KGP +S
Sbjct  508   KGPKQS  513



>ref|XP_010104683.1| hypothetical protein L484_022066 [Morus notabilis]
 gb|EXC01489.1| hypothetical protein L484_022066 [Morus notabilis]
Length=556

 Score =   473 bits (1218),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 228/306 (75%), Positives = 257/306 (84%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTIVIAPGQTTN ++TADQ AG+Y V ASP+MDAPIAVDN+T TAT
Sbjct  243   VVEVDAVYTKPFKTDTIVIAPGQTTNALLTADQNAGKYSVLASPYMDAPIAVDNKTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G  ++  T LT  P QNAT +A  F +SLRSLNSK +PA+VP  +DHSLLFT+GLG
Sbjct  303   LHYSGTLSSSRTILTAPPPQNATSIATKFTNSLRSLNSKKYPARVPLKIDHSLLFTIGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRVVA +NNVTFVMP  ALLQAHFF I GVFT DFPG PP  FNYTG 
Sbjct  363   VNPCKTC--VNGSRVVADINNVTFVMPNIALLQAHFFNISGVFTDDFPGKPPVPFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P+N  T+ GT+LYRL Y +TVQLVLQDTG++ PENHPIHLHGFNFF VG+G+GNFNP 
Sbjct  420   TQPSNFATTQGTRLYRLAYKSTVQLVLQDTGMITPENHPIHLHGFNFFVVGKGLGNFNPN  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNTIGVP+GGW AIRF+ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  480   KDQKNFNLVDPVERNTIGVPSGGWTAIRFKADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_011032153.1| PREDICTED: laccase-4-like isoform X1 [Populus euphratica]
Length=523

 Score =   471 bits (1211),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 232/306 (76%), Positives = 258/306 (84%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DT+VIAPGQTTNV++TA++ +G+Y+VAASPFMDAPIAVDN T TA 
Sbjct  210   VVEVDAAYVKPFKIDTVVIAPGQTTNVLLTANRGSGKYLVAASPFMDAPIAVDNVTATAI  269

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT  P++NATPVA NF ++LRSLNS  +PA+VP  +D SL FTVGLG
Sbjct  270   LHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARVPLKIDRSLFFTVGLG  329

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRVVA +NNVTFVMPT ALLQAH F I GVFT DFP NPP  FNYTG 
Sbjct  330   VNPCATC--INGSRVVADINNVTFVMPTIALLQAHVFNISGVFTDDFPANPPTPFNYTG-  386

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P N QT  GTKLYRL YN TVQLVLQDTG++ PENHPIHLHGFNFF VGRG+GNF+P 
Sbjct  387   TQPTNFQTVNGTKLYRLAYNNTVQLVLQDTGMLTPENHPIHLHGFNFFEVGRGVGNFDPN  446

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNTIGVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  447   KDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  506

Query  312   KGPNES  295
             KGPNES
Sbjct  507   KGPNES  512



>ref|XP_011032154.1| PREDICTED: laccase-4-like isoform X2 [Populus euphratica]
Length=556

 Score =   472 bits (1214),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 232/306 (76%), Positives = 258/306 (84%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPFK DT+VIAPGQTTNV++TA++ +G+Y+VAASPFMDAPIAVDN T TA 
Sbjct  243   VVEVDAAYVKPFKIDTVVIAPGQTTNVLLTANRGSGKYLVAASPFMDAPIAVDNVTATAI  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   +  TTLT  P++NATPVA NF ++LRSLNS  +PA+VP  +D SL FTVGLG
Sbjct  303   LHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARVPLKIDRSLFFTVGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRVVA +NNVTFVMPT ALLQAH F I GVFT DFP NPP  FNYTG 
Sbjct  363   VNPCATC--INGSRVVADINNVTFVMPTIALLQAHVFNISGVFTDDFPANPPTPFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P N QT  GTKLYRL YN TVQLVLQDTG++ PENHPIHLHGFNFF VGRG+GNF+P 
Sbjct  420   TQPTNFQTVNGTKLYRLAYNNTVQLVLQDTGMLTPENHPIHLHGFNFFEVGRGVGNFDPN  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNTIGVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  480   KDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  539

Query  312   KGPNES  295
             KGPNES
Sbjct  540   KGPNES  545



>ref|XP_009407561.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=559

 Score =   471 bits (1211),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 264/307 (86%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA Y KPF TDT+++ PGQTTNV++TA Q AG+Y+V ASPFMD+P +AVDN+T TA
Sbjct  245   VVEVDAAYTKPFTTDTLLLTPGQTTNVLLTARQGAGRYIVTASPFMDSPLVAVDNRTATA  304

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+ Y    +T A T T+ P QNATPVA++F DSLRSLNS+ +PAKVP TVDHSLLFTVGL
Sbjct  305   TVQYANSVSTSAITTTKPPPQNATPVASSFTDSLRSLNSQQYPAKVPATVDHSLLFTVGL  364

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPC +C  ANGSRVVA +NNV+FVMPTTALLQAH+F   GVFT DFPG PP AFNYTG
Sbjct  365   GVNPCATC--ANGSRVVADINNVSFVMPTTALLQAHYFNASGVFTDDFPGQPPIAFNYTG  422

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             S P  NLQT +GT+LYR+PYNA+VQLVLQDTGI+ PENHPIHLHG+NFF VGRG+GN++P
Sbjct  423   SGP-RNLQTMSGTRLYRVPYNASVQLVLQDTGIIGPENHPIHLHGYNFFVVGRGVGNYDP  481

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K+ P  FNLVDP+ERNTIGVP+GGW AIRFRADNPGVWF+HCH E+HTTWGLKMAF+VD+
Sbjct  482   KSSPSNFNLVDPIERNTIGVPSGGWTAIRFRADNPGVWFLHCHFEVHTTWGLKMAFVVDD  541

Query  315   GKGPNES  295
             G+GPN+S
Sbjct  542   GEGPNQS  548



>ref|XP_006602641.1| PREDICTED: laccase-4-like isoform X1 [Glycine max]
Length=560

 Score =   471 bits (1211),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 230/307 (75%), Positives = 260/307 (85%), Gaps = 1/307 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             VVEVDA+YVKPFKTDT+ IAPGQTTN ++TADQ +G+Y + AS FMD+P+ AVDN T TA
Sbjct  243   VVEVDASYVKPFKTDTLSIAPGQTTNALLTADQNSGKYTIVASTFMDSPVVAVDNLTATA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHYTG   T  T LT  P +NAT VANNF +SL+SLNSK +PAKVPQ VDHSLL TVGL
Sbjct  303   TLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLLTVGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPCPSC   NGSRVVA+VNNVTFVMPTTALLQAH+F IKGVFTTDFPGNP   +NYT 
Sbjct  363   GINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVFTTDFPGNPSHVYNYTA  422

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             + P A  QT+ GTK YRL +N+TVQ+VLQDTG++APE+HP+HLHGFNFF VG G+GN++P
Sbjct  423   TPPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPESHPVHLHGFNFFVVGSGVGNYDP  482

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTD   FNL DPVERNTIGVP GGWVA RFRADNPGVWF+HCH E+HTTWGLKMAFLVDN
Sbjct  483   KTDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGVWFLHCHFEVHTTWGLKMAFLVDN  542

Query  315   GKGPNES  295
             GKGPNES
Sbjct  543   GKGPNES  549



>ref|XP_007140382.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
 gb|ESW12376.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
Length=560

 Score =   470 bits (1209),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 226/307 (74%), Positives = 260/307 (85%), Gaps = 1/307 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             VVEVDA+YVKPFKTDT++IAPGQTTN ++T DQ +G+Y + AS FMD+P+ AVDN T TA
Sbjct  243   VVEVDASYVKPFKTDTLLIAPGQTTNALLTTDQNSGKYTIVASTFMDSPVVAVDNLTATA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHYTG   T  T L   P +NAT VANNF  SL+SLNSK +PA VP TVDHSLLFTVGL
Sbjct  303   TLHYTGTLATTPTVLITPPPRNATQVANNFTKSLKSLNSKKYPANVPLTVDHSLLFTVGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPCPSC   NGSRVVA+VNNVTFVMPTTALLQAH+F  +GVFTTDFPGNPP  +NYT 
Sbjct  363   GINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNTQGVFTTDFPGNPPQVYNYTA  422

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             +   A+ QT+ GTK+YRL +N+TVQ+VLQDTG++A E+HPIHLHGFNFF VG G+GN++P
Sbjct  423   TPRAASSQTTNGTKVYRLAFNSTVQVVLQDTGVIALESHPIHLHGFNFFVVGSGVGNYDP  482

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTD   FNLVDPVERNTIGVP GGW+A+RFRADNPGVWF+HCH E+HTTWGLKMAFLVDN
Sbjct  483   KTDGSNFNLVDPVERNTIGVPTGGWIALRFRADNPGVWFLHCHFEVHTTWGLKMAFLVDN  542

Query  315   GKGPNES  295
             GKGPNES
Sbjct  543   GKGPNES  549



>ref|XP_009384856.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=558

 Score =   468 bits (1205),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 262/307 (85%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDATY KPF  DT++IAPGQTTNV++TADQ AG+Y+V ASPFMD+P +AVDN TGTA
Sbjct  244   VVEVDATYTKPFTIDTLLIAPGQTTNVLLTADQGAGRYLVTASPFMDSPLVAVDNSTGTA  303

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+ YT   +T A   T++P +N+T +A+ F+DSLRSLNSK +PA VP TVDHSLLFTVGL
Sbjct  304   TVQYTDAVSTSAIATTKLPPRNSTSLASQFIDSLRSLNSKQYPANVPSTVDHSLLFTVGL  363

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPCP+C   NGSRVVA++NNVTF+MPTTALLQAH+F + GVFT DFPG P  AFNYTG
Sbjct  364   GVNPCPAC--TNGSRVVAAMNNVTFMMPTTALLQAHYFNMSGVFTNDFPGQPLIAFNYTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             S P  N QT  GT+LYRLPYNA+VQLVLQDTGI+ PE+HPIHLHG+NFF VGRG+GN++P
Sbjct  422   SGP-NNTQTMNGTRLYRLPYNASVQLVLQDTGIIGPESHPIHLHGYNFFVVGRGVGNYDP  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
              T P KFNLVDP+ERNT+ VPA GW AIRFRADNPGVWF+HCH E+HTTWGLKMAF+V++
Sbjct  481   ATSPSKFNLVDPIERNTMAVPAAGWTAIRFRADNPGVWFLHCHFEVHTTWGLKMAFVVED  540

Query  315   GKGPNES  295
             GKGPNES
Sbjct  541   GKGPNES  547



>ref|XP_009590412.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   468 bits (1205),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 220/306 (72%), Positives = 258/306 (84%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+YVKPFKTDTI IAPGQTTN I+TADQ+AG+Y++A SPFMD  +A DN T T T
Sbjct  243   VVEVDASYVKPFKTDTIFIAPGQTTNAILTADQSAGKYLIAVSPFMDTIVATDNLTATGT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY G      T LT IPS+NATPV N FVDSLRSLNSK +PA VP T+DHSLL T+G+G
Sbjct  303   VHYLGTDALSPTALTTIPSRNATPVTNIFVDSLRSLNSKKYPANVPLTIDHSLLLTMGIG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C+  NGSRVVA++NNVTFVMPTTA+LQAH++ I GV+T DFPGNP   FNYTG 
Sbjct  363   VNPCATCQ--NGSRVVAAINNVTFVMPTTAILQAHYYNISGVYTADFPGNPSIPFNYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT  GTK+Y++ +N+TVQ+VLQ T I+APE+HP HLHGFNFF VG+G+GN++PK
Sbjct  420   TPPTNLQTQNGTKVYKVEFNSTVQVVLQGTSIIAPESHPTHLHGFNFFVVGKGVGNYDPK  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+ VP  GW AIRFRADNPGVWFMHCHLE+HTTWGLKM FLV+NG
Sbjct  480   NDPKKFNLVDPVERNTMSVPTAGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMGFLVENG  539

Query  312   KGPNES  295
             KGPN+S
Sbjct  540   KGPNQS  545



>ref|XP_004490574.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=570

 Score =   468 bits (1205),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/306 (73%), Positives = 262/306 (86%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+Y KPFKTDTI+IAPGQTTNV++ A+  AG+YMVAAS FMDAPIA+DN T TAT
Sbjct  257   VVEVDASYTKPFKTDTILIAPGQTTNVLVKANHLAGKYMVAASTFMDAPIAIDNVTATAT  316

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   +  TTLT +P +NAT +ANNF +SL+SLNS  +PA+VP+ VDHSLLFT+ LG
Sbjct  317   LHYTGSLGSTITTLTSLPPRNATFLANNFTNSLKSLNSPKYPARVPKKVDHSLLFTISLG  376

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG RVVA++NNVTFVMP  +LLQAHFF I GVFT DFP  PP  +++TG 
Sbjct  377   VNPCATC--VNGGRVVAAINNVTFVMPKISLLQAHFFNISGVFTDDFPEKPPRVYDFTGK  434

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P +NL+T+ GT++YRL YN+TVQLVLQDTG++APENHPIHLHGFNFF VG+G GNFN K
Sbjct  435   QP-SNLRTNKGTRVYRLAYNSTVQLVLQDTGMIAPENHPIHLHGFNFFVVGKGKGNFNSK  493

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDNG
Sbjct  494   KDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNG  553

Query  312   KGPNES  295
             KGPNES
Sbjct  554   KGPNES  559



>ref|XP_003604619.1| Laccase 1a [Medicago truncatula]
 gb|AES86816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=557

 Score =   468 bits (1204),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 223/307 (73%), Positives = 260/307 (85%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY KPF+ +TIVIAPGQTTNV++ A+Q +G+Y+VAASPFMDAP+AVDN T TAT
Sbjct  241   VVEVDATYTKPFQIETIVIAPGQTTNVLLKANQKSGKYLVAASPFMDAPVAVDNLTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQN-ATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             LHY+G   T   T    P    AT +ANNF++SL+ LNSK +P  VP  +DHSL FTVGL
Sbjct  301   LHYSGTTLTNTPTFLTTPPPTNATQIANNFLNSLKGLNSKKYPVNVPLKIDHSLFFTVGL  360

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPCPSCK  NGSRVVA++NNVTFVMPTTALLQAH+F IK VFT DFP NPP  +N+TG
Sbjct  361   GVNPCPSCKAGNGSRVVAAINNVTFVMPTTALLQAHYFNIKNVFTADFPPNPPHIYNFTG  420

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             + P  NL T++GTKLY+L +N TVQLV+QDTGI+APE+HP+HLHGFNFF VGRG+GN++ 
Sbjct  421   AGP-KNLNTTSGTKLYKLSFNDTVQLVMQDTGIIAPESHPVHLHGFNFFVVGRGVGNYDS  479

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVPAGGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDN
Sbjct  480   KNDSKKFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  539

Query  315   GKGPNES  295
             GKGP +S
Sbjct  540   GKGPKQS  546



>ref|XP_007207096.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
 gb|EMJ08295.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
Length=558

 Score =   467 bits (1201),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 228/307 (74%), Positives = 259/307 (84%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA Y KPFKTDT++IAPGQTTNV+++ +   G+Y+VAASPFMD P I VDN+T TA
Sbjct  244   VVEVDAVYTKPFKTDTVLIAPGQTTNVLLSTNHGTGKYLVAASPFMDNPTILVDNKTATA  303

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHYTG   +  TTLT  P QNAT VA  F +SLRSLNS  FPA+VP  +DHSLLFTVGL
Sbjct  304   TLHYTGTPESTRTTLTAPPPQNATLVATKFTNSLRSLNSVKFPARVPLKIDHSLLFTVGL  363

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G++ C SC  ANG+RVVA +NNVTFVMP  +LLQAHFF I GVFT DFPGNP   +NYTG
Sbjct  364   GLHTCASC--ANGNRVVADINNVTFVMPKISLLQAHFFNISGVFTDDFPGNPLNPYNYTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               P  N+QT  GT+LYRL YN+TVQLVLQDTG++APENHP+HLHGFNFF VGRG+GNFNP
Sbjct  422   PQP-TNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENHPVHLHGFNFFEVGRGLGNFNP  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDPK+FNL+DPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  481   KTDPKRFNLIDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDN  540

Query  315   GKGPNES  295
             GKGPNES
Sbjct  541   GKGPNES  547



>ref|XP_010037723.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW49475.1| hypothetical protein EUGRSUZ_K02996 [Eucalyptus grandis]
Length=562

 Score =   466 bits (1200),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 222/309 (72%), Positives = 267/309 (86%), Gaps = 4/309 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDATYVKPF+TDTI+I PGQTTNV++T +Q AG+Y++ AS FM+ A +A+DN T +A
Sbjct  244   VVEVDATYVKPFQTDTILITPGQTTNVLLTTNQNAGKYLITASTFMETAIVAIDNVTASA  303

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
              +HY+G   + +T LT+ P QNA+ VAN+F ++LRSLNSK +PAKVP+TVDH+L FT+GL
Sbjct  304   AVHYSGTLASASTVLTKPPPQNASAVANSFNNALRSLNSKKYPAKVPKTVDHNLFFTMGL  363

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPCP+C   NGSRVVA+VNN++FVMPT ALLQAH F I GVFTTDFPGNPP  +NYT 
Sbjct  364   GVNPCPTCTAGNGSRVVAAVNNISFVMPTIALLQAHVFNISGVFTTDFPGNPPTTYNYT-  422

Query  675   STPPAN--LQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNF  502
             +TPP N  + T  GTK+YRLPYNATVQLVLQDTGI+APE HPIHLHGFNFF VG+G+GN+
Sbjct  423   ATPPQNASVPTMNGTKVYRLPYNATVQLVLQDTGIIAPETHPIHLHGFNFFGVGKGVGNY  482

Query  501   NPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV  322
             +PK DPKKFNLVDPVERNTIG+P+GGW+AIRF ADNPGVWF+HCHLE+HTTWGLKMAFLV
Sbjct  483   DPKKDPKKFNLVDPVERNTIGIPSGGWIAIRFTADNPGVWFLHCHLEVHTTWGLKMAFLV  542

Query  321   DNGKGPNES  295
             DNGKGP E+
Sbjct  543   DNGKGPKET  551



>ref|XP_004294236.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   466 bits (1199),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 258/307 (84%), Gaps = 3/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA Y KPF+T TI+IAPGQTTNV++TAD++ G+Y+VAASPFMD P +AVDN+T TA
Sbjct  246   VVEVDAVYTKPFETTTILIAPGQTTNVLLTADRSTGKYLVAASPFMDNPTVAVDNKTATA  305

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY G   +  T LT  P QNAT +A +F  SLRSLNS T+PAKVP  +DHSL+FTV L
Sbjct  306   TLHYRGSLASTNTILTVPPPQNATRLATSFTKSLRSLNSDTYPAKVPLKIDHSLMFTVSL  365

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+  CPSC  ANG+RVVA +NNVTFVMP  +LLQAH F I GVFT DFPGNP   +NYTG
Sbjct  366   GLQTCPSC--ANGNRVVADLNNVTFVMPKISLLQAHVFNISGVFTDDFPGNPLMPYNYTG  423

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             +  P N+QT  GT+LYRL YN+TVQLVLQDTG++APENHP+HLHGFNFF VGRG+GNFN 
Sbjct  424   AQQPTNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENHPVHLHGFNFFEVGRGLGNFNS  483

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDPK FNL+DPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  484   KTDPKIFNLIDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDN  543

Query  315   GKGPNES  295
             GKGPNES
Sbjct  544   GKGPNES  550



>emb|CDP14064.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   464 bits (1194),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 256/306 (84%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDA+YVKPFKTDTI I PGQTTN I+TADQ AG+Y++A SPFMD  +A DNQT T  
Sbjct  242   IVEVDASYVKPFKTDTIFIGPGQTTNAILTADQDAGKYLIAISPFMDTTVATDNQTATGV  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             + Y        T LT IP +NATPV N+F++SLRSLNSK +P KVP  +DHSLLFT+G+G
Sbjct  302   IRYKSTTAFSPTALTTIPPRNATPVTNSFMESLRSLNSKEYPTKVPLEIDHSLLFTIGIG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C+  NGSRVVA++NNVTFV+PTTALLQAH++GI GV+T DFPGNPP  +NYTG 
Sbjct  362   INPCATCQ--NGSRVVAAINNVTFVLPTTALLQAHYYGISGVYTEDFPGNPPTPYNYTG-  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP N+QT+ GTK+Y+L +N+TVQ+V+Q   IVAPE+HP HLHGFNFF VG+G+GNFNP 
Sbjct  419   TPPTNIQTTNGTKVYKLAFNSTVQVVIQGNSIVAPESHPTHLHGFNFFVVGKGLGNFNPN  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDPKKFNLVDPVERNTI VP GGW  IRFRADNPG+WFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  479   TDPKKFNLVDPVERNTISVPTGGWTVIRFRADNPGIWFMHCHLEVHTTWGLKMAFLVENG  538

Query  312   KGPNES  295
              GPNES
Sbjct  539   NGPNES  544



>ref|XP_008355354.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008355361.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008363414.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   464 bits (1193),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 229/307 (75%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA Y KPFKTDTI+IAPGQTTNV++T +  +G+Y+VAASPFMD P I VDN+T TA
Sbjct  244   VVEVDAVYTKPFKTDTILIAPGQTTNVLVTTNLGSGKYLVAASPFMDNPTIVVDNKTATA  303

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY G   +  T LT  P QNAT VA NF +SLRSLNS  FPA+VP  +DHSLLFTVGL
Sbjct  304   TLHYIGTLQSTKTILTAPPPQNATTVATNFTNSLRSLNSIRFPARVPLKIDHSLLFTVGL  363

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G++ C SC   NG+RVVA +NNVTFVMP  ALLQAHFF I GVFT DFPGNP   +NYTG
Sbjct  364   GLHTCASC--TNGNRVVADINNVTFVMPEIALLQAHFFNISGVFTDDFPGNPLNPYNYTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T P NLQT  GT+LYRL YN+TVQLVLQDTG++APE HP+HLHGFNFF VGRG+GNFNP
Sbjct  422   -TQPTNLQTRKGTRLYRLAYNSTVQLVLQDTGMIAPETHPVHLHGFNFFEVGRGLGNFNP  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
               DPKKFNLVDPVERNTIGVP+ GW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  481   MKDPKKFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDN  540

Query  315   GKGPNES  295
             GKGPNES
Sbjct  541   GKGPNES  547



>ref|XP_008220423.1| PREDICTED: laccase-4 [Prunus mume]
Length=558

 Score =   462 bits (1188),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 225/307 (73%), Positives = 257/307 (84%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA Y KPFKTDT++IAPGQTTNV+++ +   G+Y+VAASPFMD P I VDN+T TA
Sbjct  244   VVEVDAVYTKPFKTDTVLIAPGQTTNVLLSTNHGTGKYLVAASPFMDNPTILVDNKTATA  303

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY G   +  TTLT  P QNAT VA  F +SLRSLNS  FPA+VP  +DHSLLFTVGL
Sbjct  304   TLHYMGTLESTRTTLTAPPPQNATLVATKFTNSLRSLNSVKFPARVPLKIDHSLLFTVGL  363

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G++ C SC  ANG+R+VA +NNVTFVMP  +LLQAHFF I GVFT DFPGNP   +NYTG
Sbjct  364   GLHTCASC--ANGNRLVADINNVTFVMPKISLLQAHFFNISGVFTDDFPGNPLNPYNYTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               P  N+QT  GT+LYRL YN+TVQLVLQDTG++APENHP+HLHGFNFF VGRG+GNFNP
Sbjct  422   PQP-TNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENHPVHLHGFNFFEVGRGLGNFNP  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K DPK+FNL+DPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  481   KKDPKRFNLIDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDN  540

Query  315   GKGPNES  295
             GKGPNES
Sbjct  541   GKGPNES  547



>ref|XP_009416212.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=562

 Score =   461 bits (1187),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 223/308 (72%), Positives = 260/308 (84%), Gaps = 5/308 (2%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDATY KPF TDT++I PGQTTNV++TADQ AG+Y+VAASPF D+P +AVDN+T TA
Sbjct  247   VVEVDATYTKPFTTDTLLITPGQTTNVLLTADQGAGRYLVAASPFADSPLVAVDNRTATA  306

Query  1035  TLHYTGVQttlattlT-RIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVG  859
             T+ Y    +  A   T + P QNATPVA++FVD+LRSLNSK +PAKVP  VD SLLFTVG
Sbjct  307   TVQYASSVSASAVVTTTKPPPQNATPVASSFVDTLRSLNSKQYPAKVPLMVDRSLLFTVG  366

Query  858   LGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYT  679
             LG+NPC +C   NGSRVVA +NNVTFVMPTTALLQAH+F   GVFT DFPG PP AFNYT
Sbjct  367   LGVNPCATC--TNGSRVVADINNVTFVMPTTALLQAHYFNTSGVFTDDFPGQPPIAFNYT  424

Query  678   GSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
             GS P +N+QT  GT+LYRL +NA+VQLVLQDTG++ PE+HPIHLHG+NFF VGRG+GN++
Sbjct  425   GSGP-SNMQTMNGTRLYRLSFNASVQLVLQDTGVIGPESHPIHLHGYNFFVVGRGVGNYD  483

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PKT P KFNLVDPVERNTIGVP GGW AIRFRADNPGVWF+HCH E+HT+WGLKMAF+VD
Sbjct  484   PKTSPSKFNLVDPVERNTIGVPTGGWTAIRFRADNPGVWFLHCHFEVHTSWGLKMAFVVD  543

Query  318   NGKGPNES  295
             +GKG NES
Sbjct  544   DGKGTNES  551



>ref|XP_009346884.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   461 bits (1185),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 227/307 (74%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA Y KPFKTDTI+IAPGQTTNV+++ +  +G+Y+VAASPFMD P I VDN+T TA
Sbjct  244   VVEVDAVYTKPFKTDTILIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKTATA  303

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY G   +  T LT  P QNAT VA NF +SLRSLNS  FPA+VP  +DHSLLFTVGL
Sbjct  304   TLHYIGTLESTTTILTFPPPQNATLVATNFTNSLRSLNSIQFPARVPLKIDHSLLFTVGL  363

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G++ C SC  ANG+RVVA +NNVTFVMP   LLQAHFF I GVFT DFPGNP   +NYTG
Sbjct  364   GLHTCASC--ANGNRVVADINNVTFVMPKIGLLQAHFFNISGVFTDDFPGNPLNPYNYTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T P N+QT  GT+LYRL YN TVQLVLQ TG++APE HP+HLHGFNFF VGRG+GNFNP
Sbjct  422   -TQPTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETHPVHLHGFNFFEVGRGLGNFNP  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDPK+FNLVDPVERNTIGVP+ GW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  481   KTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDN  540

Query  315   GKGPNES  295
             GKGPNES
Sbjct  541   GKGPNES  547



>ref|XP_009337309.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   460 bits (1183),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 226/307 (74%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA Y KPFKTDTI+IAPGQTTNV+++ +  +G+Y+VAASPFMD P I VDN+T TA
Sbjct  244   VVEVDAVYTKPFKTDTILIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKTATA  303

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY G   +  T LT  P QNAT VA NF +SLRSLNS  FPA+VP  +DHSLLFTVGL
Sbjct  304   TLHYIGTLESTTTILTFPPPQNATLVATNFTNSLRSLNSIQFPARVPLKIDHSLLFTVGL  363

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G++ C SC  ANG+RVVA +NNVTFVMP   LLQAHFF I GVFT DFPGNP   +NYTG
Sbjct  364   GLHTCASC--ANGNRVVADINNVTFVMPKIGLLQAHFFNISGVFTDDFPGNPLNPYNYTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T P N+QT  GT+LYRL YN TVQLVLQ TG++APE HP+HLHGFNF+ VGRG+GNFNP
Sbjct  422   -TQPTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETHPVHLHGFNFYEVGRGLGNFNP  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KTDPK+FNLVDPVERNTIGVP+ GW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  481   KTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDN  540

Query  315   GKGPNES  295
             GKGPNES
Sbjct  541   GKGPNES  547



>gb|AES98533.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=558

 Score =   460 bits (1183),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 256/306 (84%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTIVI PGQTTNV++  + A+G+YMVAAS FMDAPIA+DN T TAT
Sbjct  244   VVEVDAAYTKPFKTDTIVITPGQTTNVLLKTNHASGKYMVAASTFMDAPIAIDNVTATAT  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY     +  TTLT +P  N+T +AN+F DSL+SLNS  +PA+VP+ +DHSL FTV LG
Sbjct  304   LHYPNTLGSTITTLTSLPPINSTKIANSFTDSLKSLNSHKYPARVPKKIDHSLFFTVSLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRVVA++NNVTFVMP  +LLQAHFF I G+FT DFP  P   +++TG+
Sbjct  364   VNPCATC--PNGSRVVAAINNVTFVMPKISLLQAHFFNISGIFTDDFPRKPEIVYDFTGN  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P+N +T+ GT++YRL YN+TVQL+LQDTG++APENHPIHLHGFNFF VG+G GNFNPK
Sbjct  422   KQPSNFRTNKGTRVYRLAYNSTVQLILQDTGMIAPENHPIHLHGFNFFVVGKGQGNFNPK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  482   KDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNG  541

Query  312   KGPNES  295
             KGPNES
Sbjct  542   KGPNES  547



>ref|XP_003615575.1| Laccase 1a [Medicago truncatula]
Length=593

 Score =   460 bits (1184),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 256/306 (84%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDTIVI PGQTTNV++  + A+G+YMVAAS FMDAPIA+DN T TAT
Sbjct  279   VVEVDAAYTKPFKTDTIVITPGQTTNVLLKTNHASGKYMVAASTFMDAPIAIDNVTATAT  338

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY     +  TTLT +P  N+T +AN+F DSL+SLNS  +PA+VP+ +DHSL FTV LG
Sbjct  339   LHYPNTLGSTITTLTSLPPINSTKIANSFTDSLKSLNSHKYPARVPKKIDHSLFFTVSLG  398

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRVVA++NNVTFVMP  +LLQAHFF I G+FT DFP  P   +++TG+
Sbjct  399   VNPCATC--PNGSRVVAAINNVTFVMPKISLLQAHFFNISGIFTDDFPRKPEIVYDFTGN  456

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P+N +T+ GT++YRL YN+TVQL+LQDTG++APENHPIHLHGFNFF VG+G GNFNPK
Sbjct  457   KQPSNFRTNKGTRVYRLAYNSTVQLILQDTGMIAPENHPIHLHGFNFFVVGKGQGNFNPK  516

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLEIHTTWGLKMAF+VDNG
Sbjct  517   KDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNG  576

Query  312   KGPNES  295
             KGPNES
Sbjct  577   KGPNES  582



>ref|XP_010685615.1| PREDICTED: laccase-4 [Beta vulgaris subsp. vulgaris]
Length=560

 Score =   458 bits (1178),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/308 (72%), Positives = 257/308 (83%), Gaps = 5/308 (2%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITAD-QAAGQYMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDATYVKPFKTDTIVI+PGQTTNVI+ A+ +  G+Y++  SPFMDAPI VDN TG A
Sbjct  245   VVEVDATYVKPFKTDTIVISPGQTTNVILEANNKVLGKYLMVVSPFMDAPIPVDNATGLA  304

Query  1035  TLHYTGVQttlattlTRIPSQ-NATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVG  859
             T+ YT  ++   +T    P   NAT VA+NF ++L++LNSK FPAKVPQ +DHSL FT+G
Sbjct  305   TVRYTTSKSATLSTTLTAPPPINATKVADNFTNALKALNSKEFPAKVPQKIDHSLFFTIG  364

Query  858   LGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYT  679
             LG+NPC +C   NGSRVVAS+NNVTF+MPT +LLQAH+F + GVFT DFP  P   FNYT
Sbjct  365   LGVNPCSTC--VNGSRVVASINNVTFIMPTISLLQAHYFNLSGVFTADFPSKPVIPFNYT  422

Query  678   GSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
             G+    NL T+TGTK+YRLPYNATVQLVLQDT ++APENHP HLHGFNFF VGRG+GN+N
Sbjct  423   GNQV-TNLGTTTGTKVYRLPYNATVQLVLQDTAMIAPENHPFHLHGFNFFVVGRGLGNYN  481

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PK DPKKFNLVDPVERNTIGVP+GGW AIRFRADNPGVWF+HCHLEIHTTWGLKMAFLVD
Sbjct  482   PKEDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFLHCHLEIHTTWGLKMAFLVD  541

Query  318   NGKGPNES  295
             NGKG NES
Sbjct  542   NGKGLNES  549



>ref|XP_010676357.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=561

 Score =   457 bits (1176),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 220/308 (71%), Positives = 253/308 (82%), Gaps = 4/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITAD-QAAGQYMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDATYVKPFKTDTIVI+PGQTTNVI+ A+ +A G+Y+V  SPFMDAP+ VDN TG A
Sbjct  245   VVEVDATYVKPFKTDTIVISPGQTTNVILEANNKAMGKYLVVVSPFMDAPVPVDNATGFA  304

Query  1035  TLHYTGVQttlattlTRIPSQ-NATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVG  859
             TL Y   +    +     P   NAT VA+NF ++LRSLN+K FPAKVPQ VDHSL FTVG
Sbjct  305   TLRYPAFRHKTLSATLTAPPPINATAVADNFTNALRSLNTKEFPAKVPQKVDHSLFFTVG  364

Query  858   LGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYT  679
             LG+NPC +C   NGSR+VA +NN+TFVMP  ++LQAH++ I GVFT DFP  PP  FN+T
Sbjct  365   LGVNPCKTC--VNGSRIVADINNITFVMPDISILQAHYYNISGVFTDDFPAKPPTPFNFT  422

Query  678   GSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
             G+    N+ T+ GTK+YRLPYNATVQLVLQDT I+APENHP HLHGFNFF VG+G+GNFN
Sbjct  423   GNNQVTNVGTTKGTKVYRLPYNATVQLVLQDTAIIAPENHPFHLHGFNFFVVGKGVGNFN  482

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PK DPKKFNLVDPVERNTIGVP+GGW AIRFRADNPGVWF HCHLEIHTTWGLKMAFLVD
Sbjct  483   PKNDPKKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFFHCHLEIHTTWGLKMAFLVD  542

Query  318   NGKGPNES  295
             +GKGP+ES
Sbjct  543   DGKGPSES  550



>gb|AAT75352.1| laccase-like multicopper oxidase 19 [Brassica napus]
Length=357

 Score =   449 bits (1156),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 215/289 (74%), Positives = 243/289 (84%), Gaps = 1/289 (0%)
 Frame = -2

Query  1209  VEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTATL  1030
             VEVDA YVKPFK DTIVIAPGQTTNV++TA ++ G+Y+V ASPFMD+PIAVDN T TAT+
Sbjct  70    VEVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATV  129

Query  1029  HYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLGI  850
             HY+G  ++  T LT  P QNAT VA NF +SLRSLNSK +PA VP T+DH L FTVGLG+
Sbjct  130   HYSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGL  189

Query  849   NPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGST  670
             NPCP+CK  NGSRVVAS+NNVTFVMP  ALL AH+F I GVFT DFP NPP  FNY+G +
Sbjct  190   NPCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTPDFPKNPPHVFNYSGGS  249

Query  669   PPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPKT  490
                N+ T TGT+LY+LP NATVQLVLQDTGI+APENHPIHLHG+NFF VGRG+GNFNPK 
Sbjct  250   -VTNMATETGTRLYKLPCNATVQLVLQDTGIIAPENHPIHLHGYNFFEVGRGLGNFNPKK  308

Query  489   DPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWG  343
             DP  FNLVDPVERNTIGVP+GGWV IRFRADNPGVWFMHCHLE+HTTWG
Sbjct  309   DPNNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVHTTWG  357



>emb|CBI31539.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   456 bits (1172),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 256/306 (84%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDT+ IAPGQTTN ++TADQ AG+Y+V  SPFMDAPI VDN TGTA 
Sbjct  220   VVEVDAIYAKPFKTDTLFIAPGQTTNALLTADQGAGKYLVVVSPFMDAPIPVDNITGTAI  279

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L YTG      T LT  PSQNAT + ++F+DSL+SLNSK +PA VP  +DHSLLFT+G+G
Sbjct  280   LSYTGTLAASPTVLTTSPSQNATQLTSSFMDSLKSLNSKQYPANVPLAIDHSLLFTIGVG  339

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSR+V+ +NNVTFVMPTT LL+AH++ I GVFT DFPGNP  AFNYTG 
Sbjct  340   VNPCSTC--VNGSRLVSYINNVTFVMPTTGLLEAHYYNIGGVFTVDFPGNPLIAFNYTG-  396

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P+N+QT  GT+LYRL YN+TVQ+V+Q T +++PE+HP HLHGF+F+AVGRG+GNF+P 
Sbjct  397   TQPSNMQTMNGTRLYRLAYNSTVQVVIQGTAMISPESHPTHLHGFDFYAVGRGLGNFDPV  456

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNL+DP+ RNTIGVP+GGW AIRFRADNPGVW +HCHLE+HTTWGLKMAFLV+NG
Sbjct  457   NDPKKFNLIDPIARNTIGVPSGGWTAIRFRADNPGVWLLHCHLEVHTTWGLKMAFLVENG  516

Query  312   KGPNES  295
             KGPNES
Sbjct  517   KGPNES  522



>ref|XP_002265173.1| PREDICTED: laccase-4-like [Vitis vinifera]
Length=553

 Score =   456 bits (1173),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 256/306 (84%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDT+ IAPGQTTN ++TADQ AG+Y+V  SPFMDAPI VDN TGTA 
Sbjct  240   VVEVDAIYAKPFKTDTLFIAPGQTTNALLTADQGAGKYLVVVSPFMDAPIPVDNITGTAI  299

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L YTG      T LT  PSQNAT + ++F+DSL+SLNSK +PA VP  +DHSLLFT+G+G
Sbjct  300   LSYTGTLAASPTVLTTSPSQNATQLTSSFMDSLKSLNSKQYPANVPLAIDHSLLFTIGVG  359

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSR+V+ +NNVTFVMPTT LL+AH++ I GVFT DFPGNP  AFNYTG 
Sbjct  360   VNPCSTC--VNGSRLVSYINNVTFVMPTTGLLEAHYYNIGGVFTVDFPGNPLIAFNYTG-  416

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T P+N+QT  GT+LYRL YN+TVQ+V+Q T +++PE+HP HLHGF+F+AVGRG+GNF+P 
Sbjct  417   TQPSNMQTMNGTRLYRLAYNSTVQVVIQGTAMISPESHPTHLHGFDFYAVGRGLGNFDPV  476

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNL+DP+ RNTIGVP+GGW AIRFRADNPGVW +HCHLE+HTTWGLKMAFLV+NG
Sbjct  477   NDPKKFNLIDPIARNTIGVPSGGWTAIRFRADNPGVWLLHCHLEVHTTWGLKMAFLVENG  536

Query  312   KGPNES  295
             KGPNES
Sbjct  537   KGPNES  542



>ref|XP_009374280.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   455 bits (1170),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 225/307 (73%), Positives = 254/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA Y KPFKTDTI+IAPGQTTNV++T +  +G+++VAASPFMD P I VDN+T TA
Sbjct  244   VVEVDAVYTKPFKTDTILIAPGQTTNVLVTTNLGSGKFLVAASPFMDNPTIVVDNKTATA  303

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY G   +  T LT  P QNAT VA NF +SL+SLNS  FPA+VP  VDHSLLFTV L
Sbjct  304   TLHYIGTLQSTKTILTAPPPQNATIVATNFTNSLKSLNSIRFPARVPLKVDHSLLFTVSL  363

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G++ C SC   NG+RVVA +NNVTFVMP  ALLQAHFF I GVFT DFPGNP   +NYTG
Sbjct  364   GLHTCASC--TNGNRVVADINNVTFVMPKIALLQAHFFNISGVFTDDFPGNPLNPYNYTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T P NLQT  GT+LYRL YN+TVQLVLQ TG++APE HP+HLHGFNFF VGRG+GNFNP
Sbjct  422   -TQPTNLQTRKGTRLYRLAYNSTVQLVLQGTGMIAPETHPVHLHGFNFFEVGRGLGNFNP  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K DPKKFNLVDPVERNTIGVP+ GW AIRF+ADNPG+WFMHCHLE+HTTWGLKMAF+VDN
Sbjct  481   KKDPKKFNLVDPVERNTIGVPSNGWTAIRFKADNPGIWFMHCHLEVHTTWGLKMAFVVDN  540

Query  315   GKGPNES  295
             GKGPNES
Sbjct  541   GKGPNES  547



>gb|EPS60103.1| laccase 1a, partial [Genlisea aurea]
Length=546

 Score =   454 bits (1168),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 256/308 (83%), Gaps = 3/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITA-DQAAGQYMVAASPFMDAPIAVDNQTGTA  1036
             VVE DA YVKPF+TD IVIAPGQTTN I+TA D+ AG++ + A+PF DAP+ VDN+T TA
Sbjct  229   VVEADAVYVKPFQTDVIVIAPGQTTNAILTASDKLAGKFTILATPFQDAPLPVDNRTATA  288

Query  1035  TLHYTG-VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVG  859
             T++Y G V ++ A TL   P  NATP+AN F DSLRSLNSK FPA VP  +DHSL FTVG
Sbjct  289   TVNYAGTVLSSSALTLATPPRVNATPIANGFTDSLRSLNSKNFPANVPLEIDHSLFFTVG  348

Query  858   LGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYT  679
             LG+ PC +C+  NGSR+VA +NNVTFVMPTTALLQAHFF  KGVFTTDFPGNPP +F+YT
Sbjct  349   LGVIPCATCRAGNGSRIVADINNVTFVMPTTALLQAHFFKTKGVFTTDFPGNPPSSFDYT  408

Query  678   GSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
             G +P  NL T+ GTKLYRL YN TVQ+V+QDTG++  ENHP+HLHGFNFF VG+G+GNFN
Sbjct  409   GRSP-RNLATTNGTKLYRLKYNDTVQIVIQDTGMIMAENHPVHLHGFNFFGVGKGLGNFN  467

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
                DPK+FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVD
Sbjct  468   STADPKRFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVD  527

Query  318   NGKGPNES  295
             +G  P ++
Sbjct  528   DGTSPEQT  535



>ref|XP_006287399.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
 gb|EOA20297.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
Length=558

 Score =   454 bits (1168),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 255/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +GQY++AA+PF D A +AVDN+T TA
Sbjct  242   VVEVDAAYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATA  301

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P QNAT VAN+FV SLRSLNS T+PAKVP TVDH LLFTVGL
Sbjct  302   TVHYSGTLSATPTKTTSPPPQNATSVANSFVKSLRSLNSNTYPAKVPVTVDHDLLFTVGL  361

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MPTTALLQAH+F   GV+TTDFPG P   F++TG
Sbjct  362   GINRCHSCKAGNFSRVVAAINNITFKMPTTALLQAHYFNQTGVYTTDFPGRPRRVFDFTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYNATVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  422   K-PPSNLATMKATKLYKLPYNATVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGSGNYNS  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLVDN
Sbjct  481   KRDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDN  540

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  541   GKGPNQS  547



>ref|XP_011084946.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=555

 Score =   454 bits (1168),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 253/306 (83%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDA+Y KPFKTDTI I PGQTTN ++TADQ  G Y++A SPFMD  +A+DNQT   T
Sbjct  242   IVEVDASYTKPFKTDTIFIGPGQTTNALLTADQKIGNYLIAISPFMDTIVAIDNQTAMGT  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+    +TTLT +P QNATP+   F+DSLRSLNSK +PA VPQTVDHSL+F +G+ 
Sbjct  302   LRYNGMLAVSSTTLTAMPPQNATPITTKFMDSLRSLNSKEYPANVPQTVDHSLMFAIGVA  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGSRV+A +NNV+FVMPTTA+LQAH++ I GV+T DFP NPP  +NYTG 
Sbjct  362   VNPCATC--VNGSRVMADINNVSFVMPTTAILQAHYYNISGVYTDDFPANPPNPYNYTG-  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP ++QT+ GTK+YRL YN+TVQLVLQ T I+APE+HP HLHGFNF+ VG+G+GN++PK
Sbjct  419   TPPTSIQTNNGTKVYRLAYNSTVQLVLQGTSIIAPESHPTHLHGFNFYVVGKGLGNYDPK  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTI VP  GW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  479   NDPKNFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  538

Query  312   KGPNES  295
             KGPN+S
Sbjct  539   KGPNQS  544



>ref|XP_008358974.1| PREDICTED: laccase-4-like [Malus domestica]
Length=557

 Score =   452 bits (1164),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 251/307 (82%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA Y KPFKTDT +IAPGQTTNV+++ +  +G+Y+VAASPFMD P I VDN+T TA
Sbjct  243   VVEVDAVYTKPFKTDTXLIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKTATA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHY G   +  T LT  P QNAT VA NF +SLRSLNS  FPA+VP  +DHSLLFTVGL
Sbjct  303   TLHYIGTLESTRTILTSPPPQNATLVATNFTNSLRSLNSIRFPARVPLKIDHSLLFTVGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G++ C SC  ANG RVVA +NNVTFVMP  ALLQAHFF   GVFT DFPGNP   +NYTG
Sbjct  363   GLHTCDSC--ANGIRVVADINNVTFVMPKIALLQAHFFNXSGVFTDDFPGNPLNPYNYTG  420

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T   N+QT  GT+LYRL YN TVQLVLQ TG++APE HP+HLHGFNFF VGRG+GNFNP
Sbjct  421   -TQQTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETHPVHLHGFNFFEVGRGLGNFNP  479

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
              TDPK+FNLVDPVERNTIGVP+ GW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  480   NTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDN  539

Query  315   GKGPNES  295
             GKGPNES
Sbjct  540   GKGPNES  546



>gb|KFK44563.1| hypothetical protein AALP_AA1G273400 [Arabis alpina]
Length=556

 Score =   452 bits (1163),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 256/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +GQY++AA+PF D A +AVDN+T TA
Sbjct  240   VVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATA  299

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P QNAT VAN FV+SLRSLNS T+PAKVP T+DH LLFTVGL
Sbjct  300   TVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSNTYPAKVPITIDHDLLFTVGL  359

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MPTT LLQAH+F + GV+TTDFPG P   +++TG
Sbjct  360   GINRCHSCKKGNFSRVVAAINNITFKMPTTGLLQAHYFNLTGVYTTDFPGKPRRFYDFTG  419

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG GIGN+N 
Sbjct  420   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGFGIGNYNS  478

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  479   KKDSKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  538

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  539   GKGPNQS  545



>ref|XP_002873023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49282.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   452 bits (1164),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 256/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +GQY++AA+PF D A +AVDN+T TA
Sbjct  243   VVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P QNAT VAN F++SLRSLNSKT+PAKVP TVDH LLFTVGL
Sbjct  303   TVHYSGTLSATPTKTTSPPPQNATSVANTFINSLRSLNSKTYPAKVPITVDHDLLFTVGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+N C SCK  N SRVVA++NN+TF MP TALLQAH+F + G++TTDFPG P   F++TG
Sbjct  363   GVNRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPGKPRRFFDFTG  422

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  423   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYNS  481

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  482   KKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  541

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  542   GKGPNQS  548



>ref|XP_008457399.1| PREDICTED: laccase-4 [Cucumis melo]
Length=562

 Score =   452 bits (1163),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 258/307 (84%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             VVEVDA Y KPF TDTIVIAPGQTTN ++TAD  +G+Y ++ASPFMD PI AVDN T TA
Sbjct  248   VVEVDAAYTKPFITDTIVIAPGQTTNALLTADLKSGKYAISASPFMDTPIVAVDNVTATA  307

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHYTG  +T  T+ T +P QNAT +A  F +SLRSLNSK +PA+V   VDHSLLFTVGL
Sbjct  308   TLHYTGTISTTPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPARVSLEVDHSLLFTVGL  367

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+N C +C  ++G+++VA +NNVTFVMPT +LLQAH+F I GVFT DFP NPP  ++YTG
Sbjct  368   GVNRCKTC--SSGNQLVADINNVTFVMPTISLLQAHYFNIDGVFTDDFPANPPIRYDYTG  425

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               P +N+QT+ GT+LYRL YN+TVQLVLQDT ++APENHP+HLHGFNFF VG G+GNFN 
Sbjct  426   KQP-SNMQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENHPVHLHGFNFFVVGSGLGNFNH  484

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K DP+KFNLVDPVERNT+GVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VDN
Sbjct  485   KKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDN  544

Query  315   GKGPNES  295
             G+GP ES
Sbjct  545   GRGPEES  551



>ref|XP_010535416.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535417.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535418.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535419.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
Length=568

 Score =   452 bits (1162),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 226/312 (72%), Positives = 250/312 (80%), Gaps = 9/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KPFKTDT+VIAPGQTTNV++TA+  AG  YMVAA+ +MDAPIA DN T TA
Sbjct  249   VVEVDAVYTKPFKTDTVVIAPGQTTNVLLTANAYAGSNYMVAATTYMDAPIAFDNVTATA  308

Query  1035  TLHYTGVQttlattlTR-----IPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLL  871
             TLHY G  T  A    +     +P QNAT VA  F+ SLRSLNS+ +PA+VP  VDHSL 
Sbjct  309   TLHYVGPTTANANAAAKTVLATLPPQNATWVATKFIKSLRSLNSEEYPARVPMNVDHSLF  368

Query  870   FTVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFA  691
             FTVGLG+NPC SC   NGSRVVA +NNVTFVMP  ALLQAHFF + GVFT DFP  P   
Sbjct  369   FTVGLGVNPCRSC--VNGSRVVADINNVTFVMPKIALLQAHFFNLPGVFTDDFPARPSHP  426

Query  690   FNYTGSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             +NYTG T PAN  T  GT+LYRLPYNA V++VLQDTG++ PENHPIHLHGFNFF VGRG+
Sbjct  427   YNYTG-TQPANPATMKGTRLYRLPYNARVEIVLQDTGMITPENHPIHLHGFNFFEVGRGL  485

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFN K DPKKFNLVDPVERNT+GVPAGGWVAIRF ADNPGVWFMHCHLEIHTTWGLKMA
Sbjct  486   GNFNQKKDPKKFNLVDPVERNTVGVPAGGWVAIRFTADNPGVWFMHCHLEIHTTWGLKMA  545

Query  330   FLVDNGKGPNES  295
             F+VDNG GPN S
Sbjct  546   FVVDNGDGPNHS  557



>ref|XP_009767351.1| PREDICTED: laccase-4-like, partial [Nicotiana sylvestris]
Length=321

 Score =   442 bits (1137),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 210/306 (69%), Positives = 249/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+YVKPFKTDTI IAPGQTTN I+TADQ AG+Y++A SPFMD  +A DN T T T
Sbjct  8     VVEVDASYVKPFKTDTIFIAPGQTTNAILTADQTAGKYLIAVSPFMDTIVATDNLTATGT  67

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY G      T LT IPS+NATPV N FVD LRSLNSK +PA V   + HSLL T+G+ 
Sbjct  68    IHYQGTDALSPTALTTIPSRNATPVTNIFVDFLRSLNSKKYPANVSLIIVHSLLLTMGIC  127

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C+  NGSRVVA++NNVTFVMPTTA+LQAH++ I  V+TTDFP NP   FNYTG 
Sbjct  128   VNPCATCQ--NGSRVVAAINNVTFVMPTTAILQAHYYNISDVYTTDFPENPAIPFNYTG-  184

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQT  GTK+Y++ +N+TVQ+VLQ T I+APE+HP HLHGFNFF VG+G+GN++PK
Sbjct  185   TPPTNLQTQNGTKVYKVEFNSTVQVVLQGTSIIAPESHPTHLHGFNFFVVGKGVGNYDPK  244

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+ VP  G  AIRFRADNPGVWF+HCHLE+HTTWGLKM F V+NG
Sbjct  245   NDPKKFNLVDPVERNTMSVPTAGRTAIRFRADNPGVWFLHCHLEVHTTWGLKMVFFVENG  304

Query  312   KGPNES  295
             +GPN+S
Sbjct  305   RGPNQS  310



>sp|Q0IQU1.2|LAC22_ORYSJ RecName: Full=Laccase-22; AltName: Full=Benzenediol:oxygen oxidoreductase 
22; AltName: Full=Diphenol oxidase 22; AltName: 
Full=Urishiol oxidase 22; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAX95423.1| laccase (EC 1.10.3.2) precursor - common tobacco [Oryza sativa 
Japonica Group]
 gb|ABA95532.1| Multicopper oxidase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ19339.1| hypothetical protein OsJ_34890 [Oryza sativa Japonica Group]
Length=564

 Score =   451 bits (1160),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 209/308 (68%), Positives = 256/308 (83%), Gaps = 5/308 (2%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKTDT++I PGQTTNV++ A+Q AG+Y+++ SPFMDAP+ VDN+TGTAT
Sbjct  249   VVEVDAVYTKPFKTDTLLITPGQTTNVLVRANQGAGRYLLSVSPFMDAPVQVDNKTGTAT  308

Query  1032  LHYTGVQttlattlTRI--PSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVG  859
             LHY    ++   +LT +  P QNAT + + F DSL SLNSK +PA VPQTVDHSLL TVG
Sbjct  309   LHYANTVSSSMASLTLVKPPPQNATHIVSKFTDSLHSLNSKEYPANVPQTVDHSLLLTVG  368

Query  858   LGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYT  679
             +G+NPCPSC   NG+RVV ++NNVTF+MP+T +LQAH++ I GVFT DFP  P   FNYT
Sbjct  369   VGVNPCPSC--INGTRVVGTINNVTFIMPSTPILQAHYYNIPGVFTEDFPATPLHKFNYT  426

Query  678   GSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
             GS P  NLQT  GT++YRLPYNA+VQ+VLQDTGI++PE+HPIHLHGFNFF VG+G+GN+N
Sbjct  427   GSGP-KNLQTMNGTRVYRLPYNASVQVVLQDTGIISPESHPIHLHGFNFFVVGKGVGNYN  485

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             P+T P  FNL+DP+ERNTIGVP GGW AIRFR+DNPGVWFMHCH E+HT+WGLKMAF+VD
Sbjct  486   PRTSPSTFNLIDPIERNTIGVPTGGWTAIRFRSDNPGVWFMHCHFEVHTSWGLKMAFVVD  545

Query  318   NGKGPNES  295
             NGK P+E+
Sbjct  546   NGKRPSET  553



>ref|XP_006398646.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
 gb|ESQ40099.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
Length=558

 Score =   450 bits (1157),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 256/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +GQY++AA+PF D A +AVDN+T TA
Sbjct  242   VVEVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATA  301

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +  AT  T  P QNAT VAN+FV+SLRSLNS T+PAKVP TVDH LLFTVGL
Sbjct  302   TVHYSGTFSATATKTTSPPPQNATSVANSFVNSLRSLNSITYPAKVPITVDHDLLFTVGL  361

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MP TALLQAH+F + G++TTDFP  P   F++TG
Sbjct  362   GINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPRRFFDFTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  422   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGSGNYNS  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  481   KKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  540

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  541   GKGPNQS  547



>ref|XP_010452014.1| PREDICTED: laccase-10 isoform X1 [Camelina sativa]
 ref|XP_010452015.1| PREDICTED: laccase-10 isoform X2 [Camelina sativa]
Length=559

 Score =   449 bits (1156),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 255/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +GQY++AA+PF D A +AVDN+T TA
Sbjct  243   VVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P QNAT VAN+FV+SLRSLNS T+PA VP  VDH LLFTVGL
Sbjct  303   TVHYSGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MPTTALLQAH+F + GV+TTDFPG P   F++TG
Sbjct  363   GINRCHSCKAGNFSRVVAAINNITFKMPTTALLQAHYFNLTGVYTTDFPGKPRRFFDFTG  422

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  423   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYNS  481

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  482   KKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  541

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  542   GKGPNQS  548



>gb|EYU41257.1| hypothetical protein MIMGU_mgv1a003880mg [Erythranthe guttata]
Length=558

 Score =   449 bits (1156),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 210/309 (68%), Positives = 255/309 (83%), Gaps = 6/309 (2%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATY KPF+TDTI I PGQTTN ++ AD+  G Y +A SPFMD  +A D+QT TAT
Sbjct  242   IVEVDATYTKPFRTDTIFIGPGQTTNALLKADRKIGNYQIAISPFMDTIVATDSQTATAT  301

Query  1032  LHYTGVQttlatt---lTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTV  862
             L Y G  +  A++   LT +PS+NAT V  NF+DSLRSLNS+ +PA VP+T+DHSLL  +
Sbjct  302   LRYNGTLSAAASSPTTLTTMPSKNATKVTTNFMDSLRSLNSRKYPANVPKTIDHSLLLAI  361

Query  861   GLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNY  682
             G+G+NPC +C   NGSRVVA +NNVTFVMPTTA+LQAH++ + GV+T DFPGNPP  +NY
Sbjct  362   GVGVNPCGTC--VNGSRVVADINNVTFVMPTTAILQAHYYNVSGVYTDDFPGNPPVPYNY  419

Query  681   TGSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNF  502
             TGS PP N+QT+ GTK+YRL YN+TVQ+VLQ T I+APE+HP HLHGFNF+ VG+GIGN+
Sbjct  420   TGS-PPTNMQTTNGTKVYRLGYNSTVQIVLQGTAIIAPESHPTHLHGFNFYVVGKGIGNY  478

Query  501   NPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV  322
             +PK DPK FNLVDP+ERNTI VP GGW AIRFRADNPGVWF+HCHLEIHTTWGLKMAF+V
Sbjct  479   DPKNDPKSFNLVDPIERNTISVPTGGWTAIRFRADNPGVWFLHCHLEIHTTWGLKMAFVV  538

Query  321   DNGKGPNES  295
             +NGKGPN+S
Sbjct  539   ENGKGPNQS  547



>emb|CDY48114.1| BnaC02g03710D [Brassica napus]
Length=559

 Score =   449 bits (1154),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 217/307 (71%), Positives = 255/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             +VEVDA YVKPF TDTI+IAPGQTT  +++A + +G+Y++AA+PF D A +AVDN+T TA
Sbjct  243   IVEVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P QNAT VAN+FV+SLRSLNS T+PAKVP TVDH LLFTVGL
Sbjct  303   TVHYSGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSATYPAKVPTTVDHDLLFTVGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MP TALLQAH+F + G++TTDFP  P   F++TG
Sbjct  363   GINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPHHVFDFTG  422

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  423   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGIGSGNYNS  481

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  482   KKDAKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  541

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  542   GKGPNQS  548



>ref|XP_004150626.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004169234.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=517

 Score =   447 bits (1150),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 216/307 (70%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             VVEVDA Y KPF TDTI IAPGQTTN ++TAD  +G+Y ++ASPF D PI AVDN T TA
Sbjct  203   VVEVDAAYTKPFITDTIFIAPGQTTNALLTADLKSGKYAISASPFRDTPIVAVDNVTATA  262

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHYTG  +T  T+ T +P QNAT +A  F +SLRSLNSK +PA+V   VDHSL FTVGL
Sbjct  263   TLHYTGTISTSPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPARVSLEVDHSLFFTVGL  322

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+N C +C  ++G++VVA +NNVTFVMPT +LLQAH+F I GVFT DFP NPP  ++YTG
Sbjct  323   GVNRCKTC--SSGTQVVADINNVTFVMPTISLLQAHYFNIDGVFTDDFPANPPIRYDYTG  380

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               P +NLQT+ GT+LYRL YN+TVQLVLQDT ++APENHP+HLHGFNFF VG G+GNFN 
Sbjct  381   KQP-SNLQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENHPVHLHGFNFFVVGSGLGNFNH  439

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K DP+KFNLVDPVERNT+GVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAF+V+N
Sbjct  440   KKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVNN  499

Query  315   GKGPNES  295
             G+GP ES
Sbjct  500   GRGPEES  506



>ref|XP_010543228.1| PREDICTED: laccase-10 [Tarenaya hassleriana]
Length=558

 Score =   448 bits (1153),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 258/307 (84%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +G+Y++AASPF DA  +AVDN+T TA
Sbjct  242   VVEVDAVYVKPFSTDTILIAPGQTTTALVSAVRTSGKYLIAASPFQDAAAVAVDNRTATA  301

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T+LT  P +NAT VAN+F+ SLRSLNSK FPA VP TVDH LLF VGL
Sbjct  302   TVHYSGTLSAAPTSLTSPPPRNATSVANSFIGSLRSLNSKNFPANVPATVDHDLLFAVGL  361

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  NG+RVVA +NNVTF MPTTALLQAH+F + GV+TTDFPG P  AF++TG
Sbjct  362   GINRCHSCKAGNGTRVVAGINNVTFKMPTTALLQAHYFNLSGVYTTDFPGKPHHAFDFTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TK+Y+LPYN+ VQ+VLQDTG+++PE+HPIHLHG+NFF VGRG GN+N 
Sbjct  422   K-PPSNLATMKATKVYKLPYNSRVQVVLQDTGVISPESHPIHLHGYNFFVVGRGSGNYNA  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K+D KKFNLVDPVERNT+ VP+GGWVAIRFRADNPGVWF+HCHLE+HT+WGLKMAFLV++
Sbjct  481   KSDAKKFNLVDPVERNTVSVPSGGWVAIRFRADNPGVWFLHCHLEVHTSWGLKMAFLVED  540

Query  315   GKGPNES  295
             G GPN+S
Sbjct  541   GNGPNQS  547



>ref|NP_195739.2| laccase 10 [Arabidopsis thaliana]
 sp|Q6ID18.1|LAC10_ARATH RecName: Full=Laccase-10; AltName: Full=Benzenediol:oxygen oxidoreductase 
10; AltName: Full=Diphenol oxidase 10; AltName: 
Full=Urishiol oxidase 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAT41838.1| At5g01190 [Arabidopsis thaliana]
 gb|AED90308.1| laccase 10 [Arabidopsis thaliana]
Length=558

 Score =   448 bits (1153),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 253/307 (82%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +GQY++AA+PF D A +AVDN+T TA
Sbjct  242   VVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATA  301

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P QNAT VAN FV+SLRSLNSKT+PA VP TVDH LLFTVGL
Sbjct  302   TVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSKTYPANVPITVDHDLLFTVGL  361

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MP TALLQAH+F + G++TTDFP  P   F++TG
Sbjct  362   GINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPRRVFDFTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  422   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYNS  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D  KFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  481   KKDSNKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  540

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  541   GKGPNQS  547



>emb|CAB69847.1| laccase-like protein [Arabidopsis thaliana]
Length=553

 Score =   448 bits (1152),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 253/307 (82%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +GQY++AA+PF D A +AVDN+T TA
Sbjct  237   VVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATA  296

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P QNAT VAN FV+SLRSLNSKT+PA VP TVDH LLFTVGL
Sbjct  297   TVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSKTYPANVPITVDHDLLFTVGL  356

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MP TALLQAH+F + G++TTDFP  P   F++TG
Sbjct  357   GINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPRRVFDFTG  416

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  417   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYNS  475

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D  KFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  476   KKDSNKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  535

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  536   GKGPNQS  542



>emb|CDY55905.1| BnaAnng13970D [Brassica napus]
Length=563

 Score =   448 bits (1152),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 215/307 (70%), Positives = 255/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             +VEVDA YVKPF TDTI+IAPGQTT  +++A + +G+Y++AA+PF D A +AVDN+T TA
Sbjct  247   IVEVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATA  306

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P+QNAT VAN+FV+SLRSLNS T+PAKVP  +DH LLFTVGL
Sbjct  307   TVHYSGTLSATPTKTTSPPAQNATSVANSFVNSLRSLNSVTYPAKVPIKIDHDLLFTVGL  366

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MP TALLQAH+F + G++TTDFP  P   F++TG
Sbjct  367   GINRCHSCKAGNLSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPHHVFDFTG  426

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  427   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGIGSGNYNS  485

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  486   KKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  545

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  546   GKGPNQS  552



>ref|XP_009125430.1| PREDICTED: laccase-10 [Brassica rapa]
Length=559

 Score =   447 bits (1151),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 215/307 (70%), Positives = 255/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             +VEVDA YVKPF TDTI+IAPGQTT  +++A + +G+Y++AA+PF D A +AVDN+T TA
Sbjct  243   IVEVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P+QNAT VAN+FV+SLRSLNS T+PAKVP  +DH LLFTVGL
Sbjct  303   TVHYSGTLSATPTKTTSPPAQNATSVANSFVNSLRSLNSVTYPAKVPIKIDHDLLFTVGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MP TALLQAH+F + G++TTDFP  P   F++TG
Sbjct  363   GINRCHSCKAGNLSRVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPHHVFDFTG  422

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  423   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGIGSGNYNS  481

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  482   KKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  541

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  542   GKGPNQS  548



>gb|EPS65618.1| hypothetical protein M569_09159, partial [Genlisea aurea]
Length=539

 Score =   446 bits (1148),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 246/307 (80%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAP-IAVDNQTGTA  1036
             VVEVDA YVKPF T T+++ PGQTTNVII+A Q +G+YMVA SPFMD P +AVDN T TA
Sbjct  223   VVEVDAVYVKPFTTHTVLLTPGQTTNVIISATQGSGKYMVAVSPFMDNPSLAVDNITATA  282

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TL Y G  T   T   R PSQNAT +A  F  SLRSLNS  FPA VP  VDHSLLFTVGL
Sbjct  283   TLQYYGTLTDSPTAPARPPSQNATTIAEAFASSLRSLNSARFPALVPLKVDHSLLFTVGL  342

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPC +C+  NGSRVVASVNNVTF MPTT++LQAH++ I GVFT DFPG P   FNYTG
Sbjct  343   GINPCATCRAGNGSRVVASVNNVTFAMPTTSILQAHYYKIAGVFTADFPGKPLNPFNYTG  402

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             +    N+ T TGTK+Y+L YN+TVQ+VLQ TGI+APE+HP HLHGFNFFAVG G GNFNP
Sbjct  403   AYK-GNMATVTGTKVYKLAYNSTVQVVLQGTGIIAPESHPFHLHGFNFFAVGSGKGNFNP  461

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
               DP +FNLVDPVERNT+ VP GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKM FLV+N
Sbjct  462   NLDPARFNLVDPVERNTVAVPNGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMVFLVEN  521

Query  315   GKGPNES  295
             G GPN+S
Sbjct  522   GNGPNQS  528



>dbj|BAJ98144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   447 bits (1150),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 212/307 (69%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KP+KTD ++I PGQTTNV++TADQ+AG+Y+++ SPFMDAP+ VDN+TGTAT
Sbjct  250   VVEVDAVYTKPYKTDILLITPGQTTNVLVTADQSAGRYLLSVSPFMDAPLQVDNKTGTAT  309

Query  1032  LHYTG-VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             LHY   V TT   TL   P QNATP+A+ F +SLRSLNSK +PA VPQTVDHSL FT+G+
Sbjct  310   LHYANTVSTTARLTLVNPPPQNATPIASTFSESLRSLNSKEYPANVPQTVDHSLFFTIGV  369

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPC +C   NG+RVV ++NN TFVMP+T +LQA ++ I GVFT DFP  PP  FNYTG
Sbjct  370   GVNPCANC--INGTRVVGTINNSTFVMPSTPILQARYYSIPGVFTEDFPATPPHKFNYTG  427

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             S P  NLQT  GT++YRLPYNA+VQ++LQDTGI++ E+HPIHLHGFNFF VGRGIGN+NP
Sbjct  428   SGP-NNLQTMNGTRVYRLPYNASVQVLLQDTGIISTESHPIHLHGFNFFVVGRGIGNYNP  486

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K+ P  FNL+DPVERNTIGVP GGW AIRFRADNPGVWFMHCH E+HT+WGLKM F+VDN
Sbjct  487   KSSPFTFNLIDPVERNTIGVPTGGWTAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDN  546

Query  315   GKGPNES  295
             GK P+E+
Sbjct  547   GKRPSET  553



>ref|XP_010423919.1| PREDICTED: laccase-10-like [Camelina sativa]
Length=558

 Score =   446 bits (1148),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 254/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +GQY++AA+PF D A +AVDN+T TA
Sbjct  242   VVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATA  301

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P QNAT VAN+FV+SLRSLNS T+PA VP  VDH LLFTVGL
Sbjct  302   TVHYSGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGL  361

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MPTTALL+AH+F + GV+TTDFPG P   F++ G
Sbjct  362   GINRCHSCKAGNFSRVVAAINNITFKMPTTALLEAHYFNLTGVYTTDFPGKPRRFFDFNG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+N 
Sbjct  422   K-PPSNLSTMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYNS  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  481   KKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  540

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  541   GKGPNQS  547



>gb|KGN65788.1| hypothetical protein Csa_1G528530 [Cucumis sativus]
Length=562

 Score =   446 bits (1148),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 216/307 (70%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             VVEVDA Y KPF TDTI IAPGQTTN ++TAD  +G+Y ++ASPF D PI AVDN T TA
Sbjct  248   VVEVDAAYTKPFITDTIFIAPGQTTNALLTADLKSGKYAISASPFRDTPIVAVDNVTATA  307

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHYTG  +T  T+ T +P QNAT +A  F +SLRSLNSK +PA+V   VDHSL FTVGL
Sbjct  308   TLHYTGTISTSPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPARVSLEVDHSLFFTVGL  367

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+N C +C  ++G++VVA +NNVTFVMPT +LLQAH+F I GVFT DFP NPP  ++YTG
Sbjct  368   GVNRCKTC--SSGTQVVADINNVTFVMPTISLLQAHYFNIDGVFTDDFPANPPIRYDYTG  425

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               P +NLQT+ GT+LYRL YN+TVQLVLQDT ++APENHP+HLHGFNFF VG G+GNFN 
Sbjct  426   KQP-SNLQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENHPVHLHGFNFFVVGSGLGNFNH  484

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K DP+KFNLVDPVERNT+GVP+GGWVAIRFRADNPGVWFMHCHLE+HTTWGLKMAF+V+N
Sbjct  485   KKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVNN  544

Query  315   GKGPNES  295
             G+GP ES
Sbjct  545   GRGPEES  551



>ref|XP_010490598.1| PREDICTED: laccase-10-like isoform X1 [Camelina sativa]
 ref|XP_010490599.1| PREDICTED: laccase-10-like isoform X2 [Camelina sativa]
Length=558

 Score =   446 bits (1147),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 254/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMD-APIAVDNQTGTA  1036
             VVEVDA YVKPF TDTI+IAPGQTT  +++A + +GQY++AA+PF D A +AVDN+T TA
Sbjct  242   VVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATA  301

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             T+HY+G  +   T  T  P QNAT VAN+FV+SLRSLNS T+PA VP  VDH LLFTVGL
Sbjct  302   TVHYSGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGL  361

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GIN C SCK  N SRVVA++NN+TF MPTTALLQAH+F + GV+TTDFPG P   F++TG
Sbjct  362   GINRCHSCKAGNFSRVVAAINNITFKMPTTALLQAHYFNLTGVYTTDFPGKPRRFFDFTG  421

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP+NL T   TKLY+LPYN+TVQ+VLQDTG VAPENHPIHLHGFNFF VG G GN+  
Sbjct  422   K-PPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYIS  480

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K D KKFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+N
Sbjct  481   KKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVEN  540

Query  315   GKGPNES  295
             GKGPN+S
Sbjct  541   GKGPNQS  547



>ref|XP_007220829.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
 gb|EMJ22028.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
Length=558

 Score =   446 bits (1146),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 251/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+Y KPF+TDTI I+PGQTTN I+TA++  G+Y++AASPFMDAP+  DN T  A+
Sbjct  245   VVEVDASYTKPFQTDTIFISPGQTTNAILTANRGIGKYLIAASPFMDAPVGFDNLTSIAS  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G        LT IP QNATPV N F+DSLRSLNSK +PA VP T+DHSL FT+ +G
Sbjct  305   LLYKGTPANPKAFLTSIPPQNATPVTNTFMDSLRSLNSKQYPANVPLTIDHSLFFTIAVG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGS++VA+ NNV+FVMPT ALLQA+++  KGVFT DFP NPP  FNYTG+
Sbjct  365   VNPCATC--VNGSKLVAAFNNVSFVMPTIALLQAYYYNTKGVFTLDFPANPPIPFNYTGN  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +  AN+QT+ GT+LYRL YN+TVQ+VLQ T ++APE+HP HLHGFNFF VG+GIGNF+PK
Sbjct  423   ST-ANMQTTNGTRLYRLGYNSTVQIVLQGTAVIAPESHPTHLHGFNFFVVGKGIGNFDPK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTI VP GGW AIRFRADNPG+WF+HCHLE+HTTWGLKM FLV+NG
Sbjct  482   KDPKTFNLVDPVERNTISVPTGGWTAIRFRADNPGIWFLHCHLEVHTTWGLKMPFLVENG  541

Query  312   KGPNES  295
             KGPNE+
Sbjct  542   KGPNET  547



>ref|XP_004506788.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=557

 Score =   446 bits (1146),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 225/307 (73%), Positives = 262/307 (85%), Gaps = 2/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDATYVKPF+ +TIVIAPGQTTNV++ A+Q +G+Y+VAASPFMDAP+AVDN T TAT
Sbjct  241   IVEVDATYVKPFEIETIVIAPGQTTNVLLKANQKSGKYLVAASPFMDAPVAVDNLTATAT  300

Query  1032  LHYTGVQtt-lattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             LHY+G+  +   T LT  P +N+T  ANNF++SLR LNSKT+P  +P  +DHSL FT+GL
Sbjct  301   LHYSGLTLSNTPTFLTTPPPKNSTENANNFLNSLRGLNSKTYPVNLPLKIDHSLYFTIGL  360

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+ PCPSCK ANGSRVVA+VNNVTFVMPTTALLQAH+F I GVFTTDFP NPPF FN+TG
Sbjct  361   GLQPCPSCKAANGSRVVAAVNNVTFVMPTTALLQAHYFNIGGVFTTDFPPNPPFFFNFTG  420

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             S P  NL T +GTK+YRL +N TVQLV+QDTGI+  ENHP+HLHGFNFF +G G+GN+N 
Sbjct  421   SGP-KNLNTDSGTKVYRLKFNETVQLVMQDTGILTLENHPVHLHGFNFFVIGSGLGNYNS  479

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
               D K FNLVDPVERNT+GVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN
Sbjct  480   TIDSKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  539

Query  315   GKGPNES  295
             G+GP +S
Sbjct  540   GQGPKQS  546



>ref|XP_003558760.1| PREDICTED: laccase-22 [Brachypodium distachyon]
Length=561

 Score =   445 bits (1145),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 206/307 (67%), Positives = 254/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KP+KTD ++I PGQTTNV++ ADQ+AG+Y+++ SPFMDAP+ VDN TGTA 
Sbjct  247   VVEVDAVYTKPYKTDILLITPGQTTNVLLAADQSAGRYLLSISPFMDAPVQVDNTTGTAI  306

Query  1032  LHYTG-VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             LHYT  V      TL + P QNAT +A+ F DSLRSLNSK +PA VP+TVDHSL FT+G+
Sbjct  307   LHYTNTVSAAARLTLFKPPPQNATLIASKFADSLRSLNSKEYPANVPRTVDHSLFFTIGV  366

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPCP+C   NG+RVV ++NN+TFVMP+T +LQA+++ I GVFT DFP  PP  FNYTG
Sbjct  367   GVNPCPNC--INGTRVVGTINNLTFVMPSTPILQAYYYNIPGVFTEDFPATPPHKFNYTG  424

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             S P  NL+T  GT++YRLPYNA+VQ++LQDTGI++ E+HPIHLHGFNFF VGRGIGN++P
Sbjct  425   SGP-KNLRTMNGTRVYRLPYNASVQVILQDTGIISTESHPIHLHGFNFFVVGRGIGNYSP  483

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KT P  FNL+DP+ERNTIGVP GGW AIRFRADNPGVWFMHCH E+HT+WGLKM F+V+N
Sbjct  484   KTSPSTFNLIDPIERNTIGVPTGGWTAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVEN  543

Query  315   GKGPNES  295
             GK P+E+
Sbjct  544   GKRPSET  550



>gb|AFN53658.1| hypothetical protein [Linum usitatissimum]
Length=480

 Score =   441 bits (1135),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 210/306 (69%), Positives = 246/306 (80%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY KPFK DTIV+ PGQTTNV++T++Q +G+Y ++ SPFMDAPI VDN+T TAT
Sbjct  166   VVEVDATYTKPFKVDTIVLGPGQTTNVLVTSEQGSGKYQISVSPFMDAPITVDNRTATAT  225

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG Q    T+LT  P  N+T VA  F +SL +LNS+ +P  VP TVDHSL FT+ LG
Sbjct  226   LHYTGTQIAAPTSLTIPPPINSTLVARRFTNSLLALNSQEYPTNVPLTVDHSLFFTINLG  285

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C    G+ VVA  NNVTF+MP   LLQAH+FG KGVFT DFP NP   FNYTGS
Sbjct  286   VNPCATC--TGGAHVVADFNNVTFIMPKVGLLQAHYFGTKGVFTDDFPANPLEPFNYTGS  343

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NL T+ GT++YRL +N TVQLVLQ+ G++ PENHPIHLHGFNFF VGRG+GNF+ K
Sbjct  344   PLPGNLATTNGTRVYRLKFNDTVQLVLQNIGLITPENHPIHLHGFNFFEVGRGVGNFDAK  403

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP +FNL DPVERNT+GVPAGGW AIRFRADNPGVWFMHCHLE+HTTWGLKMA++VDNG
Sbjct  404   KDPMRFNLHDPVERNTVGVPAGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAWVVDNG  463

Query  312   KGPNES  295
             KGPNES
Sbjct  464   KGPNES  469



>ref|XP_008233715.1| PREDICTED: laccase-4-like [Prunus mume]
Length=558

 Score =   444 bits (1141),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 208/306 (68%), Positives = 250/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+Y KPF+TDTI I+PGQTTN I+TA++  G+Y++AASPFMDAP+  DN T  A+
Sbjct  245   VVEVDASYTKPFQTDTIFISPGQTTNAILTANRRIGKYLIAASPFMDAPVGFDNLTSIAS  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G        LT IP QNATPV N F+DSLRSLNSK +PA VP T+DHSL FT+ +G
Sbjct  305   LRYKGTPANPKAFLTSIPPQNATPVTNTFMDSLRSLNSKQYPANVPLTIDHSLFFTIAVG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NGS++VA+ NNV+FVMPT ALLQA+++ IKGV+T DFP NPP  FNYTG+
Sbjct  365   VNPCATC--VNGSKLVAAFNNVSFVMPTIALLQAYYYNIKGVYTLDFPANPPIPFNYTGN  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T  AN+QT+ GT+LYRL YN+TVQ+VLQ T ++APE+HP HLHGFNFF VG+GIGNF+P 
Sbjct  423   TT-ANMQTTNGTRLYRLGYNSTVQIVLQGTAVIAPESHPTHLHGFNFFVVGKGIGNFDPT  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTI VP GGW AIRFRADNPG+WF+HCHLE+HTTWGLKM FLV+NG
Sbjct  482   KDPKTFNLVDPVERNTISVPTGGWTAIRFRADNPGIWFLHCHLEVHTTWGLKMPFLVENG  541

Query  312   KGPNES  295
             KG NE+
Sbjct  542   KGANET  547



>ref|XP_006663136.1| PREDICTED: laccase-22-like [Oryza brachyantha]
Length=566

 Score =   443 bits (1139),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 203/309 (66%), Positives = 253/309 (82%), Gaps = 6/309 (2%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF TDT++I PGQTT+V++ A+Q+AG+Y+++ SPFMD+P+ VDN+TGTAT
Sbjct  250   VVEVDAVYTKPFTTDTLLITPGQTTSVLLRANQSAGRYLLSVSPFMDSPLQVDNKTGTAT  309

Query  1032  LHYTGVQttlatt---lTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTV  862
             LHY    ++       L ++P QNAT + + F D L SLNSK +PA VPQT+DHSLL TV
Sbjct  310   LHYANTVSSSMAAPLILIKLPPQNATSIVSKFADRLHSLNSKEYPANVPQTIDHSLLLTV  369

Query  861   GLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNY  682
             G+G+NPCPSC   NG+RVV ++NNVTF+MP+T +LQA+++ I GVFT DFP  P   FNY
Sbjct  370   GVGVNPCPSC--INGTRVVGTINNVTFIMPSTPILQAYYYNIPGVFTQDFPATPLHKFNY  427

Query  681   TGSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNF  502
             TGS P  NLQT  GT++YRLPYNA+VQ+VLQDTGI++PE+HPIHLHGFNFF VGRG+GN+
Sbjct  428   TGSGP-KNLQTMNGTRVYRLPYNASVQVVLQDTGIISPESHPIHLHGFNFFVVGRGVGNY  486

Query  501   NPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLV  322
             NPKT P  FNL+DP+ERNT+GVP GGW AIRFRADNPGVWFMHCH E+HT+WGLKM F+V
Sbjct  487   NPKTSPSTFNLIDPIERNTVGVPTGGWTAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVV  546

Query  321   DNGKGPNES  295
             DNGK P+E+
Sbjct  547   DNGKRPSET  555



>ref|XP_004980096.1| PREDICTED: laccase-22-like [Setaria italica]
Length=589

 Score =   444 bits (1141),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 207/307 (67%), Positives = 253/307 (82%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPFKT T++I PGQTTNV++TAD+ AG+Y+++ SPFMDAP+ VDN+TGTAT
Sbjct  275   VVEVDAVYTKPFKTATLLITPGQTTNVLLTADRTAGRYLLSVSPFMDAPVQVDNKTGTAT  334

Query  1032  LHYTG-VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             LHY   +  T   TL + P QNAT + + FV+SLRSLNS+ +PA VP TVDHSL+FTVG+
Sbjct  335   LHYANTISATAPLTLIKPPPQNATTIVSKFVESLRSLNSEEYPANVPLTVDHSLVFTVGV  394

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPC  C   N +R+V ++NNVTF+MP+T +LQAH++ I GVFT DFP  PP  FNYTG
Sbjct  395   GVNPCAKC--INATRLVGTINNVTFIMPSTPILQAHYYNIPGVFTDDFPATPPHKFNYTG  452

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             S P  NLQT  GT++YRLPYNA+VQ+VLQDTGI++PE+HPIHLHGFNFF VG G+GN+NP
Sbjct  453   SGP-KNLQTMKGTRVYRLPYNASVQVVLQDTGIISPESHPIHLHGFNFFVVGNGVGNYNP  511

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             KT P  FNL+DP+ERNTIGVP GGW AIRFRADNPGVWFMHCH E+HT+WGLKM F+VDN
Sbjct  512   KTSPSTFNLIDPIERNTIGVPTGGWAAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDN  571

Query  315   GKGPNES  295
             GK P+E+
Sbjct  572   GKRPDET  578



>gb|EMT26873.1| Laccase-22 [Aegilops tauschii]
Length=563

 Score =   442 bits (1136),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 206/307 (67%), Positives = 252/307 (82%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KP+KTD ++I PGQTTNV++T DQ+AG+Y+++ SPF+DAP+ VDN+TGTAT
Sbjct  249   VVEVDAVYTKPYKTDILLITPGQTTNVLVTTDQSAGRYLLSVSPFLDAPLQVDNKTGTAT  308

Query  1032  LHYTG-VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             L Y   V  T   TL + P QNATP+A+ F +SLRSLNSK +PA VPQTVDHSL FT+G+
Sbjct  309   LQYANTVSATARLTLVKPPPQNATPIASKFSESLRSLNSKEYPANVPQTVDHSLFFTIGV  368

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPC +C   NG+RVV ++NN TFVMP+T +LQA ++ I GVFT DFP  PP  FNYTG
Sbjct  369   GVNPCANC--INGTRVVGTINNSTFVMPSTPILQARYYSIPGVFTEDFPATPPHKFNYTG  426

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             S P  NLQT  GT+++RLPYNA+VQ++LQDTGI++ E+HPIHLHGFNFF VGRG+GN+NP
Sbjct  427   SGP-KNLQTMKGTRVHRLPYNASVQVILQDTGIISTESHPIHLHGFNFFVVGRGVGNYNP  485

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K  P  FNL+DPVERNTIGVP GGW AIRFRADNPGVWFMHCH E+HT+WGLKM F+VDN
Sbjct  486   KASPSTFNLIDPVERNTIGVPTGGWTAIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDN  545

Query  315   GKGPNES  295
             GK P+E+
Sbjct  546   GKRPSET  552



>gb|EPS61127.1| laccase 3, partial [Genlisea aurea]
Length=551

 Score =   441 bits (1135),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 247/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF TDT+ I PGQTTNV++ ADQ  G+Y++A SPFMD  +A DNQ  TA 
Sbjct  238   VVEVDARYTKPFTTDTLFIGPGQTTNVLLRADQKIGKYLIAISPFMDTIVATDNQRATAF  297

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y        T LT +P +NAT V   FVDSLRS+NS TFPA VP+ +DHSLL  +G+G
Sbjct  298   LRYNNTVAFSPTNLTPLPPRNATSVTTTFVDSLRSINSNTFPANVPKKIDHSLLLAIGVG  357

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSC   NG+R+VA +NNV+FVMPTTALLQAH++ + G+FTTDFPGNPP  +NYTG 
Sbjct  358   VNPCPSC--FNGTRLVADINNVSFVMPTTALLQAHYYNMSGIFTTDFPGNPPIPYNYTG-  414

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP N+QT  GTKLYRL YN+TV++V Q T I+APE+HP HLHGF+F+ VG+G+GN++PK
Sbjct  415   TPPRNMQTVNGTKLYRLAYNSTVEIVFQGTSIIAPESHPTHLHGFDFYVVGKGVGNYDPK  474

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+ VP GGW AIRFRADNPG+WF+HCHLE+HTTWGLKMAFLV+NG
Sbjct  475   NDPKKFNLVDPVERNTVSVPTGGWTAIRFRADNPGIWFLHCHLEVHTTWGLKMAFLVENG  534

Query  312   KGPNES  295
             +GPN +
Sbjct  535   EGPNAT  540



>gb|KDO53232.1| hypothetical protein CISIN_1g0093922mg, partial [Citrus sinensis]
Length=506

 Score =   437 bits (1123),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 213/268 (79%), Positives = 239/268 (89%), Gaps = 2/268 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKTD IVIAPGQTTNV+++AD+ +G+Y+VAASPFMDAPIAVDN T TAT
Sbjct  241   VVEVDATYVKPFKTDNIVIAPGQTTNVLLSADKTSGKYLVAASPFMDAPIAVDNVTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY+G   + ATTLT  P +N T +AN F+DSLRSLNSK +PAKVPQTVDH+LLFTVGLG
Sbjct  301   LHYSGTLASSATTLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKVPQTVDHNLLFTVGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHFF I GVFTTDFPGNPP  +N+TG+
Sbjct  361   VNPCPSCKAGNGSRVVASINNVTFVMPTIALLQAHFFNISGVFTTDFPGNPPHTYNFTGT  420

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NLQTS GTK YRL YN+TVQL+LQDTGI+APENHP+HLHGFNFFAVG+G+GNFNPK
Sbjct  421   --PKNLQTSNGTKAYRLAYNSTVQLILQDTGIIAPENHPVHLHGFNFFAVGKGLGNFNPK  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIR  409
              DPKKFNLVDPVERNTIGVP+GGWVAIR
Sbjct  479   KDPKKFNLVDPVERNTIGVPSGGWVAIR  506



>ref|XP_009350996.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   437 bits (1124),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/306 (66%), Positives = 249/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+Y KPF+TDTI   PGQTTNVI+TA+Q  G+Y + ASPFMDAPI  DN T  AT
Sbjct  245   VVEVDASYTKPFQTDTIYTGPGQTTNVILTANQGIGKYFITASPFMDAPIGFDNATVIAT  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G        LT IP +NATP+ + FVDSLRSLNSK +PA VP T+DHSL FT+ +G
Sbjct  305   LRYKGTPANPTAILTSIPPRNATPLTDAFVDSLRSLNSKQYPADVPLTIDHSLFFTISVG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              NPC +C   +GS++V+++NNV+FVMP+ +LLQA+++ +KGV+T DFP NPP  FNYTG 
Sbjct  365   ANPCAAC--VSGSKLVSAINNVSFVMPSISLLQAYYYNVKGVYTLDFPANPPIPFNYTG-  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T PANLQT+ GT+LYRL YN+TVQ+VLQ T I+APE+HP HLHGFNFF VG+G+GNF+PK
Sbjct  422   TSPANLQTTNGTRLYRLEYNSTVQIVLQGTAIIAPESHPTHLHGFNFFVVGKGLGNFDPK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP+KFNLVDPVERNT+ VP  GW AIRFRA+NPG+WF+HCHLE+HT+WGLKMAFLV+NG
Sbjct  482   KDPEKFNLVDPVERNTVSVPTAGWTAIRFRANNPGIWFLHCHLEVHTSWGLKMAFLVENG  541

Query  312   KGPNES  295
             +G NES
Sbjct  542   EGQNES  547



>gb|KCW52562.1| hypothetical protein EUGRSUZ_J01941, partial [Eucalyptus grandis]
Length=524

 Score =   436 bits (1120),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 243/306 (79%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKP +TD I++ PGQTT  ++ A    G+Y++  SPFMDAP++VDN T TAT
Sbjct  211   VVEVDAAYVKPLRTDAILVGPGQTTTALLMAYHTTGKYLMIVSPFMDAPVSVDNVTATAT  270

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             + Y G            PS NAT VA  FV SLRSLN+  +PA+VP  +DHSL FTVG+G
Sbjct  271   VRYAGTPAASPAVPIAPPSPNATWVAEGFVGSLRSLNTGAYPARVPLEIDHSLFFTVGIG  330

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C  A+G RVVA  NN++FVMP TALL AH++ + GVFT DFP  P   FNYTG+
Sbjct  331   VNPCATC--ASGFRVVADFNNISFVMPKTALLSAHYYKMTGVFTDDFPAKPMIRFNYTGA  388

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P  NL T TGT+LYRL YN+TVQLVLQDTG+VAPENHPIHLHGFNFFAVGRGIGNF+P 
Sbjct  389   QP-VNLNTMTGTRLYRLRYNSTVQLVLQDTGMVAPENHPIHLHGFNFFAVGRGIGNFDPI  447

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP+KFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VD+G
Sbjct  448   TDPRKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDDG  507

Query  312   KGPNES  295
             +GP++S
Sbjct  508   EGPDQS  513



>ref|XP_009120399.1| PREDICTED: laccase-16 [Brassica rapa]
Length=565

 Score =   437 bits (1123),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 216/310 (70%), Positives = 248/310 (80%), Gaps = 6/310 (2%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAG-QYMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT++IAPGQTTNV++TA+   G +YMVAA+ FMDAPI+ DN T TA
Sbjct  247   VVEVDAVYTKPYKTDTVLIAPGQTTNVLLTANANTGSKYMVAATTFMDAPISFDNVTATA  306

Query  1035  TLHYTG--VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTV  862
             TLHY G  V ++  T L  +P  NAT VA+ F+ SLRSLNS+ +PAKVP TVDHSL FTV
Sbjct  307   TLHYIGHTVSSSKKTVLASLPQPNATLVASKFIKSLRSLNSREYPAKVPTTVDHSLFFTV  366

Query  861   GLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNY  682
             GLG NPCPSC   NG R+VA +NNVTF MP TALLQAH+F I  VFT DFP  P   FNY
Sbjct  367   GLGANPCPSCN--NGFRLVAGINNVTFTMPETALLQAHYFNISHVFTDDFPAKPSNPFNY  424

Query  681   TGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGN  505
             T     + N  T TGTKLYRLPYNATVQ++LQ+T ++  ENHP HLHGFNFF VGRG+GN
Sbjct  425   TAPVDQSVNAATMTGTKLYRLPYNATVQIILQNTAMILSENHPFHLHGFNFFEVGRGLGN  484

Query  504   FNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFL  325
             FNP+ DPK+FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLEIHTTWGLKMAF+
Sbjct  485   FNPEKDPKRFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLEIHTTWGLKMAFV  544

Query  324   VDNGKGPNES  295
             VDNG GP++S
Sbjct  545   VDNGHGPDQS  554



>ref|XP_010033027.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
Length=553

 Score =   436 bits (1120),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 243/306 (79%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKP +TD I++ PGQTT  ++ A    G+Y++  SPFMDAP++VDN T TAT
Sbjct  240   VVEVDAAYVKPLRTDAILVGPGQTTTALLMAYHTTGKYLMIVSPFMDAPVSVDNVTATAT  299

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             + Y G            PS NAT VA  FV SLRSLN+  +PA+VP  +DHSL FTVG+G
Sbjct  300   VRYAGTPAASPAVPIAPPSPNATWVAEGFVGSLRSLNTGAYPARVPLEIDHSLFFTVGIG  359

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C  A+G RVVA  NN++FVMP TALL AH++ + GVFT DFP  P   FNYTG+
Sbjct  360   VNPCATC--ASGFRVVADFNNISFVMPKTALLSAHYYKMTGVFTDDFPAKPMIRFNYTGA  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P  NL T TGT+LYRL YN+TVQLVLQDTG+VAPENHPIHLHGFNFFAVGRGIGNF+P 
Sbjct  418   QP-VNLNTMTGTRLYRLRYNSTVQLVLQDTGMVAPENHPIHLHGFNFFAVGRGIGNFDPI  476

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TDP+KFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+VD+G
Sbjct  477   TDPRKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDDG  536

Query  312   KGPNES  295
             +GP++S
Sbjct  537   EGPDQS  542



>ref|XP_009789474.1| PREDICTED: laccase-4-like isoform X2 [Nicotiana sylvestris]
Length=524

 Score =   433 bits (1113),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 250/307 (81%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+YVKPFK DTI+  PGQTTNVI++AD   G+Y++  SP+MD+PI V+N+T TAT
Sbjct  210   VVEVDASYVKPFKADTILTTPGQTTNVILSADLGTGKYLMVTSPYMDSPILVNNRTATAT  269

Query  1032  LHYTGVQttlattlTRIPSQN-ATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             L Y G  T+  TT   +P    ATP+A  F+DSLRSLNS+ +PAKVP T+DHSL FT+ L
Sbjct  270   LQYVGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAKVPLTIDHSLFFTISL  329

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPC SC    G R+VA++NNVTFVMP+ +LL AHFF   GVFT DFPGNP + F+YTG
Sbjct  330   GLNPCESC--YRGFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFTDDFPGNPAYTFDYTG  387

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP NL+T  GT+LYRL YN+ VQ+++QDTG+++PENHP+HLHGFNFF VGRG GNF+P
Sbjct  388   -IPPENLRTMEGTRLYRLAYNSNVQVIMQDTGLLSPENHPMHLHGFNFFVVGRGRGNFDP  446

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             + DPKKFNLVDPVERNTI  P+GGWVAIRFRA+NPG+WF+HCHLE+HTTWGLKMAF+VDN
Sbjct  447   EEDPKKFNLVDPVERNTINAPSGGWVAIRFRANNPGIWFLHCHLEVHTTWGLKMAFVVDN  506

Query  315   GKGPNES  295
             G GP ES
Sbjct  507   GNGPEES  513



>ref|XP_004159811.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=355

 Score =   426 bits (1096),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 244/305 (80%), Gaps = 3/305 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDA+Y KPFKT+TI I+PGQTTN ++ A +  G+Y++AASPFMDAP+A+DN T TA 
Sbjct  42    IVEVDASYTKPFKTNTIFISPGQTTNALVRAHRPIGKYLIAASPFMDAPVAIDNLTATAF  101

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y           T IP  N+T + N F DSLRSLNS+ +PAKVP  +DH+L FTVG+G
Sbjct  102   LRYKRTPKNSPIVFTHIPPPNSTLLTNQFTDSLRSLNSEEYPAKVPLFIDHNLFFTVGVG  161

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG R+VA+VNNVTF+MP  +LLQ+H++ I GVFT DFP NPPF ++YTG 
Sbjct  162   VNPCETC--VNGVRLVAAVNNVTFLMPQISLLQSHYYNIPGVFTDDFPANPPFVYDYTGK  219

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP N QTS GTK+YRL +N+TVQLVLQDT ++APE+HPIHLHGFN F VG G+GNF+P 
Sbjct  220   -PPTNNQTSNGTKVYRLRFNSTVQLVLQDTAVIAPESHPIHLHGFNVFIVGTGLGNFDPI  278

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNT GVP GGW+AIRFRADNPGVWF+HCHLE+HTTWGL+MAFLV+NG
Sbjct  279   EDWKGFNLVDPVERNTFGVPNGGWIAIRFRADNPGVWFLHCHLEVHTTWGLRMAFLVENG  338

Query  312   KGPNE  298
             +GPNE
Sbjct  339   EGPNE  343



>gb|KDO69098.1| hypothetical protein CISIN_1g008799mg [Citrus sinensis]
Length=553

 Score =   433 bits (1114),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 207/306 (68%), Positives = 247/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVD++Y KPFKTDTI I PGQTTN ++TAD+  G+Y++  SPFMD  +AV+N TG A 
Sbjct  240   VVEVDSSYTKPFKTDTIFIGPGQTTNALLTADKKIGKYLITISPFMDTIVAVNNVTGIAF  299

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G     +TTLT +P+ NAT V N F D+LRSLNSK +PAKVP TVDHSLL T+ + 
Sbjct  300   LRYKGTVAFSSTTLTNVPAINATEVTNTFSDNLRSLNSKRYPAKVPLTVDHSLLLTMAVA  359

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG++V A++NN++FVMPTTALLQAH++ I GVFT DFP  PP AFNYTG+
Sbjct  360   VNPCATCP--NGTKVGAAMNNISFVMPTTALLQAHYYKISGVFTDDFPAKPPIAFNYTGN  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                  LQT+ GT+LYRL YN+TVQLVLQ T ++APENHP HLHGFNFFAVG+G GNF+P 
Sbjct  418   YT-GTLQTTNGTRLYRLAYNSTVQLVLQGTTVIAPENHPTHLHGFNFFAVGKGSGNFDPN  476

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP+KFNLVDPVERNTI VP  GW AIRFRADNPGVWF+HCHLE+HT+WGLKMAF+VDNG
Sbjct  477   KDPQKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFLHCHLEVHTSWGLKMAFVVDNG  536

Query  312   KGPNES  295
             KGPNES
Sbjct  537   KGPNES  542



>ref|XP_006435668.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
 ref|XP_006486373.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR48908.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
Length=553

 Score =   433 bits (1114),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 207/306 (68%), Positives = 247/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVD++Y KPFKTDTI I PGQTTN ++TAD+  G+Y++  SPFMD  +AV+N TG A 
Sbjct  240   VVEVDSSYTKPFKTDTIFIGPGQTTNALLTADKKIGKYLITVSPFMDTIVAVNNVTGIAF  299

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G     +TTLT +P+ NAT V N F D+LRSLNSK +PAKVP TVDHSLL T+ + 
Sbjct  300   LRYKGTVAFSSTTLTNVPAINATEVTNTFSDNLRSLNSKRYPAKVPLTVDHSLLITMAVA  359

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG++V A++NN++FVMPTTALLQAH++ I GVFT DFP  PP AFNYTG+
Sbjct  360   VNPCATCP--NGTKVGAAMNNISFVMPTTALLQAHYYKISGVFTDDFPAKPPIAFNYTGN  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                  LQT+ GT+LYRL YN+TVQLVLQ T ++APENHP HLHGFNFFAVG+G GNF+P 
Sbjct  418   YT-GTLQTTNGTRLYRLAYNSTVQLVLQGTTVIAPENHPTHLHGFNFFAVGKGSGNFDPN  476

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP+KFNLVDPVERNTI VP  GW AIRFRADNPGVWF+HCHLE+HT+WGLKMAF+VDNG
Sbjct  477   KDPQKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFLHCHLEVHTSWGLKMAFVVDNG  536

Query  312   KGPNES  295
             KGPNES
Sbjct  537   KGPNES  542



>ref|XP_009789473.1| PREDICTED: laccase-4-like isoform X1 [Nicotiana sylvestris]
Length=557

 Score =   433 bits (1114),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 250/307 (81%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+YVKPFK DTI+  PGQTTNVI++AD   G+Y++  SP+MD+PI V+N+T TAT
Sbjct  243   VVEVDASYVKPFKADTILTTPGQTTNVILSADLGTGKYLMVTSPYMDSPILVNNRTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQN-ATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             L Y G  T+  TT   +P    ATP+A  F+DSLRSLNS+ +PAKVP T+DHSL FT+ L
Sbjct  303   LQYVGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAKVPLTIDHSLFFTISL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPC SC    G R+VA++NNVTFVMP+ +LL AHFF   GVFT DFPGNP + F+YTG
Sbjct  363   GLNPCESC--YRGFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFTDDFPGNPAYTFDYTG  420

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP NL+T  GT+LYRL YN+ VQ+++QDTG+++PENHP+HLHGFNFF VGRG GNF+P
Sbjct  421   -IPPENLRTMEGTRLYRLAYNSNVQVIMQDTGLLSPENHPMHLHGFNFFVVGRGRGNFDP  479

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             + DPKKFNLVDPVERNTI  P+GGWVAIRFRA+NPG+WF+HCHLE+HTTWGLKMAF+VDN
Sbjct  480   EEDPKKFNLVDPVERNTINAPSGGWVAIRFRANNPGIWFLHCHLEVHTTWGLKMAFVVDN  539

Query  315   GKGPNES  295
             G GP ES
Sbjct  540   GNGPEES  546



>ref|XP_008392913.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   433 bits (1113),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 246/306 (80%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+Y KPF+TDTI   PGQTTN I+TA+Q  G+Y + ASPFMDAPI  DN T  AT
Sbjct  245   VVEVDASYTKPFQTDTIYTGPGQTTNAILTANQGIGKYFITASPFMDAPIGFDNATVIAT  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G        LT IP +NATP+ + FVDSLRSLNSK +PA VP T+DHSL FT+ +G
Sbjct  305   LRYKGTPANPTAILTSIPPRNATPLTDAFVDSLRSLNSKQYPADVPLTIDHSLFFTISVG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              NPC +C   +GS++V++ NNV+FVMP+ +LLQA+++ +KGV+T DFP NPP  FNYTG 
Sbjct  365   ANPCATC--VSGSKLVSAFNNVSFVMPSISLLQAYYYNVKGVYTLDFPANPPIPFNYTG-  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T PANLQT+ GT+LYRL YN+TVQ+VLQ T I+APE+HP HLHGFNFF VG+G+GNF+PK
Sbjct  422   TSPANLQTTNGTRLYRLEYNSTVQIVLQGTAIIAPESHPTHLHGFNFFVVGKGLGNFDPK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDPVERNT+ VP  GW AIRFRA+NPG+WF+HCHLE+HT+WGLKMAFLV+NG
Sbjct  482   KDPGKFNLVDPVERNTVSVPTAGWTAIRFRANNPGIWFLHCHLEVHTSWGLKMAFLVENG  541

Query  312   KGPNES  295
             +G NES
Sbjct  542   EGQNES  547



>ref|XP_011036009.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=555

 Score =   432 bits (1111),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 241/306 (79%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY KPF TDTI I PGQTTN ++TAD++ G+Y++A SPFMD  +AVDN T  A 
Sbjct  241   VVEVDATYTKPFSTDTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAF  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G        LT  P+ NATP  + F+D LRSLNSK +PA VP TVDH L FT+G+G
Sbjct  301   LRYKGTLAFSPPVLTTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PC +C   NGS+ VA +NNV+F+MPTTALLQAH++ I GVFT DFP  PP  FNYTG+
Sbjct  361   IDPCATC--INGSKAVADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPITFNYTGN  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 NL+T+ GT+ YRL +N+ VQ+VLQ T I+APE+HP HLHGFNFF VG+G+GNF+P 
Sbjct  419   NTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGFNFFVVGKGLGNFDPD  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+ VP  GW+AIRF+ADNPGVWF+HCHLE+HTTWGLKMAF+VDNG
Sbjct  479   NDPKKFNLVDPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNG  538

Query  312   KGPNES  295
             KGPNES
Sbjct  539   KGPNES  544



>ref|XP_003544123.1| PREDICTED: laccase-4-like [Glycine max]
Length=554

 Score =   432 bits (1110),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE DA+YVKPF+TDTI ++PGQTTNV++TA+Q  G+Y++A +PFMDAPI  DN T  AT
Sbjct  240   VVEADASYVKPFETDTIFMSPGQTTNVLLTANQVVGKYLIAVTPFMDAPIGFDNVTSIAT  299

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G      TTLT IP+ NATP+ ++F+DSLRSLNSK +PA  P TVDHSL F++ +G
Sbjct  300   LRYKGTPPYPKTTLTTIPALNATPLTSDFIDSLRSLNSKEYPAIAPLTVDHSLFFSITVG  359

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTT-ALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             +NPC +C    G+R+V+++NN+TF+MPTT +LL+AH++ IKGVFT DFP  PP AFNYTG
Sbjct  360   LNPCHTC--LTGARLVSAINNITFLMPTTTSLLEAHYYNIKGVFTDDFPSFPPIAFNYTG  417

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T PAN+QT+ GT+LYRL +N+TVQ++LQ T ++APENHP HLHG+NFF VG+G+GNF+P
Sbjct  418   -TQPANIQTNNGTRLYRLDFNSTVQIILQGTAMIAPENHPFHLHGYNFFVVGQGLGNFDP  476

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             + DP  FNLVDPVERNTIGVP GGW AIRFRA+NPGVWF+HCHLE+HTTWGLKMAF+VDN
Sbjct  477   EKDPLSFNLVDPVERNTIGVPNGGWAAIRFRANNPGVWFLHCHLEVHTTWGLKMAFIVDN  536

Query  315   GKGPNES  295
             G GP+ES
Sbjct  537   GNGPHES  543



>gb|KHN20872.1| Laccase-4 [Glycine soja]
Length=562

 Score =   432 bits (1110),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 255/307 (83%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE DA+YVKPF+TDTI ++PGQTTNV++TA+Q  G+Y++A +PFMDAPI  DN T  AT
Sbjct  248   VVEADASYVKPFETDTIFMSPGQTTNVLLTANQVVGKYLIAVTPFMDAPIGFDNVTSIAT  307

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G      TTLT IP+ NATP+ ++F+DSLRSLNSK +PA  P TVDHSL F++ +G
Sbjct  308   LRYKGTPPYPKTTLTTIPALNATPLTSDFIDSLRSLNSKEYPAIAPLTVDHSLFFSITVG  367

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTT-ALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             +NPC +C    G+R+V+++NN+TF+MPTT +LL+AH++ IKGVFT DFP  PP AFNYTG
Sbjct  368   LNPCHTC--LTGARLVSAINNITFLMPTTTSLLEAHYYNIKGVFTDDFPSFPPIAFNYTG  425

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
              T PAN+QT+ GT+LYRL +N+TVQ++LQ T ++APENHP HLHG+NFF VG+G+GNF+P
Sbjct  426   -TQPANIQTNNGTRLYRLDFNSTVQIILQGTAMIAPENHPFHLHGYNFFVVGQGLGNFDP  484

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             + DP  FNLVDPVERNTIGVP GGW AIRFRA+NPGVWF+HCHLE+HTTWGLKMAF+VDN
Sbjct  485   EKDPLSFNLVDPVERNTIGVPNGGWAAIRFRANNPGVWFLHCHLEVHTTWGLKMAFIVDN  544

Query  315   GKGPNES  295
             G GP+ES
Sbjct  545   GNGPHES  551



>ref|XP_004308920.1| PREDICTED: laccase-22-like [Fragaria vesca subsp. vesca]
Length=556

 Score =   431 bits (1108),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 205/306 (67%), Positives = 244/306 (80%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+Y KPF+TDTI I+PGQTT  ++ A++  G Y+++ SPFMDAPI +DN T  AT
Sbjct  243   VVEVDASYTKPFQTDTIFISPGQTTTALLEANKDIGNYLISVSPFMDAPIGIDNFTSIAT  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y        T LT IP QNATP+   F+DSLRSL+SK +PA VP T+DHSL  TVG+G
Sbjct  303   LRYKHTPRNSTTFLTSIPPQNATPLTATFIDSLRSLDSKLYPANVPLTIDHSLFLTVGVG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   NGS++VASVNNV+FVMPT ALLQA+++ IKGV+T DFP  PP  F+YTG 
Sbjct  363   INPCDTC--VNGSKLVASVNNVSFVMPTIALLQAYYYNIKGVYTLDFPPKPPNPFDYTG-  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP N+Q + GTKLYRL YN+TVQ+VLQD  I+ PE+HP HLHGFNFF VG G+GNF+P 
Sbjct  420   TPPVNVQAANGTKLYRLGYNSTVQIVLQDIAIILPESHPTHLHGFNFFVVGTGLGNFDPD  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNT+ VP GGW AIRFRADNPG+WF+HCHLE+HTTWGLKMAFLVDNG
Sbjct  480   KDTKTFNLVDPVERNTVSVPTGGWTAIRFRADNPGIWFLHCHLEVHTTWGLKMAFLVDNG  539

Query  312   KGPNES  295
             +GPNES
Sbjct  540   EGPNES  545



>ref|XP_007009094.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY17904.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=554

 Score =   431 bits (1108),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 208/306 (68%), Positives = 240/306 (78%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KP+KTDT+ + PGQTT  ++TADQ  G+Y++A SPFMD  +AVDN T    
Sbjct  241   VVEVDAVYTKPYKTDTLFLGPGQTTTSLLTADQGIGKYLIAVSPFMDTIVAVDNLTAVGF  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y        TTLT IP  NAT V   F  SLRSLNSK +PA VP T+DHSL FT+G+G
Sbjct  301   LRYNHTLAFTPTTLTSIPPVNATSVTEVFSKSLRSLNSKEYPANVPLTIDHSLFFTIGIG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   NGSR VA++NNVTF MPTTALLQAH++GI GVFT DFP  P   FNYTG 
Sbjct  361   INPCATC--VNGSRAVAAINNVTFDMPTTALLQAHYYGISGVFTDDFPAKPLIPFNYTG-  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP++LQT  GT++YRL YN+TVQL++Q   I+APE+HP HLHGFNFFAVGRG+GNF+P+
Sbjct  418   TPPSSLQTMNGTRVYRLAYNSTVQLIIQGNSIIAPESHPTHLHGFNFFAVGRGVGNFDPE  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDPVERNTI VP  GW AIRFRADNPGVWF HCHLE+HTTWGLKMAFLV+NG
Sbjct  478   KDPLKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFFHCHLEVHTTWGLKMAFLVENG  537

Query  312   KGPNES  295
             KGPNES
Sbjct  538   KGPNES  543



>ref|XP_002316233.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
 gb|EEF02404.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
Length=555

 Score =   431 bits (1108),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 241/306 (79%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDAT+ KPF TDTI I PGQTTN ++TAD++ G+Y++A SPFMD  +AVDN T  A 
Sbjct  241   VVEVDATFTKPFSTDTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAF  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G        LT  P+ NATP  + F+D LRSLNSK +PA VP TVDH L FT+G+G
Sbjct  301   LRYKGTLAFSPPVLTTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PC +C   NGS+ VA +NNV+F+MPTTALLQAH++ I GVFT DFP  PP +FNYTG+
Sbjct  361   IDPCATC--TNGSKAVADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPISFNYTGN  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 NL+T+ GT+ YRL +N+ VQ+VLQ T I+APE+HP HLHGFNFF VG+GIGNF+P 
Sbjct  419   NTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGFNFFVVGKGIGNFDPD  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNL DPVERNT+ VP  GW+AIRF+ADNPGVWF+HCHLE+HTTWGLKMAF+VDNG
Sbjct  479   NDPKKFNLADPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNG  538

Query  312   KGPNES  295
             KGPNES
Sbjct  539   KGPNES  544



>ref|XP_007141799.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
 gb|ESW13793.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
Length=553

 Score =   429 bits (1103),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 254/306 (83%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE DA+YVKPF+TDTI ++PGQTTNV+++ADQ  G+Y++A +PFMDAPI  DN T  AT
Sbjct  240   VVEADASYVKPFETDTIFMSPGQTTNVLLSADQGVGKYLIAVTPFMDAPIGFDNVTSIAT  299

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y        TTLT IP+ NATP+ ++F+DSLRSLNSK +PA+VP TVDHSL F + +G
Sbjct  300   LRYKTTPPYPTTTLTTIPALNATPLTSHFIDSLRSLNSKEYPARVPLTVDHSLFFAITVG  359

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C    GS++V+++NN+TFVMPTT+LL+AH++ +KGVFT DFP +PP  FNYTG 
Sbjct  360   LNPCDAC--PTGSKLVSALNNITFVMPTTSLLEAHYYNVKGVFTDDFPAHPPIVFNYTG-  416

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             T PAN+QT+ GT+LYRL +N+TVQ++LQ T ++APENHP HLHG+NFF VG+G GNF+P+
Sbjct  417   TQPANIQTNNGTRLYRLNFNSTVQIILQGTAMIAPENHPFHLHGYNFFVVGQGSGNFDPE  476

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNTIGVP GGWVAIRFRA+NPGVWF+HCHLE+HTTWGLKMAF+VDNG
Sbjct  477   KDPLGFNLVDPVERNTIGVPNGGWVAIRFRANNPGVWFLHCHLEVHTTWGLKMAFIVDNG  536

Query  312   KGPNES  295
               P+ES
Sbjct  537   NSPHES  542



>emb|CDX80325.1| BnaC09g34170D [Brassica napus]
Length=570

 Score =   429 bits (1103),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 248/315 (79%), Gaps = 11/315 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAG-QYMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT++IAPGQTTNV++TA+   G +YMVAA+ FMDAPI+ DN T TA
Sbjct  247   VVEVDAVYTKPYKTDTVLIAPGQTTNVLLTANANTGSKYMVAATTFMDAPISFDNVTATA  306

Query  1035  TLH-----YTG--VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHS  877
             TLH     Y G  V ++  T L  +P  NAT V++ F+ SLRSLNS+ +PAKVP TVDHS
Sbjct  307   TLHSNALHYIGHTVSSSKKTVLASLPQPNATLVSSKFIKSLRSLNSREYPAKVPTTVDHS  366

Query  876   LLFTVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPP  697
             L FTVGLG NPCPSC   NG R+VA +NNVTF MP TALLQAH+F I  VFT DFP  P 
Sbjct  367   LFFTVGLGANPCPSCN--NGIRLVAGINNVTFTMPETALLQAHYFNISHVFTDDFPAKPS  424

Query  696   FAFNYTGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVG  520
               +NYT     + N  T TGTKLYRLPYNATVQ++LQ+T ++  ENHP HLHGFNFF VG
Sbjct  425   NPYNYTAPVDQSVNAATMTGTKLYRLPYNATVQIILQNTAMILSENHPFHLHGFNFFEVG  484

Query  519   RGIGNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGL  340
             RG+GNFNP+ DPK+FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLEIHTTWGL
Sbjct  485   RGLGNFNPEKDPKRFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLEIHTTWGL  544

Query  339   KMAFLVDNGKGPNES  295
             KMAF+VDNG GP++S
Sbjct  545   KMAFVVDNGHGPDQS  559



>gb|AAK37829.1|AF132125_1 laccase [Pinus taeda]
Length=555

 Score =   427 bits (1099),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 242/306 (79%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF+T  IV APGQTTN ++  D+ AG+Y +AA  FMDAPIAVDN+T TA 
Sbjct  242   VVEVDAVYTKPFETKAIVSAPGQTTNALLHTDKKAGRYFMAARVFMDAPIAVDNKTATAI  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L YTG   +L   +  IP+ N T  ++NF ++L+SLNS  +PAKVPQ++D +L FTVGL 
Sbjct  302   LQYTGSSNSLNPVMPLIPALNDTAFSSNFSNALKSLNSPQYPAKVPQSIDRNLFFTVGLA  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +N CP+C   NG+R  ASVNN++F MPT ALLQ+H+F I GVFTTDFP NPP  FNYTG 
Sbjct  362   LNACPTC--INGARPAASVNNISFTMPTIALLQSHYFNISGVFTTDFPDNPPATFNYTG-  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP NLQ+S GT+L R+P+N+TVQLVLQDT  +  ENHP+HLHGFNFF VGRG GN+NPK
Sbjct  419   TPPKNLQSSNGTRLSRIPFNSTVQLVLQDTSALTVENHPVHLHGFNFFIVGRGFGNYNPK  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW  IRFRADNPGVWFMHCHLE+HTTWGLKMAFLV+NG
Sbjct  479   KDPAKFNLVDPPERNTVGVPTGGWTVIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENG  538

Query  312   KGPNES  295
              GP +S
Sbjct  539   HGPEQS  544



>ref|XP_008441433.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=553

 Score =   427 bits (1099),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 245/305 (80%), Gaps = 3/305 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDA+Y KPFKT+TI I+PGQTTN +ITA +  G+Y++ ASPFMDAP+A+DN T TA 
Sbjct  240   IVEVDASYTKPFKTNTIFISPGQTTNALITAHKPIGKYLITASPFMDAPVAIDNLTATAF  299

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y           T+IP  N+T + N F++SLRSLNS+ +PAKVP  +DH+L FTVG+G
Sbjct  300   LRYKRTPRNSPIVFTKIPPPNSTFLTNQFINSLRSLNSEEYPAKVPLFIDHNLFFTVGVG  359

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              NPC +C   NG R+VA+VNNVTF+MP  +LLQ+H++ I G+FT DFP NPPF +NYTG 
Sbjct  360   ANPCETC--VNGMRLVAAVNNVTFIMPKISLLQSHYYNIPGIFTDDFPANPPFVYNYTGK  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PPAN QTS GTK+YRL +N+TVQLVLQDT ++APE+HPIHLHGFN F VG G+GNF+P 
Sbjct  418   -PPANNQTSNGTKIYRLRFNSTVQLVLQDTAVIAPESHPIHLHGFNVFIVGTGLGNFDPI  476

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              + K FNLVDPVERNT GVP GGW AIRFRADNPGVWF+HCHLE+HTTWGL+MAFLV+NG
Sbjct  477   ENSKGFNLVDPVERNTFGVPNGGWTAIRFRADNPGVWFLHCHLEVHTTWGLRMAFLVENG  536

Query  312   KGPNE  298
             +GPNE
Sbjct  537   EGPNE  541



>emb|CAA74103.1| laccase [Populus trichocarpa]
Length=555

 Score =   427 bits (1098),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 242/306 (79%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDAT+ KPF TDTI I PGQTTN ++TAD++ G+Y++A SPFMD  +AVDN T  A 
Sbjct  241   VVEVDATFTKPFSTDTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAF  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y     +   +LT  P+ NATP  + F+D LRSLNSK +PA VP TVDH L FT+G+G
Sbjct  301   LRYNEPLHSPHLSLTTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PC +C   NGS+ VA +NNV+F+MPTTALLQAH++ I GVFT DFP  PP +FNYTG+
Sbjct  361   IDPCATC--TNGSKAVADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPISFNYTGN  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 NL+T+ GT+ YRL +N+ VQ+VLQ T I+APE+HP HLHGFNFF VG+GIGNF+P 
Sbjct  419   NTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGFNFFVVGKGIGNFDPD  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNL DPVERNT+ VP  GW+AIRF+ADNPGVWF+HCHLE+HTTWGLKMAF+VDNG
Sbjct  479   NDPKKFNLADPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNG  538

Query  312   KGPNES  295
             KGPNES
Sbjct  539   KGPNES  544



>ref|XP_004138572.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis sativus]
Length=561

 Score =   427 bits (1097),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 244/305 (80%), Gaps = 3/305 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDA+Y KPFKT+TI I+PGQTTN ++ A +  G+Y++AASPFMDAP+A+DN T TA 
Sbjct  248   IVEVDASYTKPFKTNTIFISPGQTTNALVRAHRPIGKYLIAASPFMDAPVAIDNLTATAF  307

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y           T IP  N+T + N F DSLRSLNS+ +PAKVP  +DH+L FTVG+G
Sbjct  308   LRYKRTPKNSPIVFTHIPPPNSTLLTNQFTDSLRSLNSEEYPAKVPLFIDHNLFFTVGVG  367

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG R+VA+VNNVTF+MP  +LLQ+H++ I GVFT DFP NPPF ++YTG 
Sbjct  368   VNPCETC--VNGVRLVAAVNNVTFLMPQISLLQSHYYNIPGVFTDDFPANPPFVYDYTGK  425

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP N QTS GTK+YRL +N+TVQLVLQDT ++APE+HPIHLHGFN F VG G+GNF+P 
Sbjct  426   -PPTNNQTSNGTKVYRLRFNSTVQLVLQDTAVIAPESHPIHLHGFNVFIVGTGLGNFDPI  484

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNT GVP GGW+AIRFRADNPGVWF+HCHLE+HTTWGL+MAFLV+NG
Sbjct  485   EDWKGFNLVDPVERNTFGVPNGGWIAIRFRADNPGVWFLHCHLEVHTTWGLRMAFLVENG  544

Query  312   KGPNE  298
             +GPNE
Sbjct  545   EGPNE  549



>ref|XP_010067496.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW65638.1| hypothetical protein EUGRSUZ_G03028 [Eucalyptus grandis]
Length=561

 Score =   427 bits (1097),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 244/306 (80%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+Y KPF  DTI IAPGQTTN ++ AD++ G Y++A SPFMD  +AVDN T T  
Sbjct  248   VVEVDASYTKPFSIDTIFIAPGQTTNALLAADKSGGSYIMAISPFMDTVVAVDNLTATGI  307

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             + Y G   +  T    IP+ NAT    +F++SLRSLNSK +PAKVP TVDHSL  T+  G
Sbjct  308   VQYKGTIASAPTVQASIPAINATSFEFSFINSLRSLNSKQYPAKVPLTVDHSLFITMSAG  367

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG ++VA++NNV+FVMP+T +L+AH++ IKGV+T DFPGNPP  FNYTG 
Sbjct  368   VNPCSTC--VNGKKLVAALNNVSFVMPSTDILEAHYYKIKGVYTDDFPGNPPTPFNYTG-  424

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP+N+QT+ GT++Y+L YN+TVQ+VLQ T I+APENHP HLHGFNFF +G+G+GNF+P 
Sbjct  425   TPPSNMQTTNGTRVYKLAYNSTVQVVLQGTSIIAPENHPTHLHGFNFFGIGKGLGNFDPN  484

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPK FNLVDPVERNTIGVP  GW AIRFRADNPGVWF+HCHLE+HTTWGLKM F+V++G
Sbjct  485   KDPKNFNLVDPVERNTIGVPTAGWTAIRFRADNPGVWFLHCHLEVHTTWGLKMVFIVEDG  544

Query  312   KGPNES  295
              GPNES
Sbjct  545   DGPNES  550



>ref|XP_006282033.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
 gb|EOA14931.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
Length=530

 Score =   426 bits (1095),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 214/312 (69%), Positives = 241/312 (77%), Gaps = 8/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YMVAA+ F DA I  DN T TA
Sbjct  210   VVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATA  269

Query  1035  TLHYTG----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLF  868
             TLHY G    V  +  T L  +P QNAT VA  F  SLRSLNS  +PA+VP TVDHSL F
Sbjct  270   TLHYIGHTSTVSASKKTVLASLPPQNATWVATKFTRSLRSLNSHEYPARVPTTVDHSLFF  329

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
             TVGLG NPCPSC  +NG R+VA +NNVTF MP TALLQAHFF I GVFT DFP  P   +
Sbjct  330   TVGLGANPCPSC--SNGVRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPANPY  387

Query  687   NYTGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             +YT       N  T  GTKLYRLPYNATVQ+VLQ+T ++ P+NHP HLHGFNFF VGRG+
Sbjct  388   DYTAPVKLGVNAATMKGTKLYRLPYNATVQVVLQNTAMIVPDNHPFHLHGFNFFEVGRGL  447

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFNP+ DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMA
Sbjct  448   GNFNPEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMA  507

Query  330   FLVDNGKGPNES  295
             F+VDNG GP++S
Sbjct  508   FVVDNGHGPDQS  519



>gb|KGN45770.1| hypothetical protein Csa_6G009490 [Cucumis sativus]
Length=555

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 244/305 (80%), Gaps = 3/305 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VEVDA+Y KPFKT+TI I+PGQTTN ++ A +  G+Y++AASPFMDAP+A+DN T TA 
Sbjct  242   IVEVDASYTKPFKTNTIFISPGQTTNALVRAHRPIGKYLIAASPFMDAPVAIDNLTATAF  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y           T IP  N+T + N F DSLRSLNS+ +PAKVP  +DH+L FTVG+G
Sbjct  302   LRYKRTPKNSPIVFTHIPPPNSTLLTNQFTDSLRSLNSEEYPAKVPLFIDHNLFFTVGVG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG R+VA+VNNVTF+MP  +LLQ+H++ I GVFT DFP NPPF ++YTG 
Sbjct  362   VNPCETC--VNGVRLVAAVNNVTFLMPQISLLQSHYYNIPGVFTDDFPANPPFVYDYTGK  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP N QTS GTK+YRL +N+TVQLVLQDT ++APE+HPIHLHGFN F VG G+GNF+P 
Sbjct  420   -PPTNNQTSNGTKVYRLRFNSTVQLVLQDTAVIAPESHPIHLHGFNVFIVGTGLGNFDPI  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D K FNLVDPVERNT GVP GGW+AIRFRADNPGVWF+HCHLE+HTTWGL+MAFLV+NG
Sbjct  479   EDWKGFNLVDPVERNTFGVPNGGWIAIRFRADNPGVWFLHCHLEVHTTWGLRMAFLVENG  538

Query  312   KGPNE  298
             +GPNE
Sbjct  539   EGPNE  543



>ref|XP_006840270.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
 gb|ERN01945.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
Length=565

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 211/313 (67%), Positives = 250/313 (80%), Gaps = 9/313 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATY KPF T T++IAPGQTTNV++ AD++ G+Y+ AASPFMDAPIAVDN T TA 
Sbjct  244   VVEVDATYNKPFTTTTVLIAPGQTTNVLLKADKSGGRYIAAASPFMDAPIAVDNATATAL  303

Query  1032  LHYTGV--QttlattlTRIPSQNATPVANNFVDSLRSLN---SKTFPAKVPQTVDHSLLF  868
             LHYT     ++++TT   +P  NATPVA+ F+DSLRSL    S + P      VDHSL  
Sbjct  304   LHYTDTPSSSSVSTTFVSLPPLNATPVASKFMDSLRSLKKPPSSSLPRH--SRVDHSLFI  361

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
             TVGLGI PCP+C   NGSRV+A++NN++FVMPT  LLQAH+F I GVFT DFP  PP  F
Sbjct  362   TVGLGIFPCPTCTANNGSRVLAAMNNISFVMPTFNLLQAHYFNISGVFTDDFPAKPPTPF  421

Query  687   NYTGSTPPAN--LQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRG  514
             NYT +  P N  +  S GT+LYRLP+N++VQ+VLQDTG ++PENHP+HLHGFNFF VGRG
Sbjct  422   NYTQNPTPQNTSIVLSNGTRLYRLPFNSSVQVVLQDTGFISPENHPVHLHGFNFFVVGRG  481

Query  513   IGNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKM  334
             IGNF+PK DP KFNLVDPVERNT+G+P+GGW A RF ADNPGVWFMHCHLEIHTTWGLKM
Sbjct  482   IGNFDPKKDPAKFNLVDPVERNTVGLPSGGWTAFRFIADNPGVWFMHCHLEIHTTWGLKM  541

Query  333   AFLVDNGKGPNES  295
             AF+VDNGKGPN+S
Sbjct  542   AFVVDNGKGPNQS  554



>gb|ACN39933.1| unknown [Picea sitchensis]
Length=559

 Score =   426 bits (1095),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 239/307 (78%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KP +T +IVIAPGQTTN ++ A++ +G+Y +A   FMDAP+AVDN+T TA 
Sbjct  245   VVEVDAVYTKPLRTKSIVIAPGQTTNALLYANKGSGRYFIATRTFMDAPVAVDNKTATAI  304

Query  1032  LHYTGVQttlattlT-RIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             L Y    +        RIPSQN T  A NF +SLRSLNS  FPAKVPQTVD  LLFTVGL
Sbjct  305   LQYVNSNSNTDFIAMPRIPSQNDTSFATNFSNSLRSLNSARFPAKVPQTVDRHLLFTVGL  364

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
              ++ CP+C   NGSRV AS+NN++FVMP  +LLQAHFF I GVFTTDFP  PP  FNYTG
Sbjct  365   AMDSCPTCN--NGSRVAASINNISFVMPKISLLQAHFFNITGVFTTDFPDRPPTPFNYTG  422

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             + PP N  TS GT+L R+P+N+TVQLVLQ T ++A E HP+HLHGFNFF VGRG GN+NP
Sbjct  423   A-PPQNPMTSKGTRLTRIPFNSTVQLVLQGTSVLAMEKHPLHLHGFNFFIVGRGFGNYNP  481

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
               DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+V+N
Sbjct  482   NKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVEN  541

Query  315   GKGPNES  295
             G GPN+S
Sbjct  542   GDGPNQS  548



>emb|CAC14719.1| laccase [Populus trichocarpa]
Length=555

 Score =   426 bits (1095),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 241/306 (79%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDAT+ KPF  DTI I PGQTTN ++TAD++ G+Y++A SPFMD  +AVDN T  A 
Sbjct  241   VVEVDATFTKPFSADTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAF  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y     +   +LT  P+ NATP  + F+D LRSLNSK +PA VP TVDH L FT+G+G
Sbjct  301   LRYNEPLHSPHLSLTTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PC +C   NGS+ VA +NNV+F+MPTTALLQAH++ I GVFT DFP  PP +FNYTG+
Sbjct  361   IDPCATC--TNGSKAVADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPISFNYTGN  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 NL+T+ GT+ YRL +N+ VQ+VLQ T I+APE+HP HLHGFNFF VG+GIGNF+P 
Sbjct  419   NTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGFNFFVVGKGIGNFDPD  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNL DPVERNT+ VP  GW+AIRF+ADNPGVWF+HCHLE+HTTWGLKMAF+VDNG
Sbjct  479   NDPKKFNLADPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNG  538

Query  312   KGPNES  295
             KGPNES
Sbjct  539   KGPNES  544



>gb|AES99522.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=529

 Score =   425 bits (1092),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 247/306 (81%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE DA+Y+KPF+ DTI ++PGQTTNV++TA+Q  G+Y++A +PFMDAPI  DN +  AT
Sbjct  215   VVEADASYLKPFEIDTIFLSPGQTTNVLLTANQPIGKYLIAITPFMDAPIGFDNLSSIAT  274

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+     T LT IP  NATP+   F DSLRSLNSKT+P +V  T+DHSLLF + +G
Sbjct  275   LRYKGIPPYTKTILTNIPPLNATPITKTFTDSLRSLNSKTYPTRVSLTIDHSLLFAITVG  334

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   N  ++V+++NN+TF+MPT +LLQA+++ IKGVFT DFP  PP  F+YTG+
Sbjct  335   LNPCDTCITDN--KLVSAINNITFLMPTVSLLQANYYNIKGVFTDDFPSKPPMVFDYTGT  392

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               PANL T  GTK+YRL +N++VQ+VLQ T ++APENHP HLHGFNFF VG+G+GNF+P+
Sbjct  393   DQPANLHTDNGTKVYRLNFNSSVQIVLQGTAMIAPENHPFHLHGFNFFVVGQGLGNFDPE  452

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP +FNLVDP+ERNT+ VP  GW+AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNG
Sbjct  453   KDPLRFNLVDPIERNTLSVPNNGWIAIRFRADNPGVWFLHCHLEVHTTWGLKMAFIVDNG  512

Query  312   KGPNES  295
             +GP+ES
Sbjct  513   RGPSES  518



>ref|XP_002311202.1| laccase family protein [Populus trichocarpa]
 gb|EEE88569.1| laccase family protein [Populus trichocarpa]
Length=556

 Score =   426 bits (1094),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 239/306 (78%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF TDTI I PGQTTN ++TAD++ G+Y++A SPFMD  +AVDN T  A 
Sbjct  242   VVEVDAAYTKPFSTDTIFIGPGQTTNALLTADKSVGKYLMAVSPFMDTVVAVDNVTAIAF  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G        LT  P+ NATPV + F+D+LRSLNSK FPA VP TVDHSL FT+G+G
Sbjct  302   LRYKGTIAFSPPVLTTTPAINATPVTSTFMDNLRSLNSKKFPANVPLTVDHSLYFTIGVG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PC +C   NGS+ V ++NN++F+MPTTALLQAH++ I GVFT DFP  PP +FNYTG+
Sbjct  362   IDPCATC--VNGSKAVGAINNISFIMPTTALLQAHYYSISGVFTDDFPAMPPNSFNYTGN  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 NLQT  GT+ YRL +N+TVQLVLQ T I+APE+HP HLHGFNFF VG+G GNF+  
Sbjct  420   NTALNLQTINGTRTYRLAFNSTVQLVLQGTTIIAPESHPFHLHGFNFFVVGKGFGNFDAD  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNL DPVERNTI VP  GW AIRFRADNPGVWF+HCHLE+HTTWGLKM F+VDNG
Sbjct  480   NDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVDNG  539

Query  312   KGPNES  295
             +GP+ES
Sbjct  540   EGPDES  545



>ref|XP_004490949.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=554

 Score =   426 bits (1094),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 246/306 (80%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE DA+Y+KPF+TDTI ++PGQTTNV++T +Q+ G+Y++A +PFMDAPI  DN T  AT
Sbjct  240   VVEADASYIKPFETDTIFLSPGQTTNVLLTTNQSVGKYLIATTPFMDAPIGFDNVTSIAT  299

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY G Q    T LT IP  NAT +   F DSL+SLNSK +P KVP  +D SLLF + +G
Sbjct  300   LHYKGTQPDTKTILTNIPPLNATTLTKTFTDSLKSLNSKQYPTKVPLKIDQSLLFAITVG  359

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PC +C   +G+++V+++NNVTF+MPT +LLQAH++ IKGVFT DFP NPP  F+YTG+
Sbjct  360   IDPCDTC--TSGNKLVSAINNVTFLMPTISLLQAHYYNIKGVFTDDFPANPPLVFDYTGA  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               P NL T  GT++YRL +N++V++VLQ T ++APENHP HLHG+NFF VG+G+GNF+  
Sbjct  418   DQPDNLHTENGTRVYRLNFNSSVEIVLQGTAMIAPENHPFHLHGYNFFVVGQGLGNFDHD  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP +FNLVDPVERNT+ VP  GW+AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNG
Sbjct  478   KDPLRFNLVDPVERNTLSVPNAGWIAIRFRADNPGVWFLHCHLEVHTTWGLKMAFIVDNG  537

Query  312   KGPNES  295
             +GPNES
Sbjct  538   RGPNES  543



>emb|CAA74102.1| laccase [Populus trichocarpa]
Length=437

 Score =   421 bits (1082),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 238/306 (78%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF TDTI I PGQTTN ++TAD++ G+Y++A SPFMD  +AVDN T  A 
Sbjct  123   VVEVDAAYTKPFSTDTIFIGPGQTTNALLTADKSVGKYLMAVSPFMDTVVAVDNVTAIAF  182

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y         +L   P+ NATPV + F+D+LRSLNSK FPA VP TVDHSL FT+G+G
Sbjct  183   LRYREPLHFPHQSLNTTPAINATPVTSTFMDNLRSLNSKKFPANVPLTVDHSLYFTIGVG  242

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PC +C   NGS+ V ++NN++F+MPTTALLQAH++ I GVFT DFP  PP +FNYTG+
Sbjct  243   IDPCATC--VNGSKAVGAINNISFIMPTTALLQAHYYSISGVFTDDFPAMPPNSFNYTGN  300

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 NLQT  GT+ YRL +N+TVQLVLQ T I+APE+HP HLHGFNFF VG+G GNF+  
Sbjct  301   NTALNLQTINGTRTYRLAFNSTVQLVLQGTTIIAPESHPFHLHGFNFFVVGKGFGNFDAD  360

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNL DPVERNTI VP  GW AIRFRADNPGVWF+HCHLE+HTTWGLKM F+VDNG
Sbjct  361   NDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVDNG  420

Query  312   KGPNES  295
             +GP+ES
Sbjct  421   EGPDES  426



>ref|XP_009589148.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   424 bits (1090),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/307 (66%), Positives = 247/307 (80%), Gaps = 4/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+YVKPFKT+TI+  PGQTTNVI++AD  +G+Y++  S +MD+PI V+N+T TAT
Sbjct  243   VVEVDASYVKPFKTETILTTPGQTTNVILSADLESGKYLMVTSAYMDSPILVNNRTATAT  302

Query  1032  LHYTGVQttlattlTRIPSQN-ATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             L Y G  T+  TT   +P    ATP+A  F+DSLRSLNS+ +PAKVP  +DHSL FT+ L
Sbjct  303   LQYRGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAKVPLKIDHSLFFTISL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             G+NPC SC      R+VA++NNVTFVMP+ +LL AHFF   GVFT DFPGNP + F+YTG
Sbjct  363   GLNPCESC--YREFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFTDDFPGNPAYTFDYTG  420

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
               PP NL+T  GT+LYRL YN+ VQL++QDTG+++PENHP+HLHGFNFF VGRG GNF+P
Sbjct  421   -IPPENLRTMEGTRLYRLAYNSNVQLIMQDTGLLSPENHPMHLHGFNFFVVGRGRGNFDP  479

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
             K DP KFNLVDPVERNTI  P+GGWVAIRF A+NPG+WF+HCHLE+HTTWGLKMAF+VDN
Sbjct  480   KEDPNKFNLVDPVERNTINAPSGGWVAIRFTANNPGIWFLHCHLEVHTTWGLKMAFVVDN  539

Query  315   GKGPNES  295
             G GP ES
Sbjct  540   GNGPEES  546



>ref|XP_011039810.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=556

 Score =   424 bits (1090),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 239/306 (78%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KP  TDTI I PGQTTN ++TAD+  G+Y++A SPFMD  +AVDN T  A 
Sbjct  242   VVEVDAAYTKPLSTDTIFIGPGQTTNALLTADKRVGKYLMAVSPFMDTVVAVDNVTAIAF  301

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G        LT  P+ NATPV + F+D+LRSLNSK +PA VP TVDHSL FT+G+G
Sbjct  302   LRYKGTIAFSPPVLTTTPAINATPVTSTFMDNLRSLNSKKYPANVPLTVDHSLYFTIGVG  361

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PC +C   NGS+ V ++NN++F+MPTTALLQAH++ I GVFT DFP  PP +FNYTG+
Sbjct  362   IDPCATC--VNGSKAVGAINNISFIMPTTALLQAHYYSISGVFTDDFPAMPPNSFNYTGN  419

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 NLQT+ GT++YRL +N+TVQLVLQ T I+APE+HP HLHGFNFF VG+G GNF+  
Sbjct  420   NTALNLQTNNGTRIYRLAFNSTVQLVLQGTTIIAPESHPFHLHGFNFFVVGKGFGNFDAD  479

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNL DPVERNTI VP  GW AIRFRADNPGVWF+HCHLE+HTTWGLKM F+VDNG
Sbjct  480   NDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVDNG  539

Query  312   KGPNES  295
             +GP+ES
Sbjct  540   EGPDES  545



>ref|XP_002866298.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42557.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   423 bits (1087),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 240/312 (77%), Gaps = 8/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YMVAA+ F DA I  DN T TA
Sbjct  203   VVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATTFTDAQIPYDNVTATA  262

Query  1035  TLHYTG----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLF  868
             TLHY G    V  +  T L  +P QNAT VA  F  SLRSLNS+ +PA+VP TVDHSL F
Sbjct  263   TLHYIGHTATVSASKKTVLASLPPQNATWVATKFTRSLRSLNSREYPARVPTTVDHSLFF  322

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
             TVGLG NPC SC   NG R+VA +NNVTF MP TALLQAHFF I GVFT DFP NP   +
Sbjct  323   TVGLGANPCQSCN--NGVRLVAGINNVTFTMPETALLQAHFFNISGVFTDDFPANPSNPY  380

Query  687   NYTGSTP-PANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             +YT       N  T  GTKLYRLPYNATVQ+VLQ+T ++  +NHP HLHGFNFF VGRG+
Sbjct  381   DYTAPVKIGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGM  440

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFNP+ DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMA
Sbjct  441   GNFNPEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMA  500

Query  330   FLVDNGKGPNES  295
             F+VDNG GP+++
Sbjct  501   FVVDNGHGPDQA  512



>gb|KHG28836.1| Laccase-22 [Gossypium arboreum]
Length=574

 Score =   424 bits (1089),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 203/306 (66%), Positives = 237/306 (77%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KP +TDT+ + PGQTT  ++ ADQ  G+Y++A SPFMD  +AVDN TG   
Sbjct  261   VVEVDACYTKPLETDTLFLGPGQTTTALLKADQGIGKYLIAISPFMDTVVAVDNLTGMGY  320

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y        TT   IPS NATP+ + F DSLRSLNSK + A VP T+DHSL FT+G+G
Sbjct  321   LRYNHTLAFTPTTFVPIPSVNATPLTSVFSDSLRSLNSKQYLANVPLTIDHSLFFTIGVG  380

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   NGSR VA++NNV+FVMPTTA+LQAH++GI GVFT DFP  P   FNYTG 
Sbjct  381   INPCATC--FNGSRAVAAINNVSFVMPTTAILQAHYYGINGVFTDDFPAKPAIPFNYTG-  437

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             TPP+ +QT  GTK+YRL YN+TVQLV+Q   IVAPE+HP HLHG NFF VGRG+GNF+P 
Sbjct  438   TPPSGIQTMNGTKVYRLAYNSTVQLVIQGNTIVAPESHPTHLHGSNFFVVGRGVGNFDPD  497

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDPVERNT+ VP  GW AIRFRADNPG+WF HCHLE+HTTWGLKMAFLV+NG
Sbjct  498   KDPLKFNLVDPVERNTVSVPTAGWTAIRFRADNPGIWFFHCHLEVHTTWGLKMAFLVENG  557

Query  312   KGPNES  295
             KGPNES
Sbjct  558   KGPNES  563



>ref|XP_003616564.1| Laccase [Medicago truncatula]
Length=675

 Score =   426 bits (1095),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 247/306 (81%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE DA+Y+KPF+ DTI ++PGQTTNV++TA+Q  G+Y++A +PFMDAPI  DN +  AT
Sbjct  361   VVEADASYLKPFEIDTIFLSPGQTTNVLLTANQPIGKYLIAITPFMDAPIGFDNLSSIAT  420

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+     T LT IP  NATP+   F DSLRSLNSKT+P +V  T+DHSLLF + +G
Sbjct  421   LRYKGIPPYTKTILTNIPPLNATPITKTFTDSLRSLNSKTYPTRVSLTIDHSLLFAITVG  480

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   N  ++V+++NN+TF+MPT +LLQA+++ IKGVFT DFP  PP  F+YTG+
Sbjct  481   LNPCDTCITDN--KLVSAINNITFLMPTVSLLQANYYNIKGVFTDDFPSKPPMVFDYTGT  538

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
               PANL T  GTK+YRL +N++VQ+VLQ T ++APENHP HLHGFNFF VG+G+GNF+P+
Sbjct  539   DQPANLHTDNGTKVYRLNFNSSVQIVLQGTAMIAPENHPFHLHGFNFFVVGQGLGNFDPE  598

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP +FNLVDP+ERNT+ VP  GW+AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNG
Sbjct  599   KDPLRFNLVDPIERNTLSVPNNGWIAIRFRADNPGVWFLHCHLEVHTTWGLKMAFIVDNG  658

Query  312   KGPNES  295
             +GP+ES
Sbjct  659   RGPSES  664



>ref|XP_010924287.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=559

 Score =   421 bits (1082),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 242/306 (79%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             +VE+DA Y KPF T+ IVIAPGQTT+V++ AD+  G+Y +AA PFMDAPIAVDN+T TA 
Sbjct  245   MVEIDAVYCKPFTTNAIVIAPGQTTSVLVKADKNPGRYFMAARPFMDAPIAVDNRTATAI  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+ TT+   L ++P+ N T   N+F+D LRSLNS  FPA VP +VD  L +T  LG
Sbjct  305   LQYKGIPTTIVPILPQLPAPNDTEFVNDFLDKLRSLNSPQFPANVPLSVDRHLFYTASLG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             ++PCP+C   NG+R+ AS+NN+TFVMPT  LLQAH+F IKGVF  DFP  P   FNYTG+
Sbjct  365   VDPCPTC--LNGTRLTASLNNITFVMPTIGLLQAHYFNIKGVFRLDFPDKPATTFNYTGA  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L R+PYN+TV+LVLQDT ++APE+HP HLHG+NFF VGRGIGNF+PK
Sbjct  423   PLTANLGTSLGTRLSRIPYNSTVELVLQDTNLLAPESHPFHLHGYNFFVVGRGIGNFDPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP K+NLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+V+NG
Sbjct  483   KDPAKYNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTTWGLKMAFVVENG  542

Query  312   KGPNES  295
              G  +S
Sbjct  543   NGTEQS  548



>ref|XP_008811561.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=541

 Score =   420 bits (1079),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 239/306 (78%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  IVIAPGQTTNV++ AD+  G+Y +AA PFMDAPIAVDN+T TA 
Sbjct  227   VVEIDAVYCKPFTTSAIVIAPGQTTNVLVKADKTPGRYFMAARPFMDAPIAVDNRTATAI  286

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y GV TT+   L R+P+ N T   N+F+D L+SLNS  FPAKVP  +D  L +T  LG
Sbjct  287   LQYKGVPTTVIPMLPRLPAPNDTIFVNDFLDKLKSLNSPQFPAKVPLNIDRHLFYTASLG  346

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+ CP+C   NG+R+ AS+NN+TFVMP   LLQAH+F IKGVF  DFP  P  AFNYTG+
Sbjct  347   IDRCPTC--LNGTRLTASLNNITFVMPKIGLLQAHYFNIKGVFRPDFPDKPAAAFNYTGA  404

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L R+PYN+TV+LVLQDT ++A E+HP HLHG NFF VGRGIGNF+P+
Sbjct  405   PLTANLGTSLGTRLSRIPYNSTVELVLQDTNLLAAESHPFHLHGSNFFVVGRGIGNFDPE  464

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              +P KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+V+NG
Sbjct  465   KEPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTTWGLKMAFVVENG  524

Query  312   KGPNES  295
              GP ES
Sbjct  525   NGPEES  530



>ref|XP_011080855.1| PREDICTED: laccase-4 [Sesamum indicum]
Length=554

 Score =   420 bits (1080),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 244/306 (80%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA YVKPF TDT++IAPGQTTN ++TAD   G+Y V ASPFMD+PI +DN+T TAT
Sbjct  241   VVEIDAAYVKPFDTDTLLIAPGQTTNALLTADLPIGRYQVVASPFMDSPIDIDNRTATAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   +    LT  PS+NAT  A  F  SLRSLNS  +P +VP+ VDH LLF +GLG
Sbjct  301   LHYTGTLPSTPAVLTDPPSRNATATATKFAHSLRSLNSAEYPCRVPREVDHHLLFAIGLG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +N C +C  ANG RVVA +NNVTF MP+ +LL AHFF I GVFT DFPG+PP  ++YT  
Sbjct  361   LNRCSTC--ANGYRVVADINNVTFAMPSVSLLNAHFFNIPGVFTDDFPGDPPTPYDYTAR  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                 N+ T+TGT+LYR+ YNA+VQ+VLQ TG++ PENHPIHLHGFNFFAVG+G+GNF+ +
Sbjct  419   RV-VNMGTTTGTRLYRVRYNASVQVVLQGTGMIFPENHPIHLHGFNFFAVGKGLGNFDSE  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D + FNL DPVERNTI VP+GGWVAIRF ADNPGVWF+HCHLE+HT+WGLKMAF+V+NG
Sbjct  478   KDTRSFNLDDPVERNTIVVPSGGWVAIRFIADNPGVWFLHCHLEVHTSWGLKMAFIVENG  537

Query  312   KGPNES  295
             KGPN+S
Sbjct  538   KGPNQS  543



>ref|XP_006350822.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=559

 Score =   420 bits (1079),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 241/306 (79%), Gaps = 4/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA YVKPF+T+TI+ APGQTTNVI++     G+Y +  SP+MD+PI V+N+  TAT
Sbjct  247   VVEVDAAYVKPFETETILTAPGQTTNVILSTTYKNGKYSMVTSPYMDSPILVNNKAATAT  306

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G   +  T     P +NAT +A NF+DSL+SLNSK +PAKVP  ++HSL F + LG
Sbjct  307   LQYIGTNNSSTTFTVP-PPRNATFIAFNFMDSLKSLNSKKYPAKVPIKINHSLFFIISLG  365

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C    G R+VA++NNVTFVMP+ +LL  HF    GVFT DFPGNP  AF+YTG 
Sbjct  366   LNPCATC--YRGFRIVAAINNVTFVMPSVSLLSTHFLNKSGVFTDDFPGNPQNAFDYTG-  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP NL+T  GTKLYRL YN+ VQ++LQDTG+++PENHP+HLHGFNFF VGRG GNFNPK
Sbjct  423   VPPENLRTMEGTKLYRLEYNSNVQIILQDTGLLSPENHPMHLHGFNFFVVGRGKGNFNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              D KKFNLVDPVERNTI  P+GGWVAIRFRA+NPGVWF HCHLE+HTTWGLKMAF+V+NG
Sbjct  483   EDSKKFNLVDPVERNTINAPSGGWVAIRFRANNPGVWFFHCHLEVHTTWGLKMAFVVNNG  542

Query  312   KGPNES  295
              GPNES
Sbjct  543   NGPNES  548



>ref|NP_200699.1| laccase 16 [Arabidopsis thaliana]
 gb|AED97116.1| laccase 16 [Arabidopsis thaliana]
Length=523

 Score =   418 bits (1075),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 239/312 (77%), Gaps = 8/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YMVAA+ F DA I  DN T TA
Sbjct  203   VVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATA  262

Query  1035  TLHYTG----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLF  868
             TLHY G    V T+  T L  +P QNAT VA  F  SLRSLNS  +PA+VP TV+HSL F
Sbjct  263   TLHYIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSLRSLNSLEYPARVPTTVEHSLFF  322

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
             TVGLG NPC SC   NG R+VA +NNVTF MP TALLQAHFF I GVFT DFP  P   +
Sbjct  323   TVGLGANPCQSCN--NGVRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPSNPY  380

Query  687   NYTGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             +YT       N  T  GTKLYRLPYNATVQ+VLQ+T ++  +NHP HLHGFNFF VGRG+
Sbjct  381   DYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGL  440

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFNP+ DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMA
Sbjct  441   GNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMA  500

Query  330   FLVDNGKGPNES  295
             F+VDNG GP++S
Sbjct  501   FVVDNGHGPDQS  512



>ref|XP_010454388.1| PREDICTED: laccase-16 [Camelina sativa]
Length=540

 Score =   419 bits (1076),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 240/312 (77%), Gaps = 8/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YM+AA+ F DA I  DN T TA
Sbjct  220   VVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMIAATTFTDAHIPYDNVTATA  279

Query  1035  TLHYTG----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLF  868
             TLHY G    V T   T L  +P QNAT VA  F  SLRSLNS+ +PA+VP TVD SL F
Sbjct  280   TLHYIGPTATVPTFKKTILASLPPQNATWVAAKFTKSLRSLNSREYPARVPTTVDRSLFF  339

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
             TVGLG NPCPSC  +NG R+VA +NNVTF MP TALLQAHFF I GVFT DFP  P   +
Sbjct  340   TVGLGANPCPSC--SNGIRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPSNPY  397

Query  687   NYTGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             +YT       N  T  GT+LYRLPYNATVQ+VLQ+T ++  +NHP HLHGFNFF VGRG+
Sbjct  398   DYTAPVKLGVNAATMKGTRLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGL  457

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFNP+ DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMA
Sbjct  458   GNFNPEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMA  517

Query  330   FLVDNGKGPNES  295
             F+VDNG GP++S
Sbjct  518   FVVDNGHGPDQS  529



>gb|ABK28766.1| unknown [Arabidopsis thaliana]
Length=531

 Score =   418 bits (1075),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 239/312 (77%), Gaps = 8/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YMVAA+ F DA I  DN T TA
Sbjct  210   VVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATA  269

Query  1035  TLHYTG----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLF  868
             TLHY G    V T+  T L  +P QNAT VA  F  SLRSLNS  +PA+VP TV+HSL F
Sbjct  270   TLHYIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSLRSLNSLEYPARVPTTVEHSLFF  329

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
             TVGLG NPC SC   NG R+VA +NNVTF MP TALLQAHFF I GVFT DFP  P   +
Sbjct  330   TVGLGANPCQSCN--NGVRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPSNPY  387

Query  687   NYTGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             +YT       N  T  GTKLYRLPYNATVQ+VLQ+T ++  +NHP HLHGFNFF VGRG+
Sbjct  388   DYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGL  447

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFNP+ DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMA
Sbjct  448   GNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMA  507

Query  330   FLVDNGKGPNES  295
             F+VDNG GP++S
Sbjct  508   FVVDNGHGPDQS  519



>gb|ABE66261.1| laccase/diphenol oxidase [Arabidopsis thaliana]
Length=530

 Score =   418 bits (1074),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 239/312 (77%), Gaps = 8/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YMVAA+ F DA I  DN T TA
Sbjct  210   VVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATA  269

Query  1035  TLHYTG----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLF  868
             TLHY G    V T+  T L  +P QNAT VA  F  SLRSLNS  +PA+VP TV+HSL F
Sbjct  270   TLHYIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSLRSLNSLEYPARVPTTVEHSLFF  329

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
             TVGLG NPC SC   NG R+VA +NNVTF MP TALLQAHFF I GVFT DFP  P   +
Sbjct  330   TVGLGANPCQSCN--NGVRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPSNPY  387

Query  687   NYTGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             +YT       N  T  GTKLYRLPYNATVQ+VLQ+T ++  +NHP HLHGFNFF VGRG+
Sbjct  388   DYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGL  447

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFNP+ DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMA
Sbjct  448   GNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMA  507

Query  330   FLVDNGKGPNES  295
             F+VDNG GP++S
Sbjct  508   FVVDNGHGPDQS  519



>ref|XP_010543748.1| PREDICTED: laccase-22-like [Tarenaya hassleriana]
Length=555

 Score =   418 bits (1075),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 236/306 (77%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             V+EVDA+Y KPF  DT+ + PGQTTN ++TADQ++G+Y++  SPFMD  + VDN TGTA 
Sbjct  241   VIEVDASYTKPFSADTLFLGPGQTTNALLTADQSSGKYLITISPFMDTIVTVDNVTGTAF  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHY    ++ +    +IP  NAT VA  F D+LRSLNS+ +PA VP  VDHSL FT+G+G
Sbjct  301   LHYNDTTSSPSLVSDKIPPVNATSVALGFSDNLRSLNSRDYPANVPLRVDHSLFFTIGVG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPC +C   N ++ V  +NNV+FVMPT  +LQAH++ I GVFT DFPG P   FNYT +
Sbjct  361   INPCETC--INNTKAVGDINNVSFVMPTIGILQAHYYNISGVFTDDFPGKPLIPFNYTAN  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                AN++T  GTK YRL YN+TVQLV+Q T ++APE+HP HLHGFNFF +G+G+GNF+P 
Sbjct  419   NSTANMRTMNGTKAYRLAYNSTVQLVIQGTSVIAPESHPTHLHGFNFFVIGKGVGNFDPL  478

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+ VP  GW AIRFRADNPGVWF HCHLE+HT+WGLKM FLV+NG
Sbjct  479   NDPKKFNLVDPVERNTVSVPTAGWTAIRFRADNPGVWFFHCHLEVHTSWGLKMVFLVENG  538

Query  312   KGPNES  295
             KGPNE+
Sbjct  539   KGPNET  544



>sp|Q1PDH6.2|LAC16_ARATH RecName: Full=Laccase-16; AltName: Full=Benzenediol:oxygen oxidoreductase 
16; AltName: Full=Diphenol oxidase 16; AltName: 
Full=Urishiol oxidase 16; Flags: Precursor [Arabidopsis thaliana]
Length=566

 Score =   418 bits (1075),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 239/312 (77%), Gaps = 8/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YMVAA+ F DA I  DN T TA
Sbjct  246   VVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATA  305

Query  1035  TLHYTG----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLF  868
             TLHY G    V T+  T L  +P QNAT VA  F  SLRSLNS  +PA+VP TV+HSL F
Sbjct  306   TLHYIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSLRSLNSLEYPARVPTTVEHSLFF  365

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
             TVGLG NPC SC   NG R+VA +NNVTF MP TALLQAHFF I GVFT DFP  P   +
Sbjct  366   TVGLGANPCQSCN--NGVRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPSNPY  423

Query  687   NYTGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             +YT       N  T  GTKLYRLPYNATVQ+VLQ+T ++  +NHP HLHGFNFF VGRG+
Sbjct  424   DYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGL  483

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFNP+ DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMA
Sbjct  484   GNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMA  543

Query  330   FLVDNGKGPNES  295
             F+VDNG GP++S
Sbjct  544   FVVDNGHGPDQS  555



>gb|KDP44830.1| hypothetical protein JCGZ_01330 [Jatropha curcas]
Length=475

 Score =   415 bits (1066),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 235/306 (77%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             V+EVDA Y KPF TDT+ + PGQTT V++ ADQ+ G++++A SPFMD  +AVDN T  A 
Sbjct  162   VLEVDACYTKPFNTDTLFMGPGQTTTVLLNADQSTGKFLIAVSPFMDTIVAVDNLTAIAF  221

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y          LT  P  NAT VA NFVD+L+SLNSK + A VP TVDHSL F +G+G
Sbjct  222   LRYQDTVAFSPPVLTATPPINATLVARNFVDNLKSLNSKNYTANVPLTVDHSLYFAIGVG  281

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             IN C +C   NGSR V  +NNVTF+MPTTALLQAH++ I+GVFT DFP  PP  FNYTG+
Sbjct  282   INSCSTC--LNGSRAVGDINNVTFIMPTTALLQAHYYNIRGVFTDDFPATPPNPFNYTGN  339

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                  L T  GT+LYRL +N+TVQ+VLQ TGI+APE+HP HLHG NFF VGRG+GNF+P 
Sbjct  340   YT-GGLATKNGTRLYRLSFNSTVQVVLQGTGIIAPESHPFHLHGSNFFVVGRGVGNFDPV  398

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT  VP GGW AIRFRADNPGVWFMHCHLE+HT+WGLKMAF+VDNG
Sbjct  399   NDPKKFNLVDPVERNTDSVPTGGWAAIRFRADNPGVWFMHCHLEVHTSWGLKMAFVVDNG  458

Query  312   KGPNES  295
             KGPNES
Sbjct  459   KGPNES  464



>ref|XP_010483503.1| PREDICTED: laccase-16-like isoform X3 [Camelina sativa]
Length=567

 Score =   417 bits (1072),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 239/312 (77%), Gaps = 9/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YMVAA+ F DA I  DN T TA
Sbjct  248   VVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATA  307

Query  1035  TLHYTG-----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLL  871
             TLHY G     V T   T L  +P QNAT VA  F  SLRSLNS+ +PA+VP TVD SL 
Sbjct  308   TLHYIGPTATSVPTFKKTILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLF  367

Query  870   FTVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFA  691
             FTVGLG NPCPSC  + G R+VA +NNVTF MP TALLQAHFF I GVFT DFP  P   
Sbjct  368   FTVGLGANPCPSC--SKGIRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPLNP  425

Query  690   FNYTGSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             ++YT      N  T  GTKLYRLPYNATVQ+VLQ+T ++  +NHP HLHGFNFF VGRG+
Sbjct  426   YDYTAPLG-VNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGL  484

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFNP+ DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMA
Sbjct  485   GNFNPEKDPKIFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMA  544

Query  330   FLVDNGKGPNES  295
             F+VDNG GP++S
Sbjct  545   FVVDNGHGPDQS  556



>ref|XP_010483501.1| PREDICTED: laccase-16-like isoform X1 [Camelina sativa]
 ref|XP_010483502.1| PREDICTED: laccase-16-like isoform X2 [Camelina sativa]
Length=569

 Score =   417 bits (1071),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 212/313 (68%), Positives = 239/313 (76%), Gaps = 9/313 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YMVAA+ F DA I  DN T TA
Sbjct  248   VVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATA  307

Query  1035  TLHYTG-----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLL  871
             TLHY G     V T   T L  +P QNAT VA  F  SLRSLNS+ +PA+VP TVD SL 
Sbjct  308   TLHYIGPTATSVPTFKKTILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLF  367

Query  870   FTVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFA  691
             FTVGLG NPCPSC  + G R+VA +NNVTF MP TALLQAHFF I GVFT DFP  P   
Sbjct  368   FTVGLGANPCPSC--SKGIRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPLNP  425

Query  690   FNYTGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRG  514
             ++YT       N  T  GTKLYRLPYNATVQ+VLQ+T ++  +NHP HLHGFNFF VGRG
Sbjct  426   YDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRG  485

Query  513   IGNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKM  334
             +GNFNP+ DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKM
Sbjct  486   LGNFNPEKDPKIFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKM  545

Query  333   AFLVDNGKGPNES  295
             AF+VDNG GP++S
Sbjct  546   AFVVDNGHGPDQS  558



>ref|XP_010443638.1| PREDICTED: laccase-16-like [Camelina sativa]
Length=568

 Score =   416 bits (1070),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 239/312 (77%), Gaps = 8/312 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQ-YMVAASPFMDAPIAVDNQTGTA  1036
             VVEVDA Y KP+KTDT+ IAPGQTTNV++TA+  AG  YM+AA+ F DA I  DN T TA
Sbjct  248   VVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMIAATTFTDAHIPYDNVTATA  307

Query  1035  TLHYTG----VQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLF  868
             TLHY G    V T   T L  +P QNAT VA  F  SLRSLNS+ +PA+VP TVD SL F
Sbjct  308   TLHYIGPTATVPTFKKTILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFF  367

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
             TVGLG NPCPSC  +NG R+VA +NNVTF MP TALLQAHFF I GVFT DFP  P   +
Sbjct  368   TVGLGSNPCPSC--SNGIRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPLNPY  425

Query  687   NYTGSTPPA-NLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGI  511
             +YT       N  T  GTKLYRLPYNATVQ+VLQ+T ++  +NHP HLHGFNFF VGRG+
Sbjct  426   DYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPFHLHGFNFFEVGRGL  485

Query  510   GNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMA  331
             GNFN + DPK FNLVDPVERNT+GVPAGGW AIRF ADNPGVWFMHCHLE+HTTWGLKMA
Sbjct  486   GNFNSEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMA  545

Query  330   FLVDNGKGPNES  295
             F+VDNG GP++S
Sbjct  546   FVVDNGHGPDQS  557



>ref|XP_002530417.1| laccase, putative [Ricinus communis]
 gb|EEF31987.1| laccase, putative [Ricinus communis]
Length=554

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 236/306 (77%), Gaps = 3/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF TD + + PGQTT+ ++TADQ  G+Y++A SPFMD  +AVDN TG A 
Sbjct  241   VVEVDACYTKPFNTDIVFVGPGQTTSFLLTADQPTGKYLIAVSPFMDTIVAVDNATGIAF  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y          LT  P+ NAT   + F+D LRSLNSK +P  VP TVDHSL FT+G+G
Sbjct  301   LRYKDTVKFSPPVLTTTPAINATSETSIFLDKLRSLNSKRYPCNVPLTVDHSLYFTIGVG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             IN CP+C   NGSR V  +NNV+FVMPT  LL+AH++ I GVFT DFP NPP  FNYTG+
Sbjct  361   INSCPTC--VNGSRAVGDINNVSFVMPTMDLLEAHYYNISGVFTDDFPANPPTPFNYTGN  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                    TS GT+LYRL +N+TVQ+VLQ TGI+APE+HP HLHGFNFFA+GRG+GN++P 
Sbjct  419   YT-GGFATSNGTRLYRLAFNSTVQVVLQGTGILAPESHPFHLHGFNFFAIGRGVGNYDPV  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT  VP GGWVAIRFRADNPGVWF+HCHLE+HT+WGLKMAF+VDNG
Sbjct  478   NDPKKFNLVDPVERNTNSVPTGGWVAIRFRADNPGVWFLHCHLEVHTSWGLKMAFVVDNG  537

Query  312   KGPNES  295
             +GPN+S
Sbjct  538   EGPNDS  543



>ref|XP_004241179.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=560

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 242/307 (79%), Gaps = 5/307 (2%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             V EVDA YVKPF+T+TI+ APGQTTNVI++ +   G+Y++  SP+MD+PI V+N+  TAT
Sbjct  247   VEEVDAAYVKPFETETILTAPGQTTNVILSTNHKNGKYLMVTSPYMDSPILVNNKAATAT  306

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L YTG   +  T     P +NAT +A NF+DSL+SLNSK +PAKVP  ++HSL F + LG
Sbjct  307   LQYTGTNNSSTTFTVP-PPRNATSIAFNFMDSLQSLNSKRYPAKVPIKINHSLFFIISLG  365

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C    G R+VA++NNVTFVMP+ +LL  HF    GVFT DFPGNP   F+YTG 
Sbjct  366   LNPCATC--YRGFRIVAAINNVTFVMPSVSLLGTHFLNKSGVFTDDFPGNPQNVFDYTG-  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              PP NL+T  GTKLYRL YN+ VQ++LQDTG+++PENHP+HLHGFNFF VGRG GNFNPK
Sbjct  423   VPPENLRTIEGTKLYRLEYNSNVQIILQDTGLLSPENHPMHLHGFNFFVVGRGKGNFNPK  482

Query  492   TDPKKFNLVDPVERNTIGVPA-GGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
              D KKFNLVDPVERNTI  P+ GGWVAIRFRA+NPGVWF HCHLE+HTTWGLKMAF+V+N
Sbjct  483   EDFKKFNLVDPVERNTINAPSGGGWVAIRFRANNPGVWFFHCHLEVHTTWGLKMAFVVNN  542

Query  315   GKGPNES  295
             G GPNES
Sbjct  543   GNGPNES  549



>ref|XP_008797558.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=859

 Score =   421 bits (1083),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 239/306 (78%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  IVIAPGQTTNV++ AD+  G+Y +AA PFMDAPIAVDN+T TA 
Sbjct  545   VVEIDAVYCKPFTTSAIVIAPGQTTNVLVKADKTPGRYFMAARPFMDAPIAVDNRTATAI  604

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y GV TT+   L R+P+ N T   N+F+D L+SLNS  FPAKVP  +D  L +T  LG
Sbjct  605   LQYKGVPTTVIPMLPRLPAPNDTIFVNDFLDKLKSLNSPQFPAKVPLNIDRHLFYTASLG  664

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+ CP+C   NG+R+ AS+NN+TFVMP   LLQAH+F IKGVF  DFP  P  AFNYTG+
Sbjct  665   IDRCPTC--LNGTRLTASLNNITFVMPKIGLLQAHYFNIKGVFRPDFPDKPAAAFNYTGA  722

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L R+PYN+TV+LVLQDT ++A E+HP HLHG NFF VGRGIGNF+P+
Sbjct  723   PLTANLGTSLGTRLSRIPYNSTVELVLQDTNLLAAESHPFHLHGSNFFVVGRGIGNFDPE  782

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              +P KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+V+NG
Sbjct  783   KEPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTTWGLKMAFVVENG  842

Query  312   KGPNES  295
              GP ES
Sbjct  843   NGPEES  848



>ref|XP_010926015.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=847

 Score =   417 bits (1072),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 239/306 (78%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T+ I+IAPGQTTNV++ AD+  G+Y +AA PFMDAPIAVDN+T TA 
Sbjct  533   VVEIDAVYCKPFTTNGILIAPGQTTNVLVKADKIPGRYFMAARPFMDAPIAVDNKTATAI  592

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y  V TT+   L ++P+ N T   ++F+  LRSLNS  FPAKVP  +D  L +TV LG
Sbjct  593   LQYKCVPTTVIPILPQLPAPNDTKFVDDFLGKLRSLNSPQFPAKVPLNIDRHLFYTVSLG  652

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             I+PCP+C   NG+R+ AS+NN+TFVMP   LLQAH+F IKGVF  DFP  P   FNYTG+
Sbjct  653   IDPCPTC--LNGTRLTASLNNITFVMPQIGLLQAHYFNIKGVFGLDFPDKPLNTFNYTGA  710

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L R+PYN+TV+LVLQDT ++A E+HP HLHG+NFF VGRGIGNF+P 
Sbjct  711   PLTANLGTSLGTRLSRIPYNSTVELVLQDTNLLAAESHPFHLHGYNFFVVGRGIGNFDPT  770

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HTTWGLKMAF+V+NG
Sbjct  771   KDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVENG  830

Query  312   KGPNES  295
              GP ES
Sbjct  831   NGPEES  836



>gb|KHN24301.1| Laccase-4 [Glycine soja]
Length=522

 Score =   406 bits (1044),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 207/306 (68%), Positives = 230/306 (75%), Gaps = 37/306 (12%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA+YVKPFKTDT+ IAP                                     AT
Sbjct  243   VVEVDASYVKPFKTDTLSIAP-------------------------------------AT  265

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             LHYTG   T  T LT  P +NAT VANNF +SL+SLNSK +PAKVPQ VDHSLL TVGLG
Sbjct  266   LHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLLTVGLG  325

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSC   NGSRVVA+VNNVTFVMPTTALLQAH+F IKGVFTTDFPGNP   +NYT +
Sbjct  326   INPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVFTTDFPGNPSHVYNYTAT  385

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
              P A  QT+ GTK YRL +N+TVQ+VLQDTG++APE+HP+HLHGFNFF VG G+GN++PK
Sbjct  386   PPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPESHPVHLHGFNFFVVGSGVGNYDPK  445

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
             TD   FNL DPVERNTIGVP GGWVA RFRADNPGVWF+HCH E+HTTWGLKMAFLVDNG
Sbjct  446   TDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGVWFLHCHFEVHTTWGLKMAFLVDNG  505

Query  312   KGPNES  295
             KGPNES
Sbjct  506   KGPNES  511



>emb|CDP09155.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   413 bits (1062),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 238/306 (78%), Gaps = 15/306 (5%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDATYVKPFKT TI I PGQTTN I+ AD   G Y++AASPFM  P+ +D    TAT
Sbjct  443   VVEVDATYVKPFKTGTIFITPGQTTNAILEADLGTGNYLMAASPFMAEPVPIDYTAATAT  502

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             +HY+G Q++ ATT T +P +NATP+A  FVDSL+SLNS+ +PA+VP TVDHSLLFT+GLG
Sbjct  503   VHYSGTQSSAATTFTDLPPRNATPLATAFVDSLKSLNSQRYPARVPLTVDHSLLFTMGLG  562

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              NPC +C    GSR+ A  NN++F+ P  +LL AHFF I GVF  DFPGNPP        
Sbjct  563   FNPCATC--IRGSRIAAYFNNISFIRPAISLLNAHFFNISGVFADDFPGNPP--------  612

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                  ++T  GT+LYRL +N+TVQLVLQDT ++ PENHPIHLHG NFF VGRG+GNF+P+
Sbjct  613   -----IRTMEGTRLYRLAFNSTVQLVLQDTAMITPENHPIHLHGMNFFVVGRGLGNFDPE  667

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDPVERNT+GVP+GGWVA+RFRADNPGVWFMHCHLE HT  GL+MAF+VDNG
Sbjct  668   KDPSNFNLVDPVERNTVGVPSGGWVAVRFRADNPGVWFMHCHLESHTLVGLEMAFVVDNG  727

Query  312   KGPNES  295
             +GPN+S
Sbjct  728   QGPNQS  733


 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  579  IVAPENHPIHLHGFNFFAVGRGIGNFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRA  400
            +++PE+HP HLHGFNFF VG GIGNFNP  DP  FNLVDPVERNT+GVP GGWVAIRFRA
Sbjct  1    MISPESHPFHLHGFNFFVVGSGIGNFNPNKDPPNFNLVDPVERNTVGVPTGGWVAIRFRA  60

Query  399  DNPGVWFMHCHLEIHTTWGLKMAF  328
            DNPGVWF+HCHLE+HTTWGLKMAF
Sbjct  61   DNPGVWFLHCHLEVHTTWGLKMAF  84



>ref|XP_009392410.1| PREDICTED: laccase-11 [Musa acuminata subsp. malaccensis]
Length=559

 Score =   407 bits (1045),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 236/306 (77%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DATY KPF T  +VIAPGQTTNV++ ADQA G+Y +A   FMD PI VDN+T TA 
Sbjct  245   VVEIDATYCKPFNTSALVIAPGQTTNVLVRADQAPGRYFMATRSFMDIPIPVDNKTATAI  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y GV TT+   + ++P+ N T    +F D LRSLNS  +PA VP  VD  L +T+GLG
Sbjct  305   LQYRGVPTTVVPVMPQLPAPNDTSFVASFSDQLRSLNSPRYPASVPLDVDRRLFYTIGLG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C   NG+R+ AS+NN+TFV+P  ALLQAH++ +KGVF  DFP  PP +FNYTG+
Sbjct  365   VNPCPTC--LNGTRLTASLNNITFVLPQVALLQAHYYDMKGVFRLDFPDKPPTSFNYTGT  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L R+ +N+TV+LVLQDT ++  E+HP HLHG+NFF VG GIGNF+P 
Sbjct  423   PLTANLGTSLGTRLSRIAFNSTVELVLQDTNLLMVESHPFHLHGYNFFVVGTGIGNFDPA  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP+ FNL+DP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT+WGLKMAF+V+NG
Sbjct  483   KDPETFNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTSWGLKMAFVVENG  542

Query  312   KGPNES  295
              GP ES
Sbjct  543   DGPEES  548



>ref|XP_006602642.1| PREDICTED: laccase-4-like isoform X2 [Glycine max]
Length=533

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 203/280 (73%), Positives = 232/280 (83%), Gaps = 1/280 (0%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPI-AVDNQTGTA  1036
             VVEVDA+YVKPFKTDT+ IAPGQTTN ++TADQ +G+Y + AS FMD+P+ AVDN T TA
Sbjct  243   VVEVDASYVKPFKTDTLSIAPGQTTNALLTADQNSGKYTIVASTFMDSPVVAVDNLTATA  302

Query  1035  TLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             TLHYTG   T  T LT  P +NAT VANNF +SL+SLNSK +PAKVPQ VDHSLL TVGL
Sbjct  303   TLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLLTVGL  362

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
             GINPCPSC   NGSRVVA+VNNVTFVMPTTALLQAH+F IKGVFTTDFPGNP   +NYT 
Sbjct  363   GINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVFTTDFPGNPSHVYNYTA  422

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
             + P A  QT+ GTK YRL +N+TVQ+VLQDTG++APE+HP+HLHGFNFF VG G+GN++P
Sbjct  423   TPPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPESHPVHLHGFNFFVVGSGVGNYDP  482

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFM  376
             KTD   FNL DPVERNTIGVP GGWVA RFRADNPG + M
Sbjct  483   KTDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGAYNM  522



>gb|KDP41783.1| hypothetical protein JCGZ_26801 [Jatropha curcas]
Length=840

 Score =   414 bits (1064),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 238/306 (78%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I+IAPGQTT+V+I A Q+ G+Y +AA PFMDAPI++DN+T TA 
Sbjct  526   VVEIDAVYTKPFTTQAILIAPGQTTSVLIQATQSPGRYFMAARPFMDAPISIDNKTATAI  585

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  T+   L ++PS N T  A ++   LRSLNSK FPA VP  VD  LLFT GLG
Sbjct  586   LQYKGIPNTILPILPQLPSPNDTAFALDYNSKLRSLNSKQFPANVPLKVDRHLLFTAGLG  645

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             IN CPSC   NG+++ AS+NN+TFVMP   LLQAH+F IKGVF TDFP NPP  FNYTG+
Sbjct  646   INACPSC--LNGTKLTASLNNITFVMPQIGLLQAHYFKIKGVFRTDFPDNPPTPFNYTGA  703

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL T+ GT+L ++ YN+TVQLVLQDT ++  E+HP HLHG+NFF VG GIGNF+PK
Sbjct  704   PLTANLGTTLGTRLSKIAYNSTVQLVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPK  763

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW A+RFRADNPGVWFMHCHLE+HT+WGLK AF+V+NG
Sbjct  764   KDPAKFNLVDPPERNTVGVPTGGWTAVRFRADNPGVWFMHCHLELHTSWGLKTAFVVENG  823

Query  312   KGPNES  295
              GP+ES
Sbjct  824   NGPDES  829



>ref|XP_008800741.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=973

 Score =   417 bits (1073),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 239/306 (78%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+D  Y KPF T+ I IAPGQTTNV++ AD+A G+Y +AA PFMDAPIAVDN+T TA 
Sbjct  659   VVEIDGVYCKPFTTEAIQIAPGQTTNVLVKADKAPGRYFMAARPFMDAPIAVDNKTATAI  718

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+ TT+   L ++P+ N T   ++F++ LRSLNS  FPA VP++VD  L +T  LG
Sbjct  719   LQYKGIPTTIIPILPQLPAPNDTEFVHDFLNKLRSLNSPQFPANVPRSVDRHLFYTASLG  778

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             ++ CP+C   NG+R+ AS+NN+TFVMP   LLQAH+F +KGVF  DFP  P   FNYTG+
Sbjct  779   VDSCPTC--LNGTRLTASLNNITFVMPKIGLLQAHYFNVKGVFRLDFPDKPATTFNYTGA  836

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L R+PYN TV+LVLQDT ++A E+HP HLHG+NFF VGRGIGNF+PK
Sbjct  837   PLTANLGTSLGTRLSRIPYNTTVELVLQDTNLLAAESHPFHLHGYNFFVVGRGIGNFDPK  896

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP ++NLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT+WGLKMAF+V+NG
Sbjct  897   KDPAQYNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTSWGLKMAFVVENG  956

Query  312   KGPNES  295
              GP +S
Sbjct  957   NGPEQS  962



>gb|AAK37830.1|AF132126_1 laccase [Pinus taeda]
Length=577

 Score =   405 bits (1042),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 229/311 (74%), Gaps = 8/311 (3%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF T  IVIAPGQTTNV++ A++ +G Y VAA PFMDAP+ V+N+T TA 
Sbjct  259   VVEVDAVYTKPFDTKAIVIAPGQTTNVLLEANKRSGSYFVAARPFMDAPVTVNNKTATAI  318

Query  1032  LHYTGVQttlat-----tlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLF  868
             LHY    +          + R+P  N T  A +F   LRSLNS  FPAKVPQT+D +L F
Sbjct  319   LHYISRNSESDIPAVNPLMPRLPLLNDTAFATSFTSKLRSLNSVQFPAKVPQTIDRNLFF  378

Query  867   TVGLGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAF  688
              VGL    C +C    G R  AS+NN++FVMP+ +LL AH F I GVFT DFP  PP  F
Sbjct  379   AVGLATESCQTCN--GGLRASASINNISFVMPSISLLDAHIFNISGVFTADFPDKPPTPF  436

Query  687   NYTGSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIG  508
             NYTG TPP NL TS GT+L RLP+N+TVQLVLQDT ++  ENHPIHLHGFNFF VGRG G
Sbjct  437   NYTG-TPPKNLITSKGTRLSRLPFNSTVQLVLQDTSVLTVENHPIHLHGFNFFIVGRGFG  495

Query  507   NFNPKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAF  328
             N++P TDP  FNLVDP ERNT+GVP GGW  IRFRADNPGVWFMHCHLE+HTTWGLKMAF
Sbjct  496   NYDPNTDPASFNLVDPPERNTVGVPTGGWTVIRFRADNPGVWFMHCHLEVHTTWGLKMAF  555

Query  327   LVDNGKGPNES  295
             LV+NG GP++S
Sbjct  556   LVENGDGPDQS  566



>gb|KDP29119.1| hypothetical protein JCGZ_16508 [Jatropha curcas]
Length=349

 Score =   394 bits (1013),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 234/308 (76%), Gaps = 4/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I+IAPGQTTNV++ ADQA  +Y +AA PFMDAPI VDN+T TA 
Sbjct  33    VVEIDAVYTKPFTTQAILIAPGQTTNVLVKADQALNRYFMAARPFMDAPIPVDNKTVTAI  92

Query  1032  LHYTGV-QttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             L Y G+  T L      +P  N T  A ++   LRSLN+  FPA VP TVD  L +T+GL
Sbjct  93    LQYKGIPNTVLPIFPASLPVSNNTKFALDYNSKLRSLNTPQFPALVPLTVDRHLFYTIGL  152

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIK-GVFTTDFPGNPPFAFNYT  679
             G NPCP+C+  NG+++ AS+NN+TFVMP   LLQAH+F I  GVF T+FP  PP  FNYT
Sbjct  153   GQNPCPTCQ--NGTQLTASLNNITFVMPKIGLLQAHYFNISSGVFKTNFPDRPPTPFNYT  210

Query  678   GSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
             G+   ANL TS+GT+L +L +N+T++LVLQDT +++ E+HP HLHGFNFF VG GIGNF+
Sbjct  211   GAPLTANLATSSGTRLSKLAFNSTIELVLQDTNLLSVESHPFHLHGFNFFVVGNGIGNFD  270

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             P  DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+
Sbjct  271   PAKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVE  330

Query  318   NGKGPNES  295
             NGK P++S
Sbjct  331   NGKLPDQS  338



>ref|XP_009378520.1| PREDICTED: laccase-11-like [Pyrus x bretschneideri]
 ref|XP_009378525.1| PREDICTED: laccase-11-like [Pyrus x bretschneideri]
Length=562

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 235/306 (77%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I+IAPGQTTNV++ A QA G+Y +AA PFMDAP++VDN+T TA 
Sbjct  248   VVEIDAVYTKPFTTQAILIAPGQTTNVLVQATQAPGRYFMAARPFMDAPVSVDNKTATAI  307

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  ++   L ++P+ N T  A N+ D LRSLN+  FPA VP  VD  L +T+GLG
Sbjct  308   LQYKGIPNSVQPLLPQLPALNNTAFALNYDDKLRSLNTAQFPANVPLKVDRHLFYTIGLG  367

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+C   NG+++ AS+NN+TFVMP   LLQAHFF  KGVFTTDFP  PP +FN+TG+
Sbjct  368   INPCPTC--LNGTQLTASLNNITFVMPKIGLLQAHFFNTKGVFTTDFPDRPPTSFNFTGA  425

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL T  GT+L ++ +N+TV+LVLQDT ++  E+HP HLHG+NFF VG GIGNF+PK
Sbjct  426   PLTANLGTKQGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGYNFFIVGSGIGNFDPK  485

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT+WGLK AF+V+NG
Sbjct  486   KDPATFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTSWGLKTAFVVENG  545

Query  312   KGPNES  295
             K  + S
Sbjct  546   KDTDHS  551



>gb|KDO50695.1| hypothetical protein CISIN_1g036540mg [Citrus sinensis]
Length=562

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 235/306 (77%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I+IAPGQTTNV++ ADQ+  +Y +AA PFMDAPI VDN+T TA 
Sbjct  248   VVEIDAVYTKPFTTQAILIAPGQTTNVLVKADQSPSRYFMAARPFMDAPIPVDNKTVTAI  307

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  T+  TL  +P+ + T  A N+   LRSLN+  +PA VP  VD  L +T+GLG
Sbjct  308   LQYKGIPNTVLPTLPSLPAPSDTNFALNYSSKLRSLNTPQYPANVPLRVDRHLFYTIGLG  367

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              NPCPSC+  NG+++ AS+NN+TFVMP   LLQAH+F I GVF TDFP  PP  FNYTG+
Sbjct  368   QNPCPSCQ--NGTQLTASLNNITFVMPKIGLLQAHYFNISGVFRTDFPDRPPVPFNYTGA  425

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L ++ +N+T++LVLQDT ++  E+HP HLHG+NFF VG GIGNF+PK
Sbjct  426   PLTANLGTSLGTRLSKVAFNSTIELVLQDTNLLTVESHPFHLHGYNFFVVGSGIGNFDPK  485

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NG
Sbjct  486   KDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENG  545

Query  312   KGPNES  295
             K P++S
Sbjct  546   KSPDQS  551



>ref|XP_008357173.1| PREDICTED: laccase-11-like [Malus domestica]
Length=562

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 236/306 (77%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I+IAPGQTTNV++ A QA G+Y +AA PFMDAP++VDN+T TA 
Sbjct  248   VVEIDAVYTKPFTTQAILIAPGQTTNVLVQATQAPGRYFMAARPFMDAPVSVDNKTATAI  307

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  ++   L ++P+ N T  A N+ D+LRSLN+  FPA VP  VD  L +T+GLG
Sbjct  308   LQYKGIPNSVQPVLPQLPAPNNTAFALNYDDNLRSLNTAQFPAHVPLKVDRHLFYTIGLG  367

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCP+C   NG+++ AS+NN+TFVMP   LLQAHFF  KGVFTTDFP  PP +FN+TG+
Sbjct  368   INPCPTC--LNGTQLTASLNNITFVMPKIGLLQAHFFNTKGVFTTDFPDRPPTSFNFTGA  425

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL T  GT+L ++ +N+TV+LVLQDT ++  E+HP HLHG+NFF VG GIGNF+PK
Sbjct  426   PLTANLGTKQGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGYNFFIVGSGIGNFDPK  485

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP  FNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT+WGLK AF+V+NG
Sbjct  486   KDPATFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTSWGLKTAFVVENG  545

Query  312   KGPNES  295
             K  + S
Sbjct  546   KDTDHS  551



>ref|XP_011088411.1| PREDICTED: laccase-11-like [Sesamum indicum]
Length=559

 Score =   401 bits (1030),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 241/308 (78%), Gaps = 4/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T+ ++IAPGQTTNV++ A+QA G+Y +AA PFMDAPI+VDN+T TA 
Sbjct  243   VVEIDAIYTKPFSTNAVLIAPGQTTNVLLRANQAPGRYFMAARPFMDAPISVDNKTATAI  302

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+Q T+  +L ++P+ N +  A N+   LRSLNS  FPA VP  VD  L +T+GLG
Sbjct  303   LQYKGIQNTVIPSLPQLPALNDSAFALNYNAKLRSLNSPIFPANVPLKVDRHLFYTIGLG  362

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C+  NG+++ AS+NN+TFVMP TALLQAH+F +KGVFTTDFP  PP  FNYTG+
Sbjct  363   VNPCPTCQ--NGTQLTASLNNITFVMPQTALLQAHYFNLKGVFTTDFPDRPPMPFNYTGA  420

Query  672   TPPANLQT--STGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
                ANLQT  S   +L ++ +N+TV+LVLQDT +++ E+HP HLHG+NFF VG GIGNF+
Sbjct  421   PLTANLQTTQSNRPRLSKIAFNSTVELVLQDTNLLSVESHPFHLHGYNFFVVGSGIGNFD  480

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PK DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLK AF+V+
Sbjct  481   PKNDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTGWGLKTAFVVE  540

Query  318   NGKGPNES  295
             +G   + S
Sbjct  541   DGPDADHS  548



>ref|XP_006428774.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
 ref|XP_006481839.1| PREDICTED: laccase-11-like [Citrus sinensis]
 gb|ESR42014.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
Length=562

 Score =   400 bits (1029),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 236/306 (77%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I+IAPGQTTNV++ ADQ+  +Y +AA PFMDAPI VDN+T TA 
Sbjct  248   VVEIDAVYTKPFTTQAILIAPGQTTNVLVKADQSPSRYFMAARPFMDAPIPVDNKTVTAI  307

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  T+  TL  +P+ + T  A N+  +LRSLN+  +PA VP  VD  L +T+GLG
Sbjct  308   LQYKGIPNTVLPTLPSLPAPSDTNFALNYSSNLRSLNTPQYPANVPLRVDRHLFYTIGLG  367

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              NPCPSC+  NG+++ AS+NN+TFVMP   LLQAH+F I GVF TDFP  PP  FNYTG+
Sbjct  368   QNPCPSCQ--NGTQLTASLNNITFVMPKIGLLQAHYFNISGVFRTDFPDRPPVPFNYTGA  425

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L ++ +N+T++LVLQDT ++  E+HP HLHG+NFF VG GIGNF+PK
Sbjct  426   PLTANLGTSLGTRLSKVAFNSTIELVLQDTNLLTVESHPFHLHGYNFFVVGSGIGNFDPK  485

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NG
Sbjct  486   KDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENG  545

Query  312   KGPNES  295
             K P++S
Sbjct  546   KSPDQS  551



>ref|XP_010107530.1| hypothetical protein L484_024383 [Morus notabilis]
 gb|EXC16212.1| hypothetical protein L484_024383 [Morus notabilis]
Length=559

 Score =   399 bits (1025),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 230/306 (75%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I+IAPGQTTNV++ ADQ   +Y +AA PFMDAPI VDN+T TA 
Sbjct  245   VVEIDAVYTKPFTTQVILIAPGQTTNVLVNADQPPNRYFMAARPFMDAPIPVDNKTVTAI  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y GV  T+   L R+P+ N T  A N+   L+SLN+  FPAKVP  +D  L +T+GLG
Sbjct  305   LQYKGVPNTVVPILPRLPAPNDTKFALNYNGQLKSLNTPQFPAKVPLKIDRRLFYTIGLG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              NPCP+C   NG+++ AS+NN+TFVMP   LLQAH+F +  VF  DFP  PP  FNYTG+
Sbjct  365   QNPCPTC--LNGTQLTASLNNITFVMPRVGLLQAHYFNLSAVFAMDFPDRPPVPFNYTGA  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL T  GT+L ++ YN++V+LVLQDT ++  E+HP HLHGFNFF VG GIGNF+P 
Sbjct  423   PLAANLGTKLGTRLSKVAYNSSVELVLQDTNLLTVESHPFHLHGFNFFVVGSGIGNFDPA  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NG
Sbjct  483   KDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENG  542

Query  312   KGPNES  295
             K P+ES
Sbjct  543   KSPSES  548



>gb|KHN41965.1| Laccase-11 [Glycine soja]
Length=491

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 238/306 (78%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF T  I+IAPGQTTNV++ A+Q AG+Y +A   FMDAPI VDN+T TA 
Sbjct  177   VVEVDAVYTKPFTTRAILIAPGQTTNVLVQANQVAGRYFMATKAFMDAPIPVDNKTATAI  236

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  T+   L ++P++N T  A ++   LRSLNS  +PA VP  VD +L +T+GLG
Sbjct  237   LQYKGIPNTVLPVLPQLPARNDTRFALSYNKKLRSLNSTQYPANVPLKVDRNLFYTIGLG  296

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              N CP+C   NG+R+VAS+NNV+FVMP TALLQAH+F I+GVF TDFP  PP  FN+TG+
Sbjct  297   QNACPTC--LNGTRLVASLNNVSFVMPQTALLQAHYFSIRGVFRTDFPDRPPSPFNFTGA  354

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL T TGT++ ++ +N+TV+LVLQDT +++ E+HP HLHG+NFF VG GIGNF+P 
Sbjct  355   PLTANLATLTGTRVSKIAFNSTVELVLQDTNLLSVESHPFHLHGYNFFVVGTGIGNFDPA  414

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP K+NLVDP+ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLK AF+V+NG
Sbjct  415   KDPAKYNLVDPIERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTGWGLKTAFVVENG  474

Query  312   KGPNES  295
             +G ++S
Sbjct  475   QGQDQS  480



>ref|XP_010543401.1| PREDICTED: laccase-11-like [Tarenaya hassleriana]
Length=561

 Score =   399 bits (1025),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 231/306 (75%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I++ PGQTTNV++ A++   +Y +AA PFMDAP+ +DN+T TA 
Sbjct  247   VVEIDAVYTKPFITKAILLGPGQTTNVLVNANRPPNRYFMAARPFMDAPVPIDNKTVTAI  306

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y GV  T+      +P+ N T  A  +   LRSLNS +FPA VP  VD  L +T+GLG
Sbjct  307   LQYKGVPNTVLPVFPNLPAPNDTTFALGYNSKLRSLNSASFPANVPLKVDRQLFYTIGLG  366

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              NPCPSC   NG+++VAS+NNVTF+MP TALLQAH+F I GVF TDFP  PP  FNYTG+
Sbjct  367   TNPCPSC--VNGTKLVASLNNVTFIMPKTALLQAHYFNISGVFRTDFPDRPPKPFNYTGA  424

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L R+ +N T++L+LQDT ++  E+HP HLHG+NFF VG G+GNF+PK
Sbjct  425   PLTANLGTSLGTRLSRVEFNTTIELILQDTNLLTVESHPFHLHGYNFFVVGTGVGNFDPK  484

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NG
Sbjct  485   KDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTMWGLKMAFVVENG  544

Query  312   KGPNES  295
             K P ES
Sbjct  545   KTPEES  550



>ref|XP_003632636.1| PREDICTED: laccase-11 [Vitis vinifera]
 emb|CBI32739.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   399 bits (1024),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 235/306 (77%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  ++IAPGQTTNV++ ADQ+  +Y +A  PFMDAP+ VDN+T TA 
Sbjct  248   VVEIDAVYTKPFTTQALLIAPGQTTNVLVKADQSPSRYFMAVRPFMDAPVPVDNKTATAI  307

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  T+  TL ++P+ N T  A ++   L+SLN+  FPA VP  VD  L +T+GLG
Sbjct  308   LQYKGIPNTVLPTLAQLPAPNDTNFALSYNSKLKSLNTPQFPANVPLQVDRHLFYTIGLG  367

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              NPCP+C+  NG+++ AS+NN+TFVMP  ALLQAH+F IKGVF TDFP  P   FNYTG+
Sbjct  368   QNPCPTCQ--NGTQLTASLNNITFVMPKVALLQAHYFNIKGVFRTDFPDRPLAPFNYTGA  425

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L +L +N+T++LVLQDT ++  E+HP HLHG+NFF VG GIGNF+PK
Sbjct  426   PLTANLGTSLGTRLSKLAFNSTIELVLQDTNLLTVESHPFHLHGYNFFVVGNGIGNFDPK  485

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNL+DP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NG
Sbjct  486   KDPAKFNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENG  545

Query  312   KGPNES  295
             K P ES
Sbjct  546   KSPEES  551



>ref|XP_010098906.1| hypothetical protein L484_006544 [Morus notabilis]
 gb|EXB76109.1| hypothetical protein L484_006544 [Morus notabilis]
Length=545

 Score =   398 bits (1022),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 235/306 (77%), Gaps = 12/306 (4%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE DA+Y KPF+TDTI ++PGQTTN ++  DQA G+Y++A +PFMDAPI  +N T  AT
Sbjct  241   VVEADASYTKPFETDTIFLSPGQTTNALLKTDQAIGKYLIAINPFMDAPIGYNNVTSFAT  300

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y        T LT+IP QN TP    F+DSLRSLNSK +PAKVP  V HSL  T+ +G
Sbjct  301   LRYKKTPPNPKTILTKIPPQNDTPKTKAFIDSLRSLNSKQYPAKVPLNVHHSLFLTIAVG  360

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPC +C   NG+++VA +NNV+FV+P+ ALLQAH++ I  VFT DFPGNPPF FNYTG 
Sbjct  361   VNPCDTC--VNGTKLVADINNVSFVLPSIALLQAHYYNIGAVFTDDFPGNPPFRFNYTGP  418

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
             +P AN+QT+ GT+LYRL YN++VQ+VLQ T ++APENHP HLHGFNF+ VG G+GNF+P 
Sbjct  419   SP-ANIQTTNGTRLYRLAYNSSVQVVLQGTSVIAPENHPTHLHGFNFYVVGMGLGNFDPV  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DPKKFNLVDPVERNT+GVP  GW AIRFRADNP         E+HTTWGLKMAFLV+NG
Sbjct  478   EDPKKFNLVDPVERNTLGVPTAGWAAIRFRADNP---------EVHTTWGLKMAFLVENG  528

Query  312   KGPNES  295
              GPNES
Sbjct  529   FGPNES  534



>ref|XP_010690098.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=565

 Score =   399 bits (1024),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/308 (63%), Positives = 234/308 (76%), Gaps = 4/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQA-AGQYMVAASPFMDAP-IAVDNQTGT  1039
             VVEVDA+Y KPF TDTI IAPGQTTN ++ ADQ+ + +Y++  S FMDAP +AVDN T  
Sbjct  249   VVEVDASYTKPFVTDTIYIAPGQTTNALLKADQSPSKKYLIGMSSFMDAPSVAVDNTTNY  308

Query  1038  ATLHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVG  859
               L Y G        LT +P  NAT    NF ++LRSLNSK +PA+VP T+DHSLLFT G
Sbjct  309   GLLRYNGGPLGSRLVLTTMPPINATKAQLNFSNALRSLNSKKYPAQVPLTIDHSLLFTTG  368

Query  858   LGINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYT  679
             +G+NPC +C   NGS++V ++NNVTFVMP+ ALLQA+++ I GVFT DFP  PP  F+YT
Sbjct  369   VGVNPCATC--LNGSKLVGNINNVTFVMPSIALLQAYYYNISGVFTDDFPSKPPTNFDYT  426

Query  678   GSTPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
              +     L T  GTK+YRL YNATVQ+VLQDT I+APE+HP+HLHG NFF VG G GN+N
Sbjct  427   IANYTGGLATMNGTKVYRLSYNATVQVVLQDTSIIAPESHPLHLHGTNFFVVGMGTGNYN  486

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
                D K FNLVDPVERNTI VP GGW AIRFRADNPGVWFMHCHLE+HT+WGLKMAFL++
Sbjct  487   ATKDFKNFNLVDPVERNTIDVPTGGWTAIRFRADNPGVWFMHCHLEVHTSWGLKMAFLIE  546

Query  318   NGKGPNES  295
             NG GPN+S
Sbjct  547   NGDGPNKS  554



>emb|CDO97037.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   397 bits (1021),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/308 (61%), Positives = 239/308 (78%), Gaps = 4/308 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF TD I+IAPGQTTNV++ A++ + +Y +AA PFMDAP+ +DN+T TA 
Sbjct  250   VVEVDAVYTKPFSTDAILIAPGQTTNVLVHANKISSRYFMAARPFMDAPLPIDNKTATAI  309

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y GV   +  +L  +P+ N T  A ++   LRSLNS  FPA VP  VD  L +T+GLG
Sbjct  310   LQYKGVPNNVLPSLPNLPAPNDTSFALSYSAKLRSLNSPQFPANVPLKVDRHLFYTIGLG  369

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCP+C+  NG+R+ AS+NN+TF+MP   LLQAH+F + GVFTTDFP  PP  FNYTG+
Sbjct  370   MNPCPTCQ--NGTRLTASLNNITFIMPQIGLLQAHYFNLTGVFTTDFPDRPPTPFNYTGA  427

Query  672   TPPANLQT--STGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFN  499
                ANL+T  ST  +L R+ +N+TV+LVLQDT +++ E+HPIHLHG+NFF VG GIGNF+
Sbjct  428   PLTANLRTVRSTRPRLSRIAFNSTVELVLQDTNLLSVESHPIHLHGYNFFVVGTGIGNFD  487

Query  498   PKTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVD  319
             PK DP K+NLVDP ERNTIGVP GGW AIRFRADNPGVWFMHCHLE+HT+WGLK AF+V+
Sbjct  488   PKKDPAKYNLVDPPERNTIGVPTGGWTAIRFRADNPGVWFMHCHLELHTSWGLKTAFVVE  547

Query  318   NGKGPNES  295
             NG GP+++
Sbjct  548   NGPGPDQT  555



>ref|XP_010558158.1| PREDICTED: laccase-11 [Tarenaya hassleriana]
Length=566

 Score =   397 bits (1021),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 233/306 (76%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y+KPF T  I++ PGQTTNV++ A++   +Y +AA PFMDAP+++DN+T TA 
Sbjct  252   VVEIDAVYIKPFTTKAILLGPGQTTNVLVKANRPPNRYFMAARPFMDAPVSIDNKTVTAI  311

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y GV  T+      +P+ N T  A N+ + LRSLN+  FPA VP  +D  L +T+GLG
Sbjct  312   LQYKGVPNTVLPIFPNLPAPNDTAFALNYNNKLRSLNTVNFPANVPLRIDRRLFYTIGLG  371

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             +NPCPSC   NG+++VAS+NNVTFVMP TALLQAH+F + GVF TDFP  PP  FN+TG+
Sbjct  372   MNPCPSC--VNGTKLVASLNNVTFVMPKTALLQAHYFNMSGVFRTDFPDRPPKPFNFTGA  429

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TS GT+L R+ +N T++L+LQDT ++  E+HP HLHG+NFF VG GIGNF+PK
Sbjct  430   PLTANLGTSIGTRLSRVEFNTTIELILQDTNLLTVESHPFHLHGYNFFVVGSGIGNFDPK  489

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NG
Sbjct  490   KDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTMWGLKMAFVVENG  549

Query  312   KGPNES  295
               P  S
Sbjct  550   NTPENS  555



>ref|XP_008246065.1| PREDICTED: laccase-11-like, partial [Prunus mume]
Length=349

 Score =   389 bits (998),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/306 (60%), Positives = 232/306 (76%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF ++ I+IAPGQTTNV++ A+QA+G+Y +AA PFMDAPIAVDN+T T  
Sbjct  35    VVEVDAVYTKPFTSEAILIAPGQTTNVLVQANQASGRYFMAARPFMDAPIAVDNKTATGI  94

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
               Y G+  T+  +L ++P+ N T  A ++   L+SLN+  FPA VP  VD  L +T+G G
Sbjct  95    FQYRGIPNTVLPSLPQLPASNDTAFALSYNKKLKSLNTPNFPANVPLKVDRKLFYTIGFG  154

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
                CP+C   NG+R VAS+NN++F MP   LLQAH+F +KGVF TDFP  P  +FNYTG+
Sbjct  155   KESCPTC--LNGTRFVASLNNISFEMPQVGLLQAHYFNLKGVFKTDFPDRPQTSFNYTGA  212

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TSTGT+L ++ +N+TV+LVLQDT ++  E+HP HLHG+NFF VG GIGNF+P 
Sbjct  213   PLTANLGTSTGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPA  272

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP K+NLVDPVERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLK AF+V++G
Sbjct  273   KDPAKYNLVDPVERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTGWGLKTAFVVEDG  332

Query  312   KGPNES  295
              G + S
Sbjct  333   PGSDHS  338



>ref|XP_009590676.1| PREDICTED: laccase-11-like [Nicotiana tomentosiformis]
Length=559

 Score =   396 bits (1018),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 237/306 (77%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T+ I+IAPGQTTNV++ A+Q  G+Y +AA PFMDAPI+VDN+T TA 
Sbjct  245   VVEIDAVYTKPFSTEAILIAPGQTTNVLVRANQIPGRYFMAARPFMDAPISVDNKTATAI  304

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
               Y GV  T+   L  +P+ N T  A ++ + LRSLNS  +PA VP  VD +L +T+GLG
Sbjct  305   FQYKGVSETVIPKLPDLPAPNDTEFALSYDNKLRSLNSPKYPANVPLKVDRNLFYTIGLG  364

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             IN CP+C   NG+R+ AS+NN++FVMP TALLQAH+F IKGV+TTDFP  PP  FNYTG+
Sbjct  365   INACPTC--LNGTRLTASLNNISFVMPQTALLQAHYFNIKGVYTTDFPDKPPTPFNYTGA  422

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL+T+ GT+L ++ +N+TV+LV+QDT ++  E+HP HLHG+NFF VG GIGNF+PK
Sbjct  423   PLTANLKTTQGTRLSKVSFNSTVELVIQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPK  482

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP K+NL+DP ERNT+GVP GGW AIRFRADNPGVWF HCHLE+HT WGLK AF+V++G
Sbjct  483   KDPAKYNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFFHCHLELHTGWGLKTAFVVEDG  542

Query  312   KGPNES  295
              G N +
Sbjct  543   PGSNHN  548



>dbj|BAF01776.1| laccase (diphenol oxidase)-like protein [Arabidopsis thaliana]
Length=339

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 231/306 (75%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I++ PGQTTNV++  D++  +Y +AASPFMDAP++VDN+T TA 
Sbjct  25    VVEIDAVYTKPFTTKAILLGPGQTTNVLVKTDRSPNRYFMAASPFMDAPVSVDNKTVTAI  84

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y GV  T+   L ++P  N T  A ++   L+SLN+  FPA VP  VD  L +T+GLG
Sbjct  85    LQYKGVPNTVLPILPKLPLPNDTSFALDYNGKLKSLNTPNFPALVPLKVDRRLFYTIGLG  144

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             IN CP+C   NG+ + AS+NN+TF+MP TALL+AH+  I GVF TDFP  PP AFNYTG 
Sbjct  145   INACPTC--VNGTNLAASINNITFIMPKTALLKAHYSNISGVFRTDFPDRPPKAFNYTGV  202

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TSTGT+L R+ +N T++LVLQDT ++  E+HP HLHG+NFF VG G+GNF+PK
Sbjct  203   PLTANLGTSTGTRLSRVKFNTTIELVLQDTNLLTVESHPFHLHGYNFFVVGTGVGNFDPK  262

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLKMAF+V+NG
Sbjct  263   KDPAKFNLVDPPERNTVGVPTGGWAAIRFRADNPGVWFMHCHLEVHTMWGLKMAFVVENG  322

Query  312   KGPNES  295
             + P  S
Sbjct  323   ETPELS  328



>gb|KHN36103.1| Laccase-11 [Glycine soja]
Length=554

 Score =   395 bits (1015),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 237/306 (77%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF T  I+IAPGQTTNV++ A+Q AG+Y +A   FMDAPI VDN+T TA 
Sbjct  240   VVEVDAVYTKPFTTPAILIAPGQTTNVLVQANQVAGRYFMATKAFMDAPIPVDNKTATAI  299

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  T+   L ++P+ N T  A ++   LRSLNS  +PA VP  VD +L +T+GLG
Sbjct  300   LQYKGIPNTVLPVLPQLPASNDTRFALSYNKKLRSLNSAQYPANVPLKVDRNLFYTIGLG  359

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              N CP+C   NG+++VAS+NNV+FVMP TALLQAH+F IKGVF TDFP  PP  FN+TG+
Sbjct  360   QNSCPTC--LNGTQLVASLNNVSFVMPQTALLQAHYFNIKGVFRTDFPDRPPTPFNFTGA  417

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TSTGT++ ++ +N+TV+LVLQDT +++ E+HP HLHG+NFF VG G+GNF+P 
Sbjct  418   PLTANLATSTGTRVSKIAFNSTVELVLQDTNLLSVESHPFHLHGYNFFVVGTGVGNFDPA  477

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP K+NLVDP+ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLK AF+V+NG
Sbjct  478   KDPAKYNLVDPIERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVHTGWGLKTAFVVENG  537

Query  312   KGPNES  295
              G ++S
Sbjct  538   PGQDQS  543



>sp|Q8RYM9.1|LAC2_ORYSJ RecName: Full=Laccase-2; AltName: Full=Benzenediol:oxygen oxidoreductase 
2; AltName: Full=Diphenol oxidase 2; AltName: Full=Urishiol 
oxidase 2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB90733.1| putative laccase [Oryza sativa Japonica Group]
Length=562

 Score =   395 bits (1015),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 234/307 (76%), Gaps = 3/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DATY KPF   T+ ++PGQT NV+++ADQ+ G+Y + A PF D PI  DN+T TA 
Sbjct  247   VVEIDATYTKPFAASTVQLSPGQTMNVLVSADQSPGRYFMVAKPFNDVPIPADNKTATAI  306

Query  1032  LHYTGVQttlattlTR-IPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             L Y GV T++   L + +P+ N+T     F D LRSLNS  +PA VP  VD  LL+T+GL
Sbjct  307   LQYAGVPTSVVPALPQTMPATNSTGSVAAFHDKLRSLNSPRYPADVPLAVDRHLLYTIGL  366

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
              I+PC +C   N SR+ AS+NN+TFVMP TALLQAH++G KGVF  DFP  PP  FNYTG
Sbjct  367   NIDPCETC--LNRSRLAASLNNITFVMPRTALLQAHYYGQKGVFAADFPDRPPARFNYTG  424

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
                 A L TS GT+L ++ YNATV+LVLQDT +++ E+HP HLHG+NFF VGRG+GNF+P
Sbjct  425   VPLTAGLGTSLGTRLSKIAYNATVELVLQDTNLLSVESHPFHLHGYNFFVVGRGVGNFDP  484

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
               DP K+NLVDP ERNT+GVPAGGW AIRFRADNPGVWF+HCHLE+HT+WGLKMAFLV++
Sbjct  485   AKDPAKYNLVDPPERNTVGVPAGGWTAIRFRADNPGVWFLHCHLEVHTSWGLKMAFLVED  544

Query  315   GKGPNES  295
             G GP+ES
Sbjct  545   GSGPDES  551



>gb|EAZ12812.1| hypothetical protein OsJ_02731 [Oryza sativa Japonica Group]
Length=562

 Score =   395 bits (1015),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 234/307 (76%), Gaps = 3/307 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DATY KPF   T+ ++PGQT NV+++ADQ+ G+Y + A PF D PI  DN+T TA 
Sbjct  247   VVEIDATYTKPFAASTVQLSPGQTMNVLVSADQSPGRYFMVAKPFNDVPIPADNKTATAI  306

Query  1032  LHYTGVQttlattlTR-IPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGL  856
             L Y GV T++   L + +P+ N+T     F D LRSLNS  +PA VP  VD  LL+T+GL
Sbjct  307   LQYAGVPTSVVPALPQTMPATNSTGSVAAFHDKLRSLNSPRYPADVPLAVDRHLLYTIGL  366

Query  855   GINPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTG  676
              I+PC +C   N SR+ AS+NN+TFVMP TALLQAH++G KGVF  DFP  PP  FNYTG
Sbjct  367   NIDPCETC--LNRSRLAASLNNITFVMPRTALLQAHYYGQKGVFAADFPDRPPARFNYTG  424

Query  675   STPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNP  496
                 A L TS GT+L ++ YNATV+LVLQDT +++ E+HP HLHG+NFF VGRG+GNF+P
Sbjct  425   VPLTAGLGTSLGTRLSKIAYNATVELVLQDTNLLSVESHPFHLHGYNFFVVGRGVGNFDP  484

Query  495   KTDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDN  316
               DP K+NLVDP ERNT+GVPAGGW AIRFRADNPGVWF+HCHLE+HT+WGLKMAFLV++
Sbjct  485   AKDPAKYNLVDPPERNTVGVPAGGWTAIRFRADNPGVWFLHCHLEVHTSWGLKMAFLVED  544

Query  315   GKGPNES  295
             G GP+ES
Sbjct  545   GSGPDES  551



>ref|XP_007156958.1| hypothetical protein PHAVU_002G031600g [Phaseolus vulgaris]
 gb|ESW28952.1| hypothetical protein PHAVU_002G031600g [Phaseolus vulgaris]
Length=564

 Score =   395 bits (1015),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 234/306 (76%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y KPF T TI+IAPGQTTNV++ A+Q AG+Y +A   FMDAPI VDN++ TA 
Sbjct  250   VVEVDAVYTKPFTTQTIIIAPGQTTNVLVKANQVAGRYFMATRTFMDAPIPVDNKSATAI  309

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
               Y G+  T+      +P+ N TP A ++ + +RSLNS  +PA VP  VD +L +T+GL 
Sbjct  310   FQYKGIPNTVLPFPPSLPAANDTPFALSYNNKIRSLNSPQYPANVPLEVDRNLFYTIGLA  369

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
              N CP+C   NG+R++AS+NNV+FVMP TALLQAH+F IKGV+ TDFP  P   FNYTG+
Sbjct  370   QNSCPTC--VNGTRLLASLNNVSFVMPQTALLQAHYFNIKGVYRTDFPDKPSTTFNYTGA  427

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL TSTGT++ ++P+N+TV+LVLQDT ++  E+HP HLHG+NFF VG GIGNF+P 
Sbjct  428   PLTANLGTSTGTRISKVPFNSTVELVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPS  487

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP K+NLVDP+ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLK AFLV++G
Sbjct  488   KDPAKYNLVDPIERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTGWGLKTAFLVEDG  547

Query  312   KGPNES  295
              G  +S
Sbjct  548   PGQEQS  553



>ref|XP_002512915.1| laccase, putative [Ricinus communis]
 gb|EEF49418.1| laccase, putative [Ricinus communis]
Length=558

 Score =   394 bits (1013),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 233/306 (76%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVE+DA Y KPF T  I+IAPGQTTNV++ A QA  +Y +AA PFMDAP++VDN+T TA 
Sbjct  244   VVEIDAVYTKPFTTRAILIAPGQTTNVLVQATQAPNRYFMAARPFMDAPLSVDNRTATAI  303

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  T+   L ++P+ N T  A ++   L+SLN+  FPA VP  VD  L +T+GLG
Sbjct  304   LQYKGIPNTVLPILPQLPAPNDTVFALSYNSKLKSLNTLQFPANVPLKVDRHLFYTIGLG  363

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             IN CP+C   NG+++ AS+NN+TFVMP   LLQAH+F IKGVF TDFP  PP  FNYTG+
Sbjct  364   INLCPTC--LNGTQLTASLNNITFVMPQIGLLQAHYFNIKGVFRTDFPDKPPTPFNYTGA  421

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL T+ GT+L ++ YN+TVQLVLQDT ++  E+HP HLHG+NFF VG GIGNFNPK
Sbjct  422   PLTANLGTTLGTRLSKIAYNSTVQLVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFNPK  481

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW AIRFRADNPGVWFMHCHLE+HT WGLK AF+V++G
Sbjct  482   KDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTGWGLKTAFVVEDG  541

Query  312   KGPNES  295
              GP+ S
Sbjct  542   SGPDLS  547



>ref|XP_002305436.1| hypothetical protein POPTR_0004s16370g [Populus trichocarpa]
 gb|EEE85947.1| hypothetical protein POPTR_0004s16370g [Populus trichocarpa]
Length=540

 Score =   394 bits (1011),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 232/306 (76%), Gaps = 2/306 (1%)
 Frame = -2

Query  1212  VVEVDATYVKPFKTDTIVIAPGQTTNVIITADQAAGQYMVAASPFMDAPIAVDNQTGTAT  1033
             VVEVDA Y K F T  ++IAPGQTTNV++ A Q+  +Y +AA PFMDAP+ VDN+T TA 
Sbjct  226   VVEVDAVYTKHFTTQAVLIAPGQTTNVLVQATQSPNRYFMAARPFMDAPLTVDNKTATAI  285

Query  1032  LHYTGVQttlattlTRIPSQNATPVANNFVDSLRSLNSKTFPAKVPQTVDHSLLFTVGLG  853
             L Y G+  T+   L ++P+ N T  A ++   LRSLNS  FPA VP  VD  L +T+GLG
Sbjct  286   LQYKGIPNTVIPILPKLPAPNDTAFALSYNAKLRSLNSPQFPANVPLKVDRHLFYTIGLG  345

Query  852   INPCPSCKPANGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPGNPPFAFNYTGS  673
             INPCPSC   NG+R+ AS+NN+TFVMP   LLQAH+F  KG+F  DFP NPP  FNYTG 
Sbjct  346   INPCPSC--LNGTRLTASLNNITFVMPQIGLLQAHYFNTKGIFRLDFPDNPPSPFNYTGV  403

Query  672   TPPANLQTSTGTKLYRLPYNATVQLVLQDTGIVAPENHPIHLHGFNFFAVGRGIGNFNPK  493
                ANL T+ GT+L ++ YN+TVQLVLQDT ++  E+HP HLHG+NFF VG GIGNF+PK
Sbjct  404   PLTANLGTTLGTRLSKIVYNSTVQLVLQDTNLLTVESHPFHLHGYNFFVVGTGIGNFDPK  463

Query  492   TDPKKFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNG  313
              DP KFNLVDP ERNT+GVP GGW AIRF+ADNPGVWFMHCHLE+HT+WGLK AF+V++G
Sbjct  464   KDPAKFNLVDPPERNTVGVPTGGWTAIRFKADNPGVWFMHCHLELHTSWGLKTAFVVEDG  523

Query  312   KGPNES  295
              GP++S
Sbjct  524   VGPDQS  529



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3108614673813