BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23787_g1_i1 len=1560 path=[8275:0-1355 3600:1356-1392
3625:1393-1457 3690:1458-1559]

Length=1560
                                                                      Score     E

ref|XP_009786393.1|  PREDICTED: laccase-4-like                          828   0.0      
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          822   0.0      
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          813   0.0      
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          813   0.0      
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          811   0.0      
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          809   0.0      
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          808   0.0      
gb|AAC49536.1|  diphenol oxidase                                        805   0.0      Nicotiana tabacum [American tobacco]
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                796   0.0      
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          789   0.0      
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          783   0.0      
ref|XP_007026782.1|  Laccase/Diphenol oxidase family protein isof...    778   0.0      
ref|XP_004246339.1|  PREDICTED: laccase-4                               780   0.0      
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    778   0.0      
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             777   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             775   0.0      
ref|XP_006363052.1|  PREDICTED: laccase-4-like                          775   0.0      
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          775   0.0      
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          773   0.0      
emb|CDP06511.1|  unnamed protein product                                771   0.0      
gb|KDP24484.1|  hypothetical protein JCGZ_25048                         766   0.0      
ref|XP_004249583.1|  PREDICTED: laccase-4-like                          768   0.0      
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          768   0.0      
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          767   0.0      
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          767   0.0      
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          766   0.0      
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          766   0.0      
ref|XP_006338994.1|  PREDICTED: laccase-4-like                          764   0.0      
ref|XP_002322962.2|  laccase family protein                             763   0.0      Populus trichocarpa [western balsam poplar]
gb|KHG18161.1|  Laccase-4 -like protein                                 759   0.0      
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          757   0.0      
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          756   0.0      
ref|XP_002520425.1|  laccase, putative                                  756   0.0      Ricinus communis
gb|KHG11130.1|  Laccase-4 -like protein                                 753   0.0      
ref|XP_011035200.1|  PREDICTED: laccase-4                               753   0.0      
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     753   0.0      
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          749   0.0      
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             749   0.0      
ref|XP_003544873.2|  PREDICTED: laccase-4-like                          748   0.0      
ref|XP_010553253.1|  PREDICTED: laccase-4                               748   0.0      
ref|XP_002533894.1|  laccase, putative                                  748   0.0      Ricinus communis
ref|XP_008785423.1|  PREDICTED: laccase-22                              748   0.0      
ref|XP_002308209.2|  laccase family protein                             748   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          747   0.0      
ref|XP_010923124.1|  PREDICTED: laccase-22                              745   0.0      
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    745   0.0      
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    744   0.0      
ref|XP_003518300.1|  PREDICTED: laccase-4-like                          744   0.0      
ref|XP_002308208.2|  laccase family protein                             744   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002278638.1|  PREDICTED: laccase-4                               742   0.0      Vitis vinifera
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          742   0.0      
gb|KDP46534.1|  hypothetical protein JCGZ_08506                         742   0.0      
ref|XP_003516941.1|  PREDICTED: laccase-4-like                          741   0.0      
gb|EYU26646.1|  hypothetical protein MIMGU_mgv1a003805mg                741   0.0      
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             741   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003539958.2|  PREDICTED: laccase-4-like                          740   0.0      
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             739   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO37344.1|  hypothetical protein CISIN_1g009854mg                   737   0.0      
ref|XP_010101806.1|  hypothetical protein L484_023595                   738   0.0      
gb|KHN06247.1|  Laccase-4                                               737   0.0      
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein            737   0.0      
ref|XP_010256659.1|  PREDICTED: laccase-4                               736   0.0      
ref|XP_004302643.1|  PREDICTED: laccase-4-like                          736   0.0      
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             736   0.0      
ref|XP_011032153.1|  PREDICTED: laccase-4-like isoform X1               734   0.0      
ref|XP_003522150.1|  PREDICTED: laccase-4-like                          736   0.0      
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2               735   0.0      
ref|XP_003551299.1|  PREDICTED: laccase-4-like                          735   0.0      
emb|CDX74915.1|  BnaA05g06610D                                          735   0.0      
gb|KHG22893.1|  Laccase-4 -like protein                                 732   0.0      
ref|XP_007142229.1|  hypothetical protein PHAVU_008G263100g             734   0.0      
ref|XP_008775059.1|  PREDICTED: laccase-22-like                         733   0.0      
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             733   0.0      
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                    733   0.0      
emb|CDX91428.1|  BnaC04g07220D                                          733   0.0      
ref|XP_004500229.1|  PREDICTED: laccase-4-like                          732   0.0      
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             732   0.0      
ref|XP_010104683.1|  hypothetical protein L484_022066                   731   0.0      
ref|XP_008239590.1|  PREDICTED: laccase-4-like                          731   0.0      
ref|XP_002879726.1|  IRX12/LAC4                                         731   0.0      
ref|XP_008377498.1|  PREDICTED: laccase-4-like                          730   0.0      
ref|XP_007134763.1|  hypothetical protein PHAVU_010G0738000g            728   0.0      
ref|XP_007205010.1|  hypothetical protein PRUPE_ppa003646mg             729   0.0      
ref|NP_565881.1|  laccase-4                                             728   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX93330.1|  BnaC04g45660D                                          728   0.0      
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          728   0.0      
emb|CDY18406.1|  BnaA04g21810D                                          728   0.0      
ref|XP_009143427.1|  PREDICTED: laccase-4                               728   0.0      
ref|XP_009370205.1|  PREDICTED: laccase-4                               727   0.0      
gb|KHG17519.1|  Laccase-4 -like protein                                 725   0.0      
ref|XP_010104682.1|  hypothetical protein L484_022065                   727   0.0      
ref|XP_010505418.1|  PREDICTED: laccase-4                               726   0.0      
ref|XP_010517091.1|  PREDICTED: laccase-4-like                          725   0.0      
ref|XP_009141718.1|  PREDICTED: laccase-4-like                          725   0.0      
ref|XP_008388134.1|  PREDICTED: laccase-4-like                          724   0.0      
ref|XP_009358852.1|  PREDICTED: laccase-4-like                          724   0.0      
ref|XP_010509229.1|  PREDICTED: laccase-4-like                          724   0.0      
ref|XP_002280416.1|  PREDICTED: laccase-4                               723   0.0      Vitis vinifera
ref|XP_008355354.1|  PREDICTED: laccase-4                               723   0.0      
ref|XP_007146741.1|  hypothetical protein PHAVU_006G065800g             721   0.0      
ref|XP_004490574.1|  PREDICTED: laccase-4-like                          721   0.0      
ref|XP_008220423.1|  PREDICTED: laccase-4                               720   0.0      
gb|KEH34185.1|  laccase/diphenol oxidase family protein                 719   0.0      
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg             718   0.0      
ref|XP_009374280.1|  PREDICTED: laccase-4-like                          716   0.0      
ref|XP_010907627.1|  PREDICTED: laccase-22-like                         715   0.0      
ref|XP_009337309.1|  PREDICTED: laccase-4-like                          713   0.0      
gb|AES98533.2|  laccase/diphenol oxidase family protein                 712   0.0      
ref|XP_009346884.1|  PREDICTED: laccase-4-like                          712   0.0      
ref|XP_003615575.1|  Laccase 1a                                         713   0.0      
gb|KHN04832.1|  Laccase-4                                               710   0.0      
gb|AAC49538.1|  diphenol oxidase                                        705   0.0      Nicotiana tabacum [American tobacco]
ref|XP_003604619.1|  Laccase 1a                                         709   0.0      
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          709   0.0      
ref|XP_004294236.1|  PREDICTED: laccase-4-like                          707   0.0      
ref|XP_010685615.1|  PREDICTED: laccase-4                               706   0.0      
ref|XP_008358974.1|  PREDICTED: laccase-4-like                          704   0.0      
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         702   0.0      
ref|XP_010543228.1|  PREDICTED: laccase-10                              702   0.0      
ref|XP_010535416.1|  PREDICTED: laccase-16                              695   0.0      
ref|XP_007140382.1|  hypothetical protein PHAVU_008G107100g             694   0.0      
gb|KDO53232.1|  hypothetical protein CISIN_1g0093922mg                  690   0.0      
ref|XP_004150626.1|  PREDICTED: laccase-4-like                          687   0.0      
emb|CBI31539.3|  unnamed protein product                                688   0.0      
gb|EPS60103.1|  laccase 1a                                              689   0.0      
ref|XP_010676357.1|  PREDICTED: laccase-4-like                          689   0.0      
ref|XP_008457399.1|  PREDICTED: laccase-4                               689   0.0      
gb|KGN65788.1|  hypothetical protein Csa_1G528530                       687   0.0      
ref|XP_006602641.1|  PREDICTED: laccase-4-like isoform X1               687   0.0      
ref|XP_004506788.1|  PREDICTED: laccase-4-like                          686   0.0      
ref|XP_009384856.1|  PREDICTED: laccase-22-like                         685   0.0      
ref|XP_007220829.1|  hypothetical protein PRUPE_ppa027203mg             685   0.0      
ref|XP_006398646.1|  hypothetical protein EUTSA_v10015593mg             684   0.0      
ref|XP_002265173.1|  PREDICTED: laccase-4-like                          684   0.0      Vitis vinifera
emb|CAA74101.1|  laccase                                                677   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_195739.2|  laccase 10                                            682   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287399.1|  hypothetical protein CARUB_v10000605mg             682   0.0      
ref|XP_002873023.1|  predicted protein                                  680   0.0      
ref|XP_009590412.1|  PREDICTED: laccase-4-like                          680   0.0      
ref|XP_009125430.1|  PREDICTED: laccase-10                              680   0.0      
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...    679   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010452014.1|  PREDICTED: laccase-10 isoform X1                   678   0.0      
ref|XP_008233715.1|  PREDICTED: laccase-4-like                          678   0.0      
emb|CDP14064.1|  unnamed protein product                                677   0.0      
emb|CDY48114.1|  BnaC02g03710D                                          677   0.0      
gb|EPS65618.1|  hypothetical protein M569_09159                         676   0.0      
ref|XP_010490598.1|  PREDICTED: laccase-10-like isoform X1              676   0.0      
ref|XP_010423919.1|  PREDICTED: laccase-10-like                         675   0.0      
emb|CDY55905.1|  BnaAnng13970D                                          675   0.0      
gb|KCW52562.1|  hypothetical protein EUGRSUZ_J01941                     672   0.0      
ref|XP_011084946.1|  PREDICTED: laccase-4-like                          674   0.0      
ref|XP_010033027.1|  PREDICTED: laccase-4-like                          673   0.0      
ref|XP_009120399.1|  PREDICTED: laccase-16                              674   0.0      
ref|XP_009416212.1|  PREDICTED: laccase-22-like                         674   0.0      
gb|KFK44563.1|  hypothetical protein AALP_AA1G273400                    672   0.0      
ref|XP_009350996.1|  PREDICTED: laccase-4-like                          671   0.0      
emb|CAB69847.1|  laccase-like protein                                   669   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008392913.1|  PREDICTED: laccase-4-like                          667   0.0      
ref|XP_003558760.1|  PREDICTED: laccase-22                              667   0.0      
emb|CAC14718.1|  laccase                                                660   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU41257.1|  hypothetical protein MIMGU_mgv1a003880mg                666   0.0      
dbj|BAJ98144.1|  predicted protein                                      665   0.0      
ref|XP_004980096.1|  PREDICTED: laccase-22-like                         666   0.0      
ref|XP_006663136.1|  PREDICTED: laccase-22-like                         664   0.0      
ref|XP_007009094.1|  Laccase/Diphenol oxidase family protein            663   0.0      
emb|CDX80325.1|  BnaC09g34170D                                          664   0.0      
gb|EMT26873.1|  Laccase-22                                              662   0.0      
ref|XP_011080855.1|  PREDICTED: laccase-4                               656   0.0      
ref|XP_009789474.1|  PREDICTED: laccase-4-like isoform X2               653   0.0      
ref|XP_009789473.1|  PREDICTED: laccase-4-like isoform X1               653   0.0      
ref|XP_003544123.1|  PREDICTED: laccase-4-like                          652   0.0      
ref|XP_006435668.1|  hypothetical protein CICLE_v10031134mg             650   0.0      
ref|XP_004490949.1|  PREDICTED: laccase-4-like                          650   0.0      
gb|AES99522.2|  laccase/diphenol oxidase family protein                 649   0.0      
gb|KDO69098.1|  hypothetical protein CISIN_1g008799mg                   650   0.0      
ref|XP_006840270.1|  hypothetical protein AMTR_s00045p00045490          649   0.0      
ref|XP_009589148.1|  PREDICTED: laccase-4-like                          648   0.0      
ref|XP_003616564.1|  Laccase                                            652   0.0      
ref|XP_002866298.1|  hypothetical protein ARALYDRAFT_496014             645   0.0      
ref|XP_006350822.1|  PREDICTED: laccase-4-like                          646   0.0      
gb|KHN20872.1|  Laccase-4                                               645   0.0      
ref|XP_006282033.1|  hypothetical protein CARUB_v10028274mg             644   0.0      
ref|XP_002316233.1|  hypothetical protein POPTR_0010s20050g             644   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004241179.1|  PREDICTED: laccase-4-like                          644   0.0      
ref|XP_007141799.1|  hypothetical protein PHAVU_008G226700g             644   0.0      
ref|XP_011036009.1|  PREDICTED: laccase-4-like                          642   0.0      
ref|XP_010454388.1|  PREDICTED: laccase-16                              641   0.0      
ref|XP_004308920.1|  PREDICTED: laccase-22-like                         641   0.0      
ref|NP_200699.1|  laccase 16                                            640   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABE66261.1|  laccase/diphenol oxidase                                640   0.0      
gb|ABK28766.1|  unknown                                                 640   0.0      
sp|Q1PDH6.2|LAC16_ARATH  RecName: Full=Laccase-16; AltName: Full=...    640   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAA74103.1|  laccase                                                640   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010067496.1|  PREDICTED: laccase-4-like                          639   0.0      
gb|KHG28836.1|  Laccase-22                                              640   0.0      
ref|XP_010483503.1|  PREDICTED: laccase-16-like isoform X3              639   0.0      
emb|CAC14719.1|  laccase                                                637   0.0      Populus trichocarpa [western balsam poplar]
gb|EPS61127.1|  laccase 3                                               637   0.0      
ref|XP_008441433.1|  PREDICTED: laccase-4-like                          636   0.0      
ref|XP_010443638.1|  PREDICTED: laccase-16-like                         635   0.0      
ref|XP_010483501.1|  PREDICTED: laccase-16-like isoform X1              635   0.0      
ref|XP_011039810.1|  PREDICTED: laccase-4-like                          631   0.0      
ref|XP_002311202.1|  laccase family protein                             631   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002530417.1|  laccase, putative                                  630   0.0      Ricinus communis
ref|XP_006602642.1|  PREDICTED: laccase-4-like isoform X2               623   0.0      
gb|AAK37829.1|AF132125_1  laccase                                       624   0.0      Pinus taeda
gb|KGN45770.1|  hypothetical protein Csa_6G009490                       622   0.0      
gb|ACN39933.1|  unknown                                                 622   0.0      Picea sitchensis
ref|XP_010098906.1|  hypothetical protein L484_006544                   619   0.0      
ref|XP_010690098.1|  PREDICTED: laccase-4-like                          615   0.0      
gb|EMS48198.1|  Laccase-22                                              611   0.0      
ref|XP_010543748.1|  PREDICTED: laccase-22-like                         611   0.0      
ref|XP_006401026.1|  hypothetical protein EUTSA_v10013285mg             609   0.0      
ref|XP_004138572.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     610   0.0      
ref|XP_010924287.1|  PREDICTED: laccase-11-like                         609   0.0      
emb|CDP09155.1|  unnamed protein product                                615   0.0      
gb|AAK37830.1|AF132126_1  laccase                                       600   0.0      Pinus taeda
emb|CAA74102.1|  laccase                                                594   0.0      Populus trichocarpa [western balsam poplar]
gb|KFK27419.1|  hypothetical protein AALP_AA8G380300                    594   0.0      
ref|XP_010926015.1|  PREDICTED: laccase-11-like                         602   0.0      
dbj|BAN10308.1|  laccase                                                590   0.0      
ref|XP_009392410.1|  PREDICTED: laccase-11                              590   0.0      
ref|XP_009146739.1|  PREDICTED: laccase-22-like                         589   0.0      
ref|XP_008357173.1|  PREDICTED: laccase-11-like                         589   0.0      
gb|KDP41783.1|  hypothetical protein JCGZ_26801                         599   0.0      
emb|CDY01010.1|  BnaC05g41900D                                          588   0.0      
ref|XP_003632636.1|  PREDICTED: laccase-11                              587   0.0      
ref|XP_009378520.1|  PREDICTED: laccase-11-like                         587   0.0      
ref|XP_009590676.1|  PREDICTED: laccase-11-like                         584   0.0      
ref|XP_009764219.1|  PREDICTED: laccase-11-like                         584   0.0      
emb|CDO97037.1|  unnamed protein product                                583   0.0      
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg             583   0.0      
ref|XP_008800741.1|  PREDICTED: laccase-11-like                         597   0.0      
ref|XP_010486777.1|  PREDICTED: laccase-22-like isoform X1              582   0.0      
gb|KHN36103.1|  Laccase-11                                              582   0.0      
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   582   0.0      
ref|XP_010494695.1|  PREDICTED: laccase-22-like                         582   0.0      
gb|KHN41965.1|  Laccase-11                                              579   0.0      
ref|XP_006300062.1|  hypothetical protein CARUB_v10016290mg             581   0.0      
ref|XP_011099634.1|  PREDICTED: laccase-11-like                         581   0.0      
ref|XP_002512915.1|  laccase, putative                                  581   0.0      Ricinus communis
ref|XP_007156958.1|  hypothetical protein PHAVU_002G031600g             581   0.0      
ref|XP_010464832.1|  PREDICTED: laccase-22-like                         580   0.0      
ref|XP_010486778.1|  PREDICTED: laccase-22-like isoform X2              580   0.0      
ref|XP_011088411.1|  PREDICTED: laccase-11-like                         579   0.0      
ref|XP_008236999.1|  PREDICTED: laccase-11-like                         579   0.0      
ref|XP_002519529.1|  laccase, putative                                  579   0.0      Ricinus communis
ref|XP_002313847.2|  hypothetical protein POPTR_0009s10550g             578   0.0      Populus trichocarpa [western balsam poplar]
gb|KHG01609.1|  Laccase-11 -like protein                                578   0.0      
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         578   0.0      
ref|XP_008449246.1|  PREDICTED: laccase-11                              577   0.0      
ref|XP_004146556.1|  PREDICTED: laccase-11-like                         577   0.0      
ref|XP_004160985.1|  PREDICTED: laccase-11-like                         577   0.0      
ref|XP_004233973.1|  PREDICTED: laccase-11                              576   0.0      
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             576   0.0      
gb|AFN53658.1|  hypothetical protein                                    572   0.0      
ref|XP_002305436.1|  hypothetical protein POPTR_0004s16370g             574   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011000403.1|  PREDICTED: laccase-11-like                         575   0.0      
ref|XP_003612037.1|  Laccase-11                                         575   0.0      
gb|AES94995.2|  laccase/diphenol oxidase family protein                 575   0.0      
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg             574   0.0      
ref|XP_004143251.1|  PREDICTED: laccase-11-like                         573   0.0      
ref|XP_002275392.1|  PREDICTED: laccase-11                              573   0.0      Vitis vinifera
ref|XP_010024157.1|  PREDICTED: laccase-11                              573   0.0      
ref|XP_007046899.1|  Laccase 11                                         573   0.0      
gb|AAT75352.1|  laccase-like multicopper oxidase 19                     564   0.0      Brassica napus [oilseed rape]
ref|XP_004292037.1|  PREDICTED: laccase-11-like                         572   0.0      
ref|XP_008352457.1|  PREDICTED: laccase-11-like                         572   0.0      
ref|XP_007042164.1|  Laccase 11                                         581   0.0      
emb|CDY62896.1|  BnaAnng18410D                                          571   0.0      
ref|XP_006347000.1|  PREDICTED: laccase-11-like                         571   0.0      
ref|XP_009593898.1|  PREDICTED: laccase-11-like                         571   0.0      
ref|XP_010107530.1|  hypothetical protein L484_024383                   571   0.0      
ref|XP_009125488.1|  PREDICTED: laccase-11                              570   0.0      
emb|CDY44351.1|  BnaC02g03260D                                          570   0.0      
ref|XP_004289138.1|  PREDICTED: laccase-11-like                         570   0.0      
sp|Q8RYM9.1|LAC2_ORYSJ  RecName: Full=Laccase-2; AltName: Full=Be...    570   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009340732.1|  PREDICTED: laccase-11-like                         569   0.0      
ref|XP_010263632.1|  PREDICTED: laccase-11-like                         580   0.0      
ref|XP_008811561.1|  PREDICTED: laccase-11-like                         568   0.0      
ref|XP_004292029.1|  PREDICTED: laccase-11-like                         569   0.0      
ref|XP_009593896.1|  PREDICTED: laccase-11-like                         569   0.0      
ref|XP_009793780.1|  PREDICTED: laccase-11-like                         569   0.0      
ref|XP_010254791.1|  PREDICTED: laccase-11-like                         580   0.0      
ref|XP_010452196.1|  PREDICTED: laccase-11                              568   0.0      
gb|EAZ12812.1|  hypothetical protein OsJ_02731                          568   0.0      
ref|XP_004300985.1|  PREDICTED: laccase-11-like                         568   0.0      
gb|EYU42613.1|  hypothetical protein MIMGU_mgv1a003791mg                568   0.0      
ref|XP_004969263.1|  PREDICTED: laccase-2-like                          568   0.0      
emb|CDX70319.1|  BnaA10g26680D                                          568   0.0      
ref|XP_010490794.1|  PREDICTED: laccase-11-like                         568   0.0      
ref|XP_006287320.1|  hypothetical protein CARUB_v10000520mg             568   0.0      
gb|KHN41966.1|  Laccase-11                                              567   0.0      
ref|XP_006340638.1|  PREDICTED: laccase-11-like                         566   0.0      
ref|XP_003538856.1|  PREDICTED: laccase-11-like                         566   0.0      
ref|XP_003516567.1|  PREDICTED: laccase-11-like                         566   0.0      
emb|CDY10394.1|  BnaCnng02950D                                          566   0.0      
ref|XP_009772835.1|  PREDICTED: laccase-11-like                         566   0.0      
ref|XP_004232420.1|  PREDICTED: laccase-11                              566   0.0      
ref|XP_008338318.1|  PREDICTED: laccase-11-like                         565   0.0      
ref|XP_010423743.1|  PREDICTED: laccase-11-like                         565   0.0      
ref|XP_009122722.1|  PREDICTED: laccase-11-like                         565   0.0      
ref|XP_009371609.1|  PREDICTED: laccase-11-like                         565   0.0      
ref|XP_008241697.1|  PREDICTED: laccase-11-like                         565   0.0      
ref|XP_006878556.1|  hypothetical protein AMTR_s00011p00235480          564   0.0      
ref|XP_003612035.1|  Laccase-11                                         564   0.0      
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         565   0.0      
ref|XP_004232419.1|  PREDICTED: laccase-11-like                         564   0.0      
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             565   0.0      
ref|XP_009342664.1|  PREDICTED: laccase-11-like                         564   0.0      
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 564   0.0      
ref|XP_006340637.1|  PREDICTED: laccase-11-like                         563   0.0      
ref|XP_007205004.1|  hypothetical protein PRUPE_ppa003572mg             563   0.0      
ref|XP_004972357.1|  PREDICTED: laccase-2-like                          563   0.0      
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         564   0.0      
ref|XP_002873085.1|  hypothetical protein ARALYDRAFT_487097             562   0.0      
gb|KHN14004.1|  Laccase-17                                              563   0.0      
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         563   0.0      
ref|XP_004512055.1|  PREDICTED: laccase-11-like                         563   0.0      
ref|XP_006466813.1|  PREDICTED: laccase-11-like                         563   0.0      
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              563   0.0      
ref|XP_006425656.1|  hypothetical protein CICLE_v10025287mg             562   0.0      
ref|XP_007204198.1|  hypothetical protein PRUPE_ppa003577mg             561   0.0      
ref|XP_008385897.1|  PREDICTED: laccase-11-like                         561   0.0      
emb|CBI17500.3|  unnamed protein product                                560   0.0      
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              561   0.0      
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         561   0.0      
ref|XP_006398771.1|  hypothetical protein EUTSA_v10013135mg             560   0.0      
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   560   0.0      
ref|NP_195946.2|  laccase 11                                            560   0.0      
ref|XP_010107320.1|  hypothetical protein L484_009454                   560   0.0      
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   560   0.0      
ref|XP_008797558.1|  PREDICTED: laccase-11-like                         570   0.0      
emb|CAB86093.1|  laccase precursor-like                                 559   0.0      
ref|XP_002266464.1|  PREDICTED: laccase-11                              559   0.0      
ref|XP_002310245.1|  hypothetical protein POPTR_0007s13050g             559   0.0      
gb|KDO37152.1|  hypothetical protein CISIN_1g040938mg                   556   0.0      
gb|EYU40190.1|  hypothetical protein MIMGU_mgv1a003793mg                558   0.0      
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         559   0.0      
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         558   0.0      
ref|XP_007156959.1|  hypothetical protein PHAVU_002G031700g             558   0.0      
gb|KFK24777.1|  hypothetical protein AALP_AA8G023500                    557   0.0      
emb|CDP02005.1|  unnamed protein product                                557   0.0      
gb|AAK37827.1|AF132123_1  laccase                                       558   0.0      
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             557   0.0      
ref|XP_008338086.1|  PREDICTED: laccase-11-like                         557   0.0      
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         556   0.0      
ref|XP_002531562.1|  laccase, putative                                  557   0.0      
ref|XP_006480875.1|  PREDICTED: laccase-17-like isoform X2              555   0.0      
ref|XP_010679744.1|  PREDICTED: laccase-11                              556   0.0      
emb|CBI30529.3|  unnamed protein product                                556   0.0      
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          556   0.0      
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              556   0.0      
ref|XP_011025818.1|  PREDICTED: laccase-11-like                         555   0.0      
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         554   0.0      
ref|XP_010543401.1|  PREDICTED: laccase-11-like                         553   0.0      
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             554   0.0      
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          554   0.0      
ref|XP_010558158.1|  PREDICTED: laccase-11                              553   0.0      
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         551   0.0      
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             550   0.0      
ref|XP_002278232.1|  PREDICTED: laccase-17-like                         550   0.0      
ref|XP_006846061.1|  hypothetical protein AMTR_s00012p00061860          549   0.0      
gb|KHN07178.1|  Laccase-17                                              547   0.0      
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          548   0.0      
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         548   0.0      
gb|KDP44830.1|  hypothetical protein JCGZ_01330                         544   0.0      
ref|XP_006846275.1|  hypothetical protein AMTR_s00012p00248430          548   0.0      
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          548   0.0      
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         548   0.0      
ref|XP_002282823.1|  PREDICTED: laccase-17                              548   0.0      
gb|KHG14663.1|  Laccase-4                                               544   0.0      
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             547   0.0      
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          547   0.0      
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         547   0.0      
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         546   0.0      
emb|CAN60069.1|  hypothetical protein VITISV_012401                     546   0.0      
gb|EPS68485.1|  hypothetical protein M569_06281                         543   0.0      
ref|XP_003532290.1|  PREDICTED: laccase-17-like isoform X1              546   0.0      
ref|XP_010683867.1|  PREDICTED: laccase-17-like                         544   0.0      
ref|XP_010922297.1|  PREDICTED: laccase-17-like                         543   0.0      
ref|XP_002282815.1|  PREDICTED: laccase-17                              543   0.0      
ref|XP_010256874.1|  PREDICTED: laccase-17-like                         543   0.0      
ref|XP_002278215.1|  PREDICTED: laccase-17                              542   0.0      
ref|XP_006846265.1|  hypothetical protein AMTR_s00012p00245710          542   0.0      
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         541   0.0      
gb|KHF97742.1|  Laccase-17 -like protein                                541   0.0      
ref|XP_008778964.1|  PREDICTED: laccase-17-like                         541   0.0      
ref|XP_008785574.1|  PREDICTED: laccase-17-like                         541   0.0      
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             542   0.0      
ref|XP_007026974.1|  Laccase 17                                         540   0.0      
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             539   0.0      
ref|XP_007016607.1|  Laccase 17                                         539   0.0      
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             538   0.0      
ref|XP_006644993.1|  PREDICTED: laccase-4-like                          538   0.0      
ref|XP_007026973.1|  Laccase 17                                         538   0.0      
ref|XP_007022468.1|  Laccase 17                                         538   0.0      
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   537   0.0      
gb|AAK37823.1|  laccase                                                 537   0.0      
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   536   0.0      
gb|AAK37825.1|AF132121_1  laccase                                       536   0.0      
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270          536   0.0      
gb|AAK37828.1|AF132124_1  laccase                                       536   0.0      
ref|XP_009388612.1|  PREDICTED: laccase-4-like                          534   0.0      
ref|XP_006424707.1|  hypothetical protein CICLE_v10028090mg             535   0.0      
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          535   0.0      
ref|XP_007026975.1|  Laccase 17                                         535   0.0      
ref|XP_011002147.1|  PREDICTED: laccase-17-like                         535   0.0      
gb|KDO73032.1|  hypothetical protein CISIN_1g008109mg                   534   0.0      
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         535   0.0      
gb|AAC04576.1|  putative high-pI laccase                                533   0.0      
ref|XP_006603494.1|  PREDICTED: laccase-17-like                         531   0.0      
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g             534   0.0      
ref|XP_004148786.1|  PREDICTED: laccase-17-like                         533   0.0      
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    533   0.0      
gb|AAB17192.1|  laccase                                                 533   0.0      
ref|NP_001044772.1|  Os01g0842400                                       533   0.0      
gb|EAZ14115.1|  hypothetical protein OsJ_04039                          533   0.0      
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g             533   0.0      
ref|XP_010654259.1|  PREDICTED: laccase-2-like                          533   0.0      
emb|CBI31631.3|  unnamed protein product                                548   0.0      
ref|XP_002278275.1|  PREDICTED: laccase-17                              533   1e-180   
gb|EEC71777.1|  hypothetical protein OsI_04389                          532   1e-180   
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         531   2e-180   
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         531   2e-180   
ref|XP_011095204.1|  PREDICTED: laccase-17-like                         531   3e-180   
gb|KHN16225.1|  Laccase-17                                              530   3e-180   
ref|XP_002299296.1|  laccase family protein                             531   4e-180   
ref|XP_007016584.1|  Laccase 17                                         531   5e-180   
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         531   6e-180   
ref|XP_010690924.1|  PREDICTED: laccase-17-like                         531   6e-180   
ref|XP_006602563.1|  PREDICTED: laccase-17-like                         530   7e-180   
ref|XP_008778578.1|  PREDICTED: laccase-10-like                         530   8e-180   
ref|XP_008801588.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4          528   9e-180   
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         529   9e-180   
ref|XP_010920538.1|  PREDICTED: laccase-4-like                          530   9e-180   
gb|KHN16226.1|  Laccase-17                                              530   1e-179   
ref|XP_006370270.1|  hypothetical protein POPTR_0001s41160g             530   1e-179   
ref|XP_011089492.1|  PREDICTED: laccase-17                              529   2e-179   
ref|XP_010106521.1|  hypothetical protein L484_025281                   529   3e-179   
ref|XP_010535559.1|  PREDICTED: laccase-17                              529   3e-179   
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                529   3e-179   
gb|KHN16229.1|  Laccase-17                                              528   4e-179   
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                528   4e-179   
gb|AAB17194.1|  laccase                                                 529   4e-179   
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          528   4e-179   
ref|XP_004970542.1|  PREDICTED: laccase-4-like                          528   6e-179   
ref|XP_006654510.1|  PREDICTED: laccase-12/13-like                      528   7e-179   
ref|XP_002531824.1|  laccase, putative                                  528   7e-179   
gb|AAU44018.1|  putative laccase                                        524   9e-179   
ref|XP_002520231.1|  laccase, putative                                  528   1e-178   
emb|CAN73336.1|  hypothetical protein VITISV_033042                     526   1e-178   
ref|XP_004961859.1|  PREDICTED: laccase-12/13-like                      527   1e-178   
ref|XP_002271047.2|  PREDICTED: laccase-17                              528   1e-178   
ref|XP_008359106.1|  PREDICTED: laccase-17-like                         527   1e-178   
ref|NP_001055747.1|  Os05g0458600                                       527   1e-178   
ref|XP_009416147.1|  PREDICTED: laccase-4-like                          527   1e-178   
emb|CBI30527.3|  unnamed protein product                                527   2e-178   
ref|XP_002439916.1|  hypothetical protein SORBIDRAFT_09g022510          527   2e-178   
emb|CBI30528.3|  unnamed protein product                                560   2e-178   
emb|CBI31651.3|  unnamed protein product                                543   2e-178   
ref|XP_003532315.1|  PREDICTED: laccase-17-like                         526   3e-178   
gb|AAB17193.1|  laccase                                                 526   4e-178   
ref|XP_004984718.1|  PREDICTED: laccase-10-like                         525   4e-178   
ref|XP_003552160.2|  PREDICTED: laccase-17-like isoform X1              526   5e-178   
ref|XP_006602579.1|  PREDICTED: laccase-17-like isoform X2              526   5e-178   
ref|XP_010043648.1|  PREDICTED: laccase-17-like                         526   6e-178   
gb|KDP35658.1|  hypothetical protein JCGZ_09096                         525   6e-178   
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      525   7e-178   
ref|XP_008222577.1|  PREDICTED: laccase-17-like                         525   7e-178   
ref|XP_010541373.1|  PREDICTED: laccase-17                              528   8e-178   
emb|CBI16199.3|  unnamed protein product                                525   1e-177   
ref|XP_010047833.1|  PREDICTED: laccase-17-like                         525   1e-177   
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          525   1e-177   
gb|KHN24984.1|  Laccase-17                                              524   1e-177   
emb|CAN71338.1|  hypothetical protein VITISV_008643                     523   1e-177   
gb|KHN24986.1|  Laccase-17                                              525   1e-177   
ref|XP_010690891.1|  PREDICTED: laccase-17-like                         525   1e-177   
gb|ACN34362.1|  unknown                                                 525   2e-177   
ref|XP_008385213.1|  PREDICTED: laccase-17-like                         524   2e-177   
ref|XP_011077639.1|  PREDICTED: laccase-17-like                         524   2e-177   
ref|XP_004970543.1|  PREDICTED: laccase-12/13-like                      524   2e-177   
ref|XP_004492318.1|  PREDICTED: laccase-17-like                         524   2e-177   
ref|XP_008358049.1|  PREDICTED: laccase-17-like                         524   3e-177   
ref|XP_003530894.1|  PREDICTED: laccase-17-like                         524   3e-177   
ref|NP_001147942.1|  L-ascorbate oxidase precursor                      524   3e-177   
ref|XP_002284473.1|  PREDICTED: laccase-17                              524   3e-177   
gb|AES79165.2|  laccase/diphenol oxidase family protein                 524   3e-177   
ref|NP_001105875.1|  putative laccase precursor                         524   4e-177   
emb|CDM84967.1|  unnamed protein product                                523   4e-177   
emb|CAN72263.1|  hypothetical protein VITISV_037366                     523   4e-177   
ref|XP_008665185.1|  PREDICTED: laccase-4-like                          523   5e-177   
ref|XP_009358279.1|  PREDICTED: laccase-17-like                         523   5e-177   
ref|XP_011094887.1|  PREDICTED: laccase-17-like                         523   6e-177   
ref|XP_011019227.1|  PREDICTED: laccase-4-like                          513   6e-177   
ref|XP_009354529.1|  PREDICTED: laccase-17-like                         523   7e-177   
gb|KHN36104.1|  Laccase-11                                              522   7e-177   
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg             523   8e-177   
gb|EMT20803.1|  Laccase-4                                               523   9e-177   
ref|XP_010264408.1|  PREDICTED: laccase-17-like                         523   9e-177   



>ref|XP_009786393.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=556

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/440 (90%), Positives = 419/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFTITGQRGTLFWHAH+LWLRSTVHGA+VILPKLGVPYPFPKPDHEAVVVLAEWW
Sbjct  106   QSYLYNFTITGQRGTLFWHAHILWLRSTVHGAIVILPKLGVPYPFPKPDHEAVVVLAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+AIKSGLAPNVSDAHTINGHPGP++NCPSQGGY LSVDPGKSYMLRVINAA
Sbjct  166   KSDTEAVINQAIKSGLAPNVSDAHTINGHPGPLSNCPSQGGYTLSVDPGKSYMLRVINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATY+KPFKT+TIVIAPGQTTNVIVTANQGSGKYMV ASPF
Sbjct  226   LNEELFFKIAGHKMTVVEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVVASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LT+TPPKNATPVANNFVD+LRSLNSK+YPA+V
Sbjct  286   MDAPIAVDNATATATLHYSGTLASSVTTLTNTPPKNATPVANNFVDSLRSLNSKKYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ VDHSLFFTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHFF IKGV+TT
Sbjct  346   PKNVDHSLFFTVGLGINPCPSCKQGNGSRVVASINNVTFVMPTTALLQAHFFGIKGVYTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP+ FNYTG  P NL TT+GTKVYRLPYNATVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  406   DFPQNPPIKFNYTGKPPVNLATTSGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+G+GNFNPKTDP  FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  466   FFAVGKGLGNFNPKTDPKNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  526   TTWGLKMAFLVDNGKGPNES  545



>ref|XP_009593041.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/440 (89%), Positives = 416/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFTITGQRGTLFWHAH+LWLRSTVHGA+VILPKLGVPYPFPKPDHEAVV+LAEWW
Sbjct  106   QSYLYNFTITGQRGTLFWHAHILWLRSTVHGAIVILPKLGVPYPFPKPDHEAVVILAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+AIKSGLAPNVSDAHTINGHPGP++NCPSQGGYKLSVDPGKSYMLRVINAA
Sbjct  166   KSDTEAVINQAIKSGLAPNVSDAHTINGHPGPLSNCPSQGGYKLSVDPGKSYMLRVINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATYVKPFKT+TIVIAPGQTTNVIV ANQGSGKYMV ASPF
Sbjct  226   LNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVAANQGSGKYMVVASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LT+TPPKNATPVANNFVD+LRSLNSK+YPA+V
Sbjct  286   MDAPIAVDNATATATLHYSGTLASSVTTLTNTPPKNATPVANNFVDSLRSLNSKKYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ VDHSLFFTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHFF IKGV+TT
Sbjct  346   PKNVDHSLFFTVGLGINPCPSCKQGNGSRVVASINNVTFVMPTTALLQAHFFGIKGVYTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  PANL T +GTKVYRLPYNATVQLVLQDTGII+PENHP+HLHGFN
Sbjct  406   DFPQNPPFKFNYTGTPPANLSTMSGTKVYRLPYNATVQLVLQDTGIISPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+G+GNFN K DP  FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  466   FFAVGKGLGNFNSKIDPKNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  526   TTWGLKMAFLVDNGKGPNES  545



>ref|XP_006349470.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=556

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/440 (88%), Positives = 416/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTLFWHAH+LWLR+T+HGA+VILPKLGVPYPFPKPDHEAVVVLAEWW
Sbjct  106   QNYVYNFTITGQRGTLFWHAHILWLRATMHGAIVILPKLGVPYPFPKPDHEAVVVLAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+AIKSGLAPNVSDAHTINGHPG ++NCPSQGGY LSVDPGKSYMLRVINAA
Sbjct  166   KSDTEAVINQAIKSGLAPNVSDAHTINGHPGAISNCPSQGGYTLSVDPGKSYMLRVINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATYVKPFKT+TI+IAPGQTTNVIVTAN+GSGKYMVAASPF
Sbjct  226   LNEELFFKIAGHKMTVVEVDATYVKPFKTDTIIIAPGQTTNVIVTANKGSGKYMVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LT+TPPKNATPVANNF+D+LRSLNSK+YPA+V
Sbjct  286   MDAPIAVDNVTATATLHYSGTLASSITTLTNTPPKNATPVANNFIDSLRSLNSKKYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ VDHSLFFTVGLG+NPC SCK  NGSRVVAS+NNVTFVMPTVA+LQAHFF IKGV+TT
Sbjct  346   PKKVDHSLFFTVGLGVNPCSSCKQGNGSRVVASINNVTFVMPTVAILQAHFFGIKGVYTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  P NL T +GTKVY LPYNATVQLVLQDTGII+PENHP+HLHGFN
Sbjct  406   DFPQNPPFKFNYTGTPPTNLATMSGTKVYLLPYNATVQLVLQDTGIISPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+GIGNFNPKTDP  FNL+DPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFAVGKGIGNFNPKTDPNNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  526   TTWGLKMAFLVDNGKGPNES  545



>ref|XP_009799024.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=557

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/440 (88%), Positives = 414/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILPKLGVPYPFPKP+HEAVV+LAEWW
Sbjct  107   QNYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVLLAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPV+NCPSQGGYKL+VDPGK+Y+LRVINAA
Sbjct  167   KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVSNCPSQGGYKLNVDPGKTYLLRVINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATYVKPFKT+TIVIAPGQTTNVIVTANQGSGKYMVAASPF
Sbjct  227   LNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TA ATLHYSG     R  LTSTPPKNATPVAN F+D+LRSLNSK+YPA V
Sbjct  287   MDAPIAVDNVTAIATLHYSGTQGNNRISLTSTPPKNATPVANTFLDSLRSLNSKKYPANV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ +DHSLFFTVGLG+NPCPSCK  NGSRVVASVNNVTFVMPT ALLQAHFF IKGVFTT
Sbjct  347   PKKIDHSLFFTVGLGINPCPSCKQGNGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP AFNYTG GPANL TT GTKVYRL YN TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  407   DFPANPPFAFNYTGTGPANLATTNGTKVYRLRYNDTVQLVLQDTGIIAPENHPIHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             F+ VG+GIGNFNPKTDP  FNLVDPVERNT+GVP+GGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  467   FYLVGKGIGNFNPKTDPKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMA+LVDNGKGPNES
Sbjct  527   TTWGLKMAWLVDNGKGPNES  546



>ref|XP_004249084.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=556

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/440 (87%), Positives = 414/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTLFWHAH+LWLR+T+HGA+VILPKLGVPYPFPKPDHEAVV+LAEWW
Sbjct  106   QNYVYNFTITGQRGTLFWHAHILWLRATMHGAIVILPKLGVPYPFPKPDHEAVVILAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+AIKSGLAPNVSDAHTINGHPG ++NCPSQGGY LSVDPGKSYMLRVINAA
Sbjct  166   KSDTEAVINQAIKSGLAPNVSDAHTINGHPGAISNCPSQGGYTLSVDPGKSYMLRVINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATYVKPFKT+TI+IAPGQTTNVIVTA++GSGKYMVAASPF
Sbjct  226   LNEELFFKIAGHKMTVVEVDATYVKPFKTDTIIIAPGQTTNVIVTADKGSGKYMVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LT TPPKNAT VANNF+D+LRSLNSK+YPA+V
Sbjct  286   MDAPIAVDNVTATATLHYSGTLASSITTLTKTPPKNATTVANNFIDSLRSLNSKKYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ VDHSLFFTVGLG+NPC SCK  NGSRVVAS+NNVTFVMPTVA+LQAHFF IKGV+TT
Sbjct  346   PKKVDHSLFFTVGLGVNPCSSCKQGNGSRVVASINNVTFVMPTVAILQAHFFGIKGVYTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  P NL T +GTKVYRLPYNATVQLVLQDTGII+PENHP+HLHGFN
Sbjct  406   DFPQNPPFKFNYTGTPPTNLATMSGTKVYRLPYNATVQLVLQDTGIISPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+GIGNFNPK DP  FNL+DPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFAVGKGIGNFNPKKDPNNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  526   TTWGLKMAFLVDNGKGPNES  545



>ref|XP_009624727.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/440 (88%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILPKLGVPYPFPKP+HEAVV+LAEWW
Sbjct  107   QNYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVILAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPV+NC SQGGYKL+VDPGK+YMLRVINAA
Sbjct  167   KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVSNCASQGGYKLNVDPGKTYMLRVINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATY+KPFKT+TIVIAPGQTTNVIVTANQGSGKYMVAASPF
Sbjct  227   LNEELFFKIAGHKMTVVEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TA ATLHYSG        LTSTPPKNATPVAN F+D+LRSLNSK+YPA+V
Sbjct  287   MDAPIAVDNVTAIATLHYSGTQGNSHISLTSTPPKNATPVANTFLDSLRSLNSKKYPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ +DHSLFFTVGLG+NPCP+CK  NGSRVVASVNNVTFVMPTVALLQAHFF IKGVFTT
Sbjct  347   PKKIDHSLFFTVGLGINPCPTCKQGNGSRVVASVNNVTFVMPTVALLQAHFFGIKGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP AFNYTG GP NL T  GTKVYRL YN TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  407   DFPANPPFAFNYTGTGPTNLATMNGTKVYRLRYNDTVQLVLQDTGIIAPENHPIHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+GIGNFNPKTDP  FNLVDPVERNT+GVP+GGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  467   FFLVGKGIGNFNPKTDPKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMA+LVDNGKGPNES
Sbjct  527   TTWGLKMAWLVDNGKGPNES  546



>ref|XP_009787551.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=554

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/440 (88%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFTITGQRGTLFWHAHVLWLRSTVHGA+V+LPK GVPYPFPKP+HEAVVVLAEWW
Sbjct  104   QSYIYNFTITGQRGTLFWHAHVLWLRSTVHGAIVVLPKRGVPYPFPKPNHEAVVVLAEWW  163

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPGPV+NCP+QGGY LSV PGK+YMLRVINAA
Sbjct  164   KSDTEAVINEALKSGLAPNVSDAHTINGHPGPVSNCPTQGGYTLSVKPGKTYMLRVINAA  223

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATYVKPFKT+TIVIAPGQTTNVIVTA+Q  GKYMVAASPF
Sbjct  224   LNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQSFGKYMVAASPF  283

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSGAL    T LTSTPP+NAT VANNF+DAL+SLNSK+YPA+V
Sbjct  284   MDAPIAVDNITATATLHYSGALGSSPTTLTSTPPQNATSVANNFLDALKSLNSKKYPAKV  343

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQTVDHSLFFTVGLG+NPCP+CK ANGSRVVASVNNVTF+MPTVALLQAHFF I GVFTT
Sbjct  344   PQTVDHSLFFTVGLGINPCPTCKQANGSRVVASVNNVTFIMPTVALLQAHFFGINGVFTT  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  P NL TT GTKVYRLPYNATVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  404   DFPANPPFVFNYTGTSPTNLATTKGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GNFN KTDP  FNL+DPVERNTIGVPSGGWVAIR+RADNPGVWFMHCHLEVH
Sbjct  464   FFLVGKGLGNFNSKTDPKNFNLIDPVERNTIGVPSGGWVAIRWRADNPGVWFMHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKG NES
Sbjct  524   TTWGLKMAFLVDNGKGSNES  543



>gb|AAC49536.1| diphenol oxidase [Nicotiana tabacum]
Length=557

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/440 (87%), Positives = 410/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILP LGVPYPFPKP+HEAVV+LAEWW
Sbjct  107   QNYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPNLGVPYPFPKPNHEAVVILAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPV+NC SQGGYKL+VDPGK+YMLRVINAA
Sbjct  167   KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVSNCASQGGYKLNVDPGKTYMLRVINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATY+KPFKT+TIVIAPGQTTNVIVTANQGSGKYMVAASPF
Sbjct  227   LNEELFFKIAGHKMTVVEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TA ATLHYSG        LTSTPPKNATPVAN F+D+LRSLNSK+YPA+V
Sbjct  287   MDAPIAVDNVTAIATLHYSGTQGNSHISLTSTPPKNATPVANTFLDSLRSLNSKKYPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ +DHSLFFTVGLG+NPCP+CK  NGSRVVASVNNVTFVMPTVALLQAHFF  KGVFTT
Sbjct  347   PKKIDHSLFFTVGLGINPCPTCKQGNGSRVVASVNNVTFVMPTVALLQAHFFGTKGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP AFNYTG GP NL T  GTKVYRL YN TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  407   DFPANPPFAFNYTGTGPTNLATMNGTKVYRLRYNDTVQLVLQDTGIIAPENHPIHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+GIGNFNPKTDP  FNLVDPVERNT+GVP+GGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  467   FFLVGKGIGNFNPKTDPKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEIH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMA+LVDNGKGPNES
Sbjct  527   TTWGLKMAWLVDNGKGPNES  546



>gb|EYU41858.1| hypothetical protein MIMGU_mgv1a003895mg [Erythranthe guttata]
Length=557

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/441 (87%), Positives = 414/441 (94%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFTITGQRGTLFWHAH+LWLRSTVHGALVILPKLGVPYPFPKPDHE+VVVL EWW
Sbjct  106   HSYVYNFTITGQRGTLFWHAHILWLRSTVHGALVILPKLGVPYPFPKPDHESVVVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPGP++NCPS GG+ L+V PGK+YMLR+INAA
Sbjct  166   KSDTEAVINEALKSGLAPNVSDAHTINGHPGPISNCPSTGGFSLNVSPGKNYMLRLINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+TI+IAPGQTTNVIVTA+QG+GKYMVAASPF
Sbjct  226   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTILIAPGQTTNVIVTADQGAGKYMVAASPF  285

Query  1019  MDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P+ AVDN+TATAT+HYSG L+   T  T+TPP+NATPVANNFV++LRSLNSK+YPA+
Sbjct  286   MDTPVVAVDNKTATATIHYSGTLANSPTSFTATPPQNATPVANNFVNSLRSLNSKKYPAK  345

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSL FTVGLG+N CPSCK  NGSRVVASVNNVTFVMPTVALLQAH  NIKGVFT
Sbjct  346   VPMKIDHSLLFTVGLGINRCPSCKAGNGSRVVASVNNVTFVMPTVALLQAHVQNIKGVFT  405

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             +DFPGNPP AFNYTGA PANL TTTGTKVYRLPYNATVQ+VLQDTGIIAPENHPVHLHGF
Sbjct  406   SDFPGNPPHAFNYTGAPPANLSTTTGTKVYRLPYNATVQVVLQDTGIIAPENHPVHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFFAVGRG+GN+NPKTDP  FNLVDPVERNTIGVPSGGWVAIRF ADNPGVWFMHCHLEV
Sbjct  466   NFFAVGRGLGNYNPKTDPNNFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEV  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLVDNGKGPN+S
Sbjct  526   HTTWGLKMAFLVDNGKGPNQS  546



>ref|XP_009593274.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=554

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/440 (88%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFTITGQRGTLFWHAHVLWLRSTVHGA+V+LPK GVPYPFPKP+HEAVVVLAEWW
Sbjct  104   QSYIYNFTITGQRGTLFWHAHVLWLRSTVHGAIVVLPKRGVPYPFPKPNHEAVVVLAEWW  163

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPGPV+NCP+QGGY LSV+PGK+YMLRVINAA
Sbjct  164   KSDTEAVINEALKSGLAPNVSDAHTINGHPGPVSNCPTQGGYSLSVEPGKTYMLRVINAA  223

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATYVKPFKT+TIVIAPGQTTNVIVTA+Q  GKYMVAASPF
Sbjct  224   LNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQSFGKYMVAASPF  283

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSGAL    T LTSTPP+NAT VANNF+DAL+SLNSK+YPA+V
Sbjct  284   MDAPIAVDNITATATLHYSGALGTSPTTLTSTPPQNATSVANNFLDALKSLNSKKYPAKV  343

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQTVDHSLFFT GLG+NPCP+CK ANGSRVVASVNNVTFVMPTVALLQAHFF I GVFTT
Sbjct  344   PQTVDHSLFFTAGLGINPCPTCKQANGSRVVASVNNVTFVMPTVALLQAHFFGINGVFTT  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  P NL TT GTKVYRLPYNATVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  404   DFPANPPFVFNYTGTPPTNLATTKGTKVYRLPYNATVQLVLQDTGIIAPENHPIHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GNFN KTDP  FNL+DPVERNTIGVPSGGWVAIR+ ADNPGVWFMHCHLEVH
Sbjct  464   FFLVGKGLGNFNSKTDPKNFNLIDPVERNTIGVPSGGWVAIRWLADNPGVWFMHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP ES
Sbjct  524   TTWGLKMAFLVDNGKGPKES  543



>ref|XP_011094977.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=558

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/442 (85%), Positives = 408/442 (92%), Gaps = 2/442 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFTITGQRGTL WHAH+LWLR+T+HGALVILPKLGVPYPFPKPDHEAVVVL EWW
Sbjct  106   HSYVYNFTITGQRGTLLWHAHILWLRATLHGALVILPKLGVPYPFPKPDHEAVVVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGG-YKLSVDPGKSYMLRVINA  1203
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPGPV+NCPS GG + L+V PGK+YMLR+INA
Sbjct  166   KSDTEAVINEALKSGLAPNVSDAHTINGHPGPVSNCPSTGGGFTLNVSPGKTYMLRLINA  225

Query  1202  ALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASP  1023
             ALNEELFFKIAGH++TVVEVDATYVKPFKT+T++IAPGQTTNVIV A+QG+GKYM+AASP
Sbjct  226   ALNEELFFKIAGHKLTVVEVDATYVKPFKTDTVLIAPGQTTNVIVVADQGAGKYMLAASP  285

Query  1022  FMDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPA  846
             F+D PI AVDN TATATLHYSG L+   T  TSTP +NATPVANNFV++LRSLNSK+YPA
Sbjct  286   FLDTPIVAVDNMTATATLHYSGTLASSPTTFTSTPARNATPVANNFVNSLRSLNSKKYPA  345

Query  845   RVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVF  666
             +VPQ VDHSLFFTVGLG+NPCPSCK  NGSR VAS+NNVTFVMPT+ALLQAH   IKGVF
Sbjct  346   KVPQKVDHSLFFTVGLGINPCPSCKAGNGSRAVASINNVTFVMPTIALLQAHVLKIKGVF  405

Query  665   TTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             TTDFP NPP AFNYTG  PANL TTTGTKVY+LPYN+TVQ+VLQDTGIIAPENHPVHLHG
Sbjct  406   TTDFPANPPFAFNYTGTPPANLATTTGTKVYKLPYNSTVQVVLQDTGIIAPENHPVHLHG  465

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFFAVGRG+GNFNPKTDP  FNL+DPVERNTIGVPSGGWVAIRF ADNPGVWFMHCHLE
Sbjct  466   FNFFAVGRGLGNFNPKTDPKNFNLIDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLE  525

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAFLV+NG GPNES
Sbjct  526   VHTTWGLKMAFLVENGNGPNES  547



>ref|XP_007026782.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY07284.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
Length=490

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/440 (83%), Positives = 406/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLRSTVHGA+VILPK GVPYPFPKP  E VV+LAEWW
Sbjct  40    QSYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVILPKRGVPYPFPKPHKEVVVILAEWW  99

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGH GPV++CPSQGG+ L V+ GK+Y+LR+INAA
Sbjct  100   KSDTEAVINEALKSGLAPNVSDAHTINGHTGPVSSCPSQGGFTLPVENGKTYLLRLINAA  159

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT T++IAPGQTTNV+V+A++ SGKY+VAASPF
Sbjct  160   LNEELFFKIAGHKLTVVEVDATYVKPFKTKTVIIAPGQTTNVLVSADKSSGKYLVAASPF  219

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LTS PPKNATPVANNF+++LR+LNSKQYPA V
Sbjct  220   MDAPIAVDNLTATATLHYSGTLANTPTTLTSLPPKNATPVANNFINSLRALNSKQYPALV  279

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQ++DH+LFFTVGLG+NPCP+CK  NGSR VAS+NNVTFVMPT ALLQAHFFNI GVFTT
Sbjct  280   PQSIDHNLFFTVGLGINPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHFFNISGVFTT  339

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G  P NLQTT GTKV+RL YN+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  340   DFPANPPNVFNYSGTPPTNLQTTNGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFN  399

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPKTDP  FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF+HCHLEVH
Sbjct  400   FFAVGRGLGNYNPKTDPQNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFLHCHLEVH  459

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPN+S
Sbjct  460   TTWGLKMAFLVDNGKGPNQS  479



>ref|XP_004246339.1| PREDICTED: laccase-4 [Solanum lycopersicum]
Length=561

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/444 (84%), Positives = 410/444 (92%), Gaps = 4/444 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILPKLGVPYPFPKP+HEAVV+LAEWW
Sbjct  107   QNYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVILAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPV+NCP+QGGYKL+V+ GK+YMLRVINAA
Sbjct  167   KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVSNCPAQGGYKLNVEQGKTYMLRVINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATY+KPF+T+TIVIAPGQTTNVIV AN+ SGKYMV ASPF
Sbjct  227   LNEELFFKIAGHKMTVVEVDATYIKPFQTDTIVIAPGQTTNVIVNANKNSGKYMVVASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALS-GLRTVLTS--TPPKNATPVANNFVDALRSLNSKQYP  849
             MDAPIAVDN TA ATLHYSG LS    T LTS  TPPKNATP+ANNF+DALRSLNSK+YP
Sbjct  287   MDAPIAVDNVTAIATLHYSGTLSNNPSTTLTSTNTPPKNATPIANNFLDALRSLNSKKYP  346

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A+VP  +DHSL FTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT+ALLQAHF  IKGV
Sbjct  347   AKVPIKIDHSLLFTVGLGINPCPSCKQGNGSRVVASINNVTFVMPTIALLQAHFSGIKGV  406

Query  668   FTTDFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHL  492
             FT DFPGNPPV +NYT    PAN+ TT+GTKVY+L YN TVQLVLQDTGIIAPENHP+HL
Sbjct  407   FTADFPGNPPVVYNYTSTTPPANMGTTSGTKVYKLSYNDTVQLVLQDTGIIAPENHPIHL  466

Query  491   HGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCH  312
             HGFNF+ VG+G+GN+NPK DP  FNLVDPVERNT+GVPSGGWVAIRFRADNPGVWFMHCH
Sbjct  467   HGFNFYQVGKGLGNYNPKVDPKNFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCH  526

Query  311   LEVHTTWGLKMAFLVDNGKGPNES  240
             LE+HTTWGLKMAFLV+NGKGPNES
Sbjct  527   LEIHTTWGLKMAFLVENGKGPNES  550



>ref|XP_007026781.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY07283.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
Length=556

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/440 (83%), Positives = 406/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLRSTVHGA+VILPK GVPYPFPKP  E VV+LAEWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVILPKRGVPYPFPKPHKEVVVILAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGH GPV++CPSQGG+ L V+ GK+Y+LR+INAA
Sbjct  166   KSDTEAVINEALKSGLAPNVSDAHTINGHTGPVSSCPSQGGFTLPVENGKTYLLRLINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT T++IAPGQTTNV+V+A++ SGKY+VAASPF
Sbjct  226   LNEELFFKIAGHKLTVVEVDATYVKPFKTKTVIIAPGQTTNVLVSADKSSGKYLVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LTS PPKNATPVANNF+++LR+LNSKQYPA V
Sbjct  286   MDAPIAVDNLTATATLHYSGTLANTPTTLTSLPPKNATPVANNFINSLRALNSKQYPALV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQ++DH+LFFTVGLG+NPCP+CK  NGSR VAS+NNVTFVMPT ALLQAHFFNI GVFTT
Sbjct  346   PQSIDHNLFFTVGLGINPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHFFNISGVFTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G  P NLQTT GTKV+RL YN+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  406   DFPANPPNVFNYSGTPPTNLQTTNGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPKTDP  FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF+HCHLEVH
Sbjct  466   FFAVGRGLGNYNPKTDPQNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFLHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPN+S
Sbjct  526   TTWGLKMAFLVDNGKGPNQS  545



>ref|XP_002322961.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
 gb|EEF04722.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
Length=557

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/440 (84%), Positives = 401/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGALV+LPKLGVPYPFP P  E VVVLAEWW
Sbjct  107   QSYVYNFTITGQRGTLLWHAHILWLRATVHGALVVLPKLGVPYPFPAPHKEVVVVLAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ C SQGG+ L V  GK+YMLR+INAA
Sbjct  167   KSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVQSGKTYMLRLINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+T++IAPGQTTNV+VT N+ +GKY+VAASPF
Sbjct  227   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSGALS   T LT  PPKNAT +AN F ++LRSLNSK +PA+V
Sbjct  287   MDAPIAVDNMTATATLHYSGALSNSPTTLTIPPPKNATAIANQFTNSLRSLNSKTFPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSLFFTVGLG+NPCP+CK  NGSRVVAS+NNVTFVMPT ALLQAHFFNI GVFTT
Sbjct  347   PLTVDHSLFFTVGLGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNYTG  P NLQTT+GTK YRLPYN+TVQLV+QDTGII+PENHP+HLHGFN
Sbjct  407   DFPAKPPHVFNYTGTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENHPIHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPKTDP KFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  467   FFAVGRGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  527   TTWGLKMAFLVDNGKGPNES  546



>ref|XP_006429309.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
 ref|XP_006480970.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR42549.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
Length=555

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/440 (83%), Positives = 404/440 (92%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFTITGQRGTL WHAH+LWLR+TVHGA+VILPK GVPYPFPKP  E VVVLAEWW
Sbjct  106   HSYVYNFTITGQRGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVVVVLAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+A++SGLAPNVSD+HTING PGP+++C SQGG+ L VD GK+YMLR+INAA
Sbjct  166   KSDTEAVINQALRSGLAPNVSDSHTINGQPGPISSCSSQGGFTLPVDSGKTYMLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+TIVIAPGQTTNV+++A++ SGKY+VAASPF
Sbjct  226   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTIVIAPGQTTNVLLSADKTSGKYLVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LTSTPPKN T +AN F+D+LRSLNSK+YPA+V
Sbjct  286   MDAPIAVDNATATATLHYSGTLASSATTLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQTVDH+L FTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT+ALLQAHFFNI GVFTT
Sbjct  346   PQTVDHNLLFTVGLGVNPCPSCKAGNGSRVVASINNVTFVMPTIALLQAHFFNISGVFTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  +N+TG  P NLQT+ GTK YRL YN+TVQL+LQDTGIIAPENHPVHLHGFN
Sbjct  406   DFPGNPPHTYNFTGT-PKNLQTSNGTKAYRLAYNSTVQLILQDTGIIAPENHPVHLHGFN  464

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+G+GNFNPK DP KFNLVDPVERNTIGVPSGGWVAIRF ADNPGVWFMHCHLEVH
Sbjct  465   FFAVGKGLGNFNPKKDPKKFNLVDPVERNTIGVPSGGWVAIRFSADNPGVWFMHCHLEVH  524

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  525   TTWGLKMAFLVDNGKGPNES  544



>ref|XP_006363052.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=561

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/444 (83%), Positives = 407/444 (92%), Gaps = 4/444 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILPKLGVPYPFPKP+HEAVV+LAEWW
Sbjct  107   QNYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVILAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPV+NCPSQGGYKL+V+PGK+YMLRVINAA
Sbjct  167   KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVSNCPSQGGYKLNVEPGKTYMLRVINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATY+KPF+T+TIVIAPGQTTNVIV AN+ SGKYMV ASPF
Sbjct  227   LNEELFFKIAGHKMTVVEVDATYIKPFQTDTIVIAPGQTTNVIVNANKNSGKYMVVASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALS-GLRTVLTS--TPPKNATPVANNFVDALRSLNSKQYP  849
             MD+PIAVDN TA ATLHYS  L+    T LTS  TPPKNATP+ANNF+D+LRSLNSK+YP
Sbjct  287   MDSPIAVDNVTAIATLHYSATLTNNPSTTLTSTNTPPKNATPIANNFLDSLRSLNSKKYP  346

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A+VP  +DHSL FTV LG+NPCPSCK  NGSRVVAS+NNVTFVMPT+ALLQAHF  IKGV
Sbjct  347   AKVPIKIDHSLLFTVSLGINPCPSCKQGNGSRVVASINNVTFVMPTIALLQAHFSGIKGV  406

Query  668   FTTDFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHL  492
             FT DFPGNPP  +NYT    PAN+ TT+GTKVY+L YN TVQLVLQDTGIIAPENHP+HL
Sbjct  407   FTADFPGNPPFVYNYTNTTPPANMGTTSGTKVYKLSYNDTVQLVLQDTGIIAPENHPIHL  466

Query  491   HGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCH  312
             HGFNF+ VG+G+GN+NPK DP  FNLVDPVERNT+GVPSGGWVAIRFR DNPGVWFMHCH
Sbjct  467   HGFNFYQVGKGLGNYNPKVDPKNFNLVDPVERNTVGVPSGGWVAIRFRTDNPGVWFMHCH  526

Query  311   LEVHTTWGLKMAFLVDNGKGPNES  240
             LE+HTTWGLKMAFLVDNGKGPNES
Sbjct  527   LEIHTTWGLKMAFLVDNGKGPNES  550



>ref|XP_011077581.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=557

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/440 (84%), Positives = 402/440 (91%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+T+HGALVILPKLGVPYPFPKP+HE V++L EWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRATLHGALVILPKLGVPYPFPKPNHERVIILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPGPV NC S  G+ L V+PGK+Y+LR+INAA
Sbjct  166   KSDTEAVINEALKSGLAPNVSDAHTINGHPGPVPNCSSTDGFILDVEPGKTYLLRLINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MT+VEVDATYVKPFKT+TIVIAPGQTTN I+T ++  GKYMVAASPF
Sbjct  226   LNEELFFKIAGHRMTIVEVDATYVKPFKTDTIVIAPGQTTNAILTTDRAVGKYMVAASPF  285

Query  1019  MDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P+ AVDN TATATLHYSG LS   T  T  P +NATPVANNF ++LRSLNS +YPA+
Sbjct  286   MDTPVVAVDNLTATATLHYSGTLSSSLTTFTRPPAQNATPVANNFTNSLRSLNSNKYPAK  345

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VPQ VDHSLFFTVGLG+NPCP+CK  NGSRVVA+VNNVTFVMPT+ALLQAHFFNIKGVFT
Sbjct  346   VPQKVDHSLFFTVGLGINPCPTCKATNGSRVVAAVNNVTFVMPTIALLQAHFFNIKGVFT  405

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPGNPP AFNYTG+ PANL TT GTK+YRLPYNATVQ+VLQDTGIIAPENHP+HLHGF
Sbjct  406   TDFPGNPPFAFNYTGSPPANLGTTNGTKLYRLPYNATVQVVLQDTGIIAPENHPIHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GNFNPKTDP  FNLVDPVERNTIGVPSGGWVAIRF ADNPGVWFMHCHLEV
Sbjct  466   NFFVVGRGLGNFNPKTDPKTFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEV  525

Query  302   HTTWGLKMAFLVDNGKGPNE  243
             HTTWGLKMAFLVDNGKGPNE
Sbjct  526   HTTWGLKMAFLVDNGKGPNE  545



>ref|XP_011003662.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=557

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/440 (83%), Positives = 400/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGA+V+LPKLGVPYPFP P  E VVVLAEWW
Sbjct  107   QSYVYNFTITGQRGTLLWHAHILWLRATVHGAIVVLPKLGVPYPFPAPHKEVVVVLAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ C SQGG+ L V  GK+YMLR+INAA
Sbjct  167   KSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVQSGKTYMLRLINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++T+VEVDATYVKPFKT+T++IAPGQTTNV+VT N+ +GKY+VAASPF
Sbjct  227   LNEELFFKIAGHKLTLVEVDATYVKPFKTSTVLIAPGQTTNVLVTTNKNTGKYLVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSGALS   T LT  PPKNAT +AN F ++LRSLNSK +PA+V
Sbjct  287   MDAPIAVDNMTATATLHYSGALSNSPTTLTVPPPKNATAIANQFTNSLRSLNSKTFPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSLFFTVGLG+NPCP+CK  NGSRVVAS+NNVTFVMPT ALLQAHFFNI GVFTT
Sbjct  347   PLTVDHSLFFTVGLGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNYTG  P NLQTT+GTK YRLPYN+TVQLV+QDTGII+PENHP+HLHGFN
Sbjct  407   DFPAKPPHVFNYTGTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENHPIHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG G+GN+NPKTDP KFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  467   FFAVGGGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  527   TTWGLKMAFLVDNGKGPNES  546



>emb|CDP06511.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/441 (84%), Positives = 402/441 (91%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGA+VILPK GV YPFPKP HE VVVL EWW
Sbjct  110   QSYVYNFTITGQRGTLLWHAHILWLRATVHGAVVILPKRGVLYPFPKPHHENVVVLGEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPS-QGGYKLSVDPGKSYMLRVINA  1203
             KSDTEAVINEA+KSG+APNVSDAHTINGHPG V NC S QGG+ LSV+PGKSY+LRVINA
Sbjct  170   KSDTEAVINEALKSGMAPNVSDAHTINGHPGAVANCSSDQGGFTLSVEPGKSYLLRVINA  229

Query  1202  ALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASP  1023
             ALNEELFFKIAGH +TVVEVDATYVKPFKT+TI++APGQTTNVIVTA+Q +GKYMV+AS 
Sbjct  230   ALNEELFFKIAGHTLTVVEVDATYVKPFKTDTILVAPGQTTNVIVTADQSAGKYMVSAST  289

Query  1022  FMDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             FMD+ IAVDN +ATATLHYSG LS   T  T+ P  NATPVAN F ++LRSLNS++YPA+
Sbjct  290   FMDSTIAVDNTSATATLHYSGTLSSSPTTFTTAPALNATPVANKFTNSLRSLNSEKYPAQ  349

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VPQTVDHSLFF V LG+NPCP+CK ANGSRVVASVNNVTFVMPTVALLQAHFFNI GVFT
Sbjct  350   VPQTVDHSLFFVVSLGINPCPTCKAANGSRVVASVNNVTFVMPTVALLQAHFFNINGVFT  409

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPGNPP  FNYTG  PANLQT  GTKVYRLPYNATVQ+VLQDTGI+APENHP+HLHGF
Sbjct  410   TDFPGNPPSPFNYTGTPPANLQTKNGTKVYRLPYNATVQVVLQDTGIVAPENHPIHLHGF  469

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFFAVGRG+GNF+PKTDP KFNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEV
Sbjct  470   NFFAVGRGLGNFDPKTDPKKFNLVDPVERNTIGVPTGGWVAIRFRADNPGVWFMHCHLEV  529

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLVDNGKG NES
Sbjct  530   HTTWGLKMAFLVDNGKGTNES  550



>gb|KDP24484.1| hypothetical protein JCGZ_25048 [Jatropha curcas]
Length=486

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/440 (82%), Positives = 400/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTL WHAH+LWLRSTVHG LVILPK GVPYPFP P  E VVVLAEWW
Sbjct  36    QNYVYNFTITGQRGTLLWHAHILWLRSTVHGGLVILPKRGVPYPFPAPHKEVVVVLAEWW  95

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V NCPSQ G+ L V+ GK+Y+LR++NAA
Sbjct  96    KSDTEAVINEALKSGLAPNVSDAHTINGHPGAVANCPSQDGFNLPVENGKTYLLRLVNAA  155

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDATYVKPFKT+T++IAPGQTTNV+VTA+Q SGKY+VAA+PF
Sbjct  156   LNEELFFKIAGHQLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTADQSSGKYLVAAAPF  215

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AVDN+TATATLHYS ALS   T+LT  PP+NAT VAN F+++LRSLNSK+YPA+V
Sbjct  216   MDAPVAVDNKTATATLHYSAALSSTTTILTKPPPQNATAVANKFINSLRSLNSKKYPAKV  275

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTVGLG+NPCP+CK  NGSRVVAS+NNVTFVMPT ALLQAHFFNI GVFTT
Sbjct  276   PLKIDHNLLFTVGLGVNPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNINGVFTT  335

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FN+TG GPANLQT  GT+VY+L YN TVQLV+QDTGIIAPENHPVHLHGFN
Sbjct  336   DFPANPPHVFNFTGKGPANLQTKNGTRVYKLKYNETVQLVMQDTGIIAPENHPVHLHGFN  395

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRGIG++NPKTDP  FNLVDP ERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  396   FFAVGRGIGSYNPKTDPQNFNLVDPPERNTIGVPTGGWVAIRFRADNPGVWFMHCHLEVH  455

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPNES
Sbjct  456   TTWGLKMAFLVENGKGPNES  475



>ref|XP_004249583.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=557

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/441 (83%), Positives = 402/441 (91%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILPK GVPYPFPKP+HEAVVVL EWW
Sbjct  106   QNYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPKPNHEAVVVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAV+NEA+ SGLAPNVSDAHTINGHPGPV NCPS+GGY LSV PGK+YMLRVINAA
Sbjct  166   KSDTEAVVNEALNSGLAPNVSDAHTINGHPGPVPNCPSEGGYTLSVAPGKTYMLRVINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATYVKPFK++TI+IAPGQTTNVI+TA+Q  GKYM+ ASPF
Sbjct  226   LNEELFFKIAGHKMTVVEVDATYVKPFKSDTILIAPGQTTNVILTADQKFGKYMMIASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PI VDN TATATLHY+GALS     LTS PP+NAT VANNF+D+L+SLNSK+YPA+V
Sbjct  286   MDSPITVDNVTATATLHYTGALSSAPMTLTSAPPQNATLVANNFIDSLKSLNSKKYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VDHSL FTVGLG+NPCP+C PANGSRVVAS+NNVTFVMPT ALLQAHFF IK VFTT
Sbjct  346   PNNVDHSLLFTVGLGINPCPTCIPANGSRVVASINNVTFVMPTTALLQAHFFGIKNVFTT  405

Query  659   DFPGNPPVAFNYTGA-GPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFPGNPP  FNYT    P +L TT GTK+YRL Y+ATVQLVLQDTGIIAPENHP+HLHGF
Sbjct  406   DFPGNPPFIFNYTSTLPPPSLATTNGTKLYRLRYDATVQLVLQDTGIIAPENHPIHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFFAVG+G+GNFNPK D   FNL+DPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE+
Sbjct  466   NFFAVGKGLGNFNPKIDTKNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEI  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLVDNGKGPNES
Sbjct  526   HTTWGLKMAFLVDNGKGPNES  546



>ref|XP_010044089.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86095.1| hypothetical protein EUGRSUZ_B02796 [Eucalyptus grandis]
Length=556

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/440 (83%), Positives = 403/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVI++AIKSGLAPNVSDAHTINGHPGP +NCPSQGG+ L V+ GK YMLR+INAA
Sbjct  166   KSDTEAVISQAIKSGLAPNVSDAHTINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+T+VEVDATYVKPFKT+TIVIAPGQTTN +++ +Q SGKYMVAASPF
Sbjct  226   LNEELFFKIAGHQLTIVEVDATYVKPFKTDTIVIAPGQTTNALISTDQSSGKYMVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYSG L+   T LT TPP+NAT VANNFV++LRSLNSK+YPA++
Sbjct  286   MDSPIAVDNMTATATLHYSGTLAATSTTLTKTPPQNATAVANNFVNSLRSLNSKRYPAKI  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL FTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT A+LQAHFFN  GVFT+
Sbjct  346   PLTVDHSLLFTVGLGINPCPSCKAGNGSRVVASMNNVTFVMPTTAILQAHFFNKSGVFTS  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNYTG+ P+NL+TT+GTKVYRL YN+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  406   DFPGNPPTIFNYTGSPPSNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFA+G+G+GN+NPK D   FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFAIGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  526   TTWGLKMAFLVDNGKGPNES  545



>ref|XP_010044090.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044092.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044093.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86096.1| hypothetical protein EUGRSUZ_B02797 [Eucalyptus grandis]
 gb|KCW86097.1| hypothetical protein EUGRSUZ_B02798 [Eucalyptus grandis]
 gb|KCW86098.1| hypothetical protein EUGRSUZ_B02799 [Eucalyptus grandis]
Length=556

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/440 (83%), Positives = 402/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVI +AIKSGLAPNVSDAHTINGHPGP++NCPSQGG+ L V+ GK YMLR++NAA
Sbjct  166   KSDTEAVIKQAIKSGLAPNVSDAHTINGHPGPISNCPSQGGFTLPVESGKRYMLRIVNAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+T+VEVDATYVKPFKT+TIVIAPGQTTN +++A+Q SGKY+VAASPF
Sbjct  226   LNEELFFKIAGHQLTIVEVDATYVKPFKTDTIVIAPGQTTNALISADQSSGKYLVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PI VDN TATATLHYSG L+   T LT TPP+NAT VANNF+++LRSLNSK YPA+V
Sbjct  286   MDSPITVDNMTATATLHYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKIYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDH+L FTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHFFNI GVFT+
Sbjct  346   PLTVDHNLLFTVGLGINPCPSCKAGNGSRVVASMNNVTFVMPTTALLQAHFFNISGVFTS  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNYTG+ P NL+TT+GTKVYRL YN+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  406   DFPGNPPTTFNYTGSPPTNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+G+GN+NPK D   FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFAVGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  526   TTWGLKMAFLVDNGKGPNES  545



>ref|XP_010044087.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86093.1| hypothetical protein EUGRSUZ_B02794 [Eucalyptus grandis]
Length=556

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/440 (83%), Positives = 402/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+AIKSGLAPNVSDAHTINGHPGP +NCPSQGG+ L V+ GK YMLR+INAA
Sbjct  166   KSDTEAVINQAIKSGLAPNVSDAHTINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+T+VEVDATYVKPFKTNTIVIAPGQTTN +++ +Q SGKYMVAASPF
Sbjct  226   LNEELFFKIAGHQLTIVEVDATYVKPFKTNTIVIAPGQTTNALISTDQSSGKYMVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYSG L+   T LT TPP+NAT VANNF+++LRSLNSK+YPA+V
Sbjct  286   MDSPIAVDNMTATATLHYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKRYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL FTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMP+ ALLQAHFFNI GVFT+
Sbjct  346   PLTVDHSLLFTVGLGVNPCPSCKAGNGSRVVASMNNVTFVMPSTALLQAHFFNISGVFTS  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNP   FNYTG+ P+NL+TT+GTKV+RL YN+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  406   DFPGNPRTTFNYTGSPPSNLRTTSGTKVFRLHYNSTVQLVLQDTGIIAPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GN+NPK D   FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFTVGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  526   TTWGLKMAFLVDNGKGPNES  545



>ref|XP_010041000.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW44721.1| hypothetical protein EUGRSUZ_L01734 [Eucalyptus grandis]
Length=556

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/440 (83%), Positives = 402/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+AIKSGLAPNVSDAHTINGHPGP +NCPSQGG+ L V+ GK YMLR+INAA
Sbjct  166   KSDTEAVINQAIKSGLAPNVSDAHTINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+T+VEVDATYVKPFKTNTIVIAPGQTTN +++ +Q SGKYMVAASPF
Sbjct  226   LNEELFFKIAGHQLTIVEVDATYVKPFKTNTIVIAPGQTTNALISTDQSSGKYMVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYSG L+   T LT TPP+NAT VANNF+++LRSLNSK+YPA+V
Sbjct  286   MDSPIAVDNMTATATLHYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKRYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL FTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMP+ ALLQAHFFNI GVFT+
Sbjct  346   PLTVDHSLLFTVGLGVNPCPSCKAGNGSRVVASMNNVTFVMPSTALLQAHFFNISGVFTS  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNP   FNYTG+ P+NL+TT+GTKV+RL YN+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  406   DFPGNPRTTFNYTGSPPSNLRTTSGTKVFRLHYNSTVQLVLQDTGIIAPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GN+NPK D   FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFTVGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  526   TTWGLKMAFLVDNGKGPNES  545



>ref|XP_010044088.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86094.1| hypothetical protein EUGRSUZ_B02795 [Eucalyptus grandis]
Length=556

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/440 (82%), Positives = 402/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+T+HGA+VILPK GVPYPFPKP  E VVVL EWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+AIKSGLAPNVSDAH INGHPGP +NCPSQGG+ L V+ GK YMLR+INAA
Sbjct  166   KSDTEAVINQAIKSGLAPNVSDAHMINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+T+VEVDATYVKPFKT+TIVIAPGQTTN +++ +Q SGKYMVAASPF
Sbjct  226   LNEELFFKIAGHQLTIVEVDATYVKPFKTDTIVIAPGQTTNALISTDQSSGKYMVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYSG L+   T LT TPP+NAT VANNFV++LRSLNSK+YPA++
Sbjct  286   MDSPIAVDNMTATATLHYSGTLAATSTTLTKTPPQNATAVANNFVNSLRSLNSKRYPAKI  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL FTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT A+LQAHFFN  GVFT+
Sbjct  346   PLTVDHSLLFTVGLGINPCPSCKAGNGSRVVASMNNVTFVMPTTAILQAHFFNKSGVFTS  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNYTG+ P+NL+TT+GTKVYRL YN+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  406   DFPGNPPTIFNYTGSPPSNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFA+G+G+GN+NPK D   FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFAIGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP+ES
Sbjct  526   TTWGLKMAFLVDNGKGPSES  545



>ref|XP_006338994.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=557

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/441 (82%), Positives = 400/441 (91%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILPK GVPYPFPKP+HEAVVVL EWW
Sbjct  106   QNYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPKPNHEAVVVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAV NEA+ SGLAPNVSDAHTINGHPGPV+NCPSQGGY+LSV PGK+YMLRVINAA
Sbjct  166   KSDTEAVANEALNSGLAPNVSDAHTINGHPGPVSNCPSQGGYRLSVAPGKTYMLRVINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+MTVVEVDATYVKPFKT+TI+IAPGQTTNV++TA+Q  GKYMV ASPF
Sbjct  226   LNEELFFKIAGHKMTVVEVDATYVKPFKTDTILIAPGQTTNVLLTADQNFGKYMVVASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+P+ VDN TATATLHY+GALS     LTS PP+NAT VANNF+ +L+SLNSK+YPA+V
Sbjct  286   MDSPVTVDNVTATATLHYTGALSNAPMTLTSAPPQNATSVANNFIHSLKSLNSKKYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ +DHSL FTVGLG+NPCP+C P+NG RVVAS+NNVTFVMP  ALLQAHFF IK VFT 
Sbjct  346   PKNIDHSLLFTVGLGINPCPTCIPSNGIRVVASINNVTFVMPKTALLQAHFFGIKNVFTM  405

Query  659   DFPGNPPVAFNYTG-AGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFPGNPP  FNYT    P +L T  GTK+YRL YNATVQLVLQDTGIIAPENHP+HLHGF
Sbjct  406   DFPGNPPFVFNYTSTVPPPSLATMNGTKLYRLRYNATVQLVLQDTGIIAPENHPIHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFFAVG+G+GNFNPKTD   FNL+DPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE+
Sbjct  466   NFFAVGKGLGNFNPKTDTKNFNLMDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEI  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLVDNGKGPNES
Sbjct  526   HTTWGLKMAFLVDNGKGPNES  546



>ref|XP_002322962.2| laccase family protein [Populus trichocarpa]
 gb|EEF04723.2| laccase family protein [Populus trichocarpa]
Length=564

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/440 (83%), Positives = 402/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGA+V+LPK GVPYPFP P  E VVVLAEWW
Sbjct  114   QSYVYNFTITGQRGTLLWHAHILWLRATVHGAIVVLPKRGVPYPFPAPHKEFVVVLAEWW  173

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ CPSQGG+ L V+ GK+YMLR+INAA
Sbjct  174   KSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSACPSQGGFTLPVESGKTYMLRLINAA  233

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++T+VEVDATYVKPFKT+T++IAPGQTTNV+VT N+ +GKY+VAASPF
Sbjct  234   LNEELFFKIAGHKLTLVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPF  293

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSGALSG  T LT  PPKNAT VAN F ++LRSLNSK++PA+V
Sbjct  294   MDAPIAVDNMTATATLHYSGALSGTPTTLTIPPPKNATAVANQFTNSLRSLNSKRFPAKV  353

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDH+LFFTVGLG+NPCP+CK  NGSRVVAS+NNVTFVMPT ALLQAHFFNI GVFTT
Sbjct  354   PLTVDHNLFFTVGLGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTT  413

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNYTG  P NLQTT+GTKVYRL YN+TV+LV+QDTGII+PENHP+HLHGFN
Sbjct  414   DFPSKPPHVFNYTGTPPTNLQTTSGTKVYRLRYNSTVELVMQDTGIISPENHPIHLHGFN  473

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GN+NPKTDP KFNLVDPVERNTIGVPSGGWVAIRFR DNPGVWFMHCHLEVH
Sbjct  474   FFGVGRGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRVDNPGVWFMHCHLEVH  533

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  534   TTWGLKMAFLVDNGKGPNES  553



>gb|KHG18161.1| Laccase-4 -like protein [Gossypium arboreum]
Length=556

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/440 (83%), Positives = 400/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLRSTVHGA+VILPK  VPYPFPKP  E VVVLAEWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVILPKRSVPYPFPKPHKEVVVVLAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ CPSQGG+ L V+ GK+Y+LR+INAA
Sbjct  166   KSDTEAVINEALKSGLAPNVSDAHTINGHPGKVSGCPSQGGFSLPVESGKTYLLRLINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFK +T+VIAPGQTTNV+V+A+Q SGKYMVAASPF
Sbjct  226   LNEELFFKIAGHKLTVVEVDATYVKPFKIDTVVIAPGQTTNVLVSADQNSGKYMVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AVDN TATATLHYSG L    T LT+ PP+NAT VANNF+D+LRSLNSKQ+PA V
Sbjct  286   MDAPVAVDNLTATATLHYSGTLDNTPTSLTTPPPQNATSVANNFIDSLRSLNSKQFPALV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH+L+FTVGLG+NPCP+CK  NGSRVVAS+NNVTF MPT ALLQAHFFNI GVFTT
Sbjct  346   PPTIDHNLYFTVGLGVNPCPTCKAGNGSRVVASINNVTFTMPTTALLQAHFFNISGVFTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNYTG  P NLQT  GTKV+RL YN+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  406   DFPSTPPHVFNYTGTPPKNLQTRNGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+G+GN+NPKTDP KFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  466   FFAVGKGLGNYNPKTDPQKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPN+S
Sbjct  526   TTWGLKMAFLVDNGKGPNQS  545



>ref|XP_004163861.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=559

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/440 (81%), Positives = 401/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTLFWHAH+LWLR+TVHG LVILPKLGVPYPFP P+ E V+VLAEWW
Sbjct  109   QSYVYNFTITGQRGTLFWHAHILWLRATVHGGLVILPKLGVPYPFPTPNKETVLVLAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTING PG ++NCPSQ G+ L V  GK+Y+LR+INAA
Sbjct  169   KSDTEAVINEALKSGLAPNVSDAHTINGLPGSISNCPSQRGFTLPVQKGKTYLLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH++TVVEVDATYVKPFKT+T++IAPGQTTNV++TANQ SGKYMVA SPF
Sbjct  229   LNEELFFKVAGHKLTVVEVDATYVKPFKTDTVLIAPGQTTNVLLTANQNSGKYMVAVSPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AVDN+TATAT+HY+G L+   T  T+ PP+NAT +AN F ++LRSLNSK+YPA V
Sbjct  289   MDAPVAVDNKTATATVHYTGTLATSLTTSTNPPPQNATQIANAFTNSLRSLNSKKYPANV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLG+NPCP+CK ANGSRVVAS+NNVTFVMPT ALLQ HFF  KGVFTT
Sbjct  349   PLTIDHHLFFTVGLGINPCPTCKAANGSRVVASINNVTFVMPTTALLQGHFFKTKGVFTT  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNY+G GP NLQTT+ TK+Y+L YN+TV+LVLQDTGIIAPENHP+HLHGFN
Sbjct  409   DFPGNPPHKFNYSGPGPKNLQTTSATKLYKLQYNSTVELVLQDTGIIAPENHPIHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLE+H
Sbjct  469   FFEVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEIH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  529   TTWGLKMAFLVENGKGPNQS  548



>ref|XP_004137913.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN58791.1| hypothetical protein Csa_3G732490 [Cucumis sativus]
Length=559

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/440 (81%), Positives = 401/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTLFWHAH+LWLR+TVHG LVILPKLGVPYPFP P+ E V+VLAEWW
Sbjct  109   QSYVYNFTITGQRGTLFWHAHILWLRATVHGGLVILPKLGVPYPFPTPNKETVLVLAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTING PG ++NCPSQ G+ L V  GK+Y+LR+INAA
Sbjct  169   KSDTEAVINEALKSGLAPNVSDAHTINGLPGSISNCPSQRGFTLPVQKGKTYLLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH++TVVEVDATYVKPFKT+T++IAPGQTTNV++TANQ SGKYMVA SPF
Sbjct  229   LNEELFFKVAGHKLTVVEVDATYVKPFKTDTVLIAPGQTTNVLLTANQNSGKYMVAVSPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AVDN+TATAT+HY+G L+   T  T+ PP+NAT +AN F ++LRSLNSK+YPA V
Sbjct  289   MDAPVAVDNKTATATVHYTGTLATSLTTSTNPPPQNATQIANAFTNSLRSLNSKKYPANV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLG+NPCP+CK ANGSRVVAS+NNVTFVMPT ALLQAHFF  KGVFTT
Sbjct  349   PLTIDHHLFFTVGLGINPCPTCKAANGSRVVASINNVTFVMPTTALLQAHFFKTKGVFTT  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNY+G GP NLQT + TK+Y+L YN+TV+LVLQDTGIIAPENHP+HLHGFN
Sbjct  409   DFPGNPPHKFNYSGPGPKNLQTISATKLYKLQYNSTVELVLQDTGIIAPENHPIHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLE+H
Sbjct  469   FFEVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEIH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  529   TTWGLKMAFLVENGKGPNQS  548



>ref|XP_002520425.1| laccase, putative [Ricinus communis]
 gb|EEF41838.1| laccase, putative [Ricinus communis]
Length=556

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/440 (81%), Positives = 394/440 (90%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPK GVPYPFP PD E V+VL+EWW
Sbjct  108   QSYVYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPTPDKEEVIVLSEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSGLAPNVSDAHTINGHPGPV  CPSQGG+ L V  GK+YMLR++NAA
Sbjct  168   KSDVEAVINEALKSGLAPNVSDAHTINGHPGPVPACPSQGGFTLPVHSGKTYMLRIVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDATYVKPFKT+TIVIAPGQTTNV++TA + SGKY+VAASPF
Sbjct  228   LNEELFFKIAGHQLTVVEVDATYVKPFKTDTIVIAPGQTTNVLLTAGRSSGKYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TA ATLHYSG LS   T LT+TPPKNAT +A+NF +ALRSLNSK+YPA V
Sbjct  288   MDAPIAVDNVTAVATLHYSGTLSSSATTLTATPPKNATSIASNFTNALRSLNSKKYPANV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSLFFT+GLG+NPC +C   NGSRVVA +NNVTFVMPT+ LLQAHFFNI GVFT 
Sbjct  348   PLKIDHSLFFTIGLGVNPCATC--VNGSRVVADINNVTFVMPTIGLLQAHFFNISGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPPV++NYTG  P N QTTTGT++YRL YN+TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  406   DFPSNPPVSYNYTGTQPTNFQTTTGTRLYRLAYNSTVQLVLQDTGMITPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP  FNLVDPVERNT GVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  466   FFQVGRGVGNFNPKKDPKNFNLVDPVERNTAGVPSGGWTAIRFRADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>gb|KHG11130.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/440 (81%), Positives = 404/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLRSTVHGA+VILPK GVPYPFPKP  EAVVVL EWW
Sbjct  53    QSYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVILPKRGVPYPFPKPHKEAVVVLGEWW  112

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPGP+++CPSQ G+ L+V+ GK+Y+LR+INAA
Sbjct  113   KSDTEAVINEALKSGLAPNVSDAHTINGHPGPISSCPSQRGFTLAVENGKTYLLRLINAA  172

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFK +T+VIAPGQTTNV+++A+Q SGKY+VAASPF
Sbjct  173   LNEELFFKIAGHKLTVVEVDATYVKPFKIDTVVIAPGQTTNVLLSADQSSGKYLVAASPF  232

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AVDN TATAT+HYSG L+   T LT+ PPKNAT VAN F+++LR+LNSKQ+PA V
Sbjct  233   MDAPVAVDNLTATATVHYSGTLANTPTTLTAPPPKNATAVANKFINSLRALNSKQFPALV  292

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQT+DHSL+FTVGLG+NPCP+CK  NGSR VASVNN+TF MPT ALLQAHFFNI GVFTT
Sbjct  293   PQTIDHSLYFTVGLGINPCPTCKAGNGSRAVASVNNLTFTMPTTALLQAHFFNISGVFTT  352

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G  P NL+T TGTKV+RL YN+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  353   DFPANPPHKFNYSGTPPTNLKTMTGTKVFRLAYNSTVQLVLQDTGIIAPENHPIHLHGFN  412

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF+VG+G+GN+NPKTDP  FNLVDPVERNTIGVP+GGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  413   FFSVGKGLGNYNPKTDPQNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFMHCHLEVH  472

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  473   TTWGLKMAFLVENGKGPNQS  492



>ref|XP_011035200.1| PREDICTED: laccase-4 [Populus euphratica]
Length=556

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/440 (82%), Positives = 390/440 (89%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QS+VYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILPK GVPYPFP P  E V+VL EWW
Sbjct  108   QSFVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPTPHREEVIVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+ SG+APNVSDAHTINGHPGPV+ C SQGGY L V PGK+Y+LR+INAA
Sbjct  168   KSDVEAVINEAMSSGMAPNVSDAHTINGHPGPVSACSSQGGYNLPVQPGKTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDATYVKPFK +TIVIAPGQTTNV+VTAN+GSG+Y+VAASPF
Sbjct  228   LNEELFFKIAGHQLTVVEVDATYVKPFKIDTIVIAPGQTTNVLVTANRGSGRYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LT  P +NATPVA NF DALRSLNS +YPARV
Sbjct  288   MDAPIAVDNVTATATLHYSGTLASSATTLTVPPAQNATPVATNFTDALRSLNSIKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSLFFTVGLG+NPC +C   NGSRVVA  NNVTFVMPT+ALLQAHFFNIKGVFT 
Sbjct  348   PLKIDHSLFFTVGLGVNPCATC--VNGSRVVADFNNVTFVMPTIALLQAHFFNIKGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNYTG  P N QT  GTK+YRL YN+TVQLVLQDTG++ PENHP+HLHGFN
Sbjct  406   DFPGNPPTPFNYTGTQPTNFQTVNGTKLYRLAYNSTVQLVLQDTGMLTPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRGIGNFNPK DP KFNLVDPVERNTIGVP+GGW AIRF ADNPGVWFMHCHLEVH
Sbjct  466   FFEVGRGIGNFNPKRDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>ref|XP_008442464.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis melo]
Length=559

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/440 (81%), Positives = 399/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTLFWHAH+LWLR+TVHG LVILPKLGVPYPFP P+ E V+VLAEWW
Sbjct  109   QSYVYNFTITGQRGTLFWHAHILWLRATVHGGLVILPKLGVPYPFPTPNKETVLVLAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTING PG + NCPSQ G+ L V  GK+Y+LR+INAA
Sbjct  169   KSDTEAVINEALKSGLAPNVSDAHTINGLPGSIPNCPSQRGFTLPVQRGKTYLLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH++TVVEVDATYVKPFKT+T++IAPGQTTNV++TANQ SGKYMVA SPF
Sbjct  229   LNEELFFKVAGHKLTVVEVDATYVKPFKTDTVIIAPGQTTNVLLTANQNSGKYMVAVSPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AVDN+TATAT+HY+G L+   T  T+ PP+NAT +AN F+++LRSLNSK+YPA V
Sbjct  289   MDAPVAVDNKTATATVHYTGTLATSLTTSTNPPPQNATQIANAFINSLRSLNSKKYPANV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLG+NPCP+CK ANGSRVVAS+NNVTFVMPT ALLQAHFF  KGVFTT
Sbjct  349   PLTIDHHLFFTVGLGINPCPTCKAANGSRVVASINNVTFVMPTTALLQAHFFKTKGVFTT  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNY+G GP NLQTTT TK+Y+L YN+TV+LVLQDTGIIAPENHP+HLHGFN
Sbjct  409   DFPXKPPHKFNYSGPGPKNLQTTTATKLYKLQYNSTVELVLQDTGIIAPENHPIHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRGIGNFNPKTDP KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLE+H
Sbjct  469   FFEVGRGIGNFNPKTDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEIH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  529   TTWGLKMAFLVENGKGPNQS  548



>ref|XP_010262771.1| PREDICTED: laccase-4-like [Nelumbo nucifera]
Length=555

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/441 (80%), Positives = 395/441 (90%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+T+HGA+VILPK GVPYPFPKP  E VV+L EWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+ SGLAPNVSDAHTINGHPGPV  C SQ G++L VDPGK+YMLR+INAA
Sbjct  166   KSDVEAVINEALGSGLAPNVSDAHTINGHPGPVPGCSSQDGFQLQVDPGKTYMLRLINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDA Y KPFKT+T++IAPGQTTNV++TA + SGKY+VAASPF
Sbjct  226   LNEELFFKIAGHQLTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLTAGRSSGKYLVAASPF  285

Query  1019  MDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P+ AVDN TATATLHYSG+L+   T LT+ PP+NATPVA NF+D+LRSLNSKQYPA+
Sbjct  286   MDTPVVAVDNMTATATLHYSGSLATSATTLTNPPPQNATPVATNFMDSLRSLNSKQYPAK  345

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VPQTVDHSL F+VGLG+NPC +C   NGSRVVA +NNV+FVMPT ALLQAHFFNI GVFT
Sbjct  346   VPQTVDHSLLFSVGLGVNPCSTCP--NGSRVVADINNVSFVMPTTALLQAHFFNISGVFT  403

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP NPP+A+NYTG  PANLQT  GTKVYRL YN TVQ+VLQDTG+IAPENHP+HLHGF
Sbjct  404   DDFPANPPIAYNYTGTQPANLQTINGTKVYRLRYNDTVQVVLQDTGMIAPENHPIHLHGF  463

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFFAVGRG+GN+NPK DP KFNLVDP+ERNTIGVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  464   NFFAVGRGLGNYNPKKDPAKFNLVDPIERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEV  523

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKG N+S
Sbjct  524   HTTWGLKMAFVVDNGKGTNQS  544



>ref|XP_006387495.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
 gb|ERP46409.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
Length=559

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/440 (82%), Positives = 397/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGA+V+LPK G+PYPFP P  E VVVLAEWW
Sbjct  109   QSYVYNFTITGQRGTLLWHAHILWLRATVHGAMVVLPKRGIPYPFPAPHKEVVVVLAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ C SQGG+ L V  G++YMLR+INAA
Sbjct  169   KSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSACSSQGGFTLPVKSGETYMLRLINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+T++IAPGQTTNV+VT N+ +GKY+VAASPF
Sbjct  229   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATL YSGAL+   T LT+ PPKNAT VAN F ++LRSLNS+++PA+V
Sbjct  289   MDAPIAVDNMTATATLQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VDH+LFFTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHFFNI GVFTT
Sbjct  349   PLNVDHNLFFTVGLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTT  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNYTG  P NLQT +GTKVYRL YN+TVQLV+QDTGII+PENHP+HLHGFN
Sbjct  409   DFPAKPPHVFNYTGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPKTD  KFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  469   FFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP ES
Sbjct  529   TTWGLKMAFLVDNGKGPKES  548



>ref|XP_003544873.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN40048.1| Laccase-4 [Glycine soja]
Length=557

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/441 (80%), Positives = 394/441 (89%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q++VYNFT+TGQRGTL+WHAH+LWLRSTVHGALVILPKLGVPYPFPKP  E V++L+EWW
Sbjct  108   QAFVYNFTLTGQRGTLWWHAHILWLRSTVHGALVILPKLGVPYPFPKPHTEKVIILSEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSG APNVSDAHTINGHPG V NC SQGGYKL V PG +Y+LR+INAA
Sbjct  168   KSDTEAVINEALKSGSAPNVSDAHTINGHPGSVQNCASQGGYKLQVQPGNTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDA Y KPFKT+TIVIAPGQTTNV++ AN+ +GKY+VAA+PF
Sbjct  228   LNEELFFKIAGHQLTVVEVDAVYTKPFKTDTIVIAPGQTTNVLLKANRAAGKYLVAATPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PI VDN TATATLHY+G+L    T LTS PPKNATPVA NF D+LRSLNSK+YPARV
Sbjct  288   MDSPITVDNVTATATLHYTGSLGSTITTLTSLPPKNATPVATNFTDSLRSLNSKKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQ VDHSLFFTV LG+NPCP+C  ANGS+VVA++NNVTFVMP V+LLQAHFFNI GVFT 
Sbjct  348   PQKVDHSLFFTVSLGVNPCPTC--ANGSKVVAAINNVTFVMPKVSLLQAHFFNISGVFTD  405

Query  659   DFPGNPPVAFNYTGA-GPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFPG PPV +++TG   P NL+T  GT+VYRL YN+TVQLVLQDTG+I PENHP+HLHGF
Sbjct  406   DFPGKPPVVYDFTGTQQPTNLRTNRGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG GNFNPK D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLE+
Sbjct  466   NFFVVGRGQGNFNPKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEI  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  526   HTTWGLKMAFVVDNGKGPNES  546



>ref|XP_010553253.1| PREDICTED: laccase-4 [Tarenaya hassleriana]
Length=559

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/440 (79%), Positives = 397/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q YVYN+T+TGQRGTL+WHAH+LWLR+TVHGALVILPK GVPYPFPKPDHE  +VL+EWW
Sbjct  109   QVYVYNYTLTGQRGTLWWHAHILWLRATVHGALVILPKRGVPYPFPKPDHEKAIVLSEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAHTINGH GPV +CPS  GYKLSV+ G++Y+LR++NAA
Sbjct  169   KSDTENVINEALKSGLAPNVSDAHTINGHSGPVKSCPSSMGYKLSVERGETYLLRLVNAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH +TVVEVDA YVKPFKT+T++IAPGQTTNV++TA++ +GKY+V  SPF
Sbjct  229   LNEELFFKVAGHSLTVVEVDALYVKPFKTDTVLIAPGQTTNVLLTASKSAGKYLVTVSPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATAT+HYSG LS   TVLT  PP+N+T ++NNF ++LRSLNSK+YPA V
Sbjct  289   MDAPIAVDNVTATATVHYSGTLSSSATVLTLPPPQNSTAISNNFTNSLRSLNSKKYPALV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ VDH LFFTVGLG+NPCP+CK ANGSRVVAS+NNVTF MPT ALLQAH+FNI GVFTT
Sbjct  349   PKEVDHHLFFTVGLGVNPCPTCKAANGSRVVASINNVTFTMPTTALLQAHYFNISGVFTT  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  +NYTG+ PANL T  GT++Y+LPYNATV++VLQDTGII+PENHPVHLHGFN
Sbjct  409   DFPKNPPHVYNYTGSPPANLATEKGTRLYKLPYNATVEVVLQDTGIISPENHPVHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRGIGNFNPK DP  FNL DPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  469   FFQVGRGIGNFNPKKDPKSFNLDDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPNES
Sbjct  529   TTWGLKMAFLVENGKGPNES  548



>ref|XP_002533894.1| laccase, putative [Ricinus communis]
 gb|EEF28494.1| laccase, putative [Ricinus communis]
Length=556

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/440 (79%), Positives = 393/440 (89%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL WHAH+LWLRSTVHGA+VILPK GVPYPFPKP  E VV+LAEWW
Sbjct  106   QNYVYNFTLTGQRGTLLWHAHILWLRSTVHGAIVILPKRGVPYPFPKPHKEEVVILAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V NCPSQ G++L V+ GK+Y+LR+INAA
Sbjct  166   KSDTEAVINEAMKSGLAPNVSDAHTINGHPGAVPNCPSQSGFRLPVESGKAYLLRLINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVE+DA YVKP KT+T+++APGQTTNV+VTAN+ SGKY+V ASPF
Sbjct  226   LNEELFFKIAGHQLTVVEIDACYVKPLKTDTVLLAPGQTTNVLVTANKNSGKYLVTASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AVDN+TATATLHYSG L+   T + + PP+NA+ VANNF+++LRSLNS++YPARV
Sbjct  286   MDAPVAVDNRTATATLHYSGTLASAPTTVATPPPQNASAVANNFINSLRSLNSQKYPARV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VDH+L FTVGLG+N CPSCK ANGSRVVAS+NNVTFVMPT ALLQAHFF I GVFTT
Sbjct  346   PLKVDHNLLFTVGLGINACPSCKAANGSRVVASINNVTFVMPTTALLQAHFFKISGVFTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FN+TG+GP NL T   TKVYRL YN TVQLV+QDTG+IAPE+HP+HLHGFN
Sbjct  406   DFPSKPPHVFNFTGSGPKNLNTVRATKVYRLKYNDTVQLVMQDTGVIAPESHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GN+NP TDP  FNLVDP ERNTIGVP+GGW AIRFRADNPGVWFMHCHLEVH
Sbjct  466   FFVVGRGLGNYNPNTDPQNFNLVDPAERNTIGVPTGGWAAIRFRADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  526   TTWGLKMAFLVDNGKGPNES  545



>ref|XP_008785423.1| PREDICTED: laccase-22 [Phoenix dactylifera]
Length=554

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/440 (78%), Positives = 394/440 (90%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFTITGQRGTLFWHAH+LWLR TVHGA+VILPKL VPYPFP P  E V++L EWW
Sbjct  106   SSYVYNFTITGQRGTLFWHAHILWLRVTVHGAIVILPKLHVPYPFPTPHKEEVIILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+A+KSGLAPNVSDAHTINGHPGP++ CP+  G++L VD G++YMLR++NAA
Sbjct  166   KSDTEAVINQALKSGLAPNVSDAHTINGHPGPMSACPASKGFQLKVDSGRTYMLRIVNAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFF++AGHQMTVVEVDATY KPFKT+TI+I PGQTTNV++TA+QG+G+Y+V ASPF
Sbjct  226   LNEELFFRVAGHQMTVVEVDATYTKPFKTDTILITPGQTTNVLLTADQGAGRYLVTASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDNQTA A +HY+  ++         PP+NATPVA+NF+D+LRSLNSKQYPARV
Sbjct  286   MDSPIAVDNQTAMAVVHYTNTVAASALTAIKPPPQNATPVASNFIDSLRSLNSKQYPARV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL FTVGLG+NPCP+C   NGSRVVA +NNV+F MPT A+LQAH+FN+ GVFT 
Sbjct  346   PSTVDHSLLFTVGLGVNPCPTC--VNGSRVVADMNNVSFTMPTTAILQAHYFNVSGVFTD  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPG PP+AFNYTG+GP NL T TGT+VYRLP+N+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  404   DFPGKPPIAFNYTGSGPRNLGTMTGTRVYRLPFNSTVQLVLQDTGIIAPENHPIHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPK  P+KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  464   FFAVGRGLGNYNPKRSPSKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  524   TTWGLKMAFVVDNGKGPNES  543



>ref|XP_002308209.2| laccase family protein [Populus trichocarpa]
 gb|EEE91732.2| laccase family protein [Populus trichocarpa]
Length=559

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/440 (82%), Positives = 396/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGALV+LPK G+PYPFP P  E VVVLAEWW
Sbjct  109   QSYVYNFTITGQRGTLLWHAHILWLRATVHGALVVLPKRGIPYPFPAPHKEVVVVLAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ C SQGG+ L V  G++YMLR+INAA
Sbjct  169   KSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSACSSQGGFTLPVKSGETYMLRLINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+T++IAPGQTTNV+VT N+ +GKY+VAASPF
Sbjct  229   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATL YSGAL+   T LT+ PPKNAT VAN F ++LRSLNS+++PA+V
Sbjct  289   MDAPIAVDNMTATATLQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VDH+LFFTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHF NI GVFTT
Sbjct  349   PLNVDHNLFFTVGLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFLNISGVFTT  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNYTG  P NLQT +GTKVYRL YN+TVQLV+QDTGII+PENHP+HLHGFN
Sbjct  409   DFPAKPPHVFNYTGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPKTD  KFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  469   FFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP ES
Sbjct  529   TTWGLKMAFLVDNGKGPKES  548



>ref|XP_008449180.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=556

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/440 (80%), Positives = 397/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+LWLR+TVHGALVILPKLGVPYPFP P+ E VVVLAEWW
Sbjct  106   QSYLYNFTVTGQRGTLLWHAHILWLRATVHGALVILPKLGVPYPFPAPNKEVVVVLAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGH GP++ C +QGG+ L V  G +Y+LR+INAA
Sbjct  166   KSDTEAVINEALKSGLAPNVSDAHTINGHSGPISKCSTQGGFTLPVKSGHTYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+TIVIAPGQTTN ++TA+Q SGKY+VAASPF
Sbjct  226   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTIVIAPGQTTNALITADQTSGKYLVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYS  L+   T LT  PP+NATPVANNF+D+LRSLNS  YPA+V
Sbjct  286   MDSPIAVDNNTATATLHYSDTLATTATTLTVPPPQNATPVANNFIDSLRSLNSNTYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH+L+FTVGLG+NPCP+CK  NGSR VAS+NNVTFVMPT ALLQAH+FNI GVFTT
Sbjct  346   PLTIDHNLYFTVGLGINPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHYFNINGVFTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG+GP+NLQTT GTK+Y+L +N+TV+LVLQDTGIIA ENHP+HLHGFN
Sbjct  406   DFPANPPHVFNYTGSGPSNLQTTRGTKLYKLKFNSTVELVLQDTGIIAAENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRGIGN++ K DP  FNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  466   FFVVGRGIGNYDAKNDPKSFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPNES
Sbjct  526   TTWGLKMAFLVENGKGPNES  545



>ref|XP_010923124.1| PREDICTED: laccase-22 [Elaeis guineensis]
Length=554

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/439 (79%), Positives = 397/439 (90%), Gaps = 2/439 (0%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             +YVYNFTITGQRGTLFWHAH+LWLR TVHGA+VILPKL VPYPFP P  E V++L EWWK
Sbjct  107   NYVYNFTITGQRGTLFWHAHILWLRVTVHGAIVILPKLHVPYPFPTPHKEEVIILGEWWK  166

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SDTEAVINEA+KSGLAPNVSDAH INGHPGP++ CP+  G++L VD GK+YMLR+INAAL
Sbjct  167   SDTEAVINEALKSGLAPNVSDAHVINGHPGPMSTCPASKGFQLKVDSGKTYMLRIINAAL  226

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             NEELFFK+AGHQ+TVVEVDATY KPFKT+TI+I PGQTTNV++TA++G+G+Y+V ASPFM
Sbjct  227   NEELFFKVAGHQLTVVEVDATYTKPFKTDTILITPGQTTNVLLTADRGAGRYLVTASPFM  286

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             D+PIAVDNQTA AT+HY+  +S      T  PP+NATPVA+NF+D+LRSLNSK+YPARVP
Sbjct  287   DSPIAVDNQTAMATVHYTNTVSTTVLTTTKPPPQNATPVASNFIDSLRSLNSKKYPARVP  346

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
              TVDHSL FTVGLG+NPCP+C   NGSRVVA VNNVTF MPT A+LQAH+FNI GVFT D
Sbjct  347   LTVDHSLLFTVGLGVNPCPTC--VNGSRVVADVNNVTFSMPTTAILQAHYFNISGVFTAD  404

Query  656   FPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFNF  477
             FPG PP+AFNY+G+GP+NL T TGT+VYRLP+N+TVQLVLQDTGIIAPENHP+HLHGFNF
Sbjct  405   FPGKPPIAFNYSGSGPSNLGTMTGTRVYRLPFNSTVQLVLQDTGIIAPENHPIHLHGFNF  464

Query  476   FAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHT  297
             FAVGRG+GN+NPKT P+KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEVHT
Sbjct  465   FAVGRGLGNYNPKTSPSKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVHT  524

Query  296   TWGLKMAFLVDNGKGPNES  240
             TWGLKMAF+VDNGKGPNES
Sbjct  525   TWGLKMAFVVDNGKGPNES  543



>ref|XP_011019150.1| PREDICTED: laccase-4 isoform X1 [Populus euphratica]
Length=559

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/440 (81%), Positives = 397/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTL WHAH+LWLRSTVHGA+V+LPK G+PYPFP P  E VVVLAEWW
Sbjct  109   QNYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVVLPKRGIPYPFPAPHKEVVVVLAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ C SQGG+ L V  G++YMLR+INAA
Sbjct  169   KSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSACSSQGGFTLPVRSGETYMLRLINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+T++IAPGQTTNV+VT N+ +G Y+VAASPF
Sbjct  229   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGNYLVAASPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATL YSGAL+   T LT+ PPKNAT VAN F+++LRSLNS+++PA+V
Sbjct  289   MDSPIAVDNMTATATLQYSGALANSPTTLTTPPPKNATAVANQFINSLRSLNSRKFPAKV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VDH+LFFTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHFFNI GVFTT
Sbjct  349   PMNVDHNLFFTVGLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTT  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNY+G  P NLQT +GTKVYRL YN+TVQLV+QDTGII+PENHP+HLHGFN
Sbjct  409   DFPAKPPHVFNYSGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPKTD  KFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  469   FFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP ES
Sbjct  529   TTWGLKMAFLVDNGKGPKES  548



>ref|XP_011019151.1| PREDICTED: laccase-4 isoform X2 [Populus euphratica]
Length=558

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/440 (81%), Positives = 397/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTL WHAH+LWLRSTVHGA+V+LPK G+PYPFP P  E VVVLAEWW
Sbjct  108   QNYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVVLPKRGIPYPFPAPHKEVVVVLAEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ C SQGG+ L V  G++YMLR+INAA
Sbjct  168   KSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSACSSQGGFTLPVRSGETYMLRLINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+T++IAPGQTTNV+VT N+ +G Y+VAASPF
Sbjct  228   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGNYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATL YSGAL+   T LT+ PPKNAT VAN F+++LRSLNS+++PA+V
Sbjct  288   MDSPIAVDNMTATATLQYSGALANSPTTLTTPPPKNATAVANQFINSLRSLNSRKFPAKV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VDH+LFFTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHFFNI GVFTT
Sbjct  348   PMNVDHNLFFTVGLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNY+G  P NLQT +GTKVYRL YN+TVQLV+QDTGII+PENHP+HLHGFN
Sbjct  408   DFPAKPPHVFNYSGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPKTD  KFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  468   FFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP ES
Sbjct  528   TTWGLKMAFLVDNGKGPKES  547



>ref|XP_003518300.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN46170.1| Laccase-4 [Glycine soja]
Length=557

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/441 (79%), Positives = 394/441 (89%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q++VYNFT+TGQRGTL+WHAH+LWLRSTVHGALVILPKLGVPYPFPKP  E V++L+EWW
Sbjct  108   QAFVYNFTLTGQRGTLWWHAHILWLRSTVHGALVILPKLGVPYPFPKPHTEKVIILSEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V NC SQGGY+L V PG +Y+LR+INAA
Sbjct  168   KSDTEAVINEALKSGLAPNVSDAHTINGHPGSVQNCASQGGYELQVQPGNTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDA Y KPFKT+TIVIAPGQTT+V++ AN+ +GKY+VAA+PF
Sbjct  228   LNEELFFKIAGHQLTVVEVDAVYTKPFKTDTIVIAPGQTTSVLLKANRAAGKYLVAATPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHY+G+L    T LTS PPKNATPVA NF D+LRSLNSK+YPARV
Sbjct  288   MDSPIAVDNVTATATLHYTGSLGSTITTLTSLPPKNATPVATNFTDSLRSLNSKKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQ VDHSLFFT+ LG+NPCP+C   NGS+VVA++NNVTFVMP V+LLQAHFFNI GVF  
Sbjct  348   PQKVDHSLFFTISLGVNPCPTC--VNGSKVVAAINNVTFVMPKVSLLQAHFFNISGVFID  405

Query  659   DFPGNPPVAFNYTGA-GPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFPG PPV +++TG   P NL+T  GT+VYRL YN+TVQLVLQDTG+I PENHP+HLHGF
Sbjct  406   DFPGKPPVVYDFTGTQQPTNLRTNRGTRVYRLAYNSTVQLVLQDTGMITPENHPLHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG GNFNPK D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLE+
Sbjct  466   NFFVVGRGQGNFNPKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEI  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  526   HTTWGLKMAFVVDNGKGPNES  546



>ref|XP_002308208.2| laccase family protein [Populus trichocarpa]
 gb|EEE91731.2| laccase family protein [Populus trichocarpa]
Length=558

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/440 (81%), Positives = 395/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGALV+LPK G+PYPFP P  E +VVLAEWW
Sbjct  108   QSYVYNFTITGQRGTLLWHAHILWLRATVHGALVVLPKRGIPYPFPAPHKEVLVVLAEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ C SQGG+ L V  G++YMLR+INAA
Sbjct  168   KSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVKSGETYMLRLINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+T++IAPGQTTNV+VT N+ +GKY+VAASPF
Sbjct  228   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATL YSGAL+   T LT+ PPKNAT VAN F ++LRSLNS+++PA+V
Sbjct  288   MDSPIAVDNMTATATLQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VDH+LFFTV LG+NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHF NI GVFTT
Sbjct  348   PLNVDHNLFFTVSLGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFLNISGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNYTG  P NLQT +GTKVYRL YN+TVQLV+QDTGII+PENHP+HLHGFN
Sbjct  408   DFPAKPPHVFNYTGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENHPIHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPKTD  KFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  468   FFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP ES
Sbjct  528   TTWGLKMAFLVDNGKGPKES  547



>ref|XP_002278638.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI30423.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/440 (80%), Positives = 397/440 (90%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAHVLWLR+TVHGA+VILPK GVPYPFPKP  E VV+L EWW
Sbjct  107   QSYLYNFTVTGQRGTLLWHAHVLWLRATVHGAIVILPKRGVPYPFPKPHKEVVVILGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVIN+A+ SGLAPNVSDAHTINGHPGPV+NCPSQGG+ L V+ GK+Y+LR+INAA
Sbjct  167   KSDVEAVINQALSSGLAPNVSDAHTINGHPGPVSNCPSQGGFSLQVEAGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ++VVEVDA Y KPFK +T+VIAPGQTTN ++TA+Q SGKY++AASPF
Sbjct  227   LNEELFFKIAGHQLSVVEVDAVYTKPFKIDTLVIAPGQTTNALITADQSSGKYLMAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYSG L+   T LTS PP NAT VAN FV++LRSLNSK+YPA+V
Sbjct  287   MDSPIAVDNLTATATLHYSGTLASSPTSLTSPPPPNATAVANKFVNSLRSLNSKKYPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSLF TVGLG+NPC +C   NGSR VAS+NNVTFVMPT A+LQAH+FNI GV+TT
Sbjct  347   PLTVDHSLFITVGLGINPCATCVAGNGSRAVASMNNVTFVMPTTAILQAHYFNISGVYTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPPVAFNYTG+ PANLQTT GTKVYR+PYN+TVQ+VLQDTGIIA ENHPVHLHGFN
Sbjct  407   DFPANPPVAFNYTGS-PANLQTTNGTKVYRVPYNSTVQVVLQDTGIIATENHPVHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+G+GN+NPKTDP  FNL+DPVERNTIGVPSGGW AIRF ADNPGVWFMHCHLEVH
Sbjct  466   FFAVGKGLGNYNPKTDPQNFNLIDPVERNTIGVPSGGWTAIRFLADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPN+S
Sbjct  526   TTWGLKMAFLVDNGKGPNQS  545



>ref|XP_004147923.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004165325.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN54357.1| hypothetical protein Csa_4G308480 [Cucumis sativus]
Length=556

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/440 (79%), Positives = 398/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+LWLR+TVHGALVILPKLGVPYPFP P+ E VVVLAEWW
Sbjct  106   QSYLYNFTVTGQRGTLLWHAHILWLRATVHGALVILPKLGVPYPFPAPNKEVVVVLAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGH GP++NC +QGG+ L V  G +Y+LR+INAA
Sbjct  166   KSDTEAVINEALKSGLAPNVSDAHTINGHSGPISNCSTQGGFTLPVKSGHTYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+TI+IAPGQTTN ++TA+Q SGKY+VAASPF
Sbjct  226   LNEELFFKIAGHKLTVVEVDATYVKPFKTDTILIAPGQTTNALITADQTSGKYLVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHY+G L+     LT+ PP+NATPVANNF+D+LRSLNS  YPA+V
Sbjct  286   MDSPIAVDNNTATATLHYAGTLATTAATLTAPPPQNATPVANNFIDSLRSLNSNTYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH+L+FTVGLG+NPCP+CK  NGSR VAS+NNVTFVMPT ALLQAH+FNI GVFTT
Sbjct  346   PLTIDHNLYFTVGLGINPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHYFNINGVFTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG+GP+NLQTT GTK+Y+L +N+TV+LVLQDTGI+  ENHP+HLHGFN
Sbjct  406   DFPANPPHVFNYTGSGPSNLQTTRGTKLYKLKFNSTVELVLQDTGILTAENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRGIGN++ K DP  FNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  466   FFVVGRGIGNYDAKNDPKSFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  526   TTWGLKMAFLVENGKGPNQS  545



>gb|KDP46534.1| hypothetical protein JCGZ_08506 [Jatropha curcas]
Length=563

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/440 (79%), Positives = 393/440 (89%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+TGQRGTL WHAH+LWLR+TVHGA+VILPK GVPYPFP P  E V+VL EWW
Sbjct  115   QNYLYNFTVTGQRGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPTPHKEEVIVLGEWW  174

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV+NEA+KSG APNVSDAHTINGHPGPV  CPSQGG+ L V+ GK+YMLR+INAA
Sbjct  175   KSDVEAVVNEAMKSGGAPNVSDAHTINGHPGPVPACPSQGGFNLPVESGKTYMLRIINAA  234

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H++TVVEVDATYVKPFKT+TIVIAPGQTTNV++TA++ SGKY+VAASPF
Sbjct  235   LNEELFFKIACHKLTVVEVDATYVKPFKTDTIVIAPGQTTNVLLTADRTSGKYLVAASPF  294

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TA+ATLHYSGALS   T+LT  PP+NATP+A  F ++LRSLNSK+YPA V
Sbjct  295   MDAPIAVDNVTASATLHYSGALSSAATILTVPPPQNATPIAATFANSLRSLNSKKYPANV  354

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH LFFT+GLG+NPC +C  A G+RVVA +NNVTFVMPT++LLQAHFFNI GVFT 
Sbjct  355   PLKIDHFLFFTIGLGVNPCATC--ATGNRVVADINNVTFVMPTISLLQAHFFNISGVFTD  412

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPPV FNYTG  P+N+QT  GT++YRL YN+TVQ+VLQDTG+IAPENHP+HLHGFN
Sbjct  413   DFPGNPPVQFNYTGTQPSNVQTNNGTRLYRLAYNSTVQIVLQDTGMIAPENHPIHLHGFN  472

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  473   FFEVGRGVGNFNPKKDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVH  532

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNE 
Sbjct  533   TTWGLKMAFVVDNGKGPNEC  552



>ref|XP_003516941.1| PREDICTED: laccase-4-like [Glycine max]
Length=557

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/440 (81%), Positives = 395/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL +HAHV WLRST++GALVILPK GVPYPFPKPD E VVVL EWW
Sbjct  107   QTYVYNFTLTGQRGTLLYHAHVNWLRSTLYGALVILPKRGVPYPFPKPDDELVVVLGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTING PG VTNC +Q  Y L V+ GK+Y+LR++NAA
Sbjct  167   KSDTEAVINEALKSGLAPNVSDAHTINGLPGTVTNCSTQDVYNLPVESGKTYLLRIVNAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFK  TIVIAPGQTTNV++ ANQ SGKY+VAASPF
Sbjct  227   LNEELFFKIAGHKLTVVEVDATYVKPFKIETIVIAPGQTTNVLLNANQKSGKYLVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AVDN TATATLHY+G L+   T+LT+ PPKNAT +ANNF+ +LR LNSK+YP  V
Sbjct  287   MDAPVAVDNLTATATLHYTGTLAATPTILTTPPPKNATQIANNFISSLRGLNSKKYPVNV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL FTVGLG+NPCPSCK ANGSRVVA++NNVTF+MPT+ALLQAH+FNIKGVFTT
Sbjct  347   PLTVDHSLIFTVGLGINPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G GPANL T TGTKVYRLP+NATVQ+VLQDTGIIAPENHPVHLHGFN
Sbjct  407   DFPANPPHVFNYSGPGPANLNTETGTKVYRLPFNATVQVVLQDTGIIAPENHPVHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP  FNLVDPVERNTIGVP+GGW A RFRADNPGVWFMHCHLEVH
Sbjct  467   FFVVGRGVGNFNPKIDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWFMHCHLEVH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP +S
Sbjct  527   TTWGLKMAFLVDNGKGPKQS  546



>gb|EYU26646.1| hypothetical protein MIMGU_mgv1a003805mg [Erythranthe guttata]
Length=563

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/444 (80%), Positives = 394/444 (89%), Gaps = 4/444 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTL WHAH+LWLRSTVHGA+VILPKLGVPYPFPKP+HE V++LAEWW
Sbjct  109   QNYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVILPKLGVPYPFPKPNHERVIILAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQ--GGYKLSVDPGKSYMLRVIN  1206
             KSDTEAVINEA+ SGLAPNVSDAHTINGHPGPVTNCPS    G+ L V  GK+Y+LR+IN
Sbjct  169   KSDTEAVINEALTSGLAPNVSDAHTINGHPGPVTNCPSSTADGFTLKVKAGKTYLLRLIN  228

Query  1205  AALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAAS  1026
             AALNEELFFKIAGH +TVV+VDATYVKPFKT TIVIAPGQTT  I+TA++ +GKY+VAAS
Sbjct  229   AALNEELFFKIAGHNLTVVDVDATYVKPFKTGTIVIAPGQTTTAILTADRNTGKYIVAAS  288

Query  1025  PFMDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
              FMD P +AVDN TATATLHYSG LS   T  T+ PP+NATPVANNFV++LRSLNSK YP
Sbjct  289   TFMDTPGVAVDNTTATATLHYSGTLSTSPTTFTAPPPQNATPVANNFVNSLRSLNSKNYP  348

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A+VPQ VD SL FT+GLG+NPC +CK  NGSRVVA +NNVTFVMP +ALLQAH FNIKGV
Sbjct  349   AKVPQKVDRSLLFTIGLGINPCATCKAGNGSRVVADINNVTFVMPKIALLQAHVFNIKGV  408

Query  668   FTTDFPGNPPVAFNYTGAGP-ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHL  492
             FTTDFPGNPPV+FNYTG  P +N  T  GTK+YR+PYN T+Q+VLQDTGIIAPENHP+HL
Sbjct  409   FTTDFPGNPPVSFNYTGGPPPSNFGTRNGTKLYRVPYNTTIQVVLQDTGIIAPENHPIHL  468

Query  491   HGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCH  312
             HGFNFF VGRG+GNFN KTDP +FNLVDPVERNTIGVPSGGWVAIRF ADNPGVWFMHCH
Sbjct  469   HGFNFFVVGRGLGNFNSKTDPKQFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCH  528

Query  311   LEVHTTWGLKMAFLVDNGKGPNES  240
             LEVHTTWGLKMAFLVDNGK PNES
Sbjct  529   LEVHTTWGLKMAFLVDNGKSPNES  552



>ref|XP_002314124.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
 gb|EEE88079.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
Length=556

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/440 (80%), Positives = 385/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QS+VYNFTITGQRGTL WHAH+LWLR+TVHGA+VILPK GVPYPFP P  E V++L EWW
Sbjct  108   QSFVYNFTITGQRGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPTPRKEKVIILGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA KSG+APNVSDAHTINGHPGPV+ C S GGY LSV PGK+YMLR+INAA
Sbjct  168   KSDVEAVINEATKSGIAPNVSDAHTINGHPGPVSACSSHGGYNLSVHPGKTYMLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDATYVKPFK +T+VIAPGQTTNV+VTAN+GSG+Y+VAASPF
Sbjct  228   LNEELFFKIAGHQLTVVEVDATYVKPFKIDTVVIAPGQTTNVLVTANRGSGQYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LT  P KNATPVA NF +ALRSLNS +YPARV
Sbjct  288   MDAPIAVDNVTATATLHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSLFFTVGLG+NPC +C   NGSRVVA +NNVTFVMPT+ALLQAH FNI GVFT 
Sbjct  348   PLKIDHSLFFTVGLGVNPCATC--INGSRVVADINNVTFVMPTIALLQAHVFNISGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  P N QT  GTK+YRL YN TVQLVLQDTG++ PENHPVHLHGFN
Sbjct  406   DFPANPPTPFNYTGTQPTNFQTVKGTKLYRLAYNNTVQLVLQDTGMLTPENHPVHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNF+P  DP KFNLVDPVERNTIGVP+GGW AIRF ADNPGVWFMHCHLEVH
Sbjct  466   FFEVGRGVGNFDPNKDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>ref|XP_003539958.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN07789.1| Laccase-4 [Glycine soja]
Length=556

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/440 (78%), Positives = 388/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL+WHAH+LWLR+TVHGALVILPKLGVPYPFPKP+ E V++L+EWW
Sbjct  108   QAYVYNFTLTGQRGTLWWHAHILWLRATVHGALVILPKLGVPYPFPKPNMEQVIILSEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPN SDAHTINGHPGP+    SQGGYKL V PGK+Y+LR+INAA
Sbjct  168   KSDTEAVINEALKSGLAPNASDAHTINGHPGPIQGYASQGGYKLDVQPGKTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA Y KP KT+TIVIAPGQTTNV++T    +GKY+VAASPF
Sbjct  228   LNEELFFKIAGHELTVVEVDAVYTKPLKTDTIVIAPGQTTNVLLTTKHATGKYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATATLHY G L    T LTS PPKNATPVA  F+D+LRSLNSK++PARV
Sbjct  288   MDAPIAVDNKTATATLHYLGTLGSTITTLTSMPPKNATPVATTFIDSLRSLNSKEHPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTV LG+NPC +C   N SRVVA +NNVTFVMP ++LLQAHFF IKGVFT 
Sbjct  348   PLKIDHNLLFTVSLGVNPCATC--VNNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPPV +N+TG  P+NL+T  GT+VYRL YN+TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  406   DFPGNPPVVYNFTGTQPSNLKTMKGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG GNFNP  DP KFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFVVGRGQGNFNPTKDPKKFNLVDPVERNTVGVPAGGWTAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>ref|XP_002299828.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
 gb|EEE84633.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
Length=557

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/440 (81%), Positives = 388/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q++VYNFTITGQRGTL WHAH+LWLR+TVHGA+VILPK GVPYPFP P  E V+VL EWW
Sbjct  109   QNFVYNFTITGQRGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPTPHREEVIVLGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+ SG APNVSDAHTINGHPGPV+ C SQGGY L V PGK+YMLR+INAA
Sbjct  169   KSDVEAVINEAMNSGRAPNVSDAHTINGHPGPVSGCSSQGGYNLPVRPGKTYMLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDATYVKPFK +TIVIAPGQTTNV+VTAN+GSGKY+VAASPF
Sbjct  229   LNEELFFKIAGHQLTVVEVDATYVKPFKIDTIVIAPGQTTNVLVTANRGSGKYLVAASPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LT  P +NATPVA NF DALRSLNS +YPARV
Sbjct  289   MDAPIAVDNVTATATLHYSGTLASTTTTLTVPPAQNATPVATNFTDALRSLNSIKYPARV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSLFFT+GLG+NPC +C   NG+RVVA +NNVTFVMPT+ALLQAHFFNIKGVFT 
Sbjct  349   PLKIDHSLFFTIGLGVNPCATC--VNGNRVVADINNVTFVMPTIALLQAHFFNIKGVFTD  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNYTG  P N QT  GTK+YRL YN+TVQLVLQDTG++ PENHPVHLHGFN
Sbjct  407   DFPGNPPTPFNYTGTQPKNFQTVNGTKLYRLAYNSTVQLVLQDTGMLTPENHPVHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRGIGNFNPK DP KFNL DPVERNTIGVP+GGW AIRF ADNPGVWFMHCHLEVH
Sbjct  467   FFEVGRGIGNFNPKRDPKKFNLADPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  527   TTWGLKMAFVVDNGKGPNES  546



>gb|KDO37344.1| hypothetical protein CISIN_1g009854mg [Citrus sinensis]
Length=524

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/441 (78%), Positives = 392/441 (89%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+ GQRGTL+WHAH+LWLR+TVHGA+VILPK GVPYPFPKP  E  V+L+EWW
Sbjct  75    QNYIYNFTLAGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVTVILSEWW  134

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSGLAPNVSDAHTINGHPGP+++CPSQGG+KL V+ GK+YMLR+INAA
Sbjct  135   KSDVEAVINEALKSGLAPNVSDAHTINGHPGPLSSCPSQGGFKLPVESGKTYMLRLINAA  194

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA YVKPFKT T++IAPGQTTNV+++A   +GKY+VAASPF
Sbjct  195   LNEELFFKIAGHKLTVVEVDAAYVKPFKTETVLIAPGQTTNVLLSAAHATGKYLVAASPF  254

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             +D P I VDN+TATAT+HYSG L    T LT  PP+NATPVA NF  +LRSLNSK+YPAR
Sbjct  255   LDTPAILVDNKTATATVHYSGTLGSTATTLTVPPPRNATPVAANFTASLRSLNSKKYPAR  314

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSLFFT+GLG+NPC +C   NGSRVVA +NNVTFVMPT++LLQAHFF I GVFT
Sbjct  315   VPLKIDHSLFFTIGLGINPCATC--VNGSRVVADINNVTFVMPTISLLQAHFFKIGGVFT  372

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNPPV +N+TG  PAN QT  GT++YRLPYN+TVQLVLQDTG+IAPENHP+HLHGF
Sbjct  373   DDFPGNPPVTYNFTGTQPANFQTNNGTRIYRLPYNSTVQLVLQDTGMIAPENHPLHLHGF  432

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GNFN K DP KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  433   NFFEVGRGLGNFNSKKDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEV  492

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  493   HTTWGLKMAFIVDNGKGPNES  513



>ref|XP_010101806.1| hypothetical protein L484_023595 [Morus notabilis]
 gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis]
Length=558

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/440 (80%), Positives = 386/440 (88%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+T+HGALVILPKLGVPYPFP P  E VVVLAEWW
Sbjct  108   QSYVYNFTITGQRGTLLWHAHILWLRATIHGALVILPKLGVPYPFPAPHKEVVVVLAEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAHTING PGPV+NC S+GG+ L V  GK+Y+LR+INAA
Sbjct  168   KSDTENVINEAMKSGLAPNVSDAHTINGRPGPVSNCTSEGGFTLPVQTGKTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPF  +TIVIAPGQTTN ++TA+Q SGKY+VAASPF
Sbjct  228   LNEELFFKIAGHKLTVVEVDATYVKPFSIDTIVIAPGQTTNALITADQNSGKYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHY+G L+   T LT  PP+NAT VAN F + L+SLNS  +PA+V
Sbjct  288   MDAPIAVDNATATATLHYAGTLANAATTLTVPPPQNATQVANKFTNGLKSLNSNTFPAKV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P +VDH+LFFTV LG+NPCP+CK  NGSRVVAS+NNVTFVMPT ALLQAH+F  KGVFTT
Sbjct  348   PLSVDHNLFFTVSLGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHYFKTKGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G  PA+L TT GTK+YR+ YN TVQLVLQDTGIIAPENHPVHLHGFN
Sbjct  408   DFPANPPNVFNYSGTPPASLATTNGTKLYRIKYNETVQLVLQDTGIIAPENHPVHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG GN+NPK D   FNLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCHLEVH
Sbjct  468   FFVVGRGTGNYNPKKDQKSFNLVDPVERNTVGVPSGGWTAIRFLADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGPNES
Sbjct  528   TTWGLKMAFLVDNGKGPNES  547



>gb|KHN06247.1| Laccase-4 [Glycine soja]
Length=556

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/440 (78%), Positives = 388/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+++YNFT+TGQRGTL+WHAH+LWLR+TVHGALVILPKLGVPYPFPKP+ E V++L+EWW
Sbjct  108   QAFIYNFTLTGQRGTLWWHAHILWLRATVHGALVILPKLGVPYPFPKPNMEQVMILSEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPGPV  C SQ G+KL V PG +Y+LR+INAA
Sbjct  168   KSDTEAVINEALKSGLAPNVSDAHTINGHPGPVQGCASQEGFKLDVQPGNTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA Y KPFKT+TIVIAPGQTTNV++T    +GKY+VAASPF
Sbjct  228   LNEELFFKIAGHELTVVEVDAVYTKPFKTDTIVIAPGQTTNVLLTTKHAAGKYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATATLHYSG L    T LTS PPKNATP+A +F D+LRSLNSK+YPARV
Sbjct  288   MDAPIAVDNKTATATLHYSGTLGSTITTLTSMPPKNATPLATSFTDSLRSLNSKKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTV LG+NPC +C   N SRVVA +NNVTFVMP ++LLQAHFF IKGVFT 
Sbjct  348   PLKIDHNLLFTVSLGINPCATC--VNNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPPV +N+TG  P+NL+T  GT+VYRL YN+TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  406   DFPGNPPVVYNFTGTQPSNLRTMKGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG  NFNP  DP KFNLVDPVERNT+GVP+GGW AIRFR DNPGVWFMHCHLE+H
Sbjct  466   FFVVGRGQRNFNPTKDPKKFNLVDPVERNTVGVPAGGWTAIRFRTDNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>ref|XP_007016183.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY33802.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=557

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/440 (80%), Positives = 391/440 (89%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q++VYNFTITGQRGTL+WHAH+LWLR+TVHGA+VILPK GVPYPFPKP  E  ++L EWW
Sbjct  109   QNFVYNFTITGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEETIILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSG+APNVSDAHTINGHPGPV++CP+QGGY L V PGK+YMLR+INAA
Sbjct  169   KSDVEAVINEALKSGMAPNVSDAHTINGHPGPVSSCPTQGGYTLRVKPGKTYMLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH +TVVEVDATYVKPFKT TIVI PGQTTNV++TA++G+GKY+VAASPF
Sbjct  229   LNEELFFKIAGHLLTVVEVDATYVKPFKTETIVITPGQTTNVLLTAHRGAGKYLVAASPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI VDN TATATLHYSG+L+   T LTS PPKNAT VA NF +ALRSLNSKQYPA V
Sbjct  289   MDAPIVVDNVTATATLHYSGSLTSTATTLTSLPPKNATSVATNFTNALRSLNSKQYPANV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSL FTVGLG+NPCPSC   NGSRVVAS+NNVTFVMP ++LLQAHFFNI GVFTT
Sbjct  349   PLKIDHSLLFTVGLGINPCPSC--VNGSRVVASINNVTFVMPKISLLQAHFFNISGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPPV FNYT     N QT  GTK+YRL YN+TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  407   DFPGNPPVPFNYTSTQLTNFQTKQGTKLYRLAYNSTVQLVLQDTGMITPENHPLHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK D  KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  467   FFEVGRGLGNFNPKKDTKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNG GPNE+
Sbjct  527   TTWGLKMAFVVDNGNGPNET  546



>ref|XP_010256659.1| PREDICTED: laccase-4 [Nelumbo nucifera]
Length=554

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/440 (80%), Positives = 390/440 (89%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+T+HGA+VILPK GVPYPFP P  E VV+L EWW
Sbjct  106   QSYVYNFTITGQRGTLLWHAHILWLRATLHGAIVILPKHGVPYPFPTPHKEVVVILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+ SGLAPNVSDAHTING PGPV  CPSQ G+ L V+PGK+YMLR+INAA
Sbjct  166   KSDVEAVINEALNSGLAPNVSDAHTINGQPGPVPTCPSQSGFNLKVEPGKTYMLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA Y KPFKT+TIVIAPGQTTNV++   +GSGKY+VAASPF
Sbjct  226   LNEELFFKIAGHKLTVVEVDAVYTKPFKTDTIVIAPGQTTNVLLETGRGSGKYLVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYSG L+   T LT+ PP+NATPVA+NF+D+LRSLNSK+YP +V
Sbjct  286   MDSPIAVDNMTATATLHYSGTLATSATTLTNPPPQNATPVASNFIDSLRSLNSKEYPVKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL FTVGLG+NPC +C   NG RV+A +NNV+FVMPT ALLQAH+ NI GVFT 
Sbjct  346   PLTVDHSLLFTVGLGVNPCSTC--PNGIRVIADINNVSFVMPTTALLQAHYLNISGVFTD  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP++FNYTG  PANLQT  GTK+YRL YN TVQLVLQDTG+IAPENHPVHLHGFN
Sbjct  404   DFPANPPISFNYTGTQPANLQTMNGTKLYRLRYNDTVQLVLQDTGMIAPENHPVHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NPKTDP KFNLVDP+ERNTIGVPSGGW  IRFRADNPGVWFMHCHLEVH
Sbjct  464   FFAVGRGLGNYNPKTDPAKFNLVDPIERNTIGVPSGGWTVIRFRADNPGVWFMHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  524   TTWGLKMAFVVDNGKGPNES  543



>ref|XP_004302643.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/444 (80%), Positives = 395/444 (89%), Gaps = 4/444 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QS+ YNFTITGQRGTL WHAH+LWLR+TVHGALVILPK GVPYPFP P  E  VVLAEWW
Sbjct  107   QSFTYNFTITGQRGTLLWHAHILWLRATVHGALVILPKRGVPYPFPTPHKEVPVVLAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVT-NCPSQGGYKLSVDPGKSYMLRVINA  1203
             KSDTEAVINEA+K GLAPNVSDAHTINGHPG V+ NC + GG+KLSV+ GK+Y+LR+INA
Sbjct  167   KSDTEAVINEALKGGLAPNVSDAHTINGHPGLVSPNCTTDGGFKLSVESGKTYLLRIINA  226

Query  1202  ALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASP  1023
             ALNEELFFKIAGH++T+VEVDATYVKPFKT+TIVIAPGQTTN ++TANQ SGKY+V ASP
Sbjct  227   ALNEELFFKIAGHKLTIVEVDATYVKPFKTDTIVIAPGQTTNALITANQKSGKYLVTASP  286

Query  1022  FMDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPA  846
             F+D P IAVDN T+TAT+HYSG LS   T LTS PP+NAT VAN+F D+LRSLN+ ++PA
Sbjct  287   FLDTPGIAVDNLTSTATVHYSGTLSNSPTTLTSPPPQNATQVANSFTDSLRSLNTMKFPA  346

Query  845   RVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVF  666
             +VP  +DH+L FT+GLG+NPCPSCK  NGSRVVAS+NNVTFVMPT ALLQAHFF  KGVF
Sbjct  347   KVPLKIDHNLLFTIGLGINPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFKTKGVF  406

Query  665   TTDFPGNPPVAFNYTGAGPAN--LQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHL  492
             TTDFP NPP AFN++G  PAN  L TT GTKVYRL YN+TVQLVLQDTGIIAPENHPVHL
Sbjct  407   TTDFPANPPNAFNFSGGLPANSSLATTNGTKVYRLAYNSTVQLVLQDTGIIAPENHPVHL  466

Query  491   HGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCH  312
             HGFNFFA+GRG+GN+NPKTDP  FNLVDPVERNTIGVPSGGWVAIRF ADNPGVWFMHCH
Sbjct  467   HGFNFFAIGRGLGNYNPKTDPKNFNLVDPVERNTIGVPSGGWVAIRFIADNPGVWFMHCH  526

Query  311   LEVHTTWGLKMAFLVDNGKGPNES  240
             LEVHT+WGLKMAFLVDNGKGPN+S
Sbjct  527   LEVHTSWGLKMAFLVDNGKGPNQS  550



>ref|XP_006425016.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
 ref|XP_006488481.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR38256.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
Length=557

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/441 (78%), Positives = 391/441 (89%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+ GQRGTL+WHAH+LWLR+TVHGA+VILPK GVPYPFPKP  E  V+L+EWW
Sbjct  108   QNYIYNFTLAGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVTVILSEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSGLAPNVSDAHTINGHPGP+++CPSQGG+KL V+ GK+YMLR+INAA
Sbjct  168   KSDVEAVINEALKSGLAPNVSDAHTINGHPGPLSSCPSQGGFKLPVESGKTYMLRLINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA YVKPF T T++IAPGQTTNV+++A   +GKY+VAASPF
Sbjct  228   LNEELFFKIAGHKLTVVEVDAAYVKPFNTETVLIAPGQTTNVLLSAAHATGKYLVAASPF  287

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             +D P I VDN+TATAT+HYSG L    T LT  PP+NATPVA NF  +LRSLNSK+YPAR
Sbjct  288   LDTPAILVDNKTATATVHYSGTLGSTATTLTVPPPRNATPVAANFTASLRSLNSKKYPAR  347

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSLFFT+GLG+NPC +C   NGSRVVA +NNVTFVMPT++LLQAHFF I GVFT
Sbjct  348   VPLKIDHSLFFTIGLGINPCATC--VNGSRVVADINNVTFVMPTISLLQAHFFKIGGVFT  405

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNPPV +N+TG  PAN QT  GT++YRLPYN+TVQLVLQDTG+IAPENHP+HLHGF
Sbjct  406   DDFPGNPPVTYNFTGTQPANFQTNNGTRIYRLPYNSTVQLVLQDTGMIAPENHPLHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GNFN K DP KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  466   NFFEVGRGLGNFNSKKDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEV  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  526   HTTWGLKMAFIVDNGKGPNES  546



>ref|XP_011032153.1| PREDICTED: laccase-4-like isoform X1 [Populus euphratica]
Length=523

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/440 (80%), Positives = 382/440 (87%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILPK GVPYPFP P  E V+VL EWW
Sbjct  75    QSYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPTPRKEKVIVLGEWW  134

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA KSG+APNVSDAHTINGHPGPV+ C S GGY L+V PGK+YM R+INAA
Sbjct  135   KSDVEAVINEATKSGMAPNVSDAHTINGHPGPVSACSSHGGYNLTVHPGKTYMFRIINAA  194

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDA YVKPFK +T+VIAPGQTTNV++TAN+GSGKY+VAASPF
Sbjct  195   LNEELFFKIAGHQLTVVEVDAAYVKPFKIDTVVIAPGQTTNVLLTANRGSGKYLVAASPF  254

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATA LHYSG L+   T LT  P KNATPVA NF +ALRSLNS +YPARV
Sbjct  255   MDAPIAVDNVTATAILHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARV  314

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +D SLFFTVGLG+NPC +C   NGSRVVA +NNVTFVMPT+ALLQAH FNI GVFT 
Sbjct  315   PLKIDRSLFFTVGLGVNPCATC--INGSRVVADINNVTFVMPTIALLQAHVFNISGVFTD  372

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  P N QT  GTK+YRL YN TVQLVLQDTG++ PENHP+HLHGFN
Sbjct  373   DFPANPPTPFNYTGTQPTNFQTVNGTKLYRLAYNNTVQLVLQDTGMLTPENHPIHLHGFN  432

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNF+P  DP KFNLVDPVERNTIGVP+GGW AIRF ADNPGVWFMHCHLEVH
Sbjct  433   FFEVGRGVGNFDPNKDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVH  492

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  493   TTWGLKMAFVVDNGKGPNES  512



>ref|XP_003522150.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN02155.1| Laccase-4 [Glycine soja]
Length=557

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/440 (80%), Positives = 395/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+TGQRGTL +HAHV WLRST+HGALVILPK GVPYPFPKPD E VVVL EWW
Sbjct  107   QTYLYNFTLTGQRGTLLYHAHVNWLRSTLHGALVILPKRGVPYPFPKPDDELVVVLGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEA+INEA+KSGLAPNVSDAHTING PG VTNC +Q  Y L V+ GK+Y+LR+INAA
Sbjct  167   KSDTEAIINEALKSGLAPNVSDAHTINGLPGAVTNCSTQDVYNLPVESGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFK  TI+IAPGQTTNV++ A+Q  GKY+VAASPF
Sbjct  227   LNEELFFKIAGHKLTVVEVDATYVKPFKIETILIAPGQTTNVLLNADQKFGKYLVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHY+G L+   T+LT+ PPKN+T +ANNF+ +LR LNSK+YP  V
Sbjct  287   MDAPIAVDNLTATATLHYTGTLAATPTILTTPPPKNSTQIANNFISSLRGLNSKKYPVNV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSLFFTVGLG++PCPSCK ANGSRVVA++NNVTF+MPT+ALLQAH+FNIKGVFTT
Sbjct  347   PLTVDHSLFFTVGLGISPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G GPANL T TGTKVYR+P+NATVQ+VLQDTGIIAPENHPVHLHGFN
Sbjct  407   DFPANPPHLFNYSGPGPANLNTETGTKVYRVPFNATVQVVLQDTGIIAPENHPVHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP  FNLVDPVERNTIGVP+GGW A RFRADNPGVWFMHCHLEVH
Sbjct  467   FFVVGRGVGNFNPKIDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWFMHCHLEVH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP +S
Sbjct  527   TTWGLKMAFLVDNGKGPKQS  546



>ref|XP_011032154.1| PREDICTED: laccase-4-like isoform X2 [Populus euphratica]
Length=556

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/440 (80%), Positives = 382/440 (87%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTLFWHAH+LWLR+TVHGA+VILPK GVPYPFP P  E V+VL EWW
Sbjct  108   QSYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPTPRKEKVIVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA KSG+APNVSDAHTINGHPGPV+ C S GGY L+V PGK+YM R+INAA
Sbjct  168   KSDVEAVINEATKSGMAPNVSDAHTINGHPGPVSACSSHGGYNLTVHPGKTYMFRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDA YVKPFK +T+VIAPGQTTNV++TAN+GSGKY+VAASPF
Sbjct  228   LNEELFFKIAGHQLTVVEVDAAYVKPFKIDTVVIAPGQTTNVLLTANRGSGKYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATA LHYSG L+   T LT  P KNATPVA NF +ALRSLNS +YPARV
Sbjct  288   MDAPIAVDNVTATAILHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +D SLFFTVGLG+NPC +C   NGSRVVA +NNVTFVMPT+ALLQAH FNI GVFT 
Sbjct  348   PLKIDRSLFFTVGLGVNPCATC--INGSRVVADINNVTFVMPTIALLQAHVFNISGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  P N QT  GTK+YRL YN TVQLVLQDTG++ PENHP+HLHGFN
Sbjct  406   DFPANPPTPFNYTGTQPTNFQTVNGTKLYRLAYNNTVQLVLQDTGMLTPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNF+P  DP KFNLVDPVERNTIGVP+GGW AIRF ADNPGVWFMHCHLEVH
Sbjct  466   FFEVGRGVGNFDPNKDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>ref|XP_003551299.1| PREDICTED: laccase-4-like [Glycine max]
Length=556

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/440 (77%), Positives = 388/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+++YNFT+TGQRGTL+WHAH+LWLR+TVHGALVILPKLGVPYPFPKP+ E V++L+EWW
Sbjct  108   QAFIYNFTLTGQRGTLWWHAHILWLRATVHGALVILPKLGVPYPFPKPNMEQVMILSEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVS+AHTINGHPGPV  C SQ G+KL V PG +Y+LR+INAA
Sbjct  168   KSDTEAVINEALKSGLAPNVSNAHTINGHPGPVQGCASQEGFKLDVQPGNTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA Y KPFKT+TIVIAPGQTTNV++T    +GKY+VAASPF
Sbjct  228   LNEELFFKIAGHELTVVEVDAVYTKPFKTDTIVIAPGQTTNVLLTTKHAAGKYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATATLHYSG L    T LTS PPKNATP+A +F D+LRSLNSK+YPARV
Sbjct  288   MDAPIAVDNKTATATLHYSGTLGSTITTLTSMPPKNATPLATSFTDSLRSLNSKKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTV LG+NPC +C   N SRVVA +NNVTFVMP ++LLQAHFF IKGVFT 
Sbjct  348   PLKIDHNLLFTVSLGINPCATC--VNNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPPV +N+TG  P+NL+T  GT+VYRL YN+TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  406   DFPGNPPVVYNFTGTQPSNLRTMKGTRVYRLAYNSTVQLVLQDTGMITPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG  NFNP  DP KFNLVDPVERNT+GVP+GGW AIRFR DNPGVWFMHCHLE+H
Sbjct  466   FFVVGRGQRNFNPTKDPKKFNLVDPVERNTVGVPAGGWTAIRFRTDNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>emb|CDX74915.1| BnaA05g06610D [Brassica napus]
Length=558

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/440 (78%), Positives = 389/440 (88%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TVHGA+VILPK GVPYPFPKPDHE V+VLAEWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPKPDHEKVIVLAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAH INGH GPV NCPSQG YKLSV  GK+Y+LR++NAA
Sbjct  169   KSDTENVINEALKSGLAPNVSDAHMINGHSGPVNNCPSQG-YKLSVTNGKTYLLRLVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFKT+T++IAPGQTTNV++T ++ +GKY+V ASPF
Sbjct  228   LNEELFFKVAGHLFTVVEVDAVYVKPFKTDTVLIAPGQTTNVLLTTSKSAGKYLVTASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATAT+HYSG LS   T LT  PP+NAT +ANNF ++LRSLNSK+YPA V
Sbjct  288   MDSPIAVDNVTATATVHYSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYPALV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLGLNPCP+CK  NGSRVVAS+NNVTF MP  ALL AH+FNI GVFTT
Sbjct  348   PTTIDHHLFFTVGLGLNPCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+IAPENHP+HLHGFN
Sbjct  408   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFN K DP+ FNLVDPVERNTIGVPSGGWV IRFRADNPGVWFMHCHLEVH
Sbjct  468   FFEVGRGLGNFNAKKDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  528   TTWGLKMAFLVENGKGPNQS  547



>gb|KHG22893.1| Laccase-4 -like protein [Gossypium arboreum]
Length=486

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/440 (79%), Positives = 386/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFT+TGQRGTLFWHAH+LWLR+TVHGA+VILPK GVPYPFPKP  E +V+L EWW
Sbjct  38    QSYVYNFTVTGQRGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEEIVILGEWW  97

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSGLAPNVSDAHTINGHPG   +CPS+GGY L+V PGK+YMLR+INAA
Sbjct  98    KSDVEAVINEALKSGLAPNVSDAHTINGHPGSTPSCPSKGGYTLAVKPGKTYMLRIINAA  157

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFF IAGHQ+TVVEVDATYVKPFKT+TIVI+PGQTTNV+VT ++ +GKY+VAASPF
Sbjct  158   LNEELFFMIAGHQLTVVEVDATYVKPFKTDTIVISPGQTTNVLVTTHRRAGKYLVAASPF  217

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHY+G+L+   T L S PPKNAT VA NF +ALRSLNS++YPA+V
Sbjct  218   MDAPIAVDNLTATATLHYAGSLTSSATTLVSPPPKNATSVAANFTNALRSLNSEKYPAKV  277

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSL FT+GLG+NPC +C   NGSRVVASVNN+TFVMP  ALLQAHFFNI GVF T
Sbjct  278   PLKIDHSLLFTIGLGINPCSTC--VNGSRVVASVNNITFVMPKTALLQAHFFNINGVFAT  335

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             +FPG PPV FNYT     NL T   TK+YRL YN TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  336   NFPGRPPVPFNYTSIQLTNLGTKQATKLYRLGYNDTVQLVLQDTGMITPENHPIHLHGFN  395

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNF+PK DP  FNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  396   FFEVGRGVGNFDPKKDPKNFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVH  455

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  456   TTWGLKMAFVVDNGKGPNES  475



>ref|XP_007142229.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
 gb|ESW14223.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
Length=555

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/441 (79%), Positives = 387/441 (88%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q +VYNFT+TGQRGTL+WHAH+LWLRST+HGALVILPKLGVPYPFPKP+ E V++L+EWW
Sbjct  106   QVFVYNFTLTGQRGTLWWHAHILWLRSTLHGALVILPKLGVPYPFPKPNAEKVILLSEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEA+I EA+KSGLAPNVSDAHTINGH G V  C SQG YKL VD G +Y+LR+INAA
Sbjct  166   KSDTEAIIKEALKSGLAPNVSDAHTINGHTGSVQQCASQGVYKLEVDAGNTYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDA Y KP KTNTIVIAPGQTTNV++ AN+ +GKY+VAA+PF
Sbjct  226   LNEELFFKIAGHQLTVVEVDAVYTKPLKTNTIVIAPGQTTNVLLKANRATGKYLVAATPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYSG+LS   T LTS PPKNATPVA  F D+LRSLNSK YPARV
Sbjct  286   MDSPIAVDNVTATATLHYSGSLSSTITTLTSLPPKNATPVATTFTDSLRSLNSKNYPARV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VDH+LFFTV LG+NPCP+C   NGSRVVA++NNVTFVMP ++LLQAHFFNI GVFT 
Sbjct  346   PTKVDHNLFFTVSLGVNPCPTC--VNGSRVVAAINNVTFVMPKISLLQAHFFNISGVFTD  403

Query  659   DFPGNPPVAFNYTGA-GPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  P V +++TG   PANL+T  GT+VYRL YN+TVQLVLQDTG+I PENHPVHLHGF
Sbjct  404   DFPRKPSVVYDFTGTQQPANLRTNRGTRVYRLAYNSTVQLVLQDTGMITPENHPVHLHGF  463

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG GNFNPK D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLE+
Sbjct  464   NFFVVGRGQGNFNPKRDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEI  523

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLVDNGKGPNES
Sbjct  524   HTTWGLKMAFLVDNGKGPNES  544



>ref|XP_008775059.1| PREDICTED: laccase-22-like [Phoenix dactylifera]
Length=554

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/440 (76%), Positives = 394/440 (90%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFTITGQRGTLFWHAH+LWLR+TVHGA+V+LPK  VPYPFP P  E V++L EWW
Sbjct  106   HSYVYNFTITGQRGTLFWHAHILWLRATVHGAIVVLPKPNVPYPFPAPQKEEVIILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAH INGHPGP+++CP+  G++L+VD GK+Y+LR++NAA
Sbjct  166   KSDTEAVINEALKSGLAPNVSDAHIINGHPGPMSDCPTSKGFQLTVDSGKTYLLRIVNAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGHQ+TVVEVDA Y KPFKT+TI+I PGQTTNV++TA+QG+G Y+V ASPF
Sbjct  226   LNEELFFKVAGHQLTVVEVDACYTKPFKTDTILITPGQTTNVLLTADQGAGSYLVTASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN+TA AT+HY+ +++      T+ PP+NATPVA+ F+D+LRSLNS+QYPARV
Sbjct  286   MDSPIAVDNKTAMATVHYTNSVATADLTTTNPPPQNATPVASKFIDSLRSLNSEQYPARV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL FTVGLG+NPCP+C   NGSRVVA +NNV+F MPT A+LQAH+FNI GVF  
Sbjct  346   PLTVDHSLLFTVGLGVNPCPTC--VNGSRVVADMNNVSFTMPTTAILQAHYFNISGVFAD  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPG PP+AFNYTG GP N+QT +GT+VYRL +N+TVQLVLQDTGIIAPENHP+HLHGFN
Sbjct  404   DFPGKPPIAFNYTGGGPKNMQTMSGTRVYRLAFNSTVQLVLQDTGIIAPENHPIHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GN+NP T P+KFNLVDPVERNTIGVPSGGW AIRF+ADNPGVWFMHCHLEVH
Sbjct  464   FFAVGRGLGNYNPNTSPSKFNLVDPVERNTIGVPSGGWTAIRFQADNPGVWFMHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNG+GPNES
Sbjct  524   TTWGLKMAFVVDNGEGPNES  543



>ref|XP_006411009.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
 gb|ESQ52462.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
Length=557

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/440 (78%), Positives = 390/440 (89%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWW
Sbjct  108   QVYTYNYTLTGQRGTLWWHAHILWLRATVYGAIVILPKRGVPYPFPKPDHEKVIVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEAIKSGLAPNVSDAH INGHPGPV NCPSQG YKLSV+ GK+Y+LR++NAA
Sbjct  168   KSDTENVINEAIKSGLAPNVSDAHMINGHPGPVKNCPSQG-YKLSVENGKTYLLRLVNAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFK +T++IAPGQTTNV++TA++ +GKY+V ASPF
Sbjct  227   LNEELFFKVAGHIFTVVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AVDN TATAT+HYSG LS   T LT  PP+NAT VANNF ++LRSLNSK+YPA V
Sbjct  287   MDAPVAVDNVTATATVHYSGTLSSSPTTLTLPPPQNATSVANNFTNSLRSLNSKKYPALV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLGLN CP+CK  NGSRVVAS+NNVTF+MP  ALL AH+FNI GVFTT
Sbjct  347   PTTIDHHLFFTVGLGLNSCPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNISGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+IAPENHP+HLHG+N
Sbjct  407   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGYN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNF+PK DP  FNLVDPVERNT+GVPSGGWV IRFRADNPGVWFMHCHLEVH
Sbjct  467   FFEVGRGLGNFDPKKDPNNFNLVDPVERNTVGVPSGGWVVIRFRADNPGVWFMHCHLEVH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  527   TTWGLKMAFLVENGKGPNQS  546



>gb|KFK36706.1| hypothetical protein AALP_AA4G158700 [Arabis alpina]
Length=560

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/440 (78%), Positives = 389/440 (88%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y YN+T+TGQRGTL+WHAHVLWLR+TV+GALVILPK GVPYPFPKP+HE V+VL EWW
Sbjct  110   QAYTYNYTLTGQRGTLWWHAHVLWLRATVYGALVILPKRGVPYPFPKPNHEKVIVLGEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSD+H ING PG   NCPS  GYKLSV+ GK+Y+LR++NAA
Sbjct  170   KSDTENVINEALKSGLAPNVSDSHMINGRPGLAKNCPSDQGYKLSVENGKTYLLRIVNAA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFK +T++IAPGQTTNV++TA++ +GKY+VAASPF
Sbjct  230   LNEELFFKVAGHLFTVVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVAASPF  289

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG LS   T+LT  PP+NAT +ANNF ++LRSLNSK+YPA V
Sbjct  290   MDAPIAVDNVTATATLHYSGTLSSSPTILTLPPPQNATSIANNFTNSLRSLNSKKYPAIV  349

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH L FTVGLGLNPCP+CK  NGSRVVAS+NNVTF+MP  ALL AH+FNI GVFTT
Sbjct  350   PTTIDHHLLFTVGLGLNPCPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNISGVFTT  409

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+IAPENHPVHLHGFN
Sbjct  410   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPVHLHGFN  469

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP  FNLVDPVERNT+GVPSGGWV IRFRADNPGVWFMHCHLEVH
Sbjct  470   FFEVGRGLGNFNPKKDPNNFNLVDPVERNTVGVPSGGWVVIRFRADNPGVWFMHCHLEVH  529

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  530   TTWGLKMAFLVENGKGPNQS  549



>emb|CDX91428.1| BnaC04g07220D [Brassica napus]
Length=558

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/440 (78%), Positives = 388/440 (88%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TVHGA+VILPK GVPYPFPKPDHE V+VLAEWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPKPDHEKVIVLAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLA NVSDAH INGH GPV NCPSQG YKLSV  GK+Y+LR++NAA
Sbjct  169   KSDTENVINEALKSGLASNVSDAHMINGHSGPVNNCPSQG-YKLSVTNGKTYLLRLVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFKT+TI+IAPGQTTNV++T ++ +GKY+V ASPF
Sbjct  228   LNEELFFKVAGHLFTVVEVDAVYVKPFKTDTILIAPGQTTNVLLTTSKSAGKYLVTASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATAT+HYSG LS   T LT  PP+NAT +ANNF ++LRSLNSK+YPA V
Sbjct  288   MDSPIAVDNVTATATVHYSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYPALV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLGLNPCP+CK  NGSRVVAS+NNVTF MP  ALL AH+FNI GVFTT
Sbjct  348   PTTIDHHLFFTVGLGLNPCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+IAPENHP+HLHGFN
Sbjct  408   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFN K DP+ FNLVDPVERNTIGVPSGGWV IRFRADNPGVWFMHCHLEVH
Sbjct  468   FFEVGRGLGNFNAKKDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  528   TTWGLKMAFLVENGKGPNQS  547



>ref|XP_004500229.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=556

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/440 (76%), Positives = 388/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+TGQRGTL+WHAHVLWLR+TVHGALVILPKLGVPYPFPKP  E V+VL EWW
Sbjct  108   QTYLYNFTLTGQRGTLWWHAHVLWLRATVHGALVILPKLGVPYPFPKPHMEQVIVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEA+INEA+KSGLAPN+SDAHTINGHPGP+  C  QGG+ L V+P  +Y+LR++NAA
Sbjct  168   KSDTEAIINEALKSGLAPNISDAHTINGHPGPIQGCSPQGGFSLEVEPKNTYLLRIVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+A HQ+TVVEVDATYVKPF+T+TIVIAPGQTTNV++TA   +GKY+VAASPF
Sbjct  228   LNEELFFKVASHQLTVVEVDATYVKPFQTDTIVIAPGQTTNVLLTAKHTTGKYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI VDN+TATAT+HYSG L    T LTS PPKNATP+A  F D+LRSLNSK+YPA+V
Sbjct  288   MDAPIVVDNKTATATIHYSGTLGSTITTLTSLPPKNATPLATTFTDSLRSLNSKKYPAKV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTV LG+NPCP+C   N SRVVA++NNVTFVMP +ALLQAHFFNIKGVF+ 
Sbjct  348   PLKIDHNLLFTVSLGINPCPTC--VNNSRVVAAINNVTFVMPKIALLQAHFFNIKGVFSE  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP+ +N+TG  P N  TT GT++Y+L YN+TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  406   DFPGNPPIVYNFTGTQPTNFGTTKGTRLYKLAYNSTVQLVLQDTGMITPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG GN+NP+ D  KFNLVDPVERNTIGVP+GGW AIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFVVGRGQGNYNPRKDAKKFNLVDPVERNTIGVPAGGWTAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>ref|XP_006293932.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
 gb|EOA26830.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
Length=558

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/440 (78%), Positives = 390/440 (89%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVNGAIVILPKRGVPYPFPKPDHEKVIVLGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAH INGHPGPV NCPSQG YKLSV+ GK+Y+LR+INAA
Sbjct  169   KSDTEDVINEALKSGLAPNVSDAHMINGHPGPVKNCPSQG-YKLSVENGKTYLLRLINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFK +T++IAPGQTTNV++TA++ +GK++V ASPF
Sbjct  228   LNEELFFKVAGHIFTVVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKFLVTASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATAT+HYSG LS   TVLT  PP+NAT VANNF ++LRSLNSK+YPA V
Sbjct  288   MDAPIAVDNVTATATVHYSGTLSSSPTVLTLPPPQNATSVANNFTNSLRSLNSKKYPALV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH L FTVGLGLN CP+CK  NGSRVVAS+NNVTF+MP  ALL AH+FN  GVFTT
Sbjct  348   PTTIDHHLLFTVGLGLNACPTCKAGNGSRVVASINNVTFIMPKTALLSAHYFNKSGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+I+PENHP+HLHGFN
Sbjct  408   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFN KTDP  FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  468   FFQVGRGLGNFNSKTDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  528   TTWGLKMAFLVENGKGPNQS  547



>ref|XP_010104683.1| hypothetical protein L484_022066 [Morus notabilis]
 gb|EXC01489.1| hypothetical protein L484_022066 [Morus notabilis]
Length=556

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/440 (77%), Positives = 387/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL+WHAH+LWLR+TVHGA+VILPK GVPYPFP P+ E V+VL EWW
Sbjct  108   QSYVYNFTITGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPTPNKEEVIVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E+VIN+A+KSGLAPNVSDAHTING PGPV+NCPSQGG+ L V+ G++YMLR++NAA
Sbjct  168   KSDVESVINQALKSGLAPNVSDAHTINGQPGPVSNCPSQGGFTLPVESGQTYMLRIVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++ VVEVDA Y KPFKT+TIVIAPGQTTN ++TA+Q +GKY V ASP+
Sbjct  228   LNEELFFKIAGHKLAVVEVDAVYTKPFKTDTIVIAPGQTTNALLTADQNAGKYSVLASPY  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATATLHYSG LS  RT+LT+ PP+NAT +A  F ++LRSLNSK+YPARV
Sbjct  288   MDAPIAVDNKTATATLHYSGTLSSSRTILTAPPPQNATSIATKFTNSLRSLNSKKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSL FT+GLG+NPC +C   NGSRVVA +NNVTFVMP +ALLQAHFFNI GVFT 
Sbjct  348   PLKIDHSLLFTIGLGVNPCKTC--VNGSRVVADINNVTFVMPNIALLQAHFFNISGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPG PPV FNYTG  P+N  TT GT++YRL Y +TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  406   DFPGKPPVPFNYTGTQPSNFATTQGTRLYRLAYKSTVQLVLQDTGMITPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GNFNP  D   FNLVDPVERNTIGVPSGGW AIRF+ADNPGVWFMHCHLEVH
Sbjct  466   FFVVGKGLGNFNPNKDQKNFNLVDPVERNTIGVPSGGWTAIRFKADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>ref|XP_008239590.1| PREDICTED: laccase-4-like [Prunus mume]
Length=559

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/442 (80%), Positives = 397/442 (90%), Gaps = 2/442 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGALVILPK GVPYPFP P  E  V+LAEWW
Sbjct  107   QSYVYNFTITGQRGTLLWHAHILWLRATVHGALVILPKRGVPYPFPAPHKEVNVILAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+A+ SG+APNVSDAH INGHPGPV NC S+GG+ L V+ GK+Y+LR+INAA
Sbjct  167   KSDTEAVINQALSSGIAPNVSDAHIINGHPGPVANCSSEGGFTLPVENGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++T+VEVDATYVKPFKT+TIVIAPGQTTN ++TANQ SGKY+VAASPF
Sbjct  227   LNEELFFKIAGHKLTIVEVDATYVKPFKTDTIVIAPGQTTNALITANQNSGKYLVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYSG L+   T LT+ PP+NAT VANNF+++L+SLNSK++PA+V
Sbjct  287   MDSPIAVDNLTATATLHYSGTLATTPTTLTNPPPQNATQVANNFINSLKSLNSKKFPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VDH+L FTVGLG+NPCP+CK  NGSRVVASVNNVTFVMPT ALLQAH FNI GVFTT
Sbjct  347   PLKVDHNLLFTVGLGINPCPTCKAGNGSRVVASVNNVTFVMPTTALLQAHVFNISGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPAN--LQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             DFPGNPP  FN++G  PAN  + TT GTK+YRL YN+TVQLVLQDTG IAPENHPVHLHG
Sbjct  407   DFPGNPPNTFNFSGGPPANASMATTNGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHG  466

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNF++VGRG+GN+NPK DP KFNLVDPVERNT+GVPSGGW AIRF+ADNPGVWF+HCHLE
Sbjct  467   FNFYSVGRGVGNYNPKKDPKKFNLVDPVERNTVGVPSGGWAAIRFQADNPGVWFLHCHLE  526

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAFLVDNGKGPNES
Sbjct  527   VHTTWGLKMAFLVDNGKGPNES  548



>ref|XP_002879726.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55985.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/440 (78%), Positives = 388/440 (88%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GALVILPK GVPYPFPKPDHE V+VL EWW
Sbjct  108   QVYTYNYTLTGQRGTLWWHAHILWLRATVYGALVILPKRGVPYPFPKPDHEKVIVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE +INEA+KSGLAPNVSDAH INGHPGPV NCPSQG YKLSV+ GK+Y+LR++NAA
Sbjct  168   KSDTENIINEALKSGLAPNVSDAHMINGHPGPVKNCPSQG-YKLSVENGKTYLLRLVNAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFKT+T++IAPGQTTNV++TA++ +GKY+V ASPF
Sbjct  227   LNEELFFKVAGHIFTVVEVDAVYVKPFKTDTVLIAPGQTTNVLLTASKSAGKYLVTASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATAT+HYSG LS   T+LT  PP+NAT +ANNF  +LRSLNSK+YPA V
Sbjct  287   MDAPIAVDNVTATATVHYSGTLSSSPTILTLPPPQNATSIANNFTKSLRSLNSKKYPALV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLGLN CP+CK  NGSRVVAS+NNVTF+MP  ALL AH+FN  GVFTT
Sbjct  347   PTTIDHHLFFTVGLGLNACPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNTSGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+I+PENHPVHLHGFN
Sbjct  407   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPVHLHGFN  466

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFN   DP  FNL+DPVERNTIGVPSGGWV IRFRADNPGVWFMHCHLEVH
Sbjct  467   FFEVGRGLGNFNSTKDPKNFNLIDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVH  526

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  527   TTWGLKMAFLVENGKGPNQS  546



>ref|XP_008377498.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/442 (81%), Positives = 398/442 (90%), Gaps = 2/442 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGAL++LPK GVPYPFP P  E  VVLAEWW
Sbjct  107   QSYVYNFTITGQRGTLLWHAHILWLRATVHGALIVLPKRGVPYPFPAPHKEVPVVLAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+A+KSGLAPNVSDAHTINGHPGPV NC SQGG+ L V+ GK+Y+LR+INAA
Sbjct  167   KSDTEAVINQALKSGLAPNVSDAHTINGHPGPVPNCSSQGGFTLPVENGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH +T+VEVDATYVKPFKT+TIVIAPGQTTN +VTANQ SGKYM++ASPF
Sbjct  227   LNEELFFKIAGHILTIVEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMLSASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHY+G L+   T LTS PP+NAT VAN+F+++L++LNSK++PA+V
Sbjct  287   MDSPIAVDNLTATATLHYTGTLATTPTTLTSPPPQNATQVANSFINSLKALNSKKFPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTVGLG+N CPSCK ANGSRVVASVNNVTFVMPT ALLQAHFFN  GVFTT
Sbjct  347   PLKIDHNLLFTVGLGINSCPSCKAANGSRVVASVNNVTFVMPTTALLQAHFFNKSGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPAN--LQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             DFPGNPP AFN++G  PAN  L TT GTK+YRL YN+TVQLVLQDTG IAPENHPVHLHG
Sbjct  407   DFPGNPPTAFNFSGGLPANASLATTRGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHG  466

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFF+VGRGIGN+NPKTDP KFNLVDPVERNT  VP+GGWVAIRF ADNPGVWFMHCHLE
Sbjct  467   FNFFSVGRGIGNYNPKTDPKKFNLVDPVERNTANVPTGGWVAIRFIADNPGVWFMHCHLE  526

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAFLVDNGKGPN+S
Sbjct  527   VHTTWGLKMAFLVDNGKGPNQS  548



>ref|XP_007134763.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
 gb|ESW06757.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
Length=527

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/440 (80%), Positives = 395/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+TGQRGTL +HAHV WLRST+HGALVILPK GVPYPFPKPD E VVVL EWW
Sbjct  77    QTYLYNFTLTGQRGTLLYHAHVNWLRSTLHGALVILPKRGVPYPFPKPDDELVVVLGEWW  136

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEA+INEA+KSGLAPNVSDAHTING PG VTNC S+  Y L V+ GK+Y+LR++NAA
Sbjct  137   KSDTEAIINEALKSGLAPNVSDAHTINGLPGTVTNCSSKDVYNLPVEGGKTYLLRIVNAA  196

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFK  TIVIAPGQTTNV+++A+Q SGKY+VAASPF
Sbjct  197   LNEELFFKIAGHKLTVVEVDATYVKPFKIETIVIAPGQTTNVLLSADQKSGKYLVAASPF  256

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             M+AP+AVDN TATATLHY+G L+   TVLT+ PPKNAT VA NF+ +LR LNSK+YP  V
Sbjct  257   MNAPVAVDNLTATATLHYTGTLATTPTVLTTPPPKNATQVATNFISSLRGLNSKKYPVNV  316

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSLFFT GLG+NPCPSCK ANGSRVVAS+NNVTF+MPT+ALLQAH+FNIKGVFTT
Sbjct  317   PLTVDHSLFFTAGLGINPCPSCKAANGSRVVASINNVTFLMPTIALLQAHYFNIKGVFTT  376

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G GPANL T TGTKVY+LP+NATVQ+VLQDTGIIAPENHPVHLHGFN
Sbjct  377   DFPANPPHVFNYSGPGPANLNTETGTKVYKLPFNATVQVVLQDTGIIAPENHPVHLHGFN  436

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRGIGN+NP TDP  FNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLEVH
Sbjct  437   FFVVGRGIGNYNPNTDPKNFNLVDPVERNTVGVPAGGWAAIRFRADNPGVWFMHCHLEVH  496

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKG  +S
Sbjct  497   TTWGLKMAFLVENGKGSKQS  516



>ref|XP_007205010.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
 gb|EMJ06209.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
Length=559

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/442 (79%), Positives = 396/442 (90%), Gaps = 2/442 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGALVILPK GVPYPFP P  E  V+LAEWW
Sbjct  107   QSYVYNFTITGQRGTLLWHAHILWLRATVHGALVILPKRGVPYPFPAPHKEVNVILAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+A+ SG+APNVSDAHTINGHPG V NC SQGG+ L V+ GK+Y+LR+INAA
Sbjct  167   KSDTEAVINQALSSGVAPNVSDAHTINGHPGSVANCSSQGGFTLPVEKGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++T+VEVDATYVKPFKT+TIVIAPGQTTN ++TANQ SGKY+VAASPF
Sbjct  227   LNEELFFKIAGHKLTIVEVDATYVKPFKTDTIVIAPGQTTNALITANQNSGKYLVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHYSG L+   T LT+ PP+NAT VANNF+++L+SLNSK++PA+V
Sbjct  287   MDSPIAVDNLTATATLHYSGTLATTPTTLTNPPPQNATQVANNFINSLKSLNSKKFPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTVGLG+NPCP+CK  NGSRVVASVNNVTFVMPT ALLQAH FNI GVFTT
Sbjct  347   PLKIDHNLLFTVGLGINPCPTCKAGNGSRVVASVNNVTFVMPTTALLQAHVFNISGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPAN--LQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             DFPGNPP  FN++G   AN  + TT GTK+YRL YN+TVQLVLQDTG IAPENHPVHLHG
Sbjct  407   DFPGNPPNTFNFSGGPSANASMATTNGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHG  466

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             +NF+AVGRG+GN+NPK DP KFNLVDPVERNT+GVPSGGW AIRF+ADNPGVWF+HCHLE
Sbjct  467   YNFYAVGRGVGNYNPKKDPKKFNLVDPVERNTVGVPSGGWAAIRFQADNPGVWFLHCHLE  526

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAFLVDNGKGPNES
Sbjct  527   VHTTWGLKMAFLVDNGKGPNES  548



>ref|NP_565881.1| laccase-4 [Arabidopsis thaliana]
 sp|O80434.2|LAC4_ARATH RecName: Full=Laccase-4; AltName: Full=Benzenediol:oxygen oxidoreductase 
4; AltName: Full=Diphenol oxidase 4; AltName: Full=Protein 
IRREGULAR XYLEM 12; AltName: Full=Urishiol oxidase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96573.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL36080.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL38363.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAC27158.2| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAM47955.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AEC09487.1| laccase-4 [Arabidopsis thaliana]
Length=558

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/440 (78%), Positives = 389/440 (88%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GALVILPK GVPYPFPKPD+E V+VL EWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVYGALVILPKRGVPYPFPKPDNEKVIVLGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE +INEA+KSGLAPNVSD+H INGHPGPV NCPSQG YKLSV+ GK+Y+LR++NAA
Sbjct  169   KSDTENIINEALKSGLAPNVSDSHMINGHPGPVRNCPSQG-YKLSVENGKTYLLRLVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFKT+T++IAPGQTTNV++TA++ +GKY+V ASPF
Sbjct  228   LNEELFFKVAGHIFTVVEVDAVYVKPFKTDTVLIAPGQTTNVLLTASKSAGKYLVTASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATAT+HYSG LS   T+LT  PP+NAT +ANNF ++LRSLNSK+YPA V
Sbjct  288   MDAPIAVDNVTATATVHYSGTLSSSPTILTLPPPQNATSIANNFTNSLRSLNSKKYPALV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLGLN CP+CK  NGSRVVAS+NNVTF+MP  ALL AH+FN  GVFTT
Sbjct  348   PTTIDHHLFFTVGLGLNACPTCKAGNGSRVVASINNVTFIMPKTALLPAHYFNTSGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+IAPENHPVHLHGFN
Sbjct  408   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPVHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFN   DP  FNLVDPVERNTIGVPSGGWV IRFRADNPGVWFMHCHLEVH
Sbjct  468   FFEVGRGLGNFNSTKDPKNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  528   TTWGLKMAFLVENGKGPNQS  547



>emb|CDX93330.1| BnaC04g45660D [Brassica napus]
Length=560

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/440 (78%), Positives = 385/440 (88%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWW
Sbjct  110   QVYTYNYTLTGQRGTLWWHAHILWLRATVYGAIVILPKRGVPYPFPKPDHEKVIVLGEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAH ING PG   NC S  GYKLSV  GK+Y+LR++NAA
Sbjct  170   KSDTENVINEALKSGLAPNVSDAHMINGRPGLAKNCSSDQGYKLSVKNGKTYLLRLVNAA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFK +TIVIAPGQTTNV++TA++ +GKY+V ASPF
Sbjct  230   LNEELFFKVAGHLFTVVEVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPF  289

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATAT+HYSG LS   T+LT  PP+NAT VA NF ++LRSLNSK+YPA V
Sbjct  290   MDSPIAVDNVTATATVHYSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALV  349

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLGLNPCP+CK  NGSRVVAS+NNVTFVMP +ALL AH+FNI GVFT 
Sbjct  350   PTTIDHHLFFTVGLGLNPCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTP  409

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTGIIAPENHP+HLHG+N
Sbjct  410   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGIIAPENHPIHLHGYN  469

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP  FNLVDPVERNTIGVPSGGWV IRFRADNPGVWFMHCHLEVH
Sbjct  470   FFEVGRGLGNFNPKKDPNNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVH  529

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  530   TTWGLKMAFLVENGKGPNQS  549



>ref|XP_010529771.1| PREDICTED: laccase-4-like [Tarenaya hassleriana]
Length=559

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/440 (78%), Positives = 392/440 (89%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q YVYN+T+TGQRGTL+WHAH+LWLR+TVHGALVILPK G+PYPFPKPD+E V+VL+EWW
Sbjct  109   QVYVYNYTLTGQRGTLWWHAHILWLRATVHGALVILPKRGIPYPFPKPDNEKVIVLSEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAHTINGHPG + +C S  GYKLSV+ GK Y+LR+INAA
Sbjct  169   KSDTENVINEALKSGLAPNVSDAHTINGHPGLIKSCSSSQGYKLSVESGKIYLLRLINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH +TVVEVDA YVKPFKT+T++IAPGQTTNV++TA + +GK++V  SPF
Sbjct  229   LNEELFFKVAGHVLTVVEVDAVYVKPFKTDTVLIAPGQTTNVLLTAVKPAGKFLVTVSPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATAT+HYSG LS   TVLT  PP+N+T +A+ F  +LRSLNS +YPA V
Sbjct  289   MDSPIAVDNVTATATVHYSGTLSSSPTVLTLPPPQNSTAMADAFTSSLRSLNSVKYPALV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ +DH LFFTVGLG+NPCP+CKPANGSRVVAS+NNVTF MPT ALLQAH+FN+ GVFTT
Sbjct  349   PKKIDHHLFFTVGLGINPCPTCKPANGSRVVASINNVTFSMPTTALLQAHYFNVNGVFTT  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTGA PANL T  GT++Y+LPYNATV+LVLQDT +I+PENHP+HLHGFN
Sbjct  409   DFPKNPPHVFNYTGAPPANLATDKGTRLYKLPYNATVELVLQDTVVISPENHPLHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNP  DP +FNL DPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  469   FFQVGRGLGNFNPNKDPKRFNLDDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPNES
Sbjct  529   TTWGLKMAFLVENGKGPNES  548



>emb|CDY18406.1| BnaA04g21810D [Brassica napus]
Length=559

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/440 (78%), Positives = 385/440 (88%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVYGAIVILPKRGVPYPFPKPDHEKVIVLGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAH ING PG   NCPS  GYKLSV  GK+Y+LRV+NAA
Sbjct  169   KSDTENVINEALKSGLAPNVSDAHMINGRPGLAKNCPSDQGYKLSVKNGKTYLLRVVNAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFK +TIVIAPGQTTNV++TA++ +GKY+V ASPF
Sbjct  229   LNEELFFKVAGHLFTVVEVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATAT+HYSG LS   T+LT  PP+NAT VA NF ++LRSLNSK+YPA V
Sbjct  289   MDSPIAVDNVTATATVHYSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLGLNPCP+CK  NGSRVVAS+NNVTFVMP +ALL AH+FNI GVFT 
Sbjct  349   PTTIDHHLFFTVGLGLNPCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTP  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+IAPENHP+HLHG+N
Sbjct  409   DFPKIPPHVFNYSGGSLTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGYN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP  FNLVDPVERNTIGVPSGGWV IRFRADNPGVWFMHCHLEVH
Sbjct  469   FFEVGRGLGNFNPKKDPNNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  529   TTWGLKMAFLVENGKGPNQS  548



>ref|XP_009143427.1| PREDICTED: laccase-4 [Brassica rapa]
Length=561

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/443 (78%), Positives = 389/443 (88%), Gaps = 4/443 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TVHGA+VILPK GVPYPFPKPDHE V+VLAEWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPKPDHEKVIVLAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAH INGH GPV NCPSQG YKLSV  GK+Y+LR++NAA
Sbjct  169   KSDTENVINEALKSGLAPNVSDAHMINGHSGPVNNCPSQG-YKLSVTNGKTYLLRLVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKT---NTIVIAPGQTTNVIVTANQGSGKYMVAA  1029
             LNEELFFK+AGH  TVVEVDA +VKPFKT   +T++IAPGQTTNV++T ++ +GKY+V A
Sbjct  228   LNEELFFKVAGHLFTVVEVDAVFVKPFKTATTDTVLIAPGQTTNVLLTTSKSAGKYLVTA  287

Query  1028  SPFMDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
             SPFMD+PIAVDN TATAT+HYSG LS   T LT  PP+NAT +ANNF ++LRSLNSK+YP
Sbjct  288   SPFMDSPIAVDNVTATATVHYSGTLSSSPTTLTLPPPQNATTIANNFTNSLRSLNSKKYP  347

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A VP T+DH LFFTVGLGLNPCP+CK  NGSRVVAS+NNVTF MP  ALL AH+FNI GV
Sbjct  348   ALVPTTIDHHLFFTVGLGLNPCPTCKAGNGSRVVASINNVTFTMPKTALLPAHYFNISGV  407

Query  668   FTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLH  489
             FTTDFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+IAPENHP+HLH
Sbjct  408   FTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLH  467

Query  488   GFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHL  309
             GFNFF VGRG+GNFN K DP+ FNLVDPVERNTIGVPSGGWV IRFRADNPGVWFMHCHL
Sbjct  468   GFNFFEVGRGLGNFNAKKDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHL  527

Query  308   EVHTTWGLKMAFLVDNGKGPNES  240
             EVHTTWGLKMAFLV+NGKGPN+S
Sbjct  528   EVHTTWGLKMAFLVENGKGPNQS  550



>ref|XP_009370205.1| PREDICTED: laccase-4 [Pyrus x bretschneideri]
Length=559

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/442 (81%), Positives = 396/442 (90%), Gaps = 2/442 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGAL++LPK GVPYPFP P  E  VVLAEWW
Sbjct  107   QSYVYNFTITGQRGTLLWHAHILWLRATVHGALIVLPKRGVPYPFPAPHKEVPVVLAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+A+KSGLAPNVSDAHTINGHPG V NC SQGG+ L V  GK+Y+LR+INAA
Sbjct  167   KSDTEAVINQALKSGLAPNVSDAHTINGHPGLVPNCSSQGGFTLPVKNGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH +T+VEVDATYVKPFKT+TIVIAPGQTTN +VTANQ SGKYMVAASPF
Sbjct  227   LNEELFFKIAGHNLTIVEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHY+G L+   T LTS PP+NAT VAN+F+++L++LNSK++PA+V
Sbjct  287   MDSPIAVDNLTATATLHYTGTLATTPTTLTSAPPQNATQVANSFINSLKALNSKKFPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTVGLG+N CPSCK ANGSRVVASVNNVTFVMPT ALLQAHFFN  GVFTT
Sbjct  347   PLKIDHNLLFTVGLGINSCPSCKAANGSRVVASVNNVTFVMPTTALLQAHFFNKSGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPAN--LQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             DFPGNPP AFN++G  PAN  L TT+GTK+YRL YN+TVQLVLQDTG IAPENHPVHLHG
Sbjct  407   DFPGNPPTAFNFSGGLPANASLATTSGTKLYRLAYNSTVQLVLQDTGTIAPENHPVHLHG  466

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFF+VGRGIGN+N KTDP KFNLVDPVERNT  VP+GGWVAIRF ADNPGVWFMHCHLE
Sbjct  467   FNFFSVGRGIGNYNSKTDPKKFNLVDPVERNTANVPTGGWVAIRFIADNPGVWFMHCHLE  526

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAFLVDNGKGPN+S
Sbjct  527   VHTTWGLKMAFLVDNGKGPNQS  548



>gb|KHG17519.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/440 (81%), Positives = 389/440 (88%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL++HAH+LWLR+TVHGA+VILPK  VPYPFPKP  E +VVL EWW
Sbjct  56    QNYVYNFTLTGQRGTLWYHAHILWLRATVHGAIVILPKRDVPYPFPKPHKEEIVVLGEWW  115

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSGLAPNVSDAHTINGHPGPV  CPS+G Y L V PGK+YMLR+INAA
Sbjct  116   KSDVEAVINEALKSGLAPNVSDAHTINGHPGPVPGCPSKG-YMLPVTPGKTYMLRIINAA  174

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDATYVKPFKT+TIVIAPGQTTNV+VT ++G GKYMVAAS F
Sbjct  175   LNEELFFKIAGHQLTVVEVDATYVKPFKTDTIVIAPGQTTNVLVTTHRGGGKYMVAASTF  234

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG+L+   T LTSTPPKNAT VA NF+ +LRSLNSKQYPA V
Sbjct  235   MDAPIAVDNVTATATLHYSGSLTSAATTLTSTPPKNATSVATNFISSLRSLNSKQYPANV  294

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSL FTVGLG+NPCP+C   NGSRVVAS+NNVTFVMP ++LLQAHFFNI GVFT+
Sbjct  295   PLKIDHSLLFTVGLGVNPCPTC--VNGSRVVASINNVTFVMPKISLLQAHFFNISGVFTS  352

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNYT     N  T  GT++YRL YN TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  353   DFPGNPPAPFNYTSTQVTNFATKQGTRLYRLAYNDTVQLVLQDTGMITPENHPLHLHGFN  412

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  413   FFEVGRGLGNFNPKEDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEVH  472

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  473   TTWGLKMAFVVDNGKGPNES  492



>ref|XP_010104682.1| hypothetical protein L484_022065 [Morus notabilis]
 gb|EXC01488.1| hypothetical protein L484_022065 [Morus notabilis]
Length=556

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/440 (76%), Positives = 386/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q +VYNFTITGQRGTL+WHAH+LWLR+TVHGA+VILPK GVPYPFP+P  E V+VL EWW
Sbjct  108   QQFVYNFTITGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPRPHKEKVLVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSGLAPNVSDAHTING PGPV+ C SQGG+ L V   K+Y+LR++NAA
Sbjct  168   KSDVEAVINEALKSGLAPNVSDAHTINGQPGPVSGCTSQGGFTLPVGASKTYLLRIVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+TVVEVDA Y KPFKT T++IAPGQTTNV++ A++ +G+Y+VAA+PF
Sbjct  228   LNEELFFKIAGHQLTVVEVDAVYTKPFKTGTVIIAPGQTTNVLLNADRKAGRYLVAATPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATATLHYSG LS  RT+LT+ PP+NAT +A NF  +LRSLNSK+YPARV
Sbjct  288   MDAPIAVDNKTATATLHYSGTLSSSRTILTALPPQNATSIATNFTSSLRSLNSKKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSL FT+GLG+NPC +C   NGSRVVA +NNVTFVMP +ALLQAHFFNI GVFT 
Sbjct  348   PLKIDHSLLFTIGLGVNPCKTC--VNGSRVVADINNVTFVMPNIALLQAHFFNISGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPG PPV FNYTG  P+N  TT GT++YRL YN+TVQLVLQDTG+I PENHP+HLHGFN
Sbjct  406   DFPGKPPVPFNYTGTQPSNFATTQGTRLYRLAYNSTVQLVLQDTGMITPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GNF+P  DP  FNLVDPVERNTIGVPSGGW AIRF+ADNPGVWFMHCHLEVH
Sbjct  466   FFVVGKGLGNFHPNKDPKNFNLVDPVERNTIGVPSGGWTAIRFKADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNE+
Sbjct  526   TTWGLKMAFVVDNGKGPNET  545



>ref|XP_010505418.1| PREDICTED: laccase-4 [Camelina sativa]
Length=558

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/440 (78%), Positives = 387/440 (88%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVNGAIVILPKRGVPYPFPKPDHEKVIVLGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE +INEA+KSGLAPNVSDAH INGHPGPV NCPSQG YKLSV+ GK+Y+LR+INAA
Sbjct  169   KSDTEDIINEALKSGLAPNVSDAHMINGHPGPVKNCPSQG-YKLSVENGKTYLLRLINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFK +T++IAPGQTTNV++TA++ +GKY+V ASPF
Sbjct  228   LNEELFFKVAGHLFTVVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATAT+HYSG LS   TV T  PP+NAT +ANNF ++LRSLNSK+YPA V
Sbjct  288   MDAPIAVDNVTATATVHYSGTLSSSPTVRTLPPPQNATSIANNFTNSLRSLNSKKYPALV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH L FTVGLGLN CP+CK  NGSRVVAS+NNVTFVMP  ALL AH+FN  GVFTT
Sbjct  348   PTTIDHHLLFTVGLGLNACPTCKAGNGSRVVASINNVTFVMPKTALLSAHYFNKSGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+I+PENHP+HLHGFN
Sbjct  408   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF +GRG+GNFN   DP  FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  468   FFQIGRGLGNFNSTKDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  528   TTWGLKMAFLVENGKGPNQS  547



>ref|XP_010517091.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/440 (78%), Positives = 386/440 (88%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVNGAIVILPKRGVPYPFPKPDHEKVIVLGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE +INEA+KSGLAPNVSDAH INGHPGPV NCPSQG YKL V+ GK+Y+LR+INAA
Sbjct  169   KSDTEDIINEALKSGLAPNVSDAHMINGHPGPVKNCPSQG-YKLPVENGKTYLLRLINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFK +T++IAPGQTTNV++TA++ +GKY+V ASPF
Sbjct  228   LNEELFFKVAGHLFTVVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATAT+HYSG LS   TV T  PP+NAT +ANNF ++LRSLNSK+YPA V
Sbjct  288   MDAPIAVDNVTATATVHYSGTLSSSPTVRTLPPPQNATSIANNFTNSLRSLNSKKYPALV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH L FTVGLGLNPCP+CK  NGSRVVAS+NNVTFVMP  ALL AH+F   GVFTT
Sbjct  348   PTTIDHHLLFTVGLGLNPCPTCKAGNGSRVVASINNVTFVMPKTALLSAHYFKKSGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+I+PENHP+HLHGFN
Sbjct  408   DFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFN   DP  FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  468   FFQVGRGLGNFNSTKDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  528   TTWGLKMAFLVENGKGPNQS  547



>ref|XP_009141718.1| PREDICTED: laccase-4-like [Brassica rapa]
Length=559

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/440 (78%), Positives = 384/440 (87%), Gaps = 0/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GA+VILPK GVPYPFPKPDHE V+VL EWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVYGAIVILPKRGVPYPFPKPDHEKVIVLGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAH ING PG   NCPS  GYKLSV  GK+Y+LRV+NAA
Sbjct  169   KSDTENVINEALKSGLAPNVSDAHMINGRPGLAKNCPSDQGYKLSVKNGKTYLLRVVNAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFK +TIVIAPGQTTNV++TA++ +GKY+V ASPF
Sbjct  229   LNEELFFKVAGHLFTVVEVDAVYVKPFKIDTIVIAPGQTTNVLLTASKSTGKYLVTASPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATAT+HYSG LS   T+LT  PP+NAT VA NF ++LRSLNSK+YPA V
Sbjct  289   MDSPIAVDNVTATATVHYSGTLSSSPTILTLPPPQNATSVATNFTNSLRSLNSKKYPALV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH LFFTVGLGLNPCP+CK  NGSRVVAS+NNVTFVMP +ALL AH+FNI GVFT 
Sbjct  349   PTTIDHHLFFTVGLGLNPCPTCKAGNGSRVVASINNVTFVMPKIALLPAHYFNISGVFTP  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+IAPENHP+HLHG+N
Sbjct  409   DFPKIPPHVFNYSGGSLTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENHPIHLHGYN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP  F LVDPVERNTIGVPSGGWV IRFRADNPGVWFMHCHLEVH
Sbjct  469   FFEVGRGLGNFNPKKDPNNFYLVDPVERNTIGVPSGGWVVIRFRADNPGVWFMHCHLEVH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  529   TTWGLKMAFLVENGKGPNQS  548



>ref|XP_008388134.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/442 (79%), Positives = 389/442 (88%), Gaps = 2/442 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+LWLR+TVHGALVILPK GVPYPFP P  E  VVL EWW
Sbjct  107   QSYVYNFTITGQRGTLLWHAHILWLRATVHGALVILPKRGVPYPFPAPHKEVNVVLGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VIN+A+KSG+APNVSDAHTINGHPG V NC SQGG+ L V+ GK+Y+LR+INAA
Sbjct  167   KSDTETVINQALKSGIAPNVSDAHTINGHPGVVPNCSSQGGFTLPVESGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH +T+VEVDATYVKPFKT+TIVIAPGQTTN +VTANQ SGKYMVAASPF
Sbjct  227   LNEELFFKIAGHNLTIVEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMVAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHY+G L+   T LTS PP+NAT VAN+F+++L++LNS  +PA+V
Sbjct  287   MDSPIAVDNLTATATLHYTGTLASTPTTLTSPPPQNATQVANSFINSLKALNSNNFPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTVGLG+NPCPSCK  NGSRVV SVNNV+FVMPT ALLQAH FN  GVFTT
Sbjct  347   PLKIDHNLLFTVGLGINPCPSCKAGNGSRVVGSVNNVSFVMPTTALLQAHVFNKSGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPAN--LQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             DFPGNPP AFNY+G  PAN  L TT GTK+YRL YN+TVQLVLQDTG IAPENHP+HLHG
Sbjct  407   DFPGNPPTAFNYSGGPPANASLATTNGTKLYRLAYNSTVQLVLQDTGTIAPENHPIHLHG  466

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFF VGRG+GN+NPKTDP KFNLVDPVERNT  +PSGGW AIRF ADNPGVWFMHCHLE
Sbjct  467   FNFFCVGRGVGNYNPKTDPKKFNLVDPVERNTANIPSGGWTAIRFVADNPGVWFMHCHLE  526

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAFLVDNGKGPN+S
Sbjct  527   VHTTWGLKMAFLVDNGKGPNQS  548



>ref|XP_009358852.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=559

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/442 (79%), Positives = 393/442 (89%), Gaps = 2/442 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL WHAH+ WLR+TVHGALVILPK GVPYPFP P  E  VVL EWW
Sbjct  107   QSYVYNFTITGQRGTLLWHAHINWLRATVHGALVILPKRGVPYPFPAPHKEVNVVLGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VIN+A+KSG+APNVSDAHTINGHPG V NC S+GG+ L V+ GK+Y+LR+INAA
Sbjct  167   KSDTETVINQALKSGIAPNVSDAHTINGHPGVVPNCSSEGGFTLPVESGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH +T+VEVDATYVKPFKT+TIVIAPGQTTN +VTANQ SGKYM+AASPF
Sbjct  227   LNEELFFKIAGHNLTIVEVDATYVKPFKTDTIVIAPGQTTNALVTANQNSGKYMMAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATATLHY+G L+   T LTS PP+NAT VAN+F+++L++LNS ++PA+V
Sbjct  287   MDSPIAVDNLTATATLHYTGTLASTPTTLTSPPPQNATQVANSFINSLKALNSNKFPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTVGLG+NPCPSCK  NGSRVVASVNNVTFVMPT ALLQAHFFN  GVFTT
Sbjct  347   PLKIDHNLLFTVGLGINPCPSCKAGNGSRVVASVNNVTFVMPTTALLQAHFFNKSGVFTT  406

Query  659   DFPGNPPVAFNYTGAGPAN--LQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             DFPGNPP+AFNY+G  PAN  L TT GT++YRL YN+TVQLVLQDTG IAPENHP+HLHG
Sbjct  407   DFPGNPPMAFNYSGGPPANSSLATTNGTRLYRLAYNSTVQLVLQDTGTIAPENHPIHLHG  466

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             +NFF+VGRG+GN+NPKTDP KFNLVDPVERNT  VPSGGW AIRF ADNPGVWFMHCHLE
Sbjct  467   YNFFSVGRGVGNYNPKTDPKKFNLVDPVERNTANVPSGGWTAIRFIADNPGVWFMHCHLE  526

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAFLVDNGKGPN+S
Sbjct  527   VHTTWGLKMAFLVDNGKGPNQS  548



>ref|XP_010509229.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/440 (78%), Positives = 386/440 (88%), Gaps = 1/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YN+T+TGQRGTL+WHAH+LWLR+TV+GA+VILPK GVPYPFPK DHE V+VL EWW
Sbjct  109   QVYTYNYTLTGQRGTLWWHAHILWLRATVNGAIVILPKRGVPYPFPKADHEKVIVLGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE +INEA+KSGLAPNVSDAH INGHPGPV NCPSQG YKLSV+ GK+Y+LR+INAA
Sbjct  169   KSDTEDIINEALKSGLAPNVSDAHMINGHPGPVKNCPSQG-YKLSVENGKTYLLRLINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH  TVVEVDA YVKPFK +T++IAPGQTTNV++TA++ +GKY+V ASPF
Sbjct  228   LNEELFFKVAGHLFTVVEVDAVYVKPFKIDTVLIAPGQTTNVLLTASKSAGKYLVTASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATAT+HYSG LS   TV T  PP+NAT +ANNF ++LRSLNSK+YPA V
Sbjct  288   MDAPIAVDNVTATATVHYSGTLSSSPTVRTLPPPQNATSIANNFTNSLRSLNSKKYPALV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DH L FTVGLGLN CP+CK  NGSRVVAS+NNVTFVMP  ALL AH+FN  GVFTT
Sbjct  348   PTTIDHHLLFTVGLGLNACPTCKAGNGSRVVASINNVTFVMPKTALLSAHYFNKSGVFTT  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G    N+ T TGT++Y+LPYNATVQLVLQDTG+I+PENHP+HLHGFN
Sbjct  408   DFPKNPPHVFNYSGGSVKNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPLHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFN   DP  FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH
Sbjct  468   FFQVGRGLGNFNSTKDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  528   TTWGLKMAFLVENGKGPNQS  547



>ref|XP_002280416.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI16002.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/440 (78%), Positives = 385/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFTITGQRGTL WHAH+LWLR+TVHGALVILPKLGVPYPFP P  EAVV+L EWW
Sbjct  106   QSYIYNFTITGQRGTLLWHAHILWLRATVHGALVILPKLGVPYPFPTPYKEAVVILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSGLAPNVSDAHTINGHPGP ++C  QGG+ L VDPGK+YMLR+INAA
Sbjct  166   KSDVEAVINEAMKSGLAPNVSDAHTINGHPGPFSSCSLQGGFTLPVDPGKTYMLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELF KIAGH +TVVEVDATY KPF T+T++IAPGQTTNV++TA  G+GKY+V AS F
Sbjct  226   LNEELFLKIAGHHLTVVEVDATYTKPFSTDTVLIAPGQTTNVLLTAGLGAGKYLVTASSF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PIAVDN TATAT+ YSG LS   T +T+ PP+NAT VA  F D+LRSLNSK+YPARV
Sbjct  286   MDSPIAVDNMTATATVQYSGTLSSTPTTITNPPPQNATSVATKFTDSLRSLNSKKYPARV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P   DHSL FTVGLG+NPC +C   NG +VVA++NNVTFVMPT ALLQAH+F +KGV+T 
Sbjct  346   PLATDHSLLFTVGLGINPCATC--VNGGKVVANINNVTFVMPTTALLQAHYFKMKGVYTD  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP+AFNYTG  P N QT  GT++YRL YN+TVQLVLQDTG+IAPE HPVHLHGFN
Sbjct  404   DFPGNPPIAFNYTGTQPTNFQTMNGTRLYRLAYNSTVQLVLQDTGMIAPERHPVHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF +GRG+GN+NPK DP KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  464   FFVIGRGLGNYNPKKDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  524   TTWGLKMAFVVDNGKGPNES  543



>ref|XP_008355354.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008355361.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008363414.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/441 (78%), Positives = 383/441 (87%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q YVYNFTITGQRGTL+WHAH+LWLR+TVHGALVILPK GVPYPFP P  E VV+L EWW
Sbjct  109   QQYVYNFTITGQRGTLWWHAHILWLRATVHGALVILPKHGVPYPFPAPRKELVVILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPN+SDAHTINGHPGP++ C SQGG KL V PGK+YMLR+INAA
Sbjct  169   KSDTEAVINEALKSGLAPNISDAHTINGHPGPLSTCQSQGGLKLPVRPGKTYMLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H++TVVEVDA Y KPFKT+TI+IAPGQTTNV+VT N GSGKY+VAASPF
Sbjct  229   LNEELFFKIANHKLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVTTNLGSGKYLVAASPF  288

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P I VDN+TATATLHY G L   +T+LT+ PP+NAT VA NF ++LRSLNS ++PAR
Sbjct  289   MDNPTIVVDNKTATATLHYIGTLQSTKTILTAPPPQNATTVATNFTNSLRSLNSIRFPAR  348

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSL FTVGLGL+ C SC   NG+RVVA +NNVTFVMP +ALLQAHFFNI GVFT
Sbjct  349   VPLKIDHSLLFTVGLGLHTCASC--TNGNRVVADINNVTFVMPEIALLQAHFFNISGVFT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   +NYTG  P NLQT  GT++YRL YN+TVQLVLQDTG+IAPE HPVHLHGF
Sbjct  407   DDFPGNPLNPYNYTGTQPTNLQTRKGTRLYRLAYNSTVQLVLQDTGMIAPETHPVHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GNFNP  DP KFNLVDPVERNTIGVPS GW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFFEVGRGLGNFNPMKDPKKFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  527   HTTWGLKMAFVVDNGKGPNES  547



>ref|XP_007146741.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
 gb|ESW18735.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
Length=556

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/440 (77%), Positives = 388/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL+WHAH+LWLR+T+HGALVILPKLGVPYPFPKP+ E V++L+EWW
Sbjct  108   QAYVYNFTLTGQRGTLWWHAHILWLRATLHGALVILPKLGVPYPFPKPNMEQVIILSEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTINGHPGPV  C SQ G+KL V PG +Y+LR+INAA
Sbjct  168   KSDTEAVINEALKSGLAPNVSDAHTINGHPGPVQGCASQEGFKLDVQPGNTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA Y KPFKT+TIVI PGQTTNV++TA   +GKY+VAASPF
Sbjct  228   LNEELFFKIAGHELTVVEVDAVYTKPFKTDTIVITPGQTTNVLLTAKHAAGKYLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATATLHYSG LS   T LTS PPKN+T +A +F D+LRSLNSK+YPARV
Sbjct  288   MDAPIAVDNKTATATLHYSGTLSSSLTTLTSLPPKNSTILATSFTDSLRSLNSKKYPARV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +D +L FTV LG+NPC +C   N SRVVA +NNVTFVMP ++LLQAHFF IKGVFT 
Sbjct  348   PLKIDRNLLFTVSLGINPCATC--VNNSRVVADINNVTFVMPKISLLQAHFFKIKGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPPV +N+TG  P+NL T  GT++YRL YN+TVQLVLQDTG++ PENHP+HLHGFN
Sbjct  406   DFPGNPPVFYNFTGTQPSNLNTVNGTRLYRLAYNSTVQLVLQDTGMLTPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG GNFNP  DP KFNLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+H
Sbjct  466   FFVVGRGQGNFNPTKDPKKFNLVDPVERNTVGVPAGGWTAIRFRADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>ref|XP_004490574.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=570

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/440 (76%), Positives = 387/440 (88%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q YVYNFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFP+P  E VV+L+EWW
Sbjct  122   QVYVYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPRPHMEQVVILSEWW  181

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAHTINGHPGP  +C SQ G+KL V+ GK+Y+LR+INAA
Sbjct  182   KSDTEVVINEALKSGLAPNVSDAHTINGHPGPTQHCASQEGFKLQVEAGKTYLLRIINAA  241

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNE+LFFKIAGH++ VVEVDA+Y KPFKT+TI+IAPGQTTNV+V AN  +GKYMVAAS F
Sbjct  242   LNEDLFFKIAGHKLIVVEVDASYTKPFKTDTILIAPGQTTNVLVKANHLAGKYMVAASTF  301

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIA+DN TATATLHY+G+L    T LTS PP+NAT +ANNF ++L+SLNS +YPARV
Sbjct  302   MDAPIAIDNVTATATLHYTGSLGSTITTLTSLPPRNATFLANNFTNSLKSLNSPKYPARV  361

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ VDHSL FT+ LG+NPC +C   NG RVVA++NNVTFVMP ++LLQAHFFNI GVFT 
Sbjct  362   PKKVDHSLLFTISLGVNPCATC--VNGGRVVAAINNVTFVMPKISLLQAHFFNISGVFTD  419

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  +++TG  P+NL+T  GT+VYRL YN+TVQLVLQDTG+IAPENHP+HLHGFN
Sbjct  420   DFPEKPPRVYDFTGKQPSNLRTNKGTRVYRLAYNSTVQLVLQDTGMIAPENHPIHLHGFN  479

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G GNFN K DP KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  480   FFVVGKGKGNFNSKKDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEVH  539

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  540   TTWGLKMAFVVDNGKGPNES  559



>ref|XP_008220423.1| PREDICTED: laccase-4 [Prunus mume]
Length=558

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/441 (77%), Positives = 386/441 (88%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL+WHAH+LWLR+TVHGALVILPKLGVPYPFP P  E VV+L EWW
Sbjct  109   QNYVYNFTVTGQRGTLWWHAHILWLRATVHGALVILPKLGVPYPFPAPQKEVVVILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E+VIN+A+KSG APNVSDAHTINGHPGP++ C SQGG+KL V PGK+YMLR+INAA
Sbjct  169   KSDVESVINQALKSGSAPNVSDAHTINGHPGPLSTCSSQGGFKLPVRPGKTYMLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H++TVVEVDA Y KPFKT+T++IAPGQTTNV+++ N G+GKY+VAASPF
Sbjct  229   LNEELFFKIANHKLTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLSTNHGTGKYLVAASPF  288

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P I VDN+TATATLHY G L   RT LT+ PP+NAT VA  F ++LRSLNS ++PAR
Sbjct  289   MDNPTILVDNKTATATLHYMGTLESTRTTLTAPPPQNATLVATKFTNSLRSLNSVKFPAR  348

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSL FTVGLGL+ C SC  ANG+R+VA +NNVTFVMP ++LLQAHFFNI GVFT
Sbjct  349   VPLKIDHSLLFTVGLGLHTCASC--ANGNRLVADINNVTFVMPKISLLQAHFFNISGVFT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   +NYTG  P N+QT  GT++YRL YN+TVQLVLQDTG+IAPENHPVHLHGF
Sbjct  407   DDFPGNPLNPYNYTGPQPTNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENHPVHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GNFNPK DP +FNL+DPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFFEVGRGLGNFNPKKDPKRFNLIDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  527   HTTWGLKMAFVVDNGKGPNES  547



>gb|KEH34185.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=556

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/440 (76%), Positives = 381/440 (87%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPKLGVPYPFPKP  E V++L EWW
Sbjct  108   QTYLYNFTLTGQRGTLWWHAHVLWLRATVHGAIVILPKLGVPYPFPKPHMEQVILLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEA+INEA+KSGLAPN SDAHTINGHPGPV  C SQGG+ L V P  +Y+LR+INAA
Sbjct  168   KSDTEAIINEALKSGLAPNTSDAHTINGHPGPVQGCASQGGFSLEVQPKNTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA HQ+TVVEVDATYVKPFKT+TIVIAPGQTTNV+VTA    G ++VAASPF
Sbjct  228   LNEELFFKIANHQLTVVEVDATYVKPFKTDTIVIAPGQTTNVLVTAKHKIGNFLVAASPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI VDN+TATATLHYSG L    T LTS PP NAT VAN F D+LRSLNSK++PA+V
Sbjct  288   MDAPIVVDNKTATATLHYSGTLGSSLTTLTSLPPTNATSVANTFTDSLRSLNSKKFPAKV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+L FTV LG+NPC +C   N SRVVA +NNVTFVMP +ALLQAHFF IKGVFT 
Sbjct  348   PLKIDHNLLFTVSLGVNPCATC--VNNSRVVADINNVTFVMPKIALLQAHFFKIKGVFTD  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPPV +N+TG+   NL TT GT++YRL YN+TVQLVLQDTG++ PENHP+HLHGFN
Sbjct  406   DFPGNPPVVYNFTGSQVTNLATTKGTRLYRLAYNSTVQLVLQDTGMLTPENHPIHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG GNF+ K D  KFNLVDPVERNT+GVP+GGW AIRF+ADNPGVWFMHCHLE+H
Sbjct  466   FFVVGRGQGNFDSKKDVKKFNLVDPVERNTVGVPAGGWTAIRFKADNPGVWFMHCHLEIH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNGKGPNES
Sbjct  526   TTWGLKMAFVVDNGKGPNES  545



>ref|XP_007207096.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
 gb|EMJ08295.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
Length=558

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/441 (77%), Positives = 386/441 (88%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFTITGQRGTL+WHAH+LWLR+T+HGALVILPKLGVPYPFP P  E VV+L EWW
Sbjct  109   QNYVYNFTITGQRGTLWWHAHILWLRATLHGALVILPKLGVPYPFPAPQKEVVVILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E+VIN+A+KSG APNVSDAHTINGH GP++ C SQGG+KL V PGK+YMLR+INAA
Sbjct  169   KSDVESVINQALKSGSAPNVSDAHTINGHSGPLSTCSSQGGFKLPVRPGKTYMLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H++TVVEVDA Y KPFKT+T++IAPGQTTNV+++ N G+GKY+VAASPF
Sbjct  229   LNEELFFKIANHKLTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLSTNHGTGKYLVAASPF  288

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P I VDN+TATATLHY+G     RT LT+ PP+NAT VA  F ++LRSLNS ++PAR
Sbjct  289   MDNPTILVDNKTATATLHYTGTPESTRTTLTAPPPQNATLVATKFTNSLRSLNSVKFPAR  348

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSL FTVGLGL+ C SC  ANG+RVVA +NNVTFVMP ++LLQAHFFNI GVFT
Sbjct  349   VPLKIDHSLLFTVGLGLHTCASC--ANGNRVVADINNVTFVMPKISLLQAHFFNISGVFT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   +NYTG  P N+QT  GT++YRL YN+TVQLVLQDTG+IAPENHPVHLHGF
Sbjct  407   DDFPGNPLNPYNYTGPQPTNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENHPVHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GNFNPKTDP +FNL+DPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFFEVGRGLGNFNPKTDPKRFNLIDPVERNTIGVPSGGWTAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  527   HTTWGLKMAFVVDNGKGPNES  547



>ref|XP_009374280.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/441 (78%), Positives = 382/441 (87%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q YVYNFTITGQRGTL+WHAH+LWLR+TVHGALVILPKLGVPYPFP P  E VV+L EWW
Sbjct  109   QQYVYNFTITGQRGTLWWHAHILWLRATVHGALVILPKLGVPYPFPAPQKELVVILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA++SGLAPNVSDAHTINGHPGP++ C  QGG KL V PGK+YMLR+INAA
Sbjct  169   KSDTEAVINEALRSGLAPNVSDAHTINGHPGPLSTCQPQGGLKLPVRPGKTYMLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H++TVVEVDA Y KPFKT+TI+IAPGQTTNV+VT N GSGK++VAASPF
Sbjct  229   LNEELFFKIANHKLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVTTNLGSGKFLVAASPF  288

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P I VDN+TATATLHY G L   +T+LT+ PP+NAT VA NF ++L+SLNS ++PAR
Sbjct  289   MDNPTIVVDNKTATATLHYIGTLQSTKTILTAPPPQNATIVATNFTNSLKSLNSIRFPAR  348

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  VDHSL FTV LGL+ C SC   NG+RVVA +NNVTFVMP +ALLQAHFFNI GVFT
Sbjct  349   VPLKVDHSLLFTVSLGLHTCASC--TNGNRVVADINNVTFVMPKIALLQAHFFNISGVFT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   +NYTG  P NLQT  GT++YRL YN+TVQLVLQ TG+IAPE HPVHLHGF
Sbjct  407   DDFPGNPLNPYNYTGTQPTNLQTRKGTRLYRLAYNSTVQLVLQGTGMIAPETHPVHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GNFNPK DP KFNLVDPVERNTIGVPS GW AIRF+ADNPG+WFMHCHLEV
Sbjct  467   NFFEVGRGLGNFNPKKDPKKFNLVDPVERNTIGVPSNGWTAIRFKADNPGIWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  527   HTTWGLKMAFVVDNGKGPNES  547



>ref|XP_010907627.1| PREDICTED: laccase-22-like [Elaeis guineensis]
Length=554

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/439 (76%), Positives = 387/439 (88%), Gaps = 2/439 (0%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY YNF ITGQRGTLFWHAH+LWLR TVHGA+VILPKL VPYPFP P  E V++L EWWK
Sbjct  107   SYAYNFIITGQRGTLFWHAHILWLRVTVHGAIVILPKLNVPYPFPAPYKEEVIILGEWWK  166

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +DTEAVIN+A+K+GLAPNVSDAH INGHPGP+++CP+  G++L V  G++YMLR+INAAL
Sbjct  167   ADTEAVINQALKTGLAPNVSDAHIINGHPGPMSDCPTSKGFQLEVKSGETYMLRIINAAL  226

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             NEELFFK+AGHQMTVVEVDA+Y KP+KT+TI+I PGQTTNV++TA++ +G+Y+V AS FM
Sbjct  227   NEELFFKVAGHQMTVVEVDASYTKPYKTDTILITPGQTTNVLLTADREAGRYLVTASTFM  286

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             D+PIAVDNQTA AT+HY+  LS      T  PP+NATPVA+NF+D+LRSLNS+QYPARVP
Sbjct  287   DSPIAVDNQTAMATVHYTNTLSTSILTTTDPPPQNATPVASNFIDSLRSLNSEQYPARVP  346

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
              TVDHSL FTVGLG+NPCP+C   NGSRVVA +NNV+F MPT A+LQAH+FNI GVFT D
Sbjct  347   LTVDHSLLFTVGLGVNPCPTC--VNGSRVVADMNNVSFTMPTTAILQAHYFNISGVFTDD  404

Query  656   FPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFNF  477
             FPG PP+ FNYTG+GP NL T TGT+VYRLP+N++VQ+VLQDTGIIAPENHP+HLHGFNF
Sbjct  405   FPGKPPIDFNYTGSGPKNLGTMTGTRVYRLPFNSSVQVVLQDTGIIAPENHPLHLHGFNF  464

Query  476   FAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHT  297
             FAVGRG+GN+NP T P KFNLVDPVERNTIGVPSGGW AIRF ADNPGVWFMHCHLEVHT
Sbjct  465   FAVGRGLGNYNPNTSPYKFNLVDPVERNTIGVPSGGWTAIRFSADNPGVWFMHCHLEVHT  524

Query  296   TWGLKMAFLVDNGKGPNES  240
             TWGLKMAF+VDNG GP+ES
Sbjct  525   TWGLKMAFVVDNGIGPDES  543



>ref|XP_009337309.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/441 (77%), Positives = 379/441 (86%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q YVYNFTITGQRGTL+WHAH+LWLR+T+HGALV+LPKLGVPYPFP P  E VV+L EWW
Sbjct  109   QQYVYNFTITGQRGTLWWHAHILWLRATIHGALVVLPKLGVPYPFPAPQKEVVVILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VI +A+KSGLAPNVSDAHTINGH GP++ C SQGG KL V PGK+YMLR+INAA
Sbjct  169   KSDTERVIRQALKSGLAPNVSDAHTINGHTGPISTCQSQGGIKLPVRPGKTYMLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H++TVVEVDA Y KPFKT+TI+IAPGQTTNV+V+ N GSGKY+VAASPF
Sbjct  229   LNEELFFKIANHKLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVSTNHGSGKYLVAASPF  288

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P I VDN+TATATLHY G L    T+LT  PP+NAT VA NF ++LRSLNS Q+PAR
Sbjct  289   MDNPTIVVDNKTATATLHYIGTLESTTTILTFPPPQNATLVATNFTNSLRSLNSIQFPAR  348

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSL FTVGLGL+ C SC  ANG+RVVA +NNVTFVMP + LLQAHFFNI GVFT
Sbjct  349   VPLKIDHSLLFTVGLGLHTCASC--ANGNRVVADINNVTFVMPKIGLLQAHFFNISGVFT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   +NYTG  P N+QT  GT++YRL YN TVQLVLQ TG++APE HPVHLHGF
Sbjct  407   DDFPGNPLNPYNYTGTQPTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETHPVHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NF+ VGRG+GNFNPKTDP +FNLVDPVERNTIGVPS GW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFYEVGRGLGNFNPKTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  527   HTTWGLKMAFVVDNGKGPNES  547



>gb|AES98533.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=558

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/441 (75%), Positives = 383/441 (87%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y+YNFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFP+P  E V++L+EWW
Sbjct  109   QVYMYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPRPHMEQVIILSEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEA+INEA+KSGLAPNVSDAHTINGHPGPV +C SQ G+K  V+PGK+Y+LR+INAA
Sbjct  169   KSDTEAIINEALKSGLAPNVSDAHTINGHPGPVQHCASQEGFKFQVEPGKTYLLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNE+LFFKIAGH+ TVVEVDA Y KPFKT+TIVI PGQTTNV++  N  SGKYMVAAS F
Sbjct  229   LNEDLFFKIAGHKFTVVEVDAAYTKPFKTDTIVITPGQTTNVLLKTNHASGKYMVAASTF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIA+DN TATATLHY   L    T LTS PP N+T +AN+F D+L+SLNS +YPARV
Sbjct  289   MDAPIAIDNVTATATLHYPNTLGSTITTLTSLPPINSTKIANSFTDSLKSLNSHKYPARV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ +DHSLFFTV LG+NPC +C   NGSRVVA++NNVTFVMP ++LLQAHFFNI G+FT 
Sbjct  349   PKKIDHSLFFTVSLGVNPCATC--PNGSRVVAAINNVTFVMPKISLLQAHFFNISGIFTD  406

Query  659   DFPGNPPVAFNYTG-AGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  P + +++TG   P+N +T  GT+VYRL YN+TVQL+LQDTG+IAPENHP+HLHGF
Sbjct  407   DFPRKPEIVYDFTGNKQPSNFRTNKGTRVYRLAYNSTVQLILQDTGMIAPENHPIHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G GNFNPK D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLE+
Sbjct  467   NFFVVGKGQGNFNPKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEI  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  527   HTTWGLKMAFVVDNGKGPNES  547



>ref|XP_009346884.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/441 (77%), Positives = 378/441 (86%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q YVYNFTITGQRGTL+WHAH+LWLR+T+HGALV+LPKLGVPYPFP P  E VV+L EWW
Sbjct  109   QQYVYNFTITGQRGTLWWHAHILWLRATIHGALVVLPKLGVPYPFPAPQKEVVVILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VI +A+K GLAPNVSDAHTINGH GP++ C SQGG KL V PGK+YMLR+INAA
Sbjct  169   KSDTERVIRQALKFGLAPNVSDAHTINGHTGPISTCQSQGGIKLPVRPGKTYMLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H++TVVEVDA Y KPFKT+TI+IAPGQTTNV+V+ N GSGKY+VAASPF
Sbjct  229   LNEELFFKIANHKLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVSTNHGSGKYLVAASPF  288

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P I VDN+TATATLHY G L    T+LT  PP+NAT VA NF ++LRSLNS Q+PAR
Sbjct  289   MDNPTIVVDNKTATATLHYIGTLESTTTILTFPPPQNATLVATNFTNSLRSLNSIQFPAR  348

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSL FTVGLGL+ C SC  ANG+RVVA +NNVTFVMP + LLQAHFFNI GVFT
Sbjct  349   VPLKIDHSLLFTVGLGLHTCASC--ANGNRVVADINNVTFVMPKIGLLQAHFFNISGVFT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   +NYTG  P N+QT  GT++YRL YN TVQLVLQ TG++APE HPVHLHGF
Sbjct  407   DDFPGNPLNPYNYTGTQPTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETHPVHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GNFNPKTDP +FNLVDPVERNTIGVPS GW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFFEVGRGLGNFNPKTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  527   HTTWGLKMAFVVDNGKGPNES  547



>ref|XP_003615575.1| Laccase 1a [Medicago truncatula]
Length=593

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/441 (75%), Positives = 383/441 (87%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y+YNFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFP+P  E V++L+EWW
Sbjct  144   QVYMYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPRPHMEQVIILSEWW  203

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEA+INEA+KSGLAPNVSDAHTINGHPGPV +C SQ G+K  V+PGK+Y+LR+INAA
Sbjct  204   KSDTEAIINEALKSGLAPNVSDAHTINGHPGPVQHCASQEGFKFQVEPGKTYLLRIINAA  263

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNE+LFFKIAGH+ TVVEVDA Y KPFKT+TIVI PGQTTNV++  N  SGKYMVAAS F
Sbjct  264   LNEDLFFKIAGHKFTVVEVDAAYTKPFKTDTIVITPGQTTNVLLKTNHASGKYMVAASTF  323

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIA+DN TATATLHY   L    T LTS PP N+T +AN+F D+L+SLNS +YPARV
Sbjct  324   MDAPIAIDNVTATATLHYPNTLGSTITTLTSLPPINSTKIANSFTDSLKSLNSHKYPARV  383

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ +DHSLFFTV LG+NPC +C   NGSRVVA++NNVTFVMP ++LLQAHFFNI G+FT 
Sbjct  384   PKKIDHSLFFTVSLGVNPCATC--PNGSRVVAAINNVTFVMPKISLLQAHFFNISGIFTD  441

Query  659   DFPGNPPVAFNYTG-AGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  P + +++TG   P+N +T  GT+VYRL YN+TVQL+LQDTG+IAPENHP+HLHGF
Sbjct  442   DFPRKPEIVYDFTGNKQPSNFRTNKGTRVYRLAYNSTVQLILQDTGMIAPENHPIHLHGF  501

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G GNFNPK D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLE+
Sbjct  502   NFFVVGKGQGNFNPKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEI  561

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  562   HTTWGLKMAFVVDNGKGPNES  582



>gb|KHN04832.1| Laccase-4 [Glycine soja]
Length=524

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/440 (78%), Positives = 376/440 (85%), Gaps = 25/440 (6%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL +HAHV WLRST++GALVILPK GVPYPFPKPD E VVVL EWW
Sbjct  99    QTYVYNFTLTGQRGTLLYHAHVNWLRSTLYGALVILPKRGVPYPFPKPDDELVVVLGEWW  158

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTING PG VTNC +Q  Y L V+ GK+Y+LR++NAA
Sbjct  159   KSDTEAVINEALKSGLAPNVSDAHTINGLPGTVTNCSTQDVYNLPVESGKTYLLRIVNAA  218

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFK  TIVIAPGQTTNV++ ANQ SGKY+VAASPF
Sbjct  219   LNEELFFKIAGHKLTVVEVDATYVKPFKIETIVIAPGQTTNVLLNANQKSGKYLVAASPF  278

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+AV                         PPKNAT +ANNF+ +LR LNSK+YP  V
Sbjct  279   MDAPVAV-------------------------PPKNATQIANNFISSLRGLNSKKYPVNV  313

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL FTVGLG+NPCPSCK ANGSRVVA++NNVTF+MPT+ALLQAH+FNIKGVFTT
Sbjct  314   PLTVDHSLIFTVGLGINPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTT  373

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNY+G GPANL T TGTKVYRLP+NATVQ+VLQDTGIIAPENHPVHLHGFN
Sbjct  374   DFPANPPHVFNYSGPGPANLNTETGTKVYRLPFNATVQVVLQDTGIIAPENHPVHLHGFN  433

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNFNPK DP  FNLVDPVERNTIGVP+GGW A RFRADNPGVWFMHCHLEVH
Sbjct  434   FFVVGRGVGNFNPKIDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWFMHCHLEVH  493

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNGKGP +S
Sbjct  494   TTWGLKMAFLVDNGKGPKQS  513



>gb|AAC49538.1| diphenol oxidase, partial [Nicotiana tabacum]
Length=409

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/398 (87%), Positives = 370/398 (93%), Gaps = 0/398 (0%)
 Frame = -2

Query  1433  YPFPKPDHEAVVVLAEWWKSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGY  1254
             +PFPKP+HEAVVVLAEWWKSDTEAVINEA+KSGLAPNVSDAHTINGHPGPV+NCP+QGGY
Sbjct  1     HPFPKPNHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVSNCPTQGGY  60

Query  1253  KLSVDPGKSYMLRVINAALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNV  1074
              LSV+PGK+YMLRVINAALNEELFFKIAGH+MTVVEVDATYVKPFKT+TIVIAPGQTTNV
Sbjct  61    SLSVEPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAPGQTTNV  120

Query  1073  IVTANQGSGKYMVAASPFMDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVAN  894
             IVTA+Q  GKYMVAASPFMDAPIAVDN TATATLHYSGAL    T LTSTPP+NAT VAN
Sbjct  121   IVTADQSFGKYMVAASPFMDAPIAVDNITATATLHYSGALGTSPTTLTSTPPQNATSVAN  180

Query  893   NFVDALRSLNSKQYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMP  714
             NF+DAL+SLNSK+YPA+VPQTVDHSLFFT GLG+NPCP+CK ANGSRVVASVNNVTFVMP
Sbjct  181   NFLDALKSLNSKKYPAKVPQTVDHSLFFTAGLGINPCPTCKQANGSRVVASVNNVTFVMP  240

Query  713   TVALLQAHFFNIKGVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQ  534
             TVALLQAHFF I GVFTTDFP NPP  FNYTG  P NL TT GTKVYRLPYNATVQLVLQ
Sbjct  241   TVALLQAHFFGINGVFTTDFPANPPFVFNYTGTPPTNLATTNGTKVYRLPYNATVQLVLQ  300

Query  533   DTGIIAPENHPVHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIR  354
             DTGIIAPENHP+HLHGFNFF VG+G+GNFN KTDP  FNL+DPVERNTIGVPSGGWVAIR
Sbjct  301   DTGIIAPENHPIHLHGFNFFLVGKGLGNFNSKTDPKNFNLIDPVERNTIGVPSGGWVAIR  360

Query  353   FRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  240
             + ADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGP ES
Sbjct  361   WLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKES  398



>ref|XP_003604619.1| Laccase 1a [Medicago truncatula]
 gb|AES86816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=557

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/441 (77%), Positives = 382/441 (87%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SY YNFTITGQRGTL WHAHV WLRSTVHGA+VILPK GVPYPFPKPD E V+VL EWW
Sbjct  106   HSYTYNFTITGQRGTLLWHAHVNWLRSTVHGAIVILPKKGVPYPFPKPDDELVLVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAHTING PG V NC +Q  YKL V+ GK+Y+LR+INAA
Sbjct  166   KSDTEAVINEALKSGLAPNVSDAHTINGLPGTVANCSTQDVYKLPVESGKTYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATY KPF+  TIVIAPGQTTNV++ ANQ SGKY+VAASPF
Sbjct  226   LNEELFFKIAGHKLTVVEVDATYTKPFQIETIVIAPGQTTNVLLKANQKSGKYLVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKN-ATPVANNFVDALRSLNSKQYPAR  843
             MDAP+AVDN TATATLHYSG          +TPP   AT +ANNF+++L+ LNSK+YP  
Sbjct  286   MDAPVAVDNLTATATLHYSGTTLTNTPTFLTTPPPTNATQIANNFLNSLKGLNSKKYPVN  345

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSLFFTVGLG+NPCPSCK  NGSRVVA++NNVTFVMPT ALLQAH+FNIK VFT
Sbjct  346   VPLKIDHSLFFTVGLGVNPCPSCKAGNGSRVVAAINNVTFVMPTTALLQAHYFNIKNVFT  405

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP NPP  +N+TGAGP NL TT+GTK+Y+L +N TVQLV+QDTGIIAPE+HPVHLHGF
Sbjct  406   ADFPPNPPHIYNFTGAGPKNLNTTSGTKLYKLSFNDTVQLVMQDTGIIAPESHPVHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GN++ K D  KFNLVDPVERNT+GVP+GGWVAIRFRADNPGVWFMHCHLEV
Sbjct  466   NFFVVGRGVGNYDSKNDSKKFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEV  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLVDNGKGP +S
Sbjct  526   HTTWGLKMAFLVDNGKGPKQS  546



>ref|XP_010037723.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW49475.1| hypothetical protein EUGRSUZ_K02996 [Eucalyptus grandis]
Length=562

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/443 (74%), Positives = 386/443 (87%), Gaps = 3/443 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+++YNFTITGQRGTL WHAH+LWLR T+HGA+VILPK GVPYPFPKP  E V++LAEWW
Sbjct  109   QNFIYNFTITGQRGTLLWHAHILWLRVTLHGAIVILPKRGVPYPFPKPSKEYVIILAEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VIN+A+  GLAPNVSDAHTINGHPGPV  CPS+  Y L V+ GK+Y+LR++NAA
Sbjct  169   KSDTETVINQAMSQGLAPNVSDAHTINGHPGPVPGCPSERSYTLPVESGKTYLLRIVNAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H +TVVEVDATYVKPF+T+TI+I PGQTTNV++T NQ +GKY++ AS F
Sbjct  229   LNEELFFKIAQHNLTVVEVDATYVKPFQTDTILITPGQTTNVLLTTNQNAGKYLITASTF  288

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             M+ A +A+DN TA+A +HYSG L+   TVLT  PP+NA+ VAN+F +ALRSLNSK+YPA+
Sbjct  289   METAIVAIDNVTASAAVHYSGTLASASTVLTKPPPQNASAVANSFNNALRSLNSKKYPAK  348

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP+TVDH+LFFT+GLG+NPCP+C   NGSRVVA+VNN++FVMPT+ALLQAH FNI GVFT
Sbjct  349   VPKTVDHNLFFTMGLGVNPCPTCTAGNGSRVVAAVNNISFVMPTIALLQAHVFNISGVFT  408

Query  662   TDFPGNPPVAFNYTGAGPAN--LQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLH  489
             TDFPGNPP  +NYT   P N  + T  GTKVYRLPYNATVQLVLQDTGIIAPE HP+HLH
Sbjct  409   TDFPGNPPTTYNYTATPPQNASVPTMNGTKVYRLPYNATVQLVLQDTGIIAPETHPIHLH  468

Query  488   GFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHL  309
             GFNFF VG+G+GN++PK DP KFNLVDPVERNTIG+PSGGW+AIRF ADNPGVWF+HCHL
Sbjct  469   GFNFFGVGKGVGNYDPKKDPKKFNLVDPVERNTIGIPSGGWIAIRFTADNPGVWFLHCHL  528

Query  308   EVHTTWGLKMAFLVDNGKGPNES  240
             EVHTTWGLKMAFLVDNGKGP E+
Sbjct  529   EVHTTWGLKMAFLVDNGKGPKET  551



>ref|XP_004294236.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/442 (75%), Positives = 384/442 (87%), Gaps = 4/442 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q YVYNFT+TGQRGTL+WHAH+LWLR+TV+GALV+LPKLGVPYPFP P  E VV+L EWW
Sbjct  111   QQYVYNFTVTGQRGTLWWHAHILWLRATVYGALVVLPKLGVPYPFPAPKKEVVVILGEWW  170

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSG APNVSDAHTINGHPGP++ C SQGGYKL V PG +Y+LR+INAA
Sbjct  171   KSDVEAVINEALKSGAAPNVSDAHTINGHPGPLSLCSSQGGYKLPVQPGHTYLLRIINAA  230

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFK+A H++TVVEVDA Y KPF+T TI+IAPGQTTNV++TA++ +GKY+VAASPF
Sbjct  231   LNDELFFKVANHKLTVVEVDAVYTKPFETTTILIAPGQTTNVLLTADRSTGKYLVAASPF  290

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P +AVDN+TATATLHY G+L+   T+LT  PP+NAT +A +F  +LRSLNS  YPA+
Sbjct  291   MDNPTVAVDNKTATATLHYRGSLASTNTILTVPPPQNATRLATSFTKSLRSLNSDTYPAK  350

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSL FTV LGL  CPSC  ANG+RVVA +NNVTFVMP ++LLQAH FNI GVFT
Sbjct  351   VPLKIDHSLMFTVSLGLQTCPSC--ANGNRVVADLNNVTFVMPKISLLQAHVFNISGVFT  408

Query  662   TDFPGNPPVAFNYTGA-GPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
              DFPGNP + +NYTGA  P N+QT  GT++YRL YN+TVQLVLQDTG+IAPENHPVHLHG
Sbjct  409   DDFPGNPLMPYNYTGAQQPTNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENHPVHLHG  468

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFF VGRG+GNFN KTDP  FNL+DPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLE
Sbjct  469   FNFFEVGRGLGNFNSKTDPKIFNLIDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLE  528

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAF+VDNGKGPNES
Sbjct  529   VHTTWGLKMAFVVDNGKGPNES  550



>ref|XP_010685615.1| PREDICTED: laccase-4 [Beta vulgaris subsp. vulgaris]
Length=560

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/442 (76%), Positives = 382/442 (86%), Gaps = 4/442 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y YNFT+TGQRGTLF+HAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E V+VL EWW
Sbjct  110   QTYTYNFTLTGQRGTLFYHAHILWLRATVHGAIVILPKLGVPYPFPKPHKENVIVLGEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSGLAPNVSDAHTING+PGPV +C SQ  + L V PGK YMLR+INAA
Sbjct  170   KSDVEAVINEALKSGLAPNVSDAHTINGYPGPVRSCNSQELFNLHVRPGKKYMLRIINAA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGS-GKYMVAASP  1023
             LNEELFFKIAGH +TVVEVDATYVKPFKT+TIVI+PGQTTNVI+ AN    GKY++  SP
Sbjct  230   LNEELFFKIAGHHLTVVEVDATYVKPFKTDTIVISPGQTTNVILEANNKVLGKYLMVVSP  289

Query  1022  FMDAPIAVDNQTATATLHYSGALSG-LRTVLTSTPPKNATPVANNFVDALRSLNSKQYPA  846
             FMDAPI VDN T  AT+ Y+ + S  L T LT+ PP NAT VA+NF +AL++LNSK++PA
Sbjct  290   FMDAPIPVDNATGLATVRYTTSKSATLSTTLTAPPPINATKVADNFTNALKALNSKEFPA  349

Query  845   RVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVF  666
             +VPQ +DHSLFFT+GLG+NPC +C   NGSRVVAS+NNVTF+MPT++LLQAH+FN+ GVF
Sbjct  350   KVPQKIDHSLFFTIGLGVNPCSTC--VNGSRVVASINNVTFIMPTISLLQAHYFNLSGVF  407

Query  665   TTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             T DFP  P + FNYTG    NL TTTGTKVYRLPYNATVQLVLQDT +IAPENHP HLHG
Sbjct  408   TADFPSKPVIPFNYTGNQVTNLGTTTGTKVYRLPYNATVQLVLQDTAMIAPENHPFHLHG  467

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFF VGRG+GN+NPK DP KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWF+HCHLE
Sbjct  468   FNFFVVGRGLGNYNPKEDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFLHCHLE  527

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             +HTTWGLKMAFLVDNGKG NES
Sbjct  528   IHTTWGLKMAFLVDNGKGLNES  549



>ref|XP_008358974.1| PREDICTED: laccase-4-like [Malus domestica]
Length=557

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/441 (76%), Positives = 377/441 (85%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q YVYNFTITGQRGTL+WHAH+LWLR+T+HGALV+LPKLGVPYPFP P  E VV+L EWW
Sbjct  109   QQYVYNFTITGQRGTLWWHAHILWLRATIHGALVVLPKLGVPYPFPAPQKEVVVILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VI +A+KSGLAPNVSDAHTING+PGP++ C SQGG  L V PGK+YMLR+INAA
Sbjct  169   KSDTERVIRQALKSGLAPNVSDAHTINGYPGPISTCQSQGGL-LPVRPGKTYMLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H++TVVEVDA Y KPFKT+T +IAPGQTTNV+V+ N GSGKY+VAASPF
Sbjct  228   LNEELFFKIANHKLTVVEVDAVYTKPFKTDTXLIAPGQTTNVLVSTNHGSGKYLVAASPF  287

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P I VDN+TATATLHY G L   RT+LTS PP+NAT VA NF ++LRSLNS ++PAR
Sbjct  288   MDNPTIVVDNKTATATLHYIGTLESTRTILTSPPPQNATLVATNFTNSLRSLNSIRFPAR  347

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSL FTVGLGL+ C SC  ANG RVVA +NNVTFVMP +ALLQAHFFN  GVFT
Sbjct  348   VPLKIDHSLLFTVGLGLHTCDSC--ANGIRVVADINNVTFVMPKIALLQAHFFNXSGVFT  405

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   +NYTG    N+QT  GT++YRL YN TVQLVLQ TG++APE HPVHLHGF
Sbjct  406   DDFPGNPLNPYNYTGTQQTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETHPVHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GNFNP TDP +FNLVDPVERNTIGVPS GW AIRFRADNPGVWFMHCHLEV
Sbjct  466   NFFEVGRGLGNFNPNTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWFMHCHLEV  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  526   HTTWGLKMAFVVDNGKGPNES  546



>ref|XP_009407561.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=559

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/443 (73%), Positives = 388/443 (88%), Gaps = 5/443 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL+WHAH+ WLR+TVHGA+V+LPK  VPYPFP P  E V+VLAEWW
Sbjct  108   QNYVYNFTLTGQRGTLWWHAHISWLRATVHGAIVVLPKSNVPYPFPAPHKEVVLVLAEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPS--QGGYKLSVDPGKSYMLRVIN  1206
             KSDTEAVINEA+ SGLAPNVSDAHTINGH GP++ C S  + G+ L VD GK Y+LR+IN
Sbjct  168   KSDTEAVINEALNSGLAPNVSDAHTINGHAGPLSGCSSSARDGFTLQVDKGKRYLLRIIN  227

Query  1205  AALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAAS  1026
             AALNE+LFFK+AGHQ+TVVEVDA Y KPF T+T+++ PGQTTNV++TA QG+G+Y+V AS
Sbjct  228   AALNEDLFFKVAGHQLTVVEVDAAYTKPFTTDTLLLTPGQTTNVLLTARQGAGRYIVTAS  287

Query  1025  PFMDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
             PFMD+P +AVDN+TATAT+ Y+ ++S      T  PP+NATPVA++F D+LRSLNS+QYP
Sbjct  288   PFMDSPLVAVDNRTATATVQYANSVSTSAITTTKPPPQNATPVASSFTDSLRSLNSQQYP  347

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A+VP TVDHSL FTVGLG+NPC +C  ANGSRVVA +NNV+FVMPT ALLQAH+FN  GV
Sbjct  348   AKVPATVDHSLLFTVGLGVNPCATC--ANGSRVVADINNVSFVMPTTALLQAHYFNASGV  405

Query  668   FTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLH  489
             FT DFPG PP+AFNYTG+GP NLQT +GT++YR+PYNA+VQLVLQDTGII PENHP+HLH
Sbjct  406   FTDDFPGQPPIAFNYTGSGPRNLQTMSGTRLYRVPYNASVQLVLQDTGIIGPENHPIHLH  465

Query  488   GFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHL  309
             G+NFF VGRG+GN++PK+ P+ FNLVDP+ERNTIGVPSGGW AIRFRADNPGVWF+HCH 
Sbjct  466   GYNFFVVGRGVGNYDPKSSPSNFNLVDPIERNTIGVPSGGWTAIRFRADNPGVWFLHCHF  525

Query  308   EVHTTWGLKMAFLVDNGKGPNES  240
             EVHTTWGLKMAF+VD+G+GPN+S
Sbjct  526   EVHTTWGLKMAFVVDDGEGPNQS  548



>ref|XP_010543228.1| PREDICTED: laccase-10 [Tarenaya hassleriana]
Length=558

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/441 (74%), Positives = 384/441 (87%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWW
Sbjct  107   QNYVYNFTVTGQRGTLWWHAHILWLRATVHGAIVILPKPGLPYPFPKPHREEVIMLGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVINEA+KSGLAPNVSDAH INGHPGPV+ CPSQGG+KLSV+ GK+YMLR+INAA
Sbjct  167   KSDTEAVINEALKSGLAPNVSDAHIINGHPGPVSTCPSQGGFKLSVETGKTYMLRLINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +NEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SGKY++AASPF
Sbjct  227   MNEELFFKIAGHRFTVVEVDAVYVKPFSTDTILIAPGQTTTALVSAVRTSGKYLIAASPF  286

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              DA  +AVDN+TATAT+HYSG LS   T LTS PP+NAT VAN+F+ +LRSLNSK +PA 
Sbjct  287   QDAAAVAVDNRTATATVHYSGTLSAAPTSLTSPPPRNATSVANSFIGSLRSLNSKNFPAN  346

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP TVDH L F VGLG+N C SCK  NG+RVVA +NNVTF MPT ALLQAH+FN+ GV+T
Sbjct  347   VPATVDHDLLFAVGLGINRCHSCKAGNGTRVVAGINNVTFKMPTTALLQAHYFNLSGVYT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPG P  AF++TG  P+NL T   TKVY+LPYN+ VQ+VLQDTG+I+PE+HP+HLHG+
Sbjct  407   TDFPGKPHHAFDFTGKPPSNLATMKATKVYKLPYNSRVQVVLQDTGVISPESHPIHLHGY  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG GN+N K+D  KFNLVDPVERNT+ VPSGGWVAIRFRADNPGVWF+HCHLEV
Sbjct  467   NFFVVGRGSGNYNAKSDAKKFNLVDPVERNTVSVPSGGWVAIRFRADNPGVWFLHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLKMAFLV++G GPN+S
Sbjct  527   HTSWGLKMAFLVEDGNGPNQS  547



>ref|XP_010535416.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535417.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535418.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535419.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
Length=568

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/446 (74%), Positives = 378/446 (85%), Gaps = 8/446 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY YNFT+ GQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFP+P  E ++VL EWW
Sbjct  114   QSYTYNFTLAGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPQPHKEKIIVLGEWW  173

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA +SGLAPNVSDAHTINGH GP+ NCPSQ GY L V PGK+YMLR++NAA
Sbjct  174   KSDVEAVINEATRSGLAPNVSDAHTINGHTGPLPNCPSQQGYGLPVKPGKTYMLRIVNAA  233

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH++TVVEVDA Y KPFKT+T+VIAPGQTTNV++TAN  +G  YMVAA+ 
Sbjct  234   LNEELFFKIAGHELTVVEVDAVYTKPFKTDTVVIAPGQTTNVLLTANAYAGSNYMVAATT  293

Query  1022  FMDAPIAVDNQTATATLHYSG-----ALSGLRTVLTSTPPKNATPVANNFVDALRSLNSK  858
             +MDAPIA DN TATATLHY G     A +  +TVL + PP+NAT VA  F+ +LRSLNS+
Sbjct  294   YMDAPIAFDNVTATATLHYVGPTTANANAAAKTVLATLPPQNATWVATKFIKSLRSLNSE  353

Query  857   QYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNI  678
             +YPARVP  VDHSLFFTVGLG+NPC SC   NGSRVVA +NNVTFVMP +ALLQAHFFN+
Sbjct  354   EYPARVPMNVDHSLFFTVGLGVNPCRSC--VNGSRVVADINNVTFVMPKIALLQAHFFNL  411

Query  677   KGVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPV  498
              GVFT DFP  P   +NYTG  PAN  T  GT++YRLPYNA V++VLQDTG+I PENHP+
Sbjct  412   PGVFTDDFPARPSHPYNYTGTQPANPATMKGTRLYRLPYNARVEIVLQDTGMITPENHPI  471

Query  497   HLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMH  318
             HLHGFNFF VGRG+GNFN K DP KFNLVDPVERNT+GVP+GGWVAIRF ADNPGVWFMH
Sbjct  472   HLHGFNFFEVGRGLGNFNQKKDPKKFNLVDPVERNTVGVPAGGWVAIRFTADNPGVWFMH  531

Query  317   CHLEVHTTWGLKMAFLVDNGKGPNES  240
             CHLE+HTTWGLKMAF+VDNG GPN S
Sbjct  532   CHLEIHTTWGLKMAFVVDNGDGPNHS  557



>ref|XP_007140382.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
 gb|ESW12376.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
Length=560

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/444 (75%), Positives = 382/444 (86%), Gaps = 4/444 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAHV WLRST+HGA+VILPK GVPYPFPKP  E VV+L EWW
Sbjct  106   QSYLYNFTLTGQRGTLLWHAHVNWLRSTLHGAIVILPKHGVPYPFPKPVKELVVILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPV--TNCPSQGGYKLSVDPGKSYMLRVIN  1206
             KSDTE VINEA+KSGLAPNVSDAHTING PG V   NC +Q  YKL V+ GK+Y+LR+IN
Sbjct  166   KSDTEDVINEALKSGLAPNVSDAHTINGLPGIVFVANCSTQDVYKLPVESGKTYLLRIIN  225

Query  1205  AALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAAS  1026
             AALNEE FFKIAGH  TVVEVDA+YVKPFKT+T++IAPGQTTN ++T +Q SGKY + AS
Sbjct  226   AALNEETFFKIAGHLFTVVEVDASYVKPFKTDTLLIAPGQTTNALLTTDQNSGKYTIVAS  285

Query  1025  PFMDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
              FMD+P+ AVDN TATATLHY+G L+   TVL + PP+NAT VANNF  +L+SLNSK+YP
Sbjct  286   TFMDSPVVAVDNLTATATLHYTGTLATTPTVLITPPPRNATQVANNFTKSLKSLNSKKYP  345

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A VP TVDHSL FTVGLG+NPCPSC   NGSRVVA+VNNVTFVMPT ALLQAH+FN +GV
Sbjct  346   ANVPLTVDHSLLFTVGLGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNTQGV  405

Query  668   FTTDFPGNPPVAFNYTGA-GPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHL  492
             FTTDFPGNPP  +NYT     A+ QTT GTKVYRL +N+TVQ+VLQDTG+IA E+HP+HL
Sbjct  406   FTTDFPGNPPQVYNYTATPRAASSQTTNGTKVYRLAFNSTVQVVLQDTGVIALESHPIHL  465

Query  491   HGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCH  312
             HGFNFF VG G+GN++PKTD + FNLVDPVERNTIGVP+GGW+A+RFRADNPGVWF+HCH
Sbjct  466   HGFNFFVVGSGVGNYDPKTDGSNFNLVDPVERNTIGVPTGGWIALRFRADNPGVWFLHCH  525

Query  311   LEVHTTWGLKMAFLVDNGKGPNES  240
              EVHTTWGLKMAFLVDNGKGPNES
Sbjct  526   FEVHTTWGLKMAFLVDNGKGPNES  549



>gb|KDO53232.1| hypothetical protein CISIN_1g0093922mg, partial [Citrus sinensis]
Length=506

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/402 (81%), Positives = 366/402 (91%), Gaps = 1/402 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFTITGQRGTL WHAH+LWLR+TVHGA+VILPK GVPYPFPKP  E VVVLAEWW
Sbjct  106   HSYVYNFTITGQRGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVVVVLAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAVIN+A++SGLAPNVSD+HTING PGP+++C SQGG+ L VD GK+YMLR+INAA
Sbjct  166   KSDTEAVINQALQSGLAPNVSDSHTINGQPGPISSCSSQGGFTLPVDSGKTYMLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDATYVKPFKT+ IVIAPGQTTNV+++A++ SGKY+VAASPF
Sbjct  226   LNEELFFKIAGHKLTVVEVDATYVKPFKTDNIVIAPGQTTNVLLSADKTSGKYLVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN TATATLHYSG L+   T LTSTPPKN T +AN F+D+LRSLNSK+YPA+V
Sbjct  286   MDAPIAVDNVTATATLHYSGTLASSATTLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQTVDH+L FTVGLG+NPCPSCK  NGSRVVAS+NNVTFVMPT+ALLQAHFFNI GVFTT
Sbjct  346   PQTVDHNLLFTVGLGVNPCPSCKAGNGSRVVASINNVTFVMPTIALLQAHFFNISGVFTT  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  +N+TG  P NLQT+ GTK YRL YN+TVQL+LQDTGIIAPENHPVHLHGFN
Sbjct  406   DFPGNPPHTYNFTGT-PKNLQTSNGTKAYRLAYNSTVQLILQDTGIIAPENHPVHLHGFN  464

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIR  354
             FFAVG+G+GNFNPK DP KFNLVDPVERNTIGVPSGGWVAIR
Sbjct  465   FFAVGKGLGNFNPKKDPKKFNLVDPVERNTIGVPSGGWVAIR  506



>ref|XP_004150626.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004169234.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=517

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/441 (74%), Positives = 379/441 (86%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL+WHAH+LWLR+T++GA+VILPKLGVPYPFP P  E V++L EWW
Sbjct  68    QSYVYNFTITGQRGTLWWHAHILWLRATLYGAVVILPKLGVPYPFPTPHKELVLILGEWW  127

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV++EA KSGLAPNVSDAHTINGHPGPV  C ++G   + V PGK+Y+LR+INAA
Sbjct  128   KSDVEAVVHEAAKSGLAPNVSDAHTINGHPGPVNGCLTRGKGIMPVQPGKTYLLRIINAA  187

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH++TVVEVDA Y KPF T+TI IAPGQTTN ++TA+  SGKY ++ASPF
Sbjct  188   LNEELFFKVAGHKLTVVEVDAAYTKPFITDTIFIAPGQTTNALLTADLKSGKYAISASPF  247

Query  1019  MDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D PI AVDN TATATLHY+G +S   T  T  PP+NAT +A  F ++LRSLNSKQYPAR
Sbjct  248   RDTPIVAVDNVTATATLHYTGTISTSPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPAR  307

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             V   VDHSLFFTVGLG+N C +C  ++G++VVA +NNVTFVMPT++LLQAH+FNI GVFT
Sbjct  308   VSLEVDHSLFFTVGLGVNRCKTC--SSGTQVVADINNVTFVMPTISLLQAHYFNIDGVFT  365

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP NPP+ ++YTG  P+NLQTT GT++YRL YN+TVQLVLQDT +IAPENHPVHLHGF
Sbjct  366   DDFPANPPIRYDYTGKQPSNLQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENHPVHLHGF  425

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G+GNFN K DP KFNLVDPVERNT+GVPSGGWVAIRFRADNPGVWFMHCHLEV
Sbjct  426   NFFVVGSGLGNFNHKKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEV  485

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+V+NG+GP ES
Sbjct  486   HTTWGLKMAFVVNNGRGPEES  506



>emb|CBI31539.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/440 (70%), Positives = 380/440 (86%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT++GQRGTL WHAH+ WLR+T++GA+VILPK GVPYPFPKPD E VV+L EWW
Sbjct  85    QSYIYNFTLSGQRGTLLWHAHISWLRATMYGAIVILPKRGVPYPFPKPDREVVVILGEWW  144

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAVIN+AI+SGL PN+SDAHTINGHPGP + C SQ GY L+V+ GK+YMLR++NAA
Sbjct  145   KADVEAVINQAIQSGLPPNISDAHTINGHPGPTSTCSSQAGYTLNVESGKTYMLRIVNAA  204

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +N+ELFFKI+GHQ+TVVEVDA Y KPFKT+T+ IAPGQTTN ++TA+QG+GKY+V  SPF
Sbjct  205   VNDELFFKISGHQLTVVEVDAIYAKPFKTDTLFIAPGQTTNALLTADQGAGKYLVVVSPF  264

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI VDN T TA L Y+G L+   TVLT++P +NAT + ++F+D+L+SLNSKQYPA V
Sbjct  265   MDAPIPVDNITGTAILSYTGTLAASPTVLTTSPSQNATQLTSSFMDSLKSLNSKQYPANV  324

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSL FT+G+G+NPC +C   NGSR+V+ +NNVTFVMPT  LL+AH++NI GVFT 
Sbjct  325   PLAIDHSLLFTIGVGVNPCSTC--VNGSRLVSYINNVTFVMPTTGLLEAHYYNIGGVFTV  382

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNP +AFNYTG  P+N+QT  GT++YRL YN+TVQ+V+Q T +I+PE+HP HLHGF+
Sbjct  383   DFPGNPLIAFNYTGTQPSNMQTMNGTRLYRLAYNSTVQVVIQGTAMISPESHPTHLHGFD  442

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             F+AVGRG+GNF+P  DP KFNL+DP+ RNTIGVPSGGW AIRFRADNPGVW +HCHLEVH
Sbjct  443   FYAVGRGLGNFDPVNDPKKFNLIDPIARNTIGVPSGGWTAIRFRADNPGVWLLHCHLEVH  502

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPNES
Sbjct  503   TTWGLKMAFLVENGKGPNES  522



>gb|EPS60103.1| laccase 1a, partial [Genlisea aurea]
Length=546

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/441 (73%), Positives = 374/441 (85%), Gaps = 2/441 (0%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             S+VYNFTI GQRGTL WHAHVLWLR+TVHGALV+LP++GVPYPFPKPDHE VVVLAEWWK
Sbjct  95    SFVYNFTIAGQRGTLLWHAHVLWLRATVHGALVVLPRIGVPYPFPKPDHERVVVLAEWWK  154

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SDTEAVINEA+ SGLAPNVSD HTING  GPV  C S   Y L+V PGK+Y+LR+INAAL
Sbjct  155   SDTEAVINEAMSSGLAPNVSDGHTINGLTGPVEGCSSSESYNLAVAPGKTYLLRLINAAL  214

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTA-NQGSGKYMVAASPF  1020
             NEELFFKIAGH +TVVE DA YVKPF+T+ IVIAPGQTTN I+TA ++ +GK+ + A+PF
Sbjct  215   NEELFFKIAGHSLTVVEADAVYVKPFQTDVIVIAPGQTTNAILTASDKLAGKFTILATPF  274

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPK-NATPVANNFVDALRSLNSKQYPAR  843
              DAP+ VDN+TATAT++Y+G +     +  +TPP+ NATP+AN F D+LRSLNSK +PA 
Sbjct  275   QDAPLPVDNRTATATVNYAGTVLSSSALTLATPPRVNATPIANGFTDSLRSLNSKNFPAN  334

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSLFFTVGLG+ PC +C+  NGSR+VA +NNVTFVMPT ALLQAHFF  KGVFT
Sbjct  335   VPLEIDHSLFFTVGLGVIPCATCRAGNGSRIVADINNVTFVMPTTALLQAHFFKTKGVFT  394

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPGNPP +F+YTG  P NL TT GTK+YRL YN TVQ+V+QDTG+I  ENHPVHLHGF
Sbjct  395   TDFPGNPPSSFDYTGRSPRNLATTNGTKLYRLKYNDTVQIVIQDTGMIMAENHPVHLHGF  454

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G+GNFN   DP +FNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV
Sbjct  455   NFFGVGKGLGNFNSTADPKRFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  514

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLVD+G  P ++
Sbjct  515   HTTWGLKMAFLVDDGTSPEQT  535



>ref|XP_010676357.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=561

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/443 (74%), Positives = 375/443 (85%), Gaps = 5/443 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y YNFT+TGQRGTLF+HAH+LWLR+TVHGA+VILPKLGVPYPFPKPD E ++VL EWW
Sbjct  110   QTYTYNFTVTGQRGTLFYHAHILWLRATVHGAIVILPKLGVPYPFPKPDKENIIVLGEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVINEA+KSGLAPNVSDAHTING+  PV NC S+  + + V PGK YMLR+INAA
Sbjct  170   KSDVEAVINEALKSGLAPNVSDAHTINGYTRPVKNCNSKEMFNIHVKPGKRYMLRIINAA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTA-NQGSGKYMVAASP  1023
             LNEELFFKIA H++TVVEVDATYVKPFKT+TIVI+PGQTTNVI+ A N+  GKY+V  SP
Sbjct  230   LNEELFFKIADHKLTVVEVDATYVKPFKTDTIVISPGQTTNVILEANNKAMGKYLVVVSP  289

Query  1022  FMDAPIAVDNQTATATLHYSGAL-SGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPA  846
             FMDAP+ VDN T  ATL Y       L   LT+ PP NAT VA+NF +ALRSLN+K++PA
Sbjct  290   FMDAPVPVDNATGFATLRYPAFRHKTLSATLTAPPPINATAVADNFTNALRSLNTKEFPA  349

Query  845   RVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVF  666
             +VPQ VDHSLFFTVGLG+NPC +C   NGSR+VA +NN+TFVMP +++LQAH++NI GVF
Sbjct  350   KVPQKVDHSLFFTVGLGVNPCKTC--VNGSRIVADINNITFVMPDISILQAHYYNISGVF  407

Query  665   TTDFPGNPPVAFNYTGAGPA-NLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLH  489
             T DFP  PP  FN+TG     N+ TT GTKVYRLPYNATVQLVLQDT IIAPENHP HLH
Sbjct  408   TDDFPAKPPTPFNFTGNNQVTNVGTTKGTKVYRLPYNATVQLVLQDTAIIAPENHPFHLH  467

Query  488   GFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHL  309
             GFNFF VG+G+GNFNPK DP KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWF HCHL
Sbjct  468   GFNFFVVGKGVGNFNPKNDPKKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFFHCHL  527

Query  308   EVHTTWGLKMAFLVDNGKGPNES  240
             E+HTTWGLKMAFLVD+GKGP+ES
Sbjct  528   EIHTTWGLKMAFLVDDGKGPSES  550



>ref|XP_008457399.1| PREDICTED: laccase-4 [Cucumis melo]
Length=562

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/441 (73%), Positives = 380/441 (86%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL+WHAH+LWLR+T++GA+VILPKLGVPYPFP P  E V++L EWW
Sbjct  114   QSYVYNFTITGQRGTLWWHAHILWLRATLYGAVVILPKLGVPYPFPTPHKELVLILGEWW  173

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E V+NEA KSGLAPNVSDAHTINGHPGPV  C ++G + + V PGK+Y+LR+INAA
Sbjct  174   KSDVEGVVNEAAKSGLAPNVSDAHTINGHPGPVHGCLTRG-FSMPVQPGKTYLLRIINAA  232

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNE+LFFK+AGH++TVVEVDA Y KPF T+TIVIAPGQTTN ++TA+  SGKY ++ASPF
Sbjct  233   LNEDLFFKVAGHKLTVVEVDAAYTKPFITDTIVIAPGQTTNALLTADLKSGKYAISASPF  292

Query  1019  MDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD PI AVDN TATATLHY+G +S   T  T  PP+NAT +A  F ++LRSLNSKQYPAR
Sbjct  293   MDTPIVAVDNVTATATLHYTGTISTTPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPAR  352

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             V   VDHSL FTVGLG+N C +C  ++G+++VA +NNVTFVMPT++LLQAH+FNI GVFT
Sbjct  353   VSLEVDHSLLFTVGLGVNRCKTC--SSGNQLVADINNVTFVMPTISLLQAHYFNIDGVFT  410

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP NPP+ ++YTG  P+N+QTT GT++YRL YN+TVQLVLQDT +IAPENHPVHLHGF
Sbjct  411   DDFPANPPIRYDYTGKQPSNMQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENHPVHLHGF  470

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G+GNFN K DP KFNLVDPVERNT+GVPSGGWVAIRFRADNPGVWFMHCHLEV
Sbjct  471   NFFVVGSGLGNFNHKKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEV  530

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNG+GP ES
Sbjct  531   HTTWGLKMAFVVDNGRGPEES  551



>gb|KGN65788.1| hypothetical protein Csa_1G528530 [Cucumis sativus]
Length=562

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/441 (74%), Positives = 380/441 (86%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTITGQRGTL+WHAH+LWLR+T++GA+VILPKLGVPYPFP P  E V++L EWW
Sbjct  114   QSYVYNFTITGQRGTLWWHAHILWLRATLYGAVVILPKLGVPYPFPTPHKELVLILGEWW  173

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV++EA KSGLAPNVSDAHTINGHPGPV  C ++G + + V PGK+Y+LR+INAA
Sbjct  174   KSDVEAVVHEAAKSGLAPNVSDAHTINGHPGPVNGCLTRG-FSMPVQPGKTYLLRIINAA  232

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFK+AGH++TVVEVDA Y KPF T+TI IAPGQTTN ++TA+  SGKY ++ASPF
Sbjct  233   LNEELFFKVAGHKLTVVEVDAAYTKPFITDTIFIAPGQTTNALLTADLKSGKYAISASPF  292

Query  1019  MDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D PI AVDN TATATLHY+G +S   T  T  PP+NAT +A  F ++LRSLNSKQYPAR
Sbjct  293   RDTPIVAVDNVTATATLHYTGTISTSPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPAR  352

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             V   VDHSLFFTVGLG+N C +C  ++G++VVA +NNVTFVMPT++LLQAH+FNI GVFT
Sbjct  353   VSLEVDHSLFFTVGLGVNRCKTC--SSGTQVVADINNVTFVMPTISLLQAHYFNIDGVFT  410

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP NPP+ ++YTG  P+NLQTT GT++YRL YN+TVQLVLQDT +IAPENHPVHLHGF
Sbjct  411   DDFPANPPIRYDYTGKQPSNLQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENHPVHLHGF  470

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G+GNFN K DP KFNLVDPVERNT+GVPSGGWVAIRFRADNPGVWFMHCHLEV
Sbjct  471   NFFVVGSGLGNFNHKKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEV  530

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+V+NG+GP ES
Sbjct  531   HTTWGLKMAFVVNNGRGPEES  551



>ref|XP_006602641.1| PREDICTED: laccase-4-like isoform X1 [Glycine max]
Length=560

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/444 (76%), Positives = 383/444 (86%), Gaps = 4/444 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAHV WLRST+HGA+VILPK GVPYPFPKPD E VV+L EWW
Sbjct  106   QSYLYNFTLTGQRGTLLWHAHVNWLRSTLHGAIVILPKRGVPYPFPKPDKELVVILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPG--PVTNCPSQGGYKLSVDPGKSYMLRVIN  1206
             KSDTE VINEA+KSGLAPNVSDAHTING PG   V NC +Q  YKL V+ GK+Y+LR+IN
Sbjct  166   KSDTEDVINEALKSGLAPNVSDAHTINGLPGIVSVANCSTQDVYKLPVESGKTYLLRIIN  225

Query  1205  AALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAAS  1026
             AALNEELFFKIAGH  TVVEVDA+YVKPFKT+T+ IAPGQTTN ++TA+Q SGKY + AS
Sbjct  226   AALNEELFFKIAGHPFTVVEVDASYVKPFKTDTLSIAPGQTTNALLTADQNSGKYTIVAS  285

Query  1025  PFMDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
              FMD+P+ AVDN TATATLHY+G L+   T+LT+ PP+NAT VANNF ++L+SLNSK+YP
Sbjct  286   TFMDSPVVAVDNLTATATLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYP  345

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A+VPQ VDHSL  TVGLG+NPCPSC   NGSRVVA+VNNVTFVMPT ALLQAH+FNIKGV
Sbjct  346   AKVPQKVDHSLLLTVGLGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGV  405

Query  668   FTTDFPGNPPVAFNYTGAGPAN-LQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHL  492
             FTTDFPGNP   +NYT   PA   QTT GTK YRL +N+TVQ+VLQDTG+IAPE+HPVHL
Sbjct  406   FTTDFPGNPSHVYNYTATPPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPESHPVHL  465

Query  491   HGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCH  312
             HGFNFF VG G+GN++PKTD   FNL DPVERNTIGVP+GGWVA RFRADNPGVWF+HCH
Sbjct  466   HGFNFFVVGSGVGNYDPKTDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGVWFLHCH  525

Query  311   LEVHTTWGLKMAFLVDNGKGPNES  240
              EVHTTWGLKMAFLVDNGKGPNES
Sbjct  526   FEVHTTWGLKMAFLVDNGKGPNES  549



>ref|XP_004506788.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=557

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/441 (77%), Positives = 382/441 (87%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFTITGQRGTL WHAHV WLRSTVHGA+VILPK GVPYPFPKPD E V+VL EWW
Sbjct  106   HSYVYNFTITGQRGTLLWHAHVNWLRSTVHGAIVILPKRGVPYPFPKPDEELVLVLGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEA+INEA+KSG+APNVSD+HTING PG V+NC +Q  Y L V+ GKSY+LR+INAA
Sbjct  166   KSDTEAIINEALKSGMAPNVSDSHTINGFPGKVSNCSNQEVYNLPVESGKSYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H++T+VEVDATYVKPF+  TIVIAPGQTTNV++ ANQ SGKY+VAASPF
Sbjct  226   LNEELFFKIANHKLTIVEVDATYVKPFEIETIVIAPGQTTNVLLKANQKSGKYLVAASPF  285

Query  1019  MDAPIAVDNQTATATLHYSG-ALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MDAP+AVDN TATATLHYSG  LS   T LT+ PPKN+T  ANNF+++LR LNSK YP  
Sbjct  286   MDAPVAVDNLTATATLHYSGLTLSNTPTFLTTPPPKNSTENANNFLNSLRGLNSKTYPVN  345

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             +P  +DHSL+FT+GLGL PCPSCK ANGSRVVA+VNNVTFVMPT ALLQAH+FNI GVFT
Sbjct  346   LPLKIDHSLYFTIGLGLQPCPSCKAANGSRVVAAVNNVTFVMPTTALLQAHYFNIGGVFT  405

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFP NPP  FN+TG+GP NL T +GTKVYRL +N TVQLV+QDTGI+  ENHPVHLHGF
Sbjct  406   TDFPPNPPFFFNFTGSGPKNLNTDSGTKVYRLKFNETVQLVMQDTGILTLENHPVHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF +G G+GN+N   D   FNLVDPVERNT+GVP+GGWVAIRFRADNPGVWFMHCHLE+
Sbjct  466   NFFVIGSGLGNYNSTIDSKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEI  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLVDNG+GP +S
Sbjct  526   HTTWGLKMAFLVDNGQGPKQS  546



>ref|XP_009384856.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=558

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/443 (71%), Positives = 379/443 (86%), Gaps = 5/443 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y YNFT+TGQRGTL WHAH++W R+TVHGA+VILPK GVPYPFP P  E V+VLAEWW
Sbjct  107   QNYAYNFTLTGQRGTLLWHAHIMWQRATVHGAIVILPKRGVPYPFPAPHKEVVLVLAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPS--QGGYKLSVDPGKSYMLRVIN  1206
             KSD EAVINEA++SGL PNVSDAHTINGH GP + C S  + G+ L VD  K+Y+LR+IN
Sbjct  167   KSDVEAVINEALQSGLGPNVSDAHTINGHAGPTSGCASSARDGFTLRVDQRKTYLLRIIN  226

Query  1205  AALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAAS  1026
             AALN++LFFK+AGH MTVVEVDATY KPF  +T++IAPGQTTNV++TA+QG+G+Y+V AS
Sbjct  227   AALNDDLFFKVAGHLMTVVEVDATYTKPFTIDTLLIAPGQTTNVLLTADQGAGRYLVTAS  286

Query  1025  PFMDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
             PFMD+P +AVDN T TAT+ Y+ A+S      T  PP+N+T +A+ F+D+LRSLNSKQYP
Sbjct  287   PFMDSPLVAVDNSTGTATVQYTDAVSTSAIATTKLPPRNSTSLASQFIDSLRSLNSKQYP  346

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A VP TVDHSL FTVGLG+NPCP+C   NGSRVVA++NNVTF+MPT ALLQAH+FN+ GV
Sbjct  347   ANVPSTVDHSLLFTVGLGVNPCPAC--TNGSRVVAAMNNVTFMMPTTALLQAHYFNMSGV  404

Query  668   FTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLH  489
             FT DFPG P +AFNYTG+GP N QT  GT++YRLPYNA+VQLVLQDTGII PE+HP+HLH
Sbjct  405   FTNDFPGQPLIAFNYTGSGPNNTQTMNGTRLYRLPYNASVQLVLQDTGIIGPESHPIHLH  464

Query  488   GFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHL  309
             G+NFF VGRG+GN++P T P+KFNLVDP+ERNT+ VP+ GW AIRFRADNPGVWF+HCH 
Sbjct  465   GYNFFVVGRGVGNYDPATSPSKFNLVDPIERNTMAVPAAGWTAIRFRADNPGVWFLHCHF  524

Query  308   EVHTTWGLKMAFLVDNGKGPNES  240
             EVHTTWGLKMAF+V++GKGPNES
Sbjct  525   EVHTTWGLKMAFVVEDGKGPNES  547



>ref|XP_007220829.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
 gb|EMJ22028.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
Length=558

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/440 (71%), Positives = 375/440 (85%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+++YNFT+TGQRGTL WHAH  WLR+T+HGA+VILPK G PYPFP PD E  V+LAEWW
Sbjct  110   QNFIYNFTLTGQRGTLLWHAHTSWLRATLHGAIVILPKRGTPYPFPTPDEEKTVILAEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV+N++IKSGL PNVSDAHTINGH GPV  C SQGGY L V+ GK+Y+LR+INAA
Sbjct  170   KSDVEAVVNQSIKSGLPPNVSDAHTINGHAGPVPGCSSQGGYTLHVESGKTYLLRIINAA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFFKIAGH +TVVEVDA+Y KPF+T+TI I+PGQTTN I+TAN+G GKY++AASPF
Sbjct  230   LNDDLFFKIAGHNLTVVEVDASYTKPFQTDTIFISPGQTTNAILTANRGIGKYLIAASPF  289

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+  DN T+ A+L Y G  +  +  LTS PP+NATPV N F+D+LRSLNSKQYPA V
Sbjct  290   MDAPVGFDNLTSIASLLYKGTPANPKAFLTSIPPQNATPVTNTFMDSLRSLNSKQYPANV  349

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DHSLFFT+ +G+NPC +C   NGS++VA+ NNV+FVMPT+ALLQA+++N KGVFT 
Sbjct  350   PLTIDHSLFFTIAVGVNPCATC--VNGSKLVAAFNNVSFVMPTIALLQAYYYNTKGVFTL  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP+ FNYTG   AN+QTT GT++YRL YN+TVQ+VLQ T +IAPE+HP HLHGFN
Sbjct  408   DFPANPPIPFNYTGNSTANMQTTNGTRLYRLGYNSTVQIVLQGTAVIAPESHPTHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+GIGNF+PK DP  FNLVDPVERNTI VP+GGW AIRFRADNPG+WF+HCHLEVH
Sbjct  468   FFVVGKGIGNFDPKKDPKTFNLVDPVERNTISVPTGGWTAIRFRADNPGIWFLHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKM FLV+NGKGPNE+
Sbjct  528   TTWGLKMPFLVENGKGPNET  547



>ref|XP_006398646.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
 gb|ESQ40099.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
Length=558

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/441 (73%), Positives = 376/441 (85%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPK G+PYPFPKP  E V+VL EWW
Sbjct  107   HSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIVLGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE V+NEA+KSGLAPNVSDAH INGHPG V NCPSQG +KL+V+ GK+YMLR++NAA
Sbjct  167   KSDTETVVNEALKSGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLVNAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +NEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SG+Y++AA+PF
Sbjct  227   MNEELFFKIAGHRFTVVEVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGQYLIAAAPF  286

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG  S   T  TS PP+NAT VAN+FV++LRSLNS  YPA+
Sbjct  287   QDSAVVAVDNRTATATVHYSGTFSATATKTTSPPPQNATSVANSFVNSLRSLNSITYPAK  346

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP TVDH L FTVGLG+N C SCK  N SRVVA++NN+TF MP  ALLQAH+FN+ G++T
Sbjct  347   VPITVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFP  P   F++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHGF
Sbjct  407   TDFPAKPRRFFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFFVVGLGSGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLV+NGKGPN+S
Sbjct  527   HTTWGLKMAFLVENGKGPNQS  547



>ref|XP_002265173.1| PREDICTED: laccase-4-like [Vitis vinifera]
Length=553

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/440 (70%), Positives = 380/440 (86%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT++GQRGTL WHAH+ WLR+T++GA+VILPK GVPYPFPKPD E VV+L EWW
Sbjct  106   QSYIYNFTLSGQRGTLLWHAHISWLRATMYGAIVILPKRGVPYPFPKPDREVVVILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAVIN+AI+SGL PN+SDAHTINGHPGP + C SQG Y L+V+ GK+YMLR++NAA
Sbjct  166   KADVEAVINQAIQSGLPPNISDAHTINGHPGPTSTCSSQG-YTLNVESGKTYMLRIVNAA  224

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +N+ELFFKI+GHQ+TVVEVDA Y KPFKT+T+ IAPGQTTN ++TA+QG+GKY+V  SPF
Sbjct  225   VNDELFFKISGHQLTVVEVDAIYAKPFKTDTLFIAPGQTTNALLTADQGAGKYLVVVSPF  284

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI VDN T TA L Y+G L+   TVLT++P +NAT + ++F+D+L+SLNSKQYPA V
Sbjct  285   MDAPIPVDNITGTAILSYTGTLAASPTVLTTSPSQNATQLTSSFMDSLKSLNSKQYPANV  344

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSL FT+G+G+NPC +C   NGSR+V+ +NNVTFVMPT  LL+AH++NI GVFT 
Sbjct  345   PLAIDHSLLFTIGVGVNPCSTC--VNGSRLVSYINNVTFVMPTTGLLEAHYYNIGGVFTV  402

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNP +AFNYTG  P+N+QT  GT++YRL YN+TVQ+V+Q T +I+PE+HP HLHGF+
Sbjct  403   DFPGNPLIAFNYTGTQPSNMQTMNGTRLYRLAYNSTVQVVIQGTAMISPESHPTHLHGFD  462

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             F+AVGRG+GNF+P  DP KFNL+DP+ RNTIGVPSGGW AIRFRADNPGVW +HCHLEVH
Sbjct  463   FYAVGRGLGNFDPVNDPKKFNLIDPIARNTIGVPSGGWTAIRFRADNPGVWLLHCHLEVH  522

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPNES
Sbjct  523   TTWGLKMAFLVENGKGPNES  542



>emb|CAA74101.1| laccase [Populus trichocarpa]
Length=407

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/391 (83%), Positives = 352/391 (90%), Gaps = 0/391 (0%)
 Frame = -2

Query  1412  HEAVVVLAEWWKSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPG  1233
              E VVVLAEWWKSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ C SQGG+ L V  G
Sbjct  3     REVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVQSG  62

Query  1232  KSYMLRVINAALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQG  1053
             K+YMLR+INAALNEELFFKIAGH++TVVEVDATYVKPFKT+T++IAPG TTNV+VT N+ 
Sbjct  63    KTYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFKTDTVLIAPGHTTNVLVTTNKN  122

Query  1052  SGKYMVAASPFMDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALR  873
             + K +VAASPFMDAPIAVDN TATATLHYSGALS   T LT  PPKNAT +AN F ++LR
Sbjct  123   TCKILVAASPFMDAPIAVDNMTATATLHYSGALSNSPTTLTIPPPKNATAIANQFTNSLR  182

Query  872   SLNSKQYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQA  693
             SLNSK +PA+VP TVDHSLFFTVGLG+NPCP+CK  NGSRVVAS+NNVTFVMPT ALLQA
Sbjct  183   SLNSKTFPAKVPLTVDHSLFFTVGLGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQA  242

Query  692   HFFNIKGVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAP  513
             HFFNI GVFTTDFP  PP  FNYTG  P NLQTT+GTK YRLPYN+TVQLV+QDTGII+P
Sbjct  243   HFFNISGVFTTDFPAKPPHVFNYTGTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISP  302

Query  512   ENHPVHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPG  333
             ENHP+HLHGFNFFAVGRG+GN+NPKTDP KFNLVDPVERNTIGVPSGGWVAIRFRADNPG
Sbjct  303   ENHPIHLHGFNFFAVGRGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPG  362

Query  332   VWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  240
             VWFMHCHLEVHTTWGLKMAFLVDNGKGPNES
Sbjct  363   VWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  393



>ref|NP_195739.2| laccase 10 [Arabidopsis thaliana]
 sp|Q6ID18.1|LAC10_ARATH RecName: Full=Laccase-10; AltName: Full=Benzenediol:oxygen oxidoreductase 
10; AltName: Full=Diphenol oxidase 10; AltName: 
Full=Urishiol oxidase 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAT41838.1| At5g01190 [Arabidopsis thaliana]
 gb|AED90308.1| laccase 10 [Arabidopsis thaliana]
Length=558

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/441 (74%), Positives = 377/441 (85%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPKLG+PYPFPKP  E V++L EWW
Sbjct  107   HSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKLGLPYPFPKPHREEVIILGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE V+NEA+KSGLAPNVSDAH INGHPG V NCPSQG +KL+V+ GK+YMLR+INAA
Sbjct  167   KSDTETVVNEALKSGLAPNVSDAHVINGHPGFVPNCPSQGNFKLAVESGKTYMLRLINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SG+Y++AA+PF
Sbjct  227   LNEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPF  286

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG LS   T  TS PP+NAT VAN FV++LRSLNSK YPA 
Sbjct  287   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSKTYPAN  346

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP TVDH L FTVGLG+N C SCK  N SRVVA++NN+TF MP  ALLQAH+FN+ G++T
Sbjct  347   VPITVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFP  P   F++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHGF
Sbjct  407   TDFPAKPRRVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFFVVGLGTGNYNSKKDSNKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLV+NGKGPN+S
Sbjct  527   HTTWGLKMAFLVENGKGPNQS  547



>ref|XP_006287399.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
 gb|EOA20297.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
Length=558

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/441 (75%), Positives = 377/441 (85%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWW
Sbjct  107   HSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA++SGLAPNVSDAH INGHPG V NCPSQG +KL+V+ GK+YMLR+INAA
Sbjct  167   KSDTEMVINEALRSGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SG+Y++AA+PF
Sbjct  227   LNEELFFKIAGHRFTVVEVDAAYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPF  286

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG LS   T  TS PP+NAT VAN+FV +LRSLNS  YPA+
Sbjct  287   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANSFVKSLRSLNSNTYPAK  346

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP TVDH L FTVGLG+N C SCK  N SRVVA++NN+TF MPT ALLQAH+FN  GV+T
Sbjct  347   VPVTVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPTTALLQAHYFNQTGVYT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPG P   F++TG  P+NL T   TK+Y+LPYNATVQ+VLQDTG +APENHP+HLHGF
Sbjct  407   TDFPGRPRRVFDFTGKPPSNLATMKATKLYKLPYNATVQVVLQDTGNVAPENHPIHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFFVVGLGSGNYNSKRDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLVDNGKGPN+S
Sbjct  527   HTTWGLKMAFLVDNGKGPNQS  547



>ref|XP_002873023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49282.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/441 (73%), Positives = 378/441 (86%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWW
Sbjct  108   HSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE V+NEA+KSGLAPNVSDAH INGHPG V NCPSQG +KL+V+ GK+YMLR+INAA
Sbjct  168   KSDTETVVNEALKSGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +NEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SG+Y++AA+PF
Sbjct  228   MNEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPF  287

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG LS   T  TS PP+NAT VAN F+++LRSLNSK YPA+
Sbjct  288   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANTFINSLRSLNSKTYPAK  347

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP TVDH L FTVGLG+N C SCK  N SRVVA++NN+TF MP  ALLQAH+FN+ G++T
Sbjct  348   VPITVDHDLLFTVGLGVNRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYT  407

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPG P   F++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHGF
Sbjct  408   TDFPGKPRRFFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGF  467

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  468   NFFVVGLGTGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEV  527

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLV+NGKGPN+S
Sbjct  528   HTTWGLKMAFLVENGKGPNQS  548



>ref|XP_009590412.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/440 (71%), Positives = 373/440 (85%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ W R+TVHGA+VILPK  VPYPFPKP+ E +++L EWW
Sbjct  109   QSYLYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRRVPYPFPKPEKEEIIILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              SD EAVIN+A+K G+APNVSDAHTINGHPGP  NC S+G Y L V+ GK+Y+LR+INAA
Sbjct  169   SSDVEAVINQAMKMGVAPNVSDAHTINGHPGPAPNCSSKG-YTLHVESGKTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH +TVVEVDA+YVKPFKT+TI IAPGQTTN I+TA+Q +GKY++A SPF
Sbjct  228   LNEELFFKIAGHNLTVVEVDASYVKPFKTDTIFIAPGQTTNAILTADQSAGKYLIAVSPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +A DN TAT T+HY G  +   T LT+ P +NATPV N FVD+LRSLNSK+YPA V
Sbjct  288   MDTIVATDNLTATGTVHYLGTDALSPTALTTIPSRNATPVTNIFVDSLRSLNSKKYPANV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DHSL  T+G+G+NPC +C+  NGSRVVA++NNVTFVMPT A+LQAH++NI GV+T 
Sbjct  348   PLTIDHSLLLTMGIGVNPCATCQ--NGSRVVAAINNVTFVMPTTAILQAHYYNISGVYTA  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNP + FNYTG  P NLQT  GTKVY++ +N+TVQ+VLQ T IIAPE+HP HLHGFN
Sbjct  406   DFPGNPSIPFNYTGTPPTNLQTQNGTKVYKVEFNSTVQVVLQGTSIIAPESHPTHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GN++PK DP KFNLVDPVERNT+ VP+ GW AIRFRADNPGVWFMHCHLEVH
Sbjct  466   FFVVGKGVGNYDPKNDPKKFNLVDPVERNTMSVPTAGWTAIRFRADNPGVWFMHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKM FLV+NGKGPN+S
Sbjct  526   TTWGLKMGFLVENGKGPNQS  545



>ref|XP_009125430.1| PREDICTED: laccase-10 [Brassica rapa]
Length=559

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/441 (73%), Positives = 375/441 (85%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SY+YNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPK G+PYPFPKP  E V+VL EWW
Sbjct  108   HSYMYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAH INGHPG V NCPSQG +KL+V+ GK+YMLR++NAA
Sbjct  168   KSDTENVINEALKSGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +NEELFFKIAGH+ T+VEVDA YVKPF T+TI+IAPGQTT  +V+A + SGKY++AA+PF
Sbjct  228   MNEELFFKIAGHRFTIVEVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGKYLIAAAPF  287

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG LS   T  TS P +NAT VAN+FV++LRSLNS  YPA+
Sbjct  288   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPAQNATSVANSFVNSLRSLNSVTYPAK  347

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DH L FTVGLG+N C SCK  N SRVVA++NN+TF MP  ALLQAH+FN+ G++T
Sbjct  348   VPIKIDHDLLFTVGLGINRCHSCKAGNLSRVVAAINNITFKMPKTALLQAHYFNLTGIYT  407

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFP  P   F++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHGF
Sbjct  408   TDFPAKPHHVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGF  467

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  468   NFFVVGIGSGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEV  527

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLV+NGKGPN+S
Sbjct  528   HTTWGLKMAFLVENGKGPNQS  548



>sp|Q0IQU1.2|LAC22_ORYSJ RecName: Full=Laccase-22; AltName: Full=Benzenediol:oxygen oxidoreductase 
22; AltName: Full=Diphenol oxidase 22; AltName: 
Full=Urishiol oxidase 22; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAX95423.1| laccase (EC 1.10.3.2) precursor - common tobacco [Oryza sativa 
Japonica Group]
 gb|ABA95532.1| Multicopper oxidase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ19339.1| hypothetical protein OsJ_34890 [Oryza sativa Japonica Group]
Length=564

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/442 (70%), Positives = 379/442 (86%), Gaps = 5/442 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             S++YNFTITGQRGTL WHAH+ WLR+TVHGA+VILPKLGVPYPFP P  EAV+VL EWWK
Sbjct  114   SFLYNFTITGQRGTLLWHAHINWLRATVHGAIVILPKLGVPYPFPAPHKEAVIVLGEWWK  173

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNC-PSQGGYKLSVDPGKSYMLRVINAA  1200
              DTE VIN+A++ G+ PN+SD+HTINGHPGP++ C  SQ G+KLSV+ GK+YMLR+INAA
Sbjct  174   EDTETVINQAMQLGVGPNISDSHTINGHPGPLSECASSQDGFKLSVENGKTYMLRIINAA  233

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFFK+AGH++TVVEVDA Y KPFKT+T++I PGQTTNV+V ANQG+G+Y+++ SPF
Sbjct  234   LNDDLFFKVAGHELTVVEVDAVYTKPFKTDTLLITPGQTTNVLVRANQGAGRYLLSVSPF  293

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLT--STPPKNATPVANNFVDALRSLNSKQYPA  846
             MDAP+ VDN+T TATLHY+  +S     LT    PP+NAT + + F D+L SLNSK+YPA
Sbjct  294   MDAPVQVDNKTGTATLHYANTVSSSMASLTLVKPPPQNATHIVSKFTDSLHSLNSKEYPA  353

Query  845   RVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVF  666
              VPQTVDHSL  TVG+G+NPCPSC   NG+RVV ++NNVTF+MP+  +LQAH++NI GVF
Sbjct  354   NVPQTVDHSLLLTVGVGVNPCPSC--INGTRVVGTINNVTFIMPSTPILQAHYYNIPGVF  411

Query  665   TTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             T DFP  P   FNYTG+GP NLQT  GT+VYRLPYNA+VQ+VLQDTGII+PE+HP+HLHG
Sbjct  412   TEDFPATPLHKFNYTGSGPKNLQTMNGTRVYRLPYNASVQVVLQDTGIISPESHPIHLHG  471

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFF VG+G+GN+NP+T P+ FNL+DP+ERNTIGVP+GGW AIRFR+DNPGVWFMHCH E
Sbjct  472   FNFFVVGKGVGNYNPRTSPSTFNLIDPIERNTIGVPTGGWTAIRFRSDNPGVWFMHCHFE  531

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHT+WGLKMAF+VDNGK P+E+
Sbjct  532   VHTSWGLKMAFVVDNGKRPSET  553



>ref|XP_010452014.1| PREDICTED: laccase-10 isoform X1 [Camelina sativa]
 ref|XP_010452015.1| PREDICTED: laccase-10 isoform X2 [Camelina sativa]
Length=559

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/441 (74%), Positives = 377/441 (85%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWW
Sbjct  108   HSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE V+NEA+KSGLAPNVSDAH INGHPG V NCPSQG +KL+V+ GK+YMLR+INAA
Sbjct  168   KSDTEMVVNEALKSGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SG+Y++AA+PF
Sbjct  228   LNEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPF  287

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG LS   T  TS PP+NAT VAN+FV++LRSLNS  YPA 
Sbjct  288   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSNTYPAN  347

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  VDH L FTVGLG+N C SCK  N SRVVA++NN+TF MPT ALLQAH+FN+ GV+T
Sbjct  348   VPINVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPTTALLQAHYFNLTGVYT  407

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPG P   F++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHGF
Sbjct  408   TDFPGKPRRFFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGF  467

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  468   NFFVVGLGTGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEV  527

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLV+NGKGPN+S
Sbjct  528   HTTWGLKMAFLVENGKGPNQS  548



>ref|XP_008233715.1| PREDICTED: laccase-4-like [Prunus mume]
Length=558

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/440 (70%), Positives = 373/440 (85%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+++YNFT+TGQRGTL WHAH  WLR+T+HGA+VILPK G PYPFP PD E  V+LAEWW
Sbjct  110   QNFIYNFTLTGQRGTLLWHAHTSWLRATLHGAIVILPKRGTPYPFPTPDEEKTVILAEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV+N++IKSGL PNVSDAHTINGH GPV  C SQGGY L V+ GK+Y+LR+INAA
Sbjct  170   KSDVEAVVNQSIKSGLPPNVSDAHTINGHAGPVPGCSSQGGYTLHVESGKTYLLRIINAA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFFKIAGH +TVVEVDA+Y KPF+T+TI I+PGQTTN I+TAN+  GKY++AASPF
Sbjct  230   LNDDLFFKIAGHNLTVVEVDASYTKPFQTDTIFISPGQTTNAILTANRRIGKYLIAASPF  289

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+  DN T+ A+L Y G  +  +  LTS PP+NATPV N F+D+LRSLNSKQYPA V
Sbjct  290   MDAPVGFDNLTSIASLRYKGTPANPKAFLTSIPPQNATPVTNTFMDSLRSLNSKQYPANV  349

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DHSLFFT+ +G+NPC +C   NGS++VA+ NNV+FVMPT+ALLQA+++NIKGV+T 
Sbjct  350   PLTIDHSLFFTIAVGVNPCATC--VNGSKLVAAFNNVSFVMPTIALLQAYYYNIKGVYTL  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP+ FNYTG   AN+QTT GT++YRL YN+TVQ+VLQ T +IAPE+HP HLHGFN
Sbjct  408   DFPANPPIPFNYTGNTTANMQTTNGTRLYRLGYNSTVQIVLQGTAVIAPESHPTHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+GIGNF+P  DP  FNLVDPVERNTI VP+GGW AIRFRADNPG+WF+HCHLEVH
Sbjct  468   FFVVGKGIGNFDPTKDPKTFNLVDPVERNTISVPTGGWTAIRFRADNPGIWFLHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKM FLV+NGKG NE+
Sbjct  528   TTWGLKMPFLVENGKGANET  547



>emb|CDP14064.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/440 (70%), Positives = 369/440 (84%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY YNFT+TGQRGTL WH HV WLR+TVHGA+VILPK GVPYPFPKPD E ++VL EWW
Sbjct  108   QSYTYNFTLTGQRGTLLWHGHVNWLRATVHGAIVILPKRGVPYPFPKPDKEEIIVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVIN++++ G APNVSDAHTING PGP  NC S  GY L V+ GK+Y+LR++NA 
Sbjct  168   KSDVEAVINQSLQVGRAPNVSDAHTINGLPGPAPNC-SSNGYTLHVESGKTYLLRIVNAG  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGHQ+T+VEVDA+YVKPFKT+TI I PGQTTN I+TA+Q +GKY++A SPF
Sbjct  227   LNEELFFKIAGHQLTIVEVDASYVKPFKTDTIFIGPGQTTNAILTADQDAGKYLIAISPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +A DNQTAT  + Y    +   T LT+ PP+NATPV N+F+++LRSLNSK+YP +V
Sbjct  287   MDTTVATDNQTATGVIRYKSTTAFSPTALTTIPPRNATPVTNSFMESLRSLNSKEYPTKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSL FT+G+G+NPC +C+  NGSRVVA++NNVTFV+PT ALLQAH++ I GV+T 
Sbjct  347   PLEIDHSLLFTIGIGINPCATCQ--NGSRVVAAINNVTFVLPTTALLQAHYYGISGVYTE  404

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  +NYTG  P N+QTT GTKVY+L +N+TVQ+V+Q   I+APE+HP HLHGFN
Sbjct  405   DFPGNPPTPYNYTGTPPTNIQTTNGTKVYKLAFNSTVQVVIQGNSIVAPESHPTHLHGFN  464

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GNFNP TDP KFNLVDPVERNTI VP+GGW  IRFRADNPG+WFMHCHLEVH
Sbjct  465   FFVVGKGLGNFNPNTDPKKFNLVDPVERNTISVPTGGWTVIRFRADNPGIWFMHCHLEVH  524

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NG GPNES
Sbjct  525   TTWGLKMAFLVENGNGPNES  544



>emb|CDY48114.1| BnaC02g03710D [Brassica napus]
Length=559

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/442 (74%), Positives = 378/442 (86%), Gaps = 2/442 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPKLG+PYPFPKP  E V+VL EWW
Sbjct  107   HSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKLGLPYPFPKPHREEVIVLGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGG-YKLSVDPGKSYMLRVINA  1203
             KSDTE VINEA+KSGLAPNVSDAH INGHPG V NCPSQG  +KL+V+ GK+YMLR++NA
Sbjct  167   KSDTENVINEALKSGLAPNVSDAHVINGHPGLVPNCPSQGSNFKLAVESGKTYMLRLVNA  226

Query  1202  ALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASP  1023
             A+NEELFFKIAGH+ T+VEVDA YVKPF T+TI+IAPGQTT  +V+A + SGKY++AA+P
Sbjct  227   AMNEELFFKIAGHRFTIVEVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGKYLIAAAP  286

Query  1022  FMD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPA  846
             F D A +AVDN+TATAT+HYSG LS   T  TS PP+NAT VAN+FV++LRSLNS  YPA
Sbjct  287   FQDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSATYPA  346

Query  845   RVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVF  666
             +VP TVDH L FTVGLG+N C SCK  N SRVVA++NN+TF MP  ALLQAH+FN+ G++
Sbjct  347   KVPTTVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIY  406

Query  665   TTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             TTDFP  P   F++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHG
Sbjct  407   TTDFPAKPHHVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHG  466

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLE
Sbjct  467   FNFFVVGIGSGNYNSKKDAKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLE  526

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAFLV+NGKGPN+S
Sbjct  527   VHTTWGLKMAFLVENGKGPNQS  548



>gb|EPS65618.1| hypothetical protein M569_09159, partial [Genlisea aurea]
Length=539

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/441 (73%), Positives = 362/441 (82%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFTI GQRGTL WHAH+ WLR+TVHG LV+LPK G PYPF KPDHE VVVL EWW
Sbjct  88    HSYVYNFTIAGQRGTLLWHAHISWLRATVHGGLVVLPKAGAPYPFTKPDHERVVVLGEWW  147

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTEAV+N+A  SGLAPN+SDAHTING PG  +NC S GG+ L V PGK YMLR+INAA
Sbjct  148   KSDTEAVVNQATTSGLAPNISDAHTINGQPGLRSNCASSGGFTLGVSPGKRYMLRLINAA  207

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH+MTVVEVDA YVKPF T+T+++ PGQTTNVI++A QGSGKYMVA SPF
Sbjct  208   LNDELFFKIAGHEMTVVEVDAVYVKPFTTHTVLLTPGQTTNVIISATQGSGKYMVAVSPF  267

Query  1019  MDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD P +AVDN TATATL Y G L+   T     P +NAT +A  F  +LRSLNS ++PA 
Sbjct  268   MDNPSLAVDNITATATLQYYGTLTDSPTAPARPPSQNATTIAEAFASSLRSLNSARFPAL  327

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  VDHSL FTVGLG+NPC +C+  NGSRVVASVNNVTF MPT ++LQAH++ I GVFT
Sbjct  328   VPLKVDHSLLFTVGLGINPCATCRAGNGSRVVASVNNVTFAMPTTSILQAHYYKIAGVFT  387

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPG P   FNYTGA   N+ T TGTKVY+L YN+TVQ+VLQ TGIIAPE+HP HLHGF
Sbjct  388   ADFPGKPLNPFNYTGAYKGNMATVTGTKVYKLAYNSTVQVVLQGTGIIAPESHPFHLHGF  447

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFFAVG G GNFNP  DP +FNLVDPVERNT+ VP+GGWVAIRFRADNPGVWFMHCHLEV
Sbjct  448   NFFAVGSGKGNFNPNLDPARFNLVDPVERNTVAVPNGGWVAIRFRADNPGVWFMHCHLEV  507

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKM FLV+NG GPN+S
Sbjct  508   HTTWGLKMVFLVENGNGPNQS  528



>ref|XP_010490598.1| PREDICTED: laccase-10-like isoform X1 [Camelina sativa]
 ref|XP_010490599.1| PREDICTED: laccase-10-like isoform X2 [Camelina sativa]
Length=558

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/441 (74%), Positives = 376/441 (85%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWW
Sbjct  107   HSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE VINEA+KSGLAPNVSDAH INGHPG V NCPSQG +KL+V+ GK+YMLR+INAA
Sbjct  167   KSDTEMVINEALKSGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SG+Y++AA+PF
Sbjct  227   LNEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPF  286

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG LS   T  TS PP+NAT VAN+FV++LRSLNS  YPA 
Sbjct  287   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSNTYPAN  346

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  VDH L FTVGLG+N C SCK  N SRVVA++NN+TF MPT ALLQAH+FN+ GV+T
Sbjct  347   VPINVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPTTALLQAHYFNLTGVYT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPG P   F++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHGF
Sbjct  407   TDFPGKPRRFFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G GN+  K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFFVVGLGTGNYISKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLV+NGKGPN+S
Sbjct  527   HTTWGLKMAFLVENGKGPNQS  547



>ref|XP_010423919.1| PREDICTED: laccase-10-like [Camelina sativa]
Length=558

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/441 (73%), Positives = 376/441 (85%), Gaps = 1/441 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPK G+PYPFPKP  E V++L EWW
Sbjct  107   HSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIILGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE V+NEA+KSGLAPNVSDAH INGHPG V NCPSQG +KL+V+ GK+YMLR+INAA
Sbjct  167   KSDTEMVVNEALKSGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SG+Y++AA+PF
Sbjct  227   LNEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPF  286

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG LS   T  TS PP+NAT VAN+FV++LRSLNS  YPA 
Sbjct  287   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANSFVNSLRSLNSNTYPAN  346

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  VDH L FTVGLG+N C SCK  N SRVVA++NN+TF MPT ALL+AH+FN+ GV+T
Sbjct  347   VPINVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPTTALLEAHYFNLTGVYT  406

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPG P   F++ G  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHGF
Sbjct  407   TDFPGKPRRFFDFNGKPPSNLSTMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGF  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  467   NFFVVGLGTGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEV  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLV+NGKGPN+S
Sbjct  527   HTTWGLKMAFLVENGKGPNQS  547



>emb|CDY55905.1| BnaAnng13970D [Brassica napus]
Length=563

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/445 (72%), Positives = 375/445 (84%), Gaps = 5/445 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SY+YNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPK G+PYPFPKP  E V+VL EWW
Sbjct  108   HSYMYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKPGLPYPFPKPHREEVIVLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGG----YKLSVDPGKSYMLRV  1212
             KSDTE VINEA+KSGLAPNVSDAH INGHPG V NCPSQG     +KL+V+ GK+YMLR+
Sbjct  168   KSDTENVINEALKSGLAPNVSDAHVINGHPGLVPNCPSQGSLSCNFKLAVESGKTYMLRL  227

Query  1211  INAALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVA  1032
             +NAA+NEELFFKIAGH+ T+VEVDA YVKPF T+TI+IAPGQTT  +V+A + SGKY++A
Sbjct  228   VNAAMNEELFFKIAGHRFTIVEVDAVYVKPFTTDTILIAPGQTTTALVSAARPSGKYLIA  287

Query  1031  ASPFMD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQ  855
             A+PF D A +AVDN+TATAT+HYSG LS   T  TS P +NAT VAN+FV++LRSLNS  
Sbjct  288   AAPFQDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPAQNATSVANSFVNSLRSLNSVT  347

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPA+VP  +DH L FTVGLG+N C SCK  N SRVVA++NN+TF MP  ALLQAH+FN+ 
Sbjct  348   YPAKVPIKIDHDLLFTVGLGINRCHSCKAGNLSRVVAAINNITFKMPKTALLQAHYFNLT  407

Query  674   GVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVH  495
             G++TTDFP  P   F++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+H
Sbjct  408   GIYTTDFPAKPHHVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIH  467

Query  494   LHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHC  315
             LHGFNFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHC
Sbjct  468   LHGFNFFVVGIGSGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHC  527

Query  314   HLEVHTTWGLKMAFLVDNGKGPNES  240
             HLEVHTTWGLKMAFLV+NGKGPN+S
Sbjct  528   HLEVHTTWGLKMAFLVENGKGPNQS  552



>gb|KCW52562.1| hypothetical protein EUGRSUZ_J01941, partial [Eucalyptus grandis]
Length=524

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/440 (73%), Positives = 368/440 (84%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YNFTITGQRGTL WHAH+LWLR+TVHGALVILPK GVPYPFPKP  E V+VLAEWW
Sbjct  77    QIYTYNFTITGQRGTLLWHAHILWLRATVHGALVILPKRGVPYPFPKPHKEKVIVLAEWW  136

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVI EAIKSG APNVSDAHTIN HPGPV NCP +GGY+L+V PGK+YMLR+INAA
Sbjct  137   KSDVEAVIGEAIKSGGAPNVSDAHTINSHPGPVANCP-KGGYELAVRPGKTYMLRIINAA  195

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA HQ+TVVEVDA YVKP +T+ I++ PGQTT  ++ A   +GKY++  SPF
Sbjct  196   LNEELFFKIARHQLTVVEVDAAYVKPLRTDAILVGPGQTTTALLMAYHTTGKYLMIVSPF  255

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP++VDN TATAT+ Y+G  +    V  + P  NAT VA  FV +LRSLN+  YPARV
Sbjct  256   MDAPVSVDNVTATATVRYAGTPAASPAVPIAPPSPNATWVAEGFVGSLRSLNTGAYPARV  315

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSLFFTVG+G+NPC +C  A+G RVVA  NN++FVMP  ALL AH++ + GVFT 
Sbjct  316   PLEIDHSLFFTVGIGVNPCATC--ASGFRVVADFNNISFVMPKTALLSAHYYKMTGVFTD  373

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  P + FNYTGA P NL T TGT++YRL YN+TVQLVLQDTG++APENHP+HLHGFN
Sbjct  374   DFPAKPMIRFNYTGAQPVNLNTMTGTRLYRLRYNSTVQLVLQDTGMVAPENHPIHLHGFN  433

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRGIGNF+P TDP KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  434   FFAVGRGIGNFDPITDPRKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHLEVH  493

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VD+G+GP++S
Sbjct  494   TTWGLKMAFVVDDGEGPDQS  513



>ref|XP_011084946.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=555

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/440 (70%), Positives = 367/440 (83%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ W R+TVHGA+VILPK GVPYPFPKPD E +++  EWW
Sbjct  108   QSYIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEIIIFGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVIN+A+K G  PNVSDAHTING PGP  NC SQG Y L V+ GK+Y+LR++NAA
Sbjct  168   KSDVEAVINQAMKLGQPPNVSDAHTINGLPGPAPNCSSQG-YTLQVETGKTYLLRIVNAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +NEELFFKIAGHQ+T+VEVDA+Y KPFKT+TI I PGQTTN ++TA+Q  G Y++A SPF
Sbjct  227   VNEELFFKIAGHQLTIVEVDASYTKPFKTDTIFIGPGQTTNALLTADQKIGNYLIAISPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +A+DNQTA  TL Y+G L+   T LT+ PP+NATP+   F+D+LRSLNSK+YPA V
Sbjct  287   MDTIVAIDNQTAMGTLRYNGMLAVSSTTLTAMPPQNATPITTKFMDSLRSLNSKEYPANV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQTVDHSL F +G+ +NPC +C   NGSRV+A +NNV+FVMPT A+LQAH++NI GV+T 
Sbjct  347   PQTVDHSLMFAIGVAVNPCATC--VNGSRVMADINNVSFVMPTTAILQAHYYNISGVYTD  404

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  +NYTG  P ++QT  GTKVYRL YN+TVQLVLQ T IIAPE+HP HLHGFN
Sbjct  405   DFPANPPNPYNYTGTPPTSIQTNNGTKVYRLAYNSTVQLVLQGTSIIAPESHPTHLHGFN  464

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             F+ VG+G+GN++PK DP  FNLVDPVERNTI VP+ GW AIRFRADNPGVWFMHCHLEVH
Sbjct  465   FYVVGKGLGNYDPKNDPKNFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFMHCHLEVH  524

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPN+S
Sbjct  525   TTWGLKMAFLVENGKGPNQS  544



>ref|XP_010033027.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
Length=553

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/440 (73%), Positives = 368/440 (84%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q Y YNFTITGQRGTL WHAH+LWLR+TVHGALVILPK GVPYPFPKP  E V+VLAEWW
Sbjct  106   QIYTYNFTITGQRGTLLWHAHILWLRATVHGALVILPKRGVPYPFPKPHKEKVIVLAEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVI EAIKSG APNVSDAHTIN HPGPV NCP +GGY+L+V PGK+YMLR+INAA
Sbjct  166   KSDVEAVIGEAIKSGGAPNVSDAHTINSHPGPVANCP-KGGYELAVRPGKTYMLRIINAA  224

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA HQ+TVVEVDA YVKP +T+ I++ PGQTT  ++ A   +GKY++  SPF
Sbjct  225   LNEELFFKIARHQLTVVEVDAAYVKPLRTDAILVGPGQTTTALLMAYHTTGKYLMIVSPF  284

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP++VDN TATAT+ Y+G  +    V  + P  NAT VA  FV +LRSLN+  YPARV
Sbjct  285   MDAPVSVDNVTATATVRYAGTPAASPAVPIAPPSPNATWVAEGFVGSLRSLNTGAYPARV  344

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DHSLFFTVG+G+NPC +C  A+G RVVA  NN++FVMP  ALL AH++ + GVFT 
Sbjct  345   PLEIDHSLFFTVGIGVNPCATC--ASGFRVVADFNNISFVMPKTALLSAHYYKMTGVFTD  402

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  P + FNYTGA P NL T TGT++YRL YN+TVQLVLQDTG++APENHP+HLHGFN
Sbjct  403   DFPAKPMIRFNYTGAQPVNLNTMTGTRLYRLRYNSTVQLVLQDTGMVAPENHPIHLHGFN  462

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRGIGNF+P TDP KFNLVDPVERNTIGVPSGGW AIRFRADNPGVWFMHCHLEVH
Sbjct  463   FFAVGRGIGNFDPITDPRKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHLEVH  522

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VD+G+GP++S
Sbjct  523   TTWGLKMAFVVDDGEGPDQS  542



>ref|XP_009120399.1| PREDICTED: laccase-16 [Brassica rapa]
Length=565

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/445 (72%), Positives = 371/445 (83%), Gaps = 7/445 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VLAEWW
Sbjct  112   QNYLYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLAEWW  171

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +INEA K+G APN SDAHTINGH GP++NCPSQ GY L V PGK+YMLR+INAA
Sbjct  172   KSDVEQLINEATKNGTAPNASDAHTINGHSGPISNCPSQSGYGLPVRPGKTYMLRIINAA  231

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSG-KYMVAASP  1023
             LNEELFFKIAGH++TVVEVDA Y KP+KT+T++IAPGQTTNV++TAN  +G KYMVAA+ 
Sbjct  232   LNEELFFKIAGHKLTVVEVDAVYTKPYKTDTVLIAPGQTTNVLLTANANTGSKYMVAATT  291

Query  1022  FMDAPIAVDNQTATATLHYSG--ALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
             FMDAPI+ DN TATATLHY G    S  +TVL S P  NAT VA+ F+ +LRSLNS++YP
Sbjct  292   FMDAPISFDNVTATATLHYIGHTVSSSKKTVLASLPQPNATLVASKFIKSLRSLNSREYP  351

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A+VP TVDHSLFFTVGLG NPCPSC   NG R+VA +NNVTF MP  ALLQAH+FNI  V
Sbjct  352   AKVPTTVDHSLFFTVGLGANPCPSCN--NGFRLVAGINNVTFTMPETALLQAHYFNISHV  409

Query  668   FTTDFPGNPPVAFNYTG--AGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVH  495
             FT DFP  P   FNYT       N  T TGTK+YRLPYNATVQ++LQ+T +I  ENHP H
Sbjct  410   FTDDFPAKPSNPFNYTAPVDQSVNAATMTGTKLYRLPYNATVQIILQNTAMILSENHPFH  469

Query  494   LHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHC  315
             LHGFNFF VGRG+GNFNP+ DP +FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFMHC
Sbjct  470   LHGFNFFEVGRGLGNFNPEKDPKRFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHC  529

Query  314   HLEVHTTWGLKMAFLVDNGKGPNES  240
             HLE+HTTWGLKMAF+VDNG GP++S
Sbjct  530   HLEIHTTWGLKMAFVVDNGHGPDQS  554



>ref|XP_009416212.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=562

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/445 (72%), Positives = 382/445 (86%), Gaps = 7/445 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPF-PKPDHEAVVVLAEW  1383
             QSYVYNFT+ GQRGTL WHAH+ W R+TVHGA+VILPK GV YPF P P  E V+VLAEW
Sbjct  109   QSYVYNFTLAGQRGTLLWHAHISWQRATVHGAIVILPKRGVAYPFFPTPHKEVVLVLAEW  168

Query  1382  WKSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPS--QGGYKLSVDPGKSYMLRVI  1209
             W+SD EAVI+EA+ SG APNVSDAHTINGH GPV+ C S  Q G  + VD GK+Y+ R+I
Sbjct  169   WRSDVEAVIDEAMNSGRAPNVSDAHTINGHAGPVSGCASSAQDGLTVRVDKGKTYLFRII  228

Query  1208  NAALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAA  1029
             NAALNE+LFFK+AGHQ+TVVEVDATY KPF T+T++I PGQTTNV++TA+QG+G+Y+VAA
Sbjct  229   NAALNEDLFFKVAGHQLTVVEVDATYTKPFTTDTLLITPGQTTNVLLTADQGAGRYLVAA  288

Query  1028  SPFMDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPP-KNATPVANNFVDALRSLNSKQ  855
             SPF D+P +AVDN+TATAT+ Y+ ++S    V T+ PP +NATPVA++FVD LRSLNSKQ
Sbjct  289   SPFADSPLVAVDNRTATATVQYASSVSASAVVTTTKPPPQNATPVASSFVDTLRSLNSKQ  348

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPA+VP  VD SL FTVGLG+NPC +C   NGSRVVA +NNVTFVMPT ALLQAH+FN  
Sbjct  349   YPAKVPLMVDRSLLFTVGLGVNPCATC--TNGSRVVADINNVTFVMPTTALLQAHYFNTS  406

Query  674   GVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVH  495
             GVFT DFPG PP+AFNYTG+GP+N+QT  GT++YRL +NA+VQLVLQDTG+I PE+HP+H
Sbjct  407   GVFTDDFPGQPPIAFNYTGSGPSNMQTMNGTRLYRLSFNASVQLVLQDTGVIGPESHPIH  466

Query  494   LHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHC  315
             LHG+NFF VGRG+GN++PKT P+KFNLVDPVERNTIGVP+GGW AIRFRADNPGVWF+HC
Sbjct  467   LHGYNFFVVGRGVGNYDPKTSPSKFNLVDPVERNTIGVPTGGWTAIRFRADNPGVWFLHC  526

Query  314   HLEVHTTWGLKMAFLVDNGKGPNES  240
             H EVHT+WGLKMAF+VD+GKG NES
Sbjct  527   HFEVHTSWGLKMAFVVDDGKGTNES  551



>gb|KFK44563.1| hypothetical protein AALP_AA1G273400 [Arabis alpina]
Length=556

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/441 (73%), Positives = 377/441 (85%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              +YVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPKL  PYPFPKP  E V++L EWW
Sbjct  107   HNYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKL--PYPFPKPHREEVIILGEWW  164

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              SDTEAV+NEA++SGLAPNVSDAH INGHPG V NCPSQG +KL+V+ GK+YMLR+INAA
Sbjct  165   ISDTEAVVNEALRSGLAPNVSDAHVINGHPGLVPNCPSQGNFKLAVESGKTYMLRLINAA  224

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SG+Y++AA+PF
Sbjct  225   LNEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPF  284

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG LS   T  TS PP+NAT VAN FV++LRSLNS  YPA+
Sbjct  285   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSNTYPAK  344

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP T+DH L FTVGLG+N C SCK  N SRVVA++NN+TF MPT  LLQAH+FN+ GV+T
Sbjct  345   VPITIDHDLLFTVGLGINRCHSCKKGNFSRVVAAINNITFKMPTTGLLQAHYFNLTGVYT  404

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFPG P   +++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHGF
Sbjct  405   TDFPGKPRRFYDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGF  464

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG GIGN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  465   NFFVVGFGIGNYNSKKDSKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFMHCHLEV  524

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLV+NGKGPN+S
Sbjct  525   HTTWGLKMAFLVENGKGPNQS  545



>ref|XP_009350996.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/440 (69%), Positives = 370/440 (84%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+TGQRGTL WHAH  WLR+T+HGA+VILPK   PYPFP PD E ++++AEWW
Sbjct  110   QNYIYNFTLTGQRGTLLWHAHDSWLRATLHGAIVILPKRSTPYPFPTPDEEKIIIMAEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E VIN+A +SGL PNVSDAHTING  GP+  C SQGGY L V+ GK+YMLR++NAA
Sbjct  170   KSDVEDVINQATQSGLPPNVSDAHTINGRVGPLPGCSSQGGYTLHVENGKTYMLRIVNAA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +N+ELFFK+AGH +TVVEVDA+Y KPF+T+TI   PGQTTNVI+TANQG GKY + ASPF
Sbjct  230   INDELFFKVAGHNLTVVEVDASYTKPFQTDTIYTGPGQTTNVILTANQGIGKYFITASPF  289

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI  DN T  ATL Y G  +    +LTS PP+NATP+ + FVD+LRSLNSKQYPA V
Sbjct  290   MDAPIGFDNATVIATLRYKGTPANPTAILTSIPPRNATPLTDAFVDSLRSLNSKQYPADV  349

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DHSLFFT+ +G NPC +C   +GS++V+++NNV+FVMP+++LLQA+++N+KGV+T 
Sbjct  350   PLTIDHSLFFTISVGANPCAAC--VSGSKLVSAINNVSFVMPSISLLQAYYYNVKGVYTL  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP+ FNYTG  PANLQTT GT++YRL YN+TVQ+VLQ T IIAPE+HP HLHGFN
Sbjct  408   DFPANPPIPFNYTGTSPANLQTTNGTRLYRLEYNSTVQIVLQGTAIIAPESHPTHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GNF+PK DP KFNLVDPVERNT+ VP+ GW AIRFRA+NPG+WF+HCHLEVH
Sbjct  468   FFVVGKGLGNFDPKKDPEKFNLVDPVERNTVSVPTAGWTAIRFRANNPGIWFLHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLKMAFLV+NG+G NES
Sbjct  528   TSWGLKMAFLVENGEGQNES  547



>emb|CAB69847.1| laccase-like protein [Arabidopsis thaliana]
Length=553

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/441 (73%), Positives = 373/441 (85%), Gaps = 6/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SYVYNFT+TGQRGTL+WHAHVLWLR+TVHGA+VILPKLG+PYPFPKP  E V++L EWW
Sbjct  107   HSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKLGLPYPFPKPHREEVIILGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSDTE V+NEA+KSGLAPNVSDAH INGHPG V NCPSQ     +V+ GK+YMLR+INAA
Sbjct  167   KSDTETVVNEALKSGLAPNVSDAHVINGHPGFVPNCPSQ-----AVESGKTYMLRLINAA  221

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH+ TVVEVDA YVKPF T+TI+IAPGQTT  +V+A + SG+Y++AA+PF
Sbjct  222   LNEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPF  281

Query  1019  MD-APIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
              D A +AVDN+TATAT+HYSG LS   T  TS PP+NAT VAN FV++LRSLNSK YPA 
Sbjct  282   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSKTYPAN  341

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP TVDH L FTVGLG+N C SCK  N SRVVA++NN+TF MP  ALLQAH+FN+ G++T
Sbjct  342   VPITVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGIYT  401

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFP  P   F++TG  P+NL T   TK+Y+LPYN+TVQ+VLQDTG +APENHP+HLHGF
Sbjct  402   TDFPAKPRRVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGF  461

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G GN+N K D  KFNLVDPVERNT+GVPSGGW AIRFRADNPGVWFMHCHLEV
Sbjct  462   NFFVVGLGTGNYNSKKDSNKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHCHLEV  521

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAFLV+NGKGPN+S
Sbjct  522   HTTWGLKMAFLVENGKGPNQS  542



>ref|XP_008392913.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/440 (68%), Positives = 368/440 (84%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             ++Y+YNFT+TGQRGTL WHAH  WLR+T+HGA+VILPK G PYPFP PD E ++++AEWW
Sbjct  110   RNYIYNFTLTGQRGTLLWHAHDSWLRATLHGAIVILPKRGTPYPFPTPDEEKIIIMAEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E VIN+A +SGL PNVSDAHTING  GP+  C SQGGY L V+  K+YMLR++NAA
Sbjct  170   KSDVEDVINQATQSGLPPNVSDAHTINGRVGPLPGCSSQGGYTLHVESDKTYMLRIVNAA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFK+AGH +TVVEVDA+Y KPF+T+TI   PGQTTN I+TANQG GKY + ASPF
Sbjct  230   LNDELFFKVAGHSLTVVEVDASYTKPFQTDTIYTGPGQTTNAILTANQGIGKYFITASPF  289

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI  DN T  ATL Y G  +    +LTS PP+NATP+ + FVD+LRSLNSKQYPA V
Sbjct  290   MDAPIGFDNATVIATLRYKGTPANPTAILTSIPPRNATPLTDAFVDSLRSLNSKQYPADV  349

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DHSLFFT+ +G NPC +C   +GS++V++ NNV+FVMP+++LLQA+++N+KGV+T 
Sbjct  350   PLTIDHSLFFTISVGANPCATC--VSGSKLVSAFNNVSFVMPSISLLQAYYYNVKGVYTL  407

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP+ FNYTG  PANLQTT GT++YRL YN+TVQ+VLQ T IIAPE+HP HLHGFN
Sbjct  408   DFPANPPIPFNYTGTSPANLQTTNGTRLYRLEYNSTVQIVLQGTAIIAPESHPTHLHGFN  467

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GNF+PK DP KFNLVDPVERNT+ VP+ GW AIRFRA+NPG+WF+HCHLEVH
Sbjct  468   FFVVGKGLGNFDPKKDPGKFNLVDPVERNTVSVPTAGWTAIRFRANNPGIWFLHCHLEVH  527

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLKMAFLV+NG+G NES
Sbjct  528   TSWGLKMAFLVENGEGQNES  547



>ref|XP_003558760.1| PREDICTED: laccase-22 [Brachypodium distachyon]
Length=561

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/442 (68%), Positives = 378/442 (86%), Gaps = 4/442 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              S++YNFTITGQRGTL WHAH+ WLR+TVHGA+VILPKLGVPYPFP P  EAVVVL EWW
Sbjct  111   SSFLYNFTITGQRGTLLWHAHINWLRATVHGAIVILPKLGVPYPFPAPHKEAVVVLGEWW  170

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNC-PSQGGYKLSVDPGKSYMLRVINA  1203
             K+D E +IN A++ G+ PN+SD+HTINGHPGP+++C  SQ G+KL+V+ GK+YMLR+INA
Sbjct  171   KADIETIINRAMQLGVGPNISDSHTINGHPGPMSDCASSQDGFKLNVESGKTYMLRIINA  230

Query  1202  ALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASP  1023
             ALN++LFFKIAGH++TVVEVDA Y KP+KT+ ++I PGQTTNV++ A+Q +G+Y+++ SP
Sbjct  231   ALNDDLFFKIAGHKLTVVEVDAVYTKPYKTDILLITPGQTTNVLLAADQSAGRYLLSISP  290

Query  1022  FMDAPIAVDNQTATATLHYSGALSGL-RTVLTSTPPKNATPVANNFVDALRSLNSKQYPA  846
             FMDAP+ VDN T TA LHY+  +S   R  L   PP+NAT +A+ F D+LRSLNSK+YPA
Sbjct  291   FMDAPVQVDNTTGTAILHYTNTVSAAARLTLFKPPPQNATLIASKFADSLRSLNSKEYPA  350

Query  845   RVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVF  666
              VP+TVDHSLFFT+G+G+NPCP+C   NG+RVV ++NN+TFVMP+  +LQA+++NI GVF
Sbjct  351   NVPRTVDHSLFFTIGVGVNPCPNC--INGTRVVGTINNLTFVMPSTPILQAYYYNIPGVF  408

Query  665   TTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             T DFP  PP  FNYTG+GP NL+T  GT+VYRLPYNA+VQ++LQDTGII+ E+HP+HLHG
Sbjct  409   TEDFPATPPHKFNYTGSGPKNLRTMNGTRVYRLPYNASVQVILQDTGIISTESHPIHLHG  468

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFF VGRGIGN++PKT P+ FNL+DP+ERNTIGVP+GGW AIRFRADNPGVWFMHCH E
Sbjct  469   FNFFVVGRGIGNYSPKTSPSTFNLIDPIERNTIGVPTGGWTAIRFRADNPGVWFMHCHFE  528

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHT+WGLKM F+V+NGK P+E+
Sbjct  529   VHTSWGLKMVFVVENGKRPSET  550



>emb|CAC14718.1| laccase [Populus trichocarpa]
Length=396

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/382 (82%), Positives = 344/382 (90%), Gaps = 0/382 (0%)
 Frame = -2

Query  1385  WWKSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVIN  1206
             WWKSDTEAVINEA+KSGLAPNVSDAHTINGHPG V+ C SQGG+ L V  GK+YML +IN
Sbjct  1     WWKSDTEAVINEALKSGLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVQSGKTYMLWLIN  60

Query  1205  AALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAAS  1026
             AALNEELFFKIAGH++TVVEVDATYVKPFKT+T++IAPG TTNV+VT N+ + K +VAAS
Sbjct  61    AALNEELFFKIAGHKLTVVEVDATYVKPFKTDTVLIAPGHTTNVLVTTNKNTCKILVAAS  120

Query  1025  PFMDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPA  846
             PFMDAPIAVDN TATATLHYSGALS   T LT  PPKNAT +AN F ++LRSLNSK +PA
Sbjct  121   PFMDAPIAVDNMTATATLHYSGALSNSPTTLTIPPPKNATAIANQFTNSLRSLNSKTFPA  180

Query  845   RVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVF  666
             +VP TVDHSLFFTVGLG+NPCP+CK  NGSRVVAS+NNVTFVMPT ALLQAHFFNI GVF
Sbjct  181   KVPLTVDHSLFFTVGLGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVF  240

Query  665   TTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             TTDFP  PP  FNYTG  P NLQTT+GTK YRLPYN+TVQLV+QDTGII+PENHP+HLHG
Sbjct  241   TTDFPAKPPHVFNYTGTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENHPIHLHG  300

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
             FNFFAVGRG+GN+NPKTDP KFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE
Sbjct  301   FNFFAVGRGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  360

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHTTWGLKMAFLVDNGKGPNES
Sbjct  361   VHTTWGLKMAFLVDNGKGPNES  382



>gb|EYU41257.1| hypothetical protein MIMGU_mgv1a003880mg [Erythranthe guttata]
Length=558

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/443 (69%), Positives = 368/443 (83%), Gaps = 6/443 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ W R+TVHGA+VILPK GVPYPFPKPD E ++V  EWW
Sbjct  108   QSYIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEIIVFGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E VIN+A+K G  PNVSDAHTING  GP  NC S+G Y + V+ GK+Y+LR++NAA
Sbjct  168   KSDVEMVINQAMKLGQPPNVSDAHTINGQTGPAPNCSSKG-YTMYVESGKTYLLRIVNAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +NEELFFKIAGHQMT+VEVDATY KPF+T+TI I PGQTTN ++ A++  G Y +A SPF
Sbjct  227   VNEELFFKIAGHQMTIVEVDATYTKPFRTDTIFIGPGQTTNALLKADRKIGNYQIAISPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLR---TVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
             MD  +A D+QTATATL Y+G LS      T LT+ P KNAT V  NF+D+LRSLNS++YP
Sbjct  287   MDTIVATDSQTATATLRYNGTLSAAASSPTTLTTMPSKNATKVTTNFMDSLRSLNSRKYP  346

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A VP+T+DHSL   +G+G+NPC +C   NGSRVVA +NNVTFVMPT A+LQAH++N+ GV
Sbjct  347   ANVPKTIDHSLLLAIGVGVNPCGTC--VNGSRVVADINNVTFVMPTTAILQAHYYNVSGV  404

Query  668   FTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLH  489
             +T DFPGNPPV +NYTG+ P N+QTT GTKVYRL YN+TVQ+VLQ T IIAPE+HP HLH
Sbjct  405   YTDDFPGNPPVPYNYTGSPPTNMQTTNGTKVYRLGYNSTVQIVLQGTAIIAPESHPTHLH  464

Query  488   GFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHL  309
             GFNF+ VG+GIGN++PK DP  FNLVDP+ERNTI VP+GGW AIRFRADNPGVWF+HCHL
Sbjct  465   GFNFYVVGKGIGNYDPKNDPKSFNLVDPIERNTISVPTGGWTAIRFRADNPGVWFLHCHL  524

Query  308   EVHTTWGLKMAFLVDNGKGPNES  240
             E+HTTWGLKMAF+V+NGKGPN+S
Sbjct  525   EIHTTWGLKMAFVVENGKGPNQS  547



>dbj|BAJ98144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/441 (69%), Positives = 376/441 (85%), Gaps = 4/441 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             S++YNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPKLGVPYPFP P  EAVVVL EWWK
Sbjct  115   SFLYNFTVTGQRGTLLWHAHINWLRATVHGAIVILPKLGVPYPFPAPHKEAVVVLGEWWK  174

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNC-PSQGGYKLSVDPGKSYMLRVINAA  1200
             +DTE VIN+A++ G+ PN+SD+HTINGHPGP++ C  SQ G+KL V+  K+YMLR+INA 
Sbjct  175   ADTETVINQAMQLGVGPNISDSHTINGHPGPMSACASSQDGFKLDVENSKTYMLRIINAG  234

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFFKIAGH +TVVEVDA Y KP+KT+ ++I PGQTTNV+VTA+Q +G+Y+++ SPF
Sbjct  235   LNDDLFFKIAGHGLTVVEVDAVYTKPYKTDILLITPGQTTNVLVTADQSAGRYLLSVSPF  294

Query  1019  MDAPIAVDNQTATATLHYSGALSGL-RTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MDAP+ VDN+T TATLHY+  +S   R  L + PP+NATP+A+ F ++LRSLNSK+YPA 
Sbjct  295   MDAPLQVDNKTGTATLHYANTVSTTARLTLVNPPPQNATPIASTFSESLRSLNSKEYPAN  354

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VPQTVDHSLFFT+G+G+NPC +C   NG+RVV ++NN TFVMP+  +LQA +++I GVFT
Sbjct  355   VPQTVDHSLFFTIGVGVNPCANC--INGTRVVGTINNSTFVMPSTPILQARYYSIPGVFT  412

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP  PP  FNYTG+GP NLQT  GT+VYRLPYNA+VQ++LQDTGII+ E+HP+HLHGF
Sbjct  413   EDFPATPPHKFNYTGSGPNNLQTMNGTRVYRLPYNASVQVLLQDTGIISTESHPIHLHGF  472

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRGIGN+NPK+ P  FNL+DPVERNTIGVP+GGW AIRFRADNPGVWFMHCH EV
Sbjct  473   NFFVVGRGIGNYNPKSSPFTFNLIDPVERNTIGVPTGGWTAIRFRADNPGVWFMHCHFEV  532

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLKM F+VDNGK P+E+
Sbjct  533   HTSWGLKMVFVVDNGKRPSET  553



>ref|XP_004980096.1| PREDICTED: laccase-22-like [Setaria italica]
Length=589

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/441 (68%), Positives = 376/441 (85%), Gaps = 4/441 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             S++YNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPKLGVPYPFP P  E VVVL EWWK
Sbjct  140   SFLYNFTVTGQRGTLLWHAHINWLRATVHGAIVILPKLGVPYPFPTPHKEVVVVLGEWWK  199

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNC-PSQGGYKLSVDPGKSYMLRVINAA  1200
             +DTE VIN+A++ G+ PNVSD+HTINGHPGP+++C  SQ G+KL+V+ GK+YMLR+INAA
Sbjct  200   ADTEVVINQAMQQGVGPNVSDSHTINGHPGPLSDCASSQDGFKLNVENGKTYMLRIINAA  259

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFFKIAGH+ TVVEVDA Y KPFKT T++I PGQTTNV++TA++ +G+Y+++ SPF
Sbjct  260   LNDDLFFKIAGHKFTVVEVDAVYTKPFKTATLLITPGQTTNVLLTADRTAGRYLLSVSPF  319

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTV-LTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MDAP+ VDN+T TATLHY+  +S    + L   PP+NAT + + FV++LRSLNS++YPA 
Sbjct  320   MDAPVQVDNKTGTATLHYANTISATAPLTLIKPPPQNATTIVSKFVESLRSLNSEEYPAN  379

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP TVDHSL FTVG+G+NPC  C   N +R+V ++NNVTF+MP+  +LQAH++NI GVFT
Sbjct  380   VPLTVDHSLVFTVGVGVNPCAKC--INATRLVGTINNVTFIMPSTPILQAHYYNIPGVFT  437

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP  PP  FNYTG+GP NLQT  GT+VYRLPYNA+VQ+VLQDTGII+PE+HP+HLHGF
Sbjct  438   DDFPATPPHKFNYTGSGPKNLQTMKGTRVYRLPYNASVQVVLQDTGIISPESHPIHLHGF  497

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G+GN+NPKT P+ FNL+DP+ERNTIGVP+GGW AIRFRADNPGVWFMHCH EV
Sbjct  498   NFFVVGNGVGNYNPKTSPSTFNLIDPIERNTIGVPTGGWAAIRFRADNPGVWFMHCHFEV  557

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLKM F+VDNGK P+E+
Sbjct  558   HTSWGLKMVFVVDNGKRPDET  578



>ref|XP_006663136.1| PREDICTED: laccase-22-like [Oryza brachyantha]
Length=566

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/443 (67%), Positives = 373/443 (84%), Gaps = 6/443 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             S++YNFTITGQRGTL WHAH+ WLR+T+HGA+VILPKLGVPYPFP P  E V+VL EWWK
Sbjct  115   SFLYNFTITGQRGTLLWHAHINWLRATIHGAIVILPKLGVPYPFPAPHKEDVIVLGEWWK  174

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNC-PSQGGYKLSVDPGKSYMLRVINAA  1200
              DTE VIN+A++ G+ PN+SD+HTINGHPGP++ C  SQ G+KL V+ GK+YMLR+INAA
Sbjct  175   EDTENVINQAMQLGVGPNISDSHTINGHPGPLSECASSQDGFKLKVENGKTYMLRIINAA  234

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFFK+AGH++TVVEVDA Y KPF T+T++I PGQTT+V++ ANQ +G+Y+++ SPF
Sbjct  235   LNDDLFFKVAGHELTVVEVDAVYTKPFTTDTLLITPGQTTSVLLRANQSAGRYLLSVSPF  294

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRT---VLTSTPPKNATPVANNFVDALRSLNSKQYP  849
             MD+P+ VDN+T TATLHY+  +S       +L   PP+NAT + + F D L SLNSK+YP
Sbjct  295   MDSPLQVDNKTGTATLHYANTVSSSMAAPLILIKLPPQNATSIVSKFADRLHSLNSKEYP  354

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A VPQT+DHSL  TVG+G+NPCPSC   NG+RVV ++NNVTF+MP+  +LQA+++NI GV
Sbjct  355   ANVPQTIDHSLLLTVGVGVNPCPSC--INGTRVVGTINNVTFIMPSTPILQAYYYNIPGV  412

Query  668   FTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLH  489
             FT DFP  P   FNYTG+GP NLQT  GT+VYRLPYNA+VQ+VLQDTGII+PE+HP+HLH
Sbjct  413   FTQDFPATPLHKFNYTGSGPKNLQTMNGTRVYRLPYNASVQVVLQDTGIISPESHPIHLH  472

Query  488   GFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHL  309
             GFNFF VGRG+GN+NPKT P+ FNL+DP+ERNT+GVP+GGW AIRFRADNPGVWFMHCH 
Sbjct  473   GFNFFVVGRGVGNYNPKTSPSTFNLIDPIERNTVGVPTGGWTAIRFRADNPGVWFMHCHF  532

Query  308   EVHTTWGLKMAFLVDNGKGPNES  240
             EVHT+WGLKM F+VDNGK P+E+
Sbjct  533   EVHTSWGLKMVFVVDNGKRPSET  555



>ref|XP_007009094.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY17904.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=554

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/440 (70%), Positives = 365/440 (83%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+++YNFT+TGQRGTL WHAH+ WLRST+HGA+VILPK GVPYPFPKP  E V++L EWW
Sbjct  106   QNFLYNFTVTGQRGTLLWHAHISWLRSTMHGAIVILPKKGVPYPFPKPYKEKVIILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+DTEAV+N+A+++GLAPNVSDAHTINGH GP+ NC S+G Y L V+ GK+Y+LRV+NAA
Sbjct  166   KADTEAVVNQAMQTGLAPNVSDAHTINGHAGPLANCSSEGAYTLHVETGKTYLLRVVNAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +NEELFFKIAGH +TVVEVDA Y KP+KT+T+ + PGQTT  ++TA+QG GKY++A SPF
Sbjct  226   VNEELFFKIAGHNLTVVEVDAVYTKPYKTDTLFLGPGQTTTSLLTADQGIGKYLIAVSPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN TA   L Y+  L+   T LTS PP NAT V   F  +LRSLNSK+YPA V
Sbjct  286   MDTIVAVDNLTAVGFLRYNHTLAFTPTTLTSIPPVNATSVTEVFSKSLRSLNSKEYPANV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DHSLFFT+G+G+NPC +C   NGSR VA++NNVTF MPT ALLQAH++ I GVFT 
Sbjct  346   PLTIDHSLFFTIGIGINPCATC--VNGSRAVAAINNVTFDMPTTALLQAHYYGISGVFTD  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  P + FNYTG  P++LQT  GT+VYRL YN+TVQL++Q   IIAPE+HP HLHGFN
Sbjct  404   DFPAKPLIPFNYTGTPPSSLQTMNGTRVYRLAYNSTVQLIIQGNSIIAPESHPTHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVGRG+GNF+P+ DP KFNLVDPVERNTI VP+ GW AIRFRADNPGVWF HCHLEVH
Sbjct  464   FFAVGRGVGNFDPEKDPLKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFFHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPNES
Sbjct  524   TTWGLKMAFLVENGKGPNES  543



>emb|CDX80325.1| BnaC09g34170D [Brassica napus]
Length=570

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/451 (71%), Positives = 369/451 (82%), Gaps = 14/451 (3%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y YNFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL EWW
Sbjct  112   QNYFYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLGEWW  171

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +INEA K G APN SDAHTINGH GP++NCPSQ GY L V PGK+YMLR+INAA
Sbjct  172   KSDVEQLINEATKHGTAPNASDAHTINGHSGPISNCPSQSGYGLPVRPGKTYMLRIINAA  231

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSG-KYMVAASP  1023
             LNEELFFKIAGH++TVVEVDA Y KP+KT+T++IAPGQTTNV++TAN  +G KYMVAA+ 
Sbjct  232   LNEELFFKIAGHKLTVVEVDAVYTKPYKTDTVLIAPGQTTNVLLTANANTGSKYMVAATT  291

Query  1022  FMDAPIAVDNQTATATLHYSGAL--------SGLRTVLTSTPPKNATPVANNFVDALRSL  867
             FMDAPI+ DN TATATLH S AL        S  +TVL S P  NAT V++ F+ +LRSL
Sbjct  292   FMDAPISFDNVTATATLH-SNALHYIGHTVSSSKKTVLASLPQPNATLVSSKFIKSLRSL  350

Query  866   NSKQYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHF  687
             NS++YPA+VP TVDHSLFFTVGLG NPCPSC   NG R+VA +NNVTF MP  ALLQAH+
Sbjct  351   NSREYPAKVPTTVDHSLFFTVGLGANPCPSCN--NGIRLVAGINNVTFTMPETALLQAHY  408

Query  686   FNIKGVFTTDFPGNPPVAFNYTG--AGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAP  513
             FNI  VFT DFP  P   +NYT       N  T TGTK+YRLPYNATVQ++LQ+T +I  
Sbjct  409   FNISHVFTDDFPAKPSNPYNYTAPVDQSVNAATMTGTKLYRLPYNATVQIILQNTAMILS  468

Query  512   ENHPVHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPG  333
             ENHP HLHGFNFF VGRG+GNFNP+ DP +FNLVDPVERNT+GVP+GGW AIRF ADNPG
Sbjct  469   ENHPFHLHGFNFFEVGRGLGNFNPEKDPKRFNLVDPVERNTVGVPAGGWTAIRFIADNPG  528

Query  332   VWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  240
             VWFMHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  529   VWFMHCHLEIHTTWGLKMAFVVDNGHGPDQS  559



>gb|EMT26873.1| Laccase-22 [Aegilops tauschii]
Length=563

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/441 (68%), Positives = 374/441 (85%), Gaps = 4/441 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             S++YNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPKLGVPYPFP P  EAVVVL EWWK
Sbjct  114   SFLYNFTVTGQRGTLLWHAHINWLRATVHGAIVILPKLGVPYPFPAPHKEAVVVLGEWWK  173

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNC-PSQGGYKLSVDPGKSYMLRVINAA  1200
             +DTE VIN+A++ G+ PN+SD+HTINGHPGP+++C  SQ G+ L V+ GK+YMLR+INA 
Sbjct  174   ADTETVINQAMQLGVGPNISDSHTINGHPGPMSDCASSQDGFNLDVENGKTYMLRIINAG  233

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFFKIAGH +TVVEVDA Y KP+KT+ ++I PGQTTNV+VT +Q +G+Y+++ SPF
Sbjct  234   LNDDLFFKIAGHGLTVVEVDAVYTKPYKTDILLITPGQTTNVLVTTDQSAGRYLLSVSPF  293

Query  1019  MDAPIAVDNQTATATLHYSGALSGL-RTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             +DAP+ VDN+T TATL Y+  +S   R  L   PP+NATP+A+ F ++LRSLNSK+YPA 
Sbjct  294   LDAPLQVDNKTGTATLQYANTVSATARLTLVKPPPQNATPIASKFSESLRSLNSKEYPAN  353

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VPQTVDHSLFFT+G+G+NPC +C   NG+RVV ++NN TFVMP+  +LQA +++I GVFT
Sbjct  354   VPQTVDHSLFFTIGVGVNPCANC--INGTRVVGTINNSTFVMPSTPILQARYYSIPGVFT  411

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP  PP  FNYTG+GP NLQT  GT+V+RLPYNA+VQ++LQDTGII+ E+HP+HLHGF
Sbjct  412   EDFPATPPHKFNYTGSGPKNLQTMKGTRVHRLPYNASVQVILQDTGIISTESHPIHLHGF  471

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG+GN+NPK  P+ FNL+DPVERNTIGVP+GGW AIRFRADNPGVWFMHCH EV
Sbjct  472   NFFVVGRGVGNYNPKASPSTFNLIDPVERNTIGVPTGGWTAIRFRADNPGVWFMHCHFEV  531

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLKM F+VDNGK P+E+
Sbjct  532   HTSWGLKMVFVVDNGKRPSET  552



>ref|XP_011080855.1| PREDICTED: laccase-4 [Sesamum indicum]
Length=554

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/440 (70%), Positives = 363/440 (83%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFT+ GQRGT  WHAH+LWLR+TVHGA+V+LPK GVPYPFPKP  EAV +L EWW
Sbjct  106   QSYVYNFTVNGQRGTFLWHAHILWLRATVHGAIVVLPKPGVPYPFPKPHQEAVFILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E VINEA+  G+APNVSDAHTINGHPGP+++C  QGG+ L V PGK+Y+LRVINAA
Sbjct  166   KSDVEDVINEAMDLGVAPNVSDAHTINGHPGPISSCVGQGGFDLGVMPGKTYLLRVINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++ VVE+DA YVKPF T+T++IAPGQTTN ++TA+   G+Y V ASPF
Sbjct  226   LNEELFFKIAGHKLRVVEIDAAYVKPFDTDTLLIAPGQTTNALLTADLPIGRYQVVASPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PI +DN+TATATLHY+G L     VLT  P +NAT  A  F  +LRSLNS +YP RV
Sbjct  286   MDSPIDIDNRTATATLHYTGTLPSTPAVLTDPPSRNATATATKFAHSLRSLNSAEYPCRV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ VDH L F +GLGLN C +C  ANG RVVA +NNVTF MP+V+LL AHFFNI GVFT 
Sbjct  346   PREVDHHLLFAIGLGLNRCSTC--ANGYRVVADINNVTFAMPSVSLLNAHFFNIPGVFTD  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPG+PP  ++YT     N+ TTTGT++YR+ YNA+VQ+VLQ TG+I PENHP+HLHGFN
Sbjct  404   DFPGDPPTPYDYTARRVVNMGTTTGTRLYRVRYNASVQVVLQGTGMIFPENHPIHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+G+GNF+ + D   FNL DPVERNTI VPSGGWVAIRF ADNPGVWF+HCHLEVH
Sbjct  464   FFAVGKGLGNFDSEKDTRSFNLDDPVERNTIVVPSGGWVAIRFIADNPGVWFLHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLKMAF+V+NGKGPN+S
Sbjct  524   TSWGLKMAFIVENGKGPNQS  543



>ref|XP_009789474.1| PREDICTED: laccase-4-like isoform X2 [Nicotiana sylvestris]
Length=524

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/441 (69%), Positives = 371/441 (84%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             +SYVYNFT+T QRGTLFWHAH+LWLR+TVHGA+VILPKL +PYPFP P  E +++L EWW
Sbjct  75    KSYVYNFTVTDQRGTLFWHAHILWLRATVHGAIVILPKLALPYPFPNPQKEILIILGEWW  134

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV++EA + GL PN+SDAHTING PGPV+ C SQ G+   V+PGK Y+LR++NAA
Sbjct  135   KSDVEAVVDEATQLGLPPNISDAHTINGLPGPVSTCLSQEGFTFLVEPGKKYLLRIVNAA  194

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA+YVKPFK +TI+  PGQTTNVI++A+ G+GKY++  SP+
Sbjct  195   LNEELFFKIAGHKLTVVEVDASYVKPFKADTILTTPGQTTNVILSADLGTGKYLMVTSPY  254

Query  1019  MDAPIAVDNQTATATLHYSG-ALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD+PI V+N+TATATL Y G   S   T LT  PP NATP+A  F+D+LRSLNS++YPA+
Sbjct  255   MDSPILVNNRTATATLQYVGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAK  314

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP T+DHSLFFT+ LGLNPC SC    G R+VA++NNVTFVMP+V+LL AHFFN  GVFT
Sbjct  315   VPLTIDHSLFFTISLGLNPCESC--YRGFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFT  372

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   F+YTG  P NL+T  GT++YRL YN+ VQ+++QDTG+++PENHP+HLHGF
Sbjct  373   DDFPGNPAYTFDYTGIPPENLRTMEGTRLYRLAYNSNVQVIMQDTGLLSPENHPMHLHGF  432

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG GNF+P+ DP KFNLVDPVERNTI  PSGGWVAIRFRA+NPG+WF+HCHLEV
Sbjct  433   NFFVVGRGRGNFDPEEDPKKFNLVDPVERNTINAPSGGWVAIRFRANNPGIWFLHCHLEV  492

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNG GP ES
Sbjct  493   HTTWGLKMAFVVDNGNGPEES  513



>ref|XP_009789473.1| PREDICTED: laccase-4-like isoform X1 [Nicotiana sylvestris]
Length=557

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/441 (69%), Positives = 371/441 (84%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             +SYVYNFT+T QRGTLFWHAH+LWLR+TVHGA+VILPKL +PYPFP P  E +++L EWW
Sbjct  108   KSYVYNFTVTDQRGTLFWHAHILWLRATVHGAIVILPKLALPYPFPNPQKEILIILGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV++EA + GL PN+SDAHTING PGPV+ C SQ G+   V+PGK Y+LR++NAA
Sbjct  168   KSDVEAVVDEATQLGLPPNISDAHTINGLPGPVSTCLSQEGFTFLVEPGKKYLLRIVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA+YVKPFK +TI+  PGQTTNVI++A+ G+GKY++  SP+
Sbjct  228   LNEELFFKIAGHKLTVVEVDASYVKPFKADTILTTPGQTTNVILSADLGTGKYLMVTSPY  287

Query  1019  MDAPIAVDNQTATATLHYSG-ALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD+PI V+N+TATATL Y G   S   T LT  PP NATP+A  F+D+LRSLNS++YPA+
Sbjct  288   MDSPILVNNRTATATLQYVGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAK  347

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP T+DHSLFFT+ LGLNPC SC    G R+VA++NNVTFVMP+V+LL AHFFN  GVFT
Sbjct  348   VPLTIDHSLFFTISLGLNPCESC--YRGFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFT  405

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   F+YTG  P NL+T  GT++YRL YN+ VQ+++QDTG+++PENHP+HLHGF
Sbjct  406   DDFPGNPAYTFDYTGIPPENLRTMEGTRLYRLAYNSNVQVIMQDTGLLSPENHPMHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG GNF+P+ DP KFNLVDPVERNTI  PSGGWVAIRFRA+NPG+WF+HCHLEV
Sbjct  466   NFFVVGRGRGNFDPEEDPKKFNLVDPVERNTINAPSGGWVAIRFRANNPGIWFLHCHLEV  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNG GP ES
Sbjct  526   HTTWGLKMAFVVDNGNGPEES  546



>ref|XP_003544123.1| PREDICTED: laccase-4-like [Glycine max]
Length=554

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/441 (68%), Positives = 371/441 (84%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFTI GQRGTL WHAH+ WLR+TV+G +VILPK G+ YPFPKPD E +++L EWW
Sbjct  106   QSYVYNFTINGQRGTLLWHAHITWLRATVYGGIVILPKRGISYPFPKPDKEKIIILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EA++N+A  SGL PN+SDAHTINGH GP+  C SQG Y L V+ GK+Y+LR+INAA
Sbjct  166   KSDVEAILNQAENSGLPPNISDAHTINGHTGPIPGCTSQG-YTLHVESGKTYLLRIINAA  224

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH++TVVE DA+YVKPF+T+TI ++PGQTTNV++TANQ  GKY++A +PF
Sbjct  225   LNDELFFKIAGHKLTVVEADASYVKPFETDTIFMSPGQTTNVLLTANQVVGKYLIAVTPF  284

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI  DN T+ ATL Y G     +T LT+ P  NATP+ ++F+D+LRSLNSK+YPA  
Sbjct  285   MDAPIGFDNVTSIATLRYKGTPPYPKTTLTTIPALNATPLTSDFIDSLRSLNSKEYPAIA  344

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTV-ALLQAHFFNIKGVFT  663
             P TVDHSLFF++ +GLNPC +C    G+R+V+++NN+TF+MPT  +LL+AH++NIKGVFT
Sbjct  345   PLTVDHSLFFSITVGLNPCHTC--LTGARLVSAINNITFLMPTTTSLLEAHYYNIKGVFT  402

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP  PP+AFNYTG  PAN+QT  GT++YRL +N+TVQ++LQ T +IAPENHP HLHG+
Sbjct  403   DDFPSFPPIAFNYTGTQPANIQTNNGTRLYRLDFNSTVQIILQGTAMIAPENHPFHLHGY  462

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G+GNF+P+ DP  FNLVDPVERNTIGVP+GGW AIRFRA+NPGVWF+HCHLEV
Sbjct  463   NFFVVGQGLGNFDPEKDPLSFNLVDPVERNTIGVPNGGWAAIRFRANNPGVWFLHCHLEV  522

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNG GP+ES
Sbjct  523   HTTWGLKMAFIVDNGNGPHES  543



>ref|XP_006435668.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
 ref|XP_006486373.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR48908.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
Length=553

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/440 (69%), Positives = 360/440 (82%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK  VPYPFPK D E ++V  EWW
Sbjct  106   QSYVYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRSVPYPFPKADKEKIIVFGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAVIN+A + G+APNVSDAHTINGHPGPVTNC SQG + L V+ GK+Y+LR++NAA
Sbjct  166   KADVEAVINQATQMGVAPNVSDAHTINGHPGPVTNCTSQG-FTLHVESGKTYLLRIVNAA  224

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +N+ELFFKIAGH +TVVEVD++Y KPFKT+TI I PGQTTN ++TA++  GKY++  SPF
Sbjct  225   VNDELFFKIAGHNLTVVEVDSSYTKPFKTDTIFIGPGQTTNALLTADKKIGKYLITVSPF  284

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AV+N T  A L Y G ++   T LT+ P  NAT V N F D LRSLNSK+YPA+V
Sbjct  285   MDTIVAVNNVTGIAFLRYKGTVAFSSTTLTNVPAINATEVTNTFSDNLRSLNSKRYPAKV  344

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL  T+ + +NPC +C   NG++V A++NN++FVMPT ALLQAH++ I GVFT 
Sbjct  345   PLTVDHSLLITMAVAVNPCATC--PNGTKVGAAMNNISFVMPTTALLQAHYYKISGVFTD  402

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP+AFNYTG     LQTT GT++YRL YN+TVQLVLQ T +IAPENHP HLHGFN
Sbjct  403   DFPAKPPIAFNYTGNYTGTLQTTNGTRLYRLAYNSTVQLVLQGTTVIAPENHPTHLHGFN  462

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+G GNF+P  DP KFNLVDPVERNTI VP+ GW AIRFRADNPGVWF+HCHLEVH
Sbjct  463   FFAVGKGSGNFDPNKDPQKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFLHCHLEVH  522

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLKMAF+VDNGKGPNES
Sbjct  523   TSWGLKMAFVVDNGKGPNES  542



>ref|XP_004490949.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=554

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/441 (66%), Positives = 368/441 (83%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QS+VYNFTITGQRGTL WHAH+ WLR+T+HGA+VILPK  +PYPFPKPD E +++L EWW
Sbjct  106   QSFVYNFTITGQRGTLLWHAHITWLRATMHGAIVILPKRDIPYPFPKPDKEKIIILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV+N+A  SGL PN+SDAHTINGHPG V  C SQG Y L V+ GK+Y+LR+INAA
Sbjct  166   KSDVEAVVNQATNSGLPPNISDAHTINGHPGSVPGCMSQG-YTLHVERGKTYLLRIINAA  224

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH++TVVE DA+Y+KPF+T+TI ++PGQTTNV++T NQ  GKY++A +PF
Sbjct  225   LNDELFFKIAGHKLTVVEADASYIKPFETDTIFLSPGQTTNVLLTTNQSVGKYLIATTPF  284

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI  DN T+ ATLHY G     +T+LT+ PP NAT +   F D+L+SLNSKQYP +V
Sbjct  285   MDAPIGFDNVTSIATLHYKGTQPDTKTILTNIPPLNATTLTKTFTDSLKSLNSKQYPTKV  344

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +D SL F + +G++PC +C   +G+++V+++NNVTF+MPT++LLQAH++NIKGVFT 
Sbjct  345   PLKIDQSLLFAITVGIDPCDTC--TSGNKLVSAINNVTFLMPTISLLQAHYYNIKGVFTD  402

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP NPP+ F+YTGA  P NL T  GT+VYRL +N++V++VLQ T +IAPENHP HLHG+
Sbjct  403   DFPANPPLVFDYTGADQPDNLHTENGTRVYRLNFNSSVEIVLQGTAMIAPENHPFHLHGY  462

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G+GNF+   DP +FNLVDPVERNT+ VP+ GW+AIRFRADNPGVWF+HCHLEV
Sbjct  463   NFFVVGQGLGNFDHDKDPLRFNLVDPVERNTLSVPNAGWIAIRFRADNPGVWFLHCHLEV  522

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNG+GPNES
Sbjct  523   HTTWGLKMAFIVDNGRGPNES  543



>gb|AES99522.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=529

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/441 (67%), Positives = 367/441 (83%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QS+VYNFTITGQRGTL WHAH+ WLR+T+HGA+VILPK G PYPFPKPD E +++L EWW
Sbjct  81    QSFVYNFTITGQRGTLLWHAHITWLRATMHGAIVILPKRGTPYPFPKPDKEKIIILGEWW  140

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV+N+A  SG+ PN+SDAHTINGHPGPV  C SQG Y L V+ GK+Y+LR+INAA
Sbjct  141   KSDVEAVVNQATSSGMPPNISDAHTINGHPGPVPGCISQG-YTLHVESGKTYLLRIINAA  199

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH++ VVE DA+Y+KPF+ +TI ++PGQTTNV++TANQ  GKY++A +PF
Sbjct  200   LNDELFFKIAGHKLIVVEADASYLKPFEIDTIFLSPGQTTNVLLTANQPIGKYLIAITPF  259

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI  DN ++ ATL Y G     +T+LT+ PP NATP+   F D+LRSLNSK YP RV
Sbjct  260   MDAPIGFDNLSSIATLRYKGIPPYTKTILTNIPPLNATPITKTFTDSLRSLNSKTYPTRV  319

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
               T+DHSL F + +GLNPC +C   N  ++V+++NN+TF+MPTV+LLQA+++NIKGVFT 
Sbjct  320   SLTIDHSLLFAITVGLNPCDTCITDN--KLVSAINNITFLMPTVSLLQANYYNIKGVFTD  377

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP+ F+YTG   PANL T  GTKVYRL +N++VQ+VLQ T +IAPENHP HLHGF
Sbjct  378   DFPSKPPMVFDYTGTDQPANLHTDNGTKVYRLNFNSSVQIVLQGTAMIAPENHPFHLHGF  437

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G+GNF+P+ DP +FNLVDP+ERNT+ VP+ GW+AIRFRADNPGVWF+HCHLEV
Sbjct  438   NFFVVGQGLGNFDPEKDPLRFNLVDPIERNTLSVPNNGWIAIRFRADNPGVWFLHCHLEV  497

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNG+GP+ES
Sbjct  498   HTTWGLKMAFIVDNGRGPSES  518



>gb|KDO69098.1| hypothetical protein CISIN_1g008799mg [Citrus sinensis]
Length=553

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/440 (69%), Positives = 360/440 (82%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSYVYNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK  VPYPFPK D E ++V  EWW
Sbjct  106   QSYVYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRSVPYPFPKADKEKIIVFGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAVIN+A + G+APNVSDAHTINGHPGPVTNC SQG + L V+ GK+Y+LR++NAA
Sbjct  166   KADVEAVINQATQMGVAPNVSDAHTINGHPGPVTNCTSQG-FTLHVESGKTYLLRIVNAA  224

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +N+ELFFKIAGH +TVVEVD++Y KPFKT+TI I PGQTTN ++TA++  GKY++  SPF
Sbjct  225   VNDELFFKIAGHNLTVVEVDSSYTKPFKTDTIFIGPGQTTNALLTADKKIGKYLITISPF  284

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AV+N T  A L Y G ++   T LT+ P  NAT V N F D LRSLNSK+YPA+V
Sbjct  285   MDTIVAVNNVTGIAFLRYKGTVAFSSTTLTNVPAINATEVTNTFSDNLRSLNSKRYPAKV  344

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL  T+ + +NPC +C   NG++V A++NN++FVMPT ALLQAH++ I GVFT 
Sbjct  345   PLTVDHSLLLTMAVAVNPCATC--PNGTKVGAAMNNISFVMPTTALLQAHYYKISGVFTD  402

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP+AFNYTG     LQTT GT++YRL YN+TVQLVLQ T +IAPENHP HLHGFN
Sbjct  403   DFPAKPPIAFNYTGNYTGTLQTTNGTRLYRLAYNSTVQLVLQGTTVIAPENHPTHLHGFN  462

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFAVG+G GNF+P  DP KFNLVDPVERNTI VP+ GW AIRFRADNPGVWF+HCHLEVH
Sbjct  463   FFAVGKGSGNFDPNKDPQKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFLHCHLEVH  522

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLKMAF+VDNGKGPNES
Sbjct  523   TSWGLKMAFVVDNGKGPNES  542



>ref|XP_006840270.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
 gb|ERN01945.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
Length=565

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/449 (71%), Positives = 371/449 (83%), Gaps = 10/449 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y YNFTITGQRGTL WHAH+LWLR+TVHGA+VILPK GVPYPFPKP  E VV+LAEWW
Sbjct  107   QTYTYNFTITGQRGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVVVILAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGG--YKLSVDPGKSYMLRVIN  1206
              SD EAVIN A+KSG APNVSDAHTINGHPGP++NC SQGG  +KL V+ GK+Y+LR+IN
Sbjct  167   NSDVEAVINTAMKSGAAPNVSDAHTINGHPGPLSNCSSQGGGGFKLEVESGKTYLLRIIN  226

Query  1205  AALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAAS  1026
             AALNEELFF +AGH +TVVEVDATY KPF T T++IAPGQTTNV++ A++  G+Y+ AAS
Sbjct  227   AALNEELFFGVAGHPLTVVEVDATYNKPFTTTTVLIAPGQTTNVLLKADKSGGRYIAAAS  286

Query  1025  PFMDAPIAVDNQTATATLHYSGA--LSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQY  852
             PFMDAPIAVDN TATA LHY+     S + T   S PP NATPVA+ F+D+LRSL  K  
Sbjct  287   PFMDAPIAVDNATATALLHYTDTPSSSSVSTTFVSLPPLNATPVASKFMDSLRSL-KKPP  345

Query  851   PARVPQ--TVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNI  678
              + +P+   VDHSLF TVGLG+ PCP+C   NGSRV+A++NN++FVMPT  LLQAH+FNI
Sbjct  346   SSSLPRHSRVDHSLFITVGLGIFPCPTCTANNGSRVLAAMNNISFVMPTFNLLQAHYFNI  405

Query  677   KGVFTTDFPGNPPVAFNYT-GAGPAN--LQTTTGTKVYRLPYNATVQLVLQDTGIIAPEN  507
              GVFT DFP  PP  FNYT    P N  +  + GT++YRLP+N++VQ+VLQDTG I+PEN
Sbjct  406   SGVFTDDFPAKPPTPFNYTQNPTPQNTSIVLSNGTRLYRLPFNSSVQVVLQDTGFISPEN  465

Query  506   HPVHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVW  327
             HPVHLHGFNFF VGRGIGNF+PK DP KFNLVDPVERNT+G+PSGGW A RF ADNPGVW
Sbjct  466   HPVHLHGFNFFVVGRGIGNFDPKKDPAKFNLVDPVERNTVGLPSGGWTAFRFIADNPGVW  525

Query  326   FMHCHLEVHTTWGLKMAFLVDNGKGPNES  240
             FMHCHLE+HTTWGLKMAF+VDNGKGPN+S
Sbjct  526   FMHCHLEIHTTWGLKMAFVVDNGKGPNQS  554



>ref|XP_009589148.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/441 (70%), Positives = 366/441 (83%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             +SYVYNFT+T QRGTLFWHAH+LWLR+TVHGA+VILPKL  PYPFPKP  E +++L EWW
Sbjct  108   KSYVYNFTVTDQRGTLFWHAHILWLRATVHGAIVILPKLVFPYPFPKPQKEILIILGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVI+EA K GL PN+SDAHTING PGP++ C SQ G+   V+PGK Y+LR++NAA
Sbjct  168   KSDVEAVIDEATKLGLPPNISDAHTINGLPGPLSTCLSQEGFTFLVEPGKKYLLRIVNAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH++TVVEVDA+YVKPFKT TI+  PGQTTNVI++A+  SGKY++  S +
Sbjct  228   LNEELFFKIAGHKLTVVEVDASYVKPFKTETILTTPGQTTNVILSADLESGKYLMVTSAY  287

Query  1019  MDAPIAVDNQTATATLHYSG-ALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MD+PI V+N+TATATL Y G   S   T LT  PP NATP+A  F+D+LRSLNS++YPA+
Sbjct  288   MDSPILVNNRTATATLQYRGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAK  347

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VP  +DHSLFFT+ LGLNPC SC      R+VA++NNVTFVMP+V+LL AHFFN  GVFT
Sbjct  348   VPLKIDHSLFFTISLGLNPCESC--YREFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFT  405

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPGNP   F+YTG  P NL+T  GT++YRL YN+ VQL++QDTG+++PENHP+HLHGF
Sbjct  406   DDFPGNPAYTFDYTGIPPENLRTMEGTRLYRLAYNSNVQLIMQDTGLLSPENHPMHLHGF  465

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG GNF+PK DP KFNLVDPVERNTI  PSGGWVAIRF A+NPG+WF+HCHLEV
Sbjct  466   NFFVVGRGRGNFDPKEDPNKFNLVDPVERNTINAPSGGWVAIRFTANNPGIWFLHCHLEV  525

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNG GP ES
Sbjct  526   HTTWGLKMAFVVDNGNGPEES  546



>ref|XP_003616564.1| Laccase [Medicago truncatula]
Length=675

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/441 (67%), Positives = 367/441 (83%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QS+VYNFTITGQRGTL WHAH+ WLR+T+HGA+VILPK G PYPFPKPD E +++L EWW
Sbjct  227   QSFVYNFTITGQRGTLLWHAHITWLRATMHGAIVILPKRGTPYPFPKPDKEKIIILGEWW  286

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV+N+A  SG+ PN+SDAHTINGHPGPV  C SQG Y L V+ GK+Y+LR+INAA
Sbjct  287   KSDVEAVVNQATSSGMPPNISDAHTINGHPGPVPGCISQG-YTLHVESGKTYLLRIINAA  345

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH++ VVE DA+Y+KPF+ +TI ++PGQTTNV++TANQ  GKY++A +PF
Sbjct  346   LNDELFFKIAGHKLIVVEADASYLKPFEIDTIFLSPGQTTNVLLTANQPIGKYLIAITPF  405

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI  DN ++ ATL Y G     +T+LT+ PP NATP+   F D+LRSLNSK YP RV
Sbjct  406   MDAPIGFDNLSSIATLRYKGIPPYTKTILTNIPPLNATPITKTFTDSLRSLNSKTYPTRV  465

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
               T+DHSL F + +GLNPC +C   N  ++V+++NN+TF+MPTV+LLQA+++NIKGVFT 
Sbjct  466   SLTIDHSLLFAITVGLNPCDTCITDN--KLVSAINNITFLMPTVSLLQANYYNIKGVFTD  523

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP+ F+YTG   PANL T  GTKVYRL +N++VQ+VLQ T +IAPENHP HLHGF
Sbjct  524   DFPSKPPMVFDYTGTDQPANLHTDNGTKVYRLNFNSSVQIVLQGTAMIAPENHPFHLHGF  583

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G+GNF+P+ DP +FNLVDP+ERNT+ VP+ GW+AIRFRADNPGVWF+HCHLEV
Sbjct  584   NFFVVGQGLGNFDPEKDPLRFNLVDPIERNTLSVPNNGWIAIRFRADNPGVWFLHCHLEV  643

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNG+GP+ES
Sbjct  644   HTTWGLKMAFIVDNGRGPSES  664



>ref|XP_002866298.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42557.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/447 (70%), Positives = 361/447 (81%), Gaps = 9/447 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL+EWW
Sbjct  68    QNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLSEWW  127

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +INEA K G AP+ SDAHTINGH G ++NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  128   KSDVEELINEASKIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRAGKTYMLRIINAA  187

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YMVAA+ 
Sbjct  188   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATT  247

Query  1022  FMDAPIAVDNQTATATLHYSGALSGL----RTVLTSTPPKNATPVANNFVDALRSLNSKQ  855
             F DA I  DN TATATLHY G  + +    +TVL S PP+NAT VA  F  +LRSLNS++
Sbjct  248   FTDAQIPYDNVTATATLHYIGHTATVSASKKTVLASLPPQNATWVATKFTRSLRSLNSRE  307

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPARVP TVDHSLFFTVGLG NPC SC   NG R+VA +NNVTF MP  ALLQAHFFNI 
Sbjct  308   YPARVPTTVDHSLFFTVGLGANPCQSCN--NGVRLVAGINNVTFTMPETALLQAHFFNIS  365

Query  674   GVFTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHP  501
             GVFT DFP NP   ++YT       N  T  GTK+YRLPYNATVQ+VLQ+T +I  +NHP
Sbjct  366   GVFTDDFPANPSNPYDYTAPVKIGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHP  425

Query  500   VHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
              HLHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFM
Sbjct  426   FHLHGFNFFEVGRGMGNFNPEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFM  485

Query  320   HCHLEVHTTWGLKMAFLVDNGKGPNES  240
             HCHLE+HTTWGLKMAF+VDNG GP+++
Sbjct  486   HCHLELHTTWGLKMAFVVDNGHGPDQA  512



>ref|XP_006350822.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=559

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/440 (69%), Positives = 360/440 (82%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             +SYVYNFT+T QRGTLFWHAH+LWLR+TVHGA+VILPK  +PYPF KP  E V++L EWW
Sbjct  112   KSYVYNFTVTEQRGTLFWHAHILWLRATVHGAVVILPKHTLPYPFSKPKKEVVIILGEWW  171

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV++EA +SGL PN+SDAHTING  GPV+ C SQ G+   V+PGK Y+LR+INAA
Sbjct  172   KSDVEAVVDEATQSGLPPNISDAHTINGLTGPVSTCLSQEGFNFLVEPGKKYLLRIINAA  231

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH +TVVEVDA YVKPF+T TI+ APGQTTNVI++    +GKY +  SP+
Sbjct  232   LNEELFFKIAGHNLTVVEVDAAYVKPFETETILTAPGQTTNVILSTTYKNGKYSMVTSPY  291

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PI V+N+ ATATL Y G  +   T  T  PP+NAT +A NF+D+L+SLNSK+YPA+V
Sbjct  292   MDSPILVNNKAATATLQYIGT-NNSSTTFTVPPPRNATFIAFNFMDSLKSLNSKKYPAKV  350

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  ++HSLFF + LGLNPC +C    G R+VA++NNVTFVMP+V+LL  HF N  GVFT 
Sbjct  351   PIKINHSLFFIISLGLNPCATC--YRGFRIVAAINNVTFVMPSVSLLSTHFLNKSGVFTD  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNP  AF+YTG  P NL+T  GTK+YRL YN+ VQ++LQDTG+++PENHP+HLHGFN
Sbjct  409   DFPGNPQNAFDYTGVPPENLRTMEGTKLYRLEYNSNVQIILQDTGLLSPENHPMHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG GNFNPK D  KFNLVDPVERNTI  PSGGWVAIRFRA+NPGVWF HCHLEVH
Sbjct  469   FFVVGRGKGNFNPKEDSKKFNLVDPVERNTINAPSGGWVAIRFRANNPGVWFFHCHLEVH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+V+NG GPNES
Sbjct  529   TTWGLKMAFVVNNGNGPNES  548



>gb|KHN20872.1| Laccase-4 [Glycine soja]
Length=562

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/449 (66%), Positives = 371/449 (83%), Gaps = 12/449 (3%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVL----  1392
             QSYVYNFTI GQRGTL WHAH+ WLR+TV+G +VILPK G+ YPFPKPD E +++L    
Sbjct  106   QSYVYNFTINGQRGTLLWHAHITWLRATVYGGIVILPKRGISYPFPKPDKEKIIILGKIY  165

Query  1391  ----AEWWKSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSY  1224
                  EWWKSD EA++N+A  SGL PN+SDAHTINGH GP+  C SQG Y L V+ GK+Y
Sbjct  166   VRIKCEWWKSDVEAILNQAENSGLPPNISDAHTINGHTGPIPGCTSQG-YTLHVESGKTY  224

Query  1223  MLRVINAALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK  1044
             +LR+INAALN+ELFFKIAGH++TVVE DA+YVKPF+T+TI ++PGQTTNV++TANQ  GK
Sbjct  225   LLRIINAALNDELFFKIAGHKLTVVEADASYVKPFETDTIFMSPGQTTNVLLTANQVVGK  284

Query  1043  YMVAASPFMDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLN  864
             Y++A +PFMDAPI  DN T+ ATL Y G     +T LT+ P  NATP+ ++F+D+LRSLN
Sbjct  285   YLIAVTPFMDAPIGFDNVTSIATLRYKGTPPYPKTTLTTIPALNATPLTSDFIDSLRSLN  344

Query  863   SKQYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTV-ALLQAHF  687
             SK+YPA  P TVDHSLFF++ +GLNPC +C    G+R+V+++NN+TF+MPT  +LL+AH+
Sbjct  345   SKEYPAIAPLTVDHSLFFSITVGLNPCHTC--LTGARLVSAINNITFLMPTTTSLLEAHY  402

Query  686   FNIKGVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPEN  507
             +NIKGVFT DFP  PP+AFNYTG  PAN+QT  GT++YRL +N+TVQ++LQ T +IAPEN
Sbjct  403   YNIKGVFTDDFPSFPPIAFNYTGTQPANIQTNNGTRLYRLDFNSTVQIILQGTAMIAPEN  462

Query  506   HPVHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVW  327
             HP HLHG+NFF VG+G+GNF+P+ DP  FNLVDPVERNTIGVP+GGW AIRFRA+NPGVW
Sbjct  463   HPFHLHGYNFFVVGQGLGNFDPEKDPLSFNLVDPVERNTIGVPNGGWAAIRFRANNPGVW  522

Query  326   FMHCHLEVHTTWGLKMAFLVDNGKGPNES  240
             F+HCHLEVHTTWGLKMAF+VDNG GP+ES
Sbjct  523   FLHCHLEVHTTWGLKMAFIVDNGNGPHES  551



>ref|XP_006282033.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
 gb|EOA14931.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
Length=530

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/447 (70%), Positives = 359/447 (80%), Gaps = 9/447 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL EWW
Sbjct  75    QNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLGEWW  134

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E ++NEA K G AP  SDAHTINGH G + NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  135   KSDVEELVNEASKIGTAPMASDAHTINGHSGSIPNCPSQSSYGLPVRAGKTYMLRIINAA  194

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YMVAA+ 
Sbjct  195   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMVAATT  254

Query  1022  FMDAPIAVDNQTATATLHYSGALSGL----RTVLTSTPPKNATPVANNFVDALRSLNSKQ  855
             F DA I  DN TATATLHY G  S +    +TVL S PP+NAT VA  F  +LRSLNS +
Sbjct  255   FTDAHIPYDNVTATATLHYIGHTSTVSASKKTVLASLPPQNATWVATKFTRSLRSLNSHE  314

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPARVP TVDHSLFFTVGLG NPCPSC  +NG R+VA +NNVTF MP  ALLQAHFFNI 
Sbjct  315   YPARVPTTVDHSLFFTVGLGANPCPSC--SNGVRLVAGINNVTFTMPKTALLQAHFFNIS  372

Query  674   GVFTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHP  501
             GVFT DFP  P   ++YT       N  T  GTK+YRLPYNATVQ+VLQ+T +I P+NHP
Sbjct  373   GVFTDDFPAKPANPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQVVLQNTAMIVPDNHP  432

Query  500   VHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
              HLHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFM
Sbjct  433   FHLHGFNFFEVGRGLGNFNPEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFM  492

Query  320   HCHLEVHTTWGLKMAFLVDNGKGPNES  240
             HCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  493   HCHLELHTTWGLKMAFVVDNGHGPDQS  519



>ref|XP_002316233.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
 gb|EEF02404.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
Length=555

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/441 (67%), Positives = 362/441 (82%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ WLR+T+HGA+VI PK GVPYPFPKPD E +++L+EWW
Sbjct  107   QSYLYNFTLTGQRGTLLWHAHISWLRATIHGAIVIFPKKGVPYPFPKPDKEKIIILSEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAV+N+A  +GL PN+SDAHT+NGH G V  C S G + L V+ GK+Y+LR+INAA
Sbjct  167   KADVEAVVNQATMTGLPPNISDAHTVNGHTGAVPGCTSPG-FTLHVESGKTYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH +TVVEVDAT+ KPF T+TI I PGQTTN ++TA++  GKY++A SPF
Sbjct  226   LNDELFFKIAGHNITVVEVDATFTKPFSTDTIFIGPGQTTNALLTADKSIGKYLIAVSPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN TA A L Y G L+    VLT+TP  NATP  + F+D LRSLNSK+YPA V
Sbjct  286   MDTVVAVDNVTAIAFLRYKGTLAFSPPVLTTTPAINATPATSTFMDKLRSLNSKKYPANV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDH L+FT+G+G++PC +C   NGS+ VA +NNV+F+MPT ALLQAH++NI GVFT 
Sbjct  346   PLTVDHDLYFTIGVGIDPCATC--TNGSKAVADINNVSFIMPTTALLQAHYYNISGVFTD  403

Query  659   DFPGNPPVAFNYTGAGPA-NLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP++FNYTG   A NL+TT GT+ YRL +N+ VQ+VLQ T IIAPE+HP HLHGF
Sbjct  404   DFPAKPPISFNYTGNNTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGF  463

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+GIGNF+P  DP KFNL DPVERNT+ VP+ GW+AIRF+ADNPGVWF+HCHLEV
Sbjct  464   NFFVVGKGIGNFDPDNDPKKFNLADPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEV  523

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  524   HTTWGLKMAFVVDNGKGPNES  544



>ref|XP_004241179.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=560

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/441 (68%), Positives = 361/441 (82%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             +SYVYNFT+  QRGTLFWHAH+LWLR+TVHGA+VILPKL +PYPF KP  E V++L EWW
Sbjct  112   KSYVYNFTVREQRGTLFWHAHILWLRATVHGAIVILPKLALPYPFSKPKKEVVIILGEWW  171

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV++EA +SGL PN+SDAHTING  GPV+ C SQ G+   V+PGK Y+LR+INAA
Sbjct  172   KSDVEAVVDEATQSGLPPNISDAHTINGLTGPVSTCLSQEGFNFQVEPGKKYLLRIINAA  231

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIAGH +TV EVDA YVKPF+T TI+ APGQTTNVI++ N  +GKY++  SP+
Sbjct  232   LNEELFFKIAGHNLTVEEVDAAYVKPFETETILTAPGQTTNVILSTNHKNGKYLMVTSPY  291

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD+PI V+N+ ATATL Y+G  +   T  T  PP+NAT +A NF+D+L+SLNSK+YPA+V
Sbjct  292   MDSPILVNNKAATATLQYTGT-NNSSTTFTVPPPRNATSIAFNFMDSLQSLNSKRYPAKV  350

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  ++HSLFF + LGLNPC +C    G R+VA++NNVTFVMP+V+LL  HF N  GVFT 
Sbjct  351   PIKINHSLFFIISLGLNPCATC--YRGFRIVAAINNVTFVMPSVSLLGTHFLNKSGVFTD  408

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNP   F+YTG  P NL+T  GTK+YRL YN+ VQ++LQDTG+++PENHP+HLHGFN
Sbjct  409   DFPGNPQNVFDYTGVPPENLRTIEGTKLYRLEYNSNVQIILQDTGLLSPENHPMHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPS-GGWVAIRFRADNPGVWFMHCHLEV  303
             FF VGRG GNFNPK D  KFNLVDPVERNTI  PS GGWVAIRFRA+NPGVWF HCHLEV
Sbjct  469   FFVVGRGKGNFNPKEDFKKFNLVDPVERNTINAPSGGGWVAIRFRANNPGVWFFHCHLEV  528

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+V+NG GPNES
Sbjct  529   HTTWGLKMAFVVNNGNGPNES  549



>ref|XP_007141799.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
 gb|ESW13793.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
Length=553

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/440 (68%), Positives = 369/440 (84%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QS+VYNFT TGQRGTL WHAH+ WLR+TV+GA+VILPK G+ YPFP PD E  ++L EWW
Sbjct  106   QSFVYNFTTTGQRGTLLWHAHITWLRATVYGAIVILPKRGISYPFPTPDKEKTIILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV+NEA  SGL PN+SDAHTINGH GPV  C S+G Y L V+ GK+Y+LR+INAA
Sbjct  166   KSDVEAVLNEAESSGLPPNISDAHTINGHTGPVPGCTSRG-YTLHVESGKTYLLRIINAA  224

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH++TVVE DA+YVKPF+T+TI ++PGQTTNV+++A+QG GKY++A +PF
Sbjct  225   LNDELFFKIAGHKLTVVEADASYVKPFETDTIFMSPGQTTNVLLSADQGVGKYLIAVTPF  284

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI  DN T+ ATL Y        T LT+ P  NATP+ ++F+D+LRSLNSK+YPARV
Sbjct  285   MDAPIGFDNVTSIATLRYKTTPPYPTTTLTTIPALNATPLTSHFIDSLRSLNSKEYPARV  344

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSLFF + +GLNPC +C    GS++V+++NN+TFVMPT +LL+AH++N+KGVFT 
Sbjct  345   PLTVDHSLFFAITVGLNPCDAC--PTGSKLVSALNNITFVMPTTSLLEAHYYNVKGVFTD  402

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP +PP+ FNYTG  PAN+QT  GT++YRL +N+TVQ++LQ T +IAPENHP HLHG+N
Sbjct  403   DFPAHPPIVFNYTGTQPANIQTNNGTRLYRLNFNSTVQIILQGTAMIAPENHPFHLHGYN  462

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G GNF+P+ DP  FNLVDPVERNTIGVP+GGWVAIRFRA+NPGVWF+HCHLEVH
Sbjct  463   FFVVGQGSGNFDPEKDPLGFNLVDPVERNTIGVPNGGWVAIRFRANNPGVWFLHCHLEVH  522

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+VDNG  P+ES
Sbjct  523   TTWGLKMAFIVDNGNSPHES  542



>ref|XP_011036009.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=555

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/441 (68%), Positives = 360/441 (82%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ WLR+T+HGA+VI PK GVPYPFPKPD E ++ L+EWW
Sbjct  107   QSYLYNFTLTGQRGTLLWHAHISWLRATIHGAIVIFPKKGVPYPFPKPDKEKIITLSEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAVIN+A  +GL PN+SDAHT+NG  G V  C S G + L V+ GK+Y+LR+INAA
Sbjct  167   KADVEAVINQATMTGLPPNISDAHTVNGQTGAVPGCTSPG-FTLHVESGKTYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH +TVVEVDATY KPF T+TI I PGQTTN ++TA++  GKY++A SPF
Sbjct  226   LNDELFFKIAGHNITVVEVDATYTKPFSTDTIFIGPGQTTNALLTADKSIGKYLIAVSPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN TA A L Y G L+    VLT+TP  NATP  + F+D LRSLNSK+YPA V
Sbjct  286   MDTVVAVDNVTAIAFLRYKGTLAFSPPVLTTTPAINATPATSTFMDKLRSLNSKKYPANV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDH L+FT+G+G++PC +C   NGS+ VA +NNV+F+MPT ALLQAH++NI GVFT 
Sbjct  346   PLTVDHDLYFTIGVGIDPCATC--INGSKAVADINNVSFIMPTTALLQAHYYNISGVFTD  403

Query  659   DFPGNPPVAFNYTGAGPA-NLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP+ FNYTG   A NL+TT GT+ YRL +N+ VQ+VLQ T IIAPE+HP HLHGF
Sbjct  404   DFPAKPPITFNYTGNNTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGF  463

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G+GNF+P  DP KFNLVDPVERNT+ VP+ GW+AIRF+ADNPGVWF+HCHLEV
Sbjct  464   NFFVVGKGLGNFDPDNDPKKFNLVDPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEV  523

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  524   HTTWGLKMAFVVDNGKGPNES  544



>ref|XP_010454388.1| PREDICTED: laccase-16 [Camelina sativa]
Length=540

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/447 (69%), Positives = 360/447 (81%), Gaps = 9/447 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL EWW
Sbjct  85    QNYIHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLGEWW  144

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +INEA K G AP+ SDAHTINGH G ++NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  145   KSDVEELINEASKIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRAGKTYMLRIINAA  204

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YM+AA+ 
Sbjct  205   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMIAATT  264

Query  1022  FMDAPIAVDNQTATATLHYSGALSGL----RTVLTSTPPKNATPVANNFVDALRSLNSKQ  855
             F DA I  DN TATATLHY G  + +    +T+L S PP+NAT VA  F  +LRSLNS++
Sbjct  265   FTDAHIPYDNVTATATLHYIGPTATVPTFKKTILASLPPQNATWVAAKFTKSLRSLNSRE  324

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPARVP TVD SLFFTVGLG NPCPSC  +NG R+VA +NNVTF MP  ALLQAHFFNI 
Sbjct  325   YPARVPTTVDRSLFFTVGLGANPCPSC--SNGIRLVAGINNVTFTMPKTALLQAHFFNIS  382

Query  674   GVFTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHP  501
             GVFT DFP  P   ++YT       N  T  GT++YRLPYNATVQ+VLQ+T +I  +NHP
Sbjct  383   GVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTRLYRLPYNATVQIVLQNTAMILSDNHP  442

Query  500   VHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
              HLHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFM
Sbjct  443   FHLHGFNFFEVGRGLGNFNPEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFM  502

Query  320   HCHLEVHTTWGLKMAFLVDNGKGPNES  240
             HCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  503   HCHLELHTTWGLKMAFVVDNGHGPDQS  529



>ref|XP_004308920.1| PREDICTED: laccase-22-like [Fragaria vesca subsp. vesca]
Length=556

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/440 (67%), Positives = 359/440 (82%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+++Y FTITGQRGTL WHAH  WLR+T+HGA+VILPKLG PYPFP P  E +++L+EWW
Sbjct  109   QNFIYKFTITGQRGTLLWHAHDSWLRATLHGAIVILPKLGTPYPFPTPQKERIIILSEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAV++E+ +SGL PN+SDAHTINGHPGP   C SQG + L V+ GK+Y+LR+INAA
Sbjct  169   KSDVEAVVDESTQSGLPPNISDAHTINGHPGPAPGCSSQG-FTLHVESGKTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFFKIA H +TVVEVDA+Y KPF+T+TI I+PGQTT  ++ AN+  G Y+++ SPF
Sbjct  228   LNDDLFFKIARHNLTVVEVDASYTKPFQTDTIFISPGQTTTALLEANKDIGNYLISVSPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI +DN T+ ATL Y        T LTS PP+NATP+   F+D+LRSL+SK YPA V
Sbjct  288   MDAPIGIDNFTSIATLRYKHTPRNSTTFLTSIPPQNATPLTATFIDSLRSLDSKLYPANV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DHSLF TVG+G+NPC +C   NGS++VASVNNV+FVMPT+ALLQA+++NIKGV+T 
Sbjct  348   PLTIDHSLFLTVGVGINPCDTC--VNGSKLVASVNNVSFVMPTIALLQAYYYNIKGVYTL  405

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  PP  F+YTG  P N+Q   GTK+YRL YN+TVQ+VLQD  II PE+HP HLHGFN
Sbjct  406   DFPPKPPNPFDYTGTPPVNVQAANGTKLYRLGYNSTVQIVLQDIAIILPESHPTHLHGFN  465

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG G+GNF+P  D   FNLVDPVERNT+ VP+GGW AIRFRADNPG+WF+HCHLEVH
Sbjct  466   FFVVGTGLGNFDPDKDTKTFNLVDPVERNTVSVPTGGWTAIRFRADNPGIWFLHCHLEVH  525

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLVDNG+GPNES
Sbjct  526   TTWGLKMAFLVDNGEGPNES  545



>ref|NP_200699.1| laccase 16 [Arabidopsis thaliana]
 gb|AED97116.1| laccase 16 [Arabidopsis thaliana]
Length=523

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/447 (70%), Positives = 359/447 (80%), Gaps = 9/447 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL+EWW
Sbjct  68    QNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLSEWW  127

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +INEA + G AP+ SDAHTINGH G ++NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  128   KSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRAGKTYMLRIINAA  187

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YMVAA+ 
Sbjct  188   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATT  247

Query  1022  FMDAPIAVDNQTATATLHYSGALSGL----RTVLTSTPPKNATPVANNFVDALRSLNSKQ  855
             F DA I  DN TATATLHY G  S +    +TVL S PP+NAT VA  F  +LRSLNS +
Sbjct  248   FTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSLRSLNSLE  307

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPARVP TV+HSLFFTVGLG NPC SC   NG R+VA +NNVTF MP  ALLQAHFFNI 
Sbjct  308   YPARVPTTVEHSLFFTVGLGANPCQSCN--NGVRLVAGINNVTFTMPKTALLQAHFFNIS  365

Query  674   GVFTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHP  501
             GVFT DFP  P   ++YT       N  T  GTK+YRLPYNATVQ+VLQ+T +I  +NHP
Sbjct  366   GVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHP  425

Query  500   VHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
              HLHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFM
Sbjct  426   FHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFM  485

Query  320   HCHLEVHTTWGLKMAFLVDNGKGPNES  240
             HCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  486   HCHLELHTTWGLKMAFVVDNGHGPDQS  512



>gb|ABE66261.1| laccase/diphenol oxidase [Arabidopsis thaliana]
Length=530

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/447 (70%), Positives = 359/447 (80%), Gaps = 9/447 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL+EWW
Sbjct  75    QNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLSEWW  134

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +INEA + G AP+ SDAHTINGH G ++NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  135   KSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRAGKTYMLRIINAA  194

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YMVAA+ 
Sbjct  195   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATT  254

Query  1022  FMDAPIAVDNQTATATLHYSGALSGL----RTVLTSTPPKNATPVANNFVDALRSLNSKQ  855
             F DA I  DN TATATLHY G  S +    +TVL S PP+NAT VA  F  +LRSLNS +
Sbjct  255   FTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSLRSLNSLE  314

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPARVP TV+HSLFFTVGLG NPC SC   NG R+VA +NNVTF MP  ALLQAHFFNI 
Sbjct  315   YPARVPTTVEHSLFFTVGLGANPCQSCN--NGVRLVAGINNVTFTMPKTALLQAHFFNIS  372

Query  674   GVFTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHP  501
             GVFT DFP  P   ++YT       N  T  GTK+YRLPYNATVQ+VLQ+T +I  +NHP
Sbjct  373   GVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHP  432

Query  500   VHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
              HLHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFM
Sbjct  433   FHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFM  492

Query  320   HCHLEVHTTWGLKMAFLVDNGKGPNES  240
             HCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  493   HCHLELHTTWGLKMAFVVDNGHGPDQS  519



>gb|ABK28766.1| unknown [Arabidopsis thaliana]
Length=531

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/447 (70%), Positives = 359/447 (80%), Gaps = 9/447 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL+EWW
Sbjct  75    QNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLSEWW  134

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +INEA + G AP+ SDAHTINGH G ++NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  135   KSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRAGKTYMLRIINAA  194

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YMVAA+ 
Sbjct  195   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATT  254

Query  1022  FMDAPIAVDNQTATATLHYSGALSGL----RTVLTSTPPKNATPVANNFVDALRSLNSKQ  855
             F DA I  DN TATATLHY G  S +    +TVL S PP+NAT VA  F  +LRSLNS +
Sbjct  255   FTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSLRSLNSLE  314

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPARVP TV+HSLFFTVGLG NPC SC   NG R+VA +NNVTF MP  ALLQAHFFNI 
Sbjct  315   YPARVPTTVEHSLFFTVGLGANPCQSCN--NGVRLVAGINNVTFTMPKTALLQAHFFNIS  372

Query  674   GVFTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHP  501
             GVFT DFP  P   ++YT       N  T  GTK+YRLPYNATVQ+VLQ+T +I  +NHP
Sbjct  373   GVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHP  432

Query  500   VHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
              HLHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFM
Sbjct  433   FHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFM  492

Query  320   HCHLEVHTTWGLKMAFLVDNGKGPNES  240
             HCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  493   HCHLELHTTWGLKMAFVVDNGHGPDQS  519



>sp|Q1PDH6.2|LAC16_ARATH RecName: Full=Laccase-16; AltName: Full=Benzenediol:oxygen oxidoreductase 
16; AltName: Full=Diphenol oxidase 16; AltName: 
Full=Urishiol oxidase 16; Flags: Precursor [Arabidopsis thaliana]
Length=566

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/447 (70%), Positives = 359/447 (80%), Gaps = 9/447 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL+EWW
Sbjct  111   QNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLSEWW  170

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +INEA + G AP+ SDAHTINGH G ++NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  171   KSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRAGKTYMLRIINAA  230

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YMVAA+ 
Sbjct  231   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATT  290

Query  1022  FMDAPIAVDNQTATATLHYSGALSGL----RTVLTSTPPKNATPVANNFVDALRSLNSKQ  855
             F DA I  DN TATATLHY G  S +    +TVL S PP+NAT VA  F  +LRSLNS +
Sbjct  291   FTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSLRSLNSLE  350

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPARVP TV+HSLFFTVGLG NPC SC   NG R+VA +NNVTF MP  ALLQAHFFNI 
Sbjct  351   YPARVPTTVEHSLFFTVGLGANPCQSCN--NGVRLVAGINNVTFTMPKTALLQAHFFNIS  408

Query  674   GVFTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHP  501
             GVFT DFP  P   ++YT       N  T  GTK+YRLPYNATVQ+VLQ+T +I  +NHP
Sbjct  409   GVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHP  468

Query  500   VHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
              HLHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFM
Sbjct  469   FHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFM  528

Query  320   HCHLEVHTTWGLKMAFLVDNGKGPNES  240
             HCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  529   HCHLELHTTWGLKMAFVVDNGHGPDQS  555



>emb|CAA74103.1| laccase [Populus trichocarpa]
Length=555

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/441 (67%), Positives = 360/441 (82%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ WLR+T+HGA+VI PK GVPYPFPKPD E +++L+EWW
Sbjct  107   QSYLYNFTLTGQRGTLLWHAHISWLRATIHGAIVIFPKKGVPYPFPKPDKEKIIILSEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAV+N+A  +GL PN+SDAHT+NGH G V  C S G + L V+ GK+Y+LR+INAA
Sbjct  167   KADVEAVVNQATMTGLPPNISDAHTVNGHTGAVPGCTSPG-FTLHVESGKTYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH +TVVEVDAT+ KPF T+TI I PGQTTN ++TA++  GKY++A SPF
Sbjct  226   LNDELFFKIAGHNITVVEVDATFTKPFSTDTIFIGPGQTTNALLTADKSIGKYLIAVSPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN TA A L Y+  L      LT+TP  NATP  + F+D LRSLNSK+YPA V
Sbjct  286   MDTVVAVDNVTAIAFLRYNEPLHSPHLSLTTTPAINATPATSTFMDKLRSLNSKKYPANV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDH L+FT+G+G++PC +C   NGS+ VA +NNV+F+MPT ALLQAH++NI GVFT 
Sbjct  346   PLTVDHDLYFTIGVGIDPCATC--TNGSKAVADINNVSFIMPTTALLQAHYYNISGVFTD  403

Query  659   DFPGNPPVAFNYTGAGPA-NLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP++FNYTG   A NL+TT GT+ YRL +N+ VQ+VLQ T IIAPE+HP HLHGF
Sbjct  404   DFPAKPPISFNYTGNNTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGF  463

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+GIGNF+P  DP KFNL DPVERNT+ VP+ GW+AIRF+ADNPGVWF+HCHLEV
Sbjct  464   NFFVVGKGIGNFDPDNDPKKFNLADPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEV  523

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  524   HTTWGLKMAFVVDNGKGPNES  544



>ref|XP_010067496.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW65638.1| hypothetical protein EUGRSUZ_G03028 [Eucalyptus grandis]
Length=561

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/440 (65%), Positives = 361/440 (82%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ WLRST+HGA+VILPK GVPYPFPKP  E  ++  EWW
Sbjct  114   QSYIYNFTLTGQRGTLLWHAHITWLRSTLHGAIVILPKRGVPYPFPKPYKEKTIIFGEWW  173

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+DTE V++++++SG+ PN SD+HTING+PGP+ NC SQG Y+L V+ GK+Y+LR++NAA
Sbjct  174   KADTELVLSQSVQSGMPPNKSDSHTINGYPGPLPNCSSQG-YELQVESGKTYLLRIVNAA  232

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +N+ELFFKIAGH +TVVEVDA+Y KPF  +TI IAPGQTTN ++ A++  G Y++A SPF
Sbjct  233   VNDELFFKIAGHNLTVVEVDASYTKPFSIDTIFIAPGQTTNALLAADKSGGSYIMAISPF  292

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN TAT  + Y G ++   TV  S P  NAT    +F+++LRSLNSKQYPA+V
Sbjct  293   MDTVVAVDNLTATGIVQYKGTIASAPTVQASIPAINATSFEFSFINSLRSLNSKQYPAKV  352

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSLF T+  G+NPC +C   NG ++VA++NNV+FVMP+  +L+AH++ IKGV+T 
Sbjct  353   PLTVDHSLFITMSAGVNPCSTC--VNGKKLVAALNNVSFVMPSTDILEAHYYKIKGVYTD  410

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNYTG  P+N+QTT GT+VY+L YN+TVQ+VLQ T IIAPENHP HLHGFN
Sbjct  411   DFPGNPPTPFNYTGTPPSNMQTTNGTRVYKLAYNSTVQVVLQGTSIIAPENHPTHLHGFN  470

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF +G+G+GNF+P  DP  FNLVDPVERNTIGVP+ GW AIRFRADNPGVWF+HCHLEVH
Sbjct  471   FFGIGKGLGNFDPNKDPKNFNLVDPVERNTIGVPTAGWTAIRFRADNPGVWFLHCHLEVH  530

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKM F+V++G GPNES
Sbjct  531   TTWGLKMVFIVEDGDGPNES  550



>gb|KHG28836.1| Laccase-22 [Gossypium arboreum]
Length=574

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/440 (67%), Positives = 354/440 (80%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+++YNFT+TGQRGTL WHAH+ WLRSTVHGA+VILPK GVPYPFPKP  E V+VL EWW
Sbjct  126   QNFLYNFTLTGQRGTLLWHAHISWLRSTVHGAIVILPKKGVPYPFPKPYKEKVIVLGEWW  185

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+DTEAV+N+A+++GL PN+SDAHTINGHPGPV NC S   Y L V+ GK+Y+LRVINAA
Sbjct  186   KADTEAVVNQAMQTGLPPNISDAHTINGHPGPVPNCSSDDAYTLHVETGKTYLLRVINAA  245

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIA H +TVVEVDA Y KP +T+T+ + PGQTT  ++ A+QG GKY++A SPF
Sbjct  246   LNDELFFKIANHNLTVVEVDACYTKPLETDTLFLGPGQTTTALLKADQGIGKYLIAISPF  305

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN T    L Y+  L+   T     P  NATP+ + F D+LRSLNSKQY A V
Sbjct  306   MDTVVAVDNLTGMGYLRYNHTLAFTPTTFVPIPSVNATPLTSVFSDSLRSLNSKQYLANV  365

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P T+DHSLFFT+G+G+NPC +C   NGSR VA++NNV+FVMPT A+LQAH++ I GVFT 
Sbjct  366   PLTIDHSLFFTIGVGINPCATC--FNGSRAVAAINNVSFVMPTTAILQAHYYGINGVFTD  423

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP  P + FNYTG  P+ +QT  GTKVYRL YN+TVQLV+Q   I+APE+HP HLHG N
Sbjct  424   DFPAKPAIPFNYTGTPPSGIQTMNGTKVYRLAYNSTVQLVIQGNTIVAPESHPTHLHGSN  483

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG+GNF+P  DP KFNLVDPVERNT+ VP+ GW AIRFRADNPG+WF HCHLEVH
Sbjct  484   FFVVGRGVGNFDPDKDPLKFNLVDPVERNTVSVPTAGWTAIRFRADNPGIWFFHCHLEVH  543

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NGKGPNES
Sbjct  544   TTWGLKMAFLVENGKGPNES  563



>ref|XP_010483503.1| PREDICTED: laccase-16-like isoform X3 [Camelina sativa]
Length=567

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/446 (69%), Positives = 357/446 (80%), Gaps = 8/446 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL EWW
Sbjct  113   QNYIHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLGEWW  172

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +IN A K G AP+ SDAHTINGH G ++NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  173   KSDVEELINVASKIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRAGKTYMLRIINAA  232

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YMVAA+ 
Sbjct  233   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMVAATT  292

Query  1022  FMDAPIAVDNQTATATLHYSGALSG-----LRTVLTSTPPKNATPVANNFVDALRSLNSK  858
             F DA I  DN TATATLHY G  +       +T+L S PP+NAT VA  F  +LRSLNS+
Sbjct  293   FTDAHIPYDNVTATATLHYIGPTATSVPTFKKTILASLPPQNATWVAAKFTKSLRSLNSR  352

Query  857   QYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNI  678
             +YPARVP TVD SLFFTVGLG NPCPSC  + G R+VA +NNVTF MP  ALLQAHFFNI
Sbjct  353   EYPARVPSTVDRSLFFTVGLGANPCPSC--SKGIRLVAGINNVTFTMPKTALLQAHFFNI  410

Query  677   KGVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPV  498
              GVFT DFP  P   ++YT     N  T  GTK+YRLPYNATVQ+VLQ+T +I  +NHP 
Sbjct  411   SGVFTDDFPAKPLNPYDYTAPLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHPF  470

Query  497   HLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMH  318
             HLHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFMH
Sbjct  471   HLHGFNFFEVGRGLGNFNPEKDPKIFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFMH  530

Query  317   CHLEVHTTWGLKMAFLVDNGKGPNES  240
             CHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  531   CHLELHTTWGLKMAFVVDNGHGPDQS  556



>emb|CAC14719.1| laccase [Populus trichocarpa]
Length=555

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/441 (67%), Positives = 359/441 (81%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ WLR+T+HGA+VI PK GVPYPFPKPD E +++L+EWW
Sbjct  107   QSYLYNFTLTGQRGTLLWHAHISWLRATIHGAIVIFPKKGVPYPFPKPDKEKIIILSEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAV+N+A  +GL PN+SDAHT+NGH G V  C S G + L V+ GK+Y+LR+INAA
Sbjct  167   KADVEAVVNQATMTGLPPNISDAHTVNGHTGAVPGCTSPG-FTLHVESGKTYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH +TVVEVDAT+ KPF  +TI I PGQTTN ++TA++  GKY++A SPF
Sbjct  226   LNDELFFKIAGHNITVVEVDATFTKPFSADTIFIGPGQTTNALLTADKSIGKYLIAVSPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN TA A L Y+  L      LT+TP  NATP  + F+D LRSLNSK+YPA V
Sbjct  286   MDTVVAVDNVTAIAFLRYNEPLHSPHLSLTTTPAINATPATSTFMDKLRSLNSKKYPANV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDH L+FT+G+G++PC +C   NGS+ VA +NNV+F+MPT ALLQAH++NI GVFT 
Sbjct  346   PLTVDHDLYFTIGVGIDPCATC--TNGSKAVADINNVSFIMPTTALLQAHYYNISGVFTD  403

Query  659   DFPGNPPVAFNYTGAGPA-NLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP++FNYTG   A NL+TT GT+ YRL +N+ VQ+VLQ T IIAPE+HP HLHGF
Sbjct  404   DFPAKPPISFNYTGNNTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPESHPFHLHGF  463

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+GIGNF+P  DP KFNL DPVERNT+ VP+ GW+AIRF+ADNPGVWF+HCHLEV
Sbjct  464   NFFVVGKGIGNFDPDNDPKKFNLADPVERNTVSVPTAGWIAIRFKADNPGVWFLHCHLEV  523

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+VDNGKGPNES
Sbjct  524   HTTWGLKMAFVVDNGKGPNES  544



>gb|EPS61127.1| laccase 3, partial [Genlisea aurea]
Length=551

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/440 (66%), Positives = 359/440 (82%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             +SY YNFT+TGQRGTL +H+H+ W R+T+HGA+VILP+L   YPFPKPD E +++LAEWW
Sbjct  104   KSYTYNFTLTGQRGTLLYHSHINWQRATLHGAIVILPRLRDSYPFPKPDDEKIIILAEWW  163

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EAVIN A+  GL PNVSDAHTING PGP+ NC S G Y L V+ GK+Y+LR+INAA
Sbjct  164   KSDVEAVINSAMSQGLPPNVSDAHTINGLPGPLPNCTSPG-YTLHVESGKTYLLRIINAA  222

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNEELFFKIA H+ TVVEVDA Y KPF T+T+ I PGQTTNV++ A+Q  GKY++A SPF
Sbjct  223   LNEELFFKIADHKFTVVEVDARYTKPFTTDTLFIGPGQTTNVLLRADQKIGKYLIAISPF  282

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +A DNQ ATA L Y+  ++   T LT  PP+NAT V   FVD+LRS+NS  +PA V
Sbjct  283   MDTIVATDNQRATAFLRYNNTVAFSPTNLTPLPPRNATSVTTTFVDSLRSINSNTFPANV  342

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P+ +DHSL   +G+G+NPCPSC   NG+R+VA +NNV+FVMPT ALLQAH++N+ G+FTT
Sbjct  343   PKKIDHSLLLAIGVGVNPCPSC--FNGTRLVADINNVSFVMPTTALLQAHYYNMSGIFTT  400

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP+ +NYTG  P N+QT  GTK+YRL YN+TV++V Q T IIAPE+HP HLHGF+
Sbjct  401   DFPGNPPIPYNYTGTPPRNMQTVNGTKLYRLAYNSTVEIVFQGTSIIAPESHPTHLHGFD  460

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             F+ VG+G+GN++PK DP KFNLVDPVERNT+ VP+GGW AIRFRADNPG+WF+HCHLEVH
Sbjct  461   FYVVGKGVGNYDPKNDPKKFNLVDPVERNTVSVPTGGWTAIRFRADNPGIWFLHCHLEVH  520

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NG+GPN +
Sbjct  521   TTWGLKMAFLVENGEGPNAT  540



>ref|XP_008441433.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=553

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/439 (66%), Positives = 361/439 (82%), Gaps = 2/439 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+  QRGTL WHAH+ W+R+TVHGA+VILPKLGVPYPFP+P  + +++L EWW
Sbjct  105   QNYVYNFTLNSQRGTLLWHAHISWIRATVHGAIVILPKLGVPYPFPRPHKQKIIILGEWW  164

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EA++N++ + G  PNVSDAHTINGHPG V  C ++GG+ L+V+ GK+Y+LR+INAA
Sbjct  165   KSDVEAMVNKSTQLGQPPNVSDAHTINGHPGHVPGCAAKGGFTLNVETGKTYLLRIINAA  224

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNE+ FFKIA H  T+VEVDA+Y KPFKTNTI I+PGQTTN ++TA++  GKY++ ASPF
Sbjct  225   LNEDFFFKIASHHFTIVEVDASYTKPFKTNTIFISPGQTTNALITAHKPIGKYLITASPF  284

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+A+DN TATA L Y         V T  PP N+T + N F+++LRSLNS++YPA+V
Sbjct  285   MDAPVAIDNLTATAFLRYKRTPRNSPIVFTKIPPPNSTFLTNQFINSLRSLNSEEYPAKV  344

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+LFFTVG+G NPC +C   NG R+VA+VNNVTF+MP ++LLQ+H++NI G+FT 
Sbjct  345   PLFIDHNLFFTVGVGANPCETC--VNGMRLVAAVNNVTFIMPKISLLQSHYYNIPGIFTD  402

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  +NYTG  PAN QT+ GTK+YRL +N+TVQLVLQDT +IAPE+HP+HLHGFN
Sbjct  403   DFPANPPFVYNYTGKPPANNQTSNGTKIYRLRFNSTVQLVLQDTAVIAPESHPIHLHGFN  462

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
              F VG G+GNF+P  +   FNLVDPVERNT GVP+GGW AIRFRADNPGVWF+HCHLEVH
Sbjct  463   VFIVGTGLGNFDPIENSKGFNLVDPVERNTFGVPNGGWTAIRFRADNPGVWFLHCHLEVH  522

Query  299   TTWGLKMAFLVDNGKGPNE  243
             TTWGL+MAFLV+NG+GPNE
Sbjct  523   TTWGLRMAFLVENGEGPNE  541



>ref|XP_010443638.1| PREDICTED: laccase-16-like [Camelina sativa]
Length=568

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/447 (69%), Positives = 358/447 (80%), Gaps = 9/447 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL EWW
Sbjct  113   QNYIHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLGEWW  172

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +IN A K G AP+ SDAHTINGH G ++NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  173   KSDVEELINVASKIGTAPSASDAHTINGHSGSLSNCPSQSSYGLPVRAGKTYMLRIINAA  232

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YM+AA+ 
Sbjct  233   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMIAATT  292

Query  1022  FMDAPIAVDNQTATATLHYSGALSGL----RTVLTSTPPKNATPVANNFVDALRSLNSKQ  855
             F DA I  DN TATATLHY G  + +    +T+L S PP+NAT VA  F  +LRSLNS++
Sbjct  293   FTDAHIPYDNVTATATLHYIGPTATVPTFKKTILASLPPQNATWVAAKFTKSLRSLNSRE  352

Query  854   YPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIK  675
             YPARVP TVD SLFFTVGLG NPCPSC  +NG R+VA +NNVTF MP  ALLQAHFFNI 
Sbjct  353   YPARVPSTVDRSLFFTVGLGSNPCPSC--SNGIRLVAGINNVTFTMPKTALLQAHFFNIS  410

Query  674   GVFTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHP  501
             GVFT DFP  P   ++YT       N  T  GTK+YRLPYNATVQ+VLQ+T +I  +NHP
Sbjct  411   GVFTDDFPAKPLNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNHP  470

Query  500   VHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
              HLHGFNFF VGRG+GNFN + DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFM
Sbjct  471   FHLHGFNFFEVGRGLGNFNSEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWFM  530

Query  320   HCHLEVHTTWGLKMAFLVDNGKGPNES  240
             HCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  531   HCHLELHTTWGLKMAFVVDNGHGPDQS  557



>ref|XP_010483501.1| PREDICTED: laccase-16-like isoform X1 [Camelina sativa]
 ref|XP_010483502.1| PREDICTED: laccase-16-like isoform X2 [Camelina sativa]
Length=569

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/448 (69%), Positives = 357/448 (80%), Gaps = 10/448 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y++NFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL EWW
Sbjct  113   QNYIHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLGEWW  172

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +IN A K G AP+ SDAHTINGH G ++NCPSQ  Y L V  GK+YMLR+INAA
Sbjct  173   KSDVEELINVASKIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRAGKTYMLRIINAA  232

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGK-YMVAASP  1023
             LNEELFFKIAGH +TVVEVDA Y KP+KT+T+ IAPGQTTNV++TAN  +G  YMVAA+ 
Sbjct  233   LNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANANAGSNYMVAATT  292

Query  1022  FMDAPIAVDNQTATATLHYSGALSG-----LRTVLTSTPPKNATPVANNFVDALRSLNSK  858
             F DA I  DN TATATLHY G  +       +T+L S PP+NAT VA  F  +LRSLNS+
Sbjct  293   FTDAHIPYDNVTATATLHYIGPTATSVPTFKKTILASLPPQNATWVAAKFTKSLRSLNSR  352

Query  857   QYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNI  678
             +YPARVP TVD SLFFTVGLG NPCPSC  + G R+VA +NNVTF MP  ALLQAHFFNI
Sbjct  353   EYPARVPSTVDRSLFFTVGLGANPCPSC--SKGIRLVAGINNVTFTMPKTALLQAHFFNI  410

Query  677   KGVFTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENH  504
              GVFT DFP  P   ++YT       N  T  GTK+YRLPYNATVQ+VLQ+T +I  +NH
Sbjct  411   SGVFTDDFPAKPLNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNH  470

Query  503   PVHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  324
             P HLHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWF
Sbjct  471   PFHLHGFNFFEVGRGLGNFNPEKDPKIFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWF  530

Query  323   MHCHLEVHTTWGLKMAFLVDNGKGPNES  240
             MHCHLE+HTTWGLKMAF+VDNG GP++S
Sbjct  531   MHCHLELHTTWGLKMAFVVDNGHGPDQS  558



>ref|XP_011039810.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=556

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/441 (66%), Positives = 358/441 (81%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ WLR+T+HGA+VILP+ GVPYPFPKPD E +++L EWW
Sbjct  108   QSYLYNFTLTGQRGTLLWHAHISWLRATIHGAIVILPQKGVPYPFPKPDKEKIIILGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAV+N+A ++GL PN+SDAH +NG  G V  CPS G + L V+ GK+Y+LR+INAA
Sbjct  168   KADVEAVVNQATQTGLPPNISDAHIVNGQTGAVPGCPSPG-FTLHVESGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH +TVVEVDA Y KP  T+TI I PGQTTN ++TA++  GKY++A SPF
Sbjct  227   LNDELFFKIAGHNITVVEVDAAYTKPLSTDTIFIGPGQTTNALLTADKRVGKYLMAVSPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN TA A L Y G ++    VLT+TP  NATPV + F+D LRSLNSK+YPA V
Sbjct  287   MDTVVAVDNVTAIAFLRYKGTIAFSPPVLTTTPAINATPVTSTFMDNLRSLNSKKYPANV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL+FT+G+G++PC +C   NGS+ V ++NN++F+MPT ALLQAH+++I GVFT 
Sbjct  347   PLTVDHSLYFTIGVGIDPCATC--VNGSKAVGAINNISFIMPTTALLQAHYYSISGVFTD  404

Query  659   DFPGNPPVAFNYTGAGPA-NLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP +FNYTG   A NLQT  GT++YRL +N+TVQLVLQ T IIAPE+HP HLHGF
Sbjct  405   DFPAMPPNSFNYTGNNTALNLQTNNGTRIYRLAFNSTVQLVLQGTTIIAPESHPFHLHGF  464

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G GNF+   DP KFNL DPVERNTI VP+ GW AIRFRADNPGVWF+HCHLEV
Sbjct  465   NFFVVGKGFGNFDADNDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVWFLHCHLEV  524

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKM F+VDNG+GP+ES
Sbjct  525   HTTWGLKMVFVVDNGEGPDES  545



>ref|XP_002311202.1| laccase family protein [Populus trichocarpa]
 gb|EEE88569.1| laccase family protein [Populus trichocarpa]
Length=556

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/441 (66%), Positives = 358/441 (81%), Gaps = 4/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ WLR+T+HGA+VILP+ GVPYPFPKPD E +++L EWW
Sbjct  108   QSYLYNFTLTGQRGTLLWHAHISWLRATIHGAIVILPQKGVPYPFPKPDKEKIIILGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAV+N+A ++GL PN+SDAH +NG  G V  CPS G + L V+ GK+Y+LR+INAA
Sbjct  168   KADVEAVVNQATQTGLPPNISDAHIVNGQTGAVPGCPSPG-FTLHVESGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH +TVVEVDA Y KPF T+TI I PGQTTN ++TA++  GKY++A SPF
Sbjct  227   LNDELFFKIAGHNITVVEVDAAYTKPFSTDTIFIGPGQTTNALLTADKSVGKYLMAVSPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN TA A L Y G ++    VLT+TP  NATPV + F+D LRSLNSK++PA V
Sbjct  287   MDTVVAVDNVTAIAFLRYKGTIAFSPPVLTTTPAINATPVTSTFMDNLRSLNSKKFPANV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL+FT+G+G++PC +C   NGS+ V ++NN++F+MPT ALLQAH+++I GVFT 
Sbjct  347   PLTVDHSLYFTIGVGIDPCATC--VNGSKAVGAINNISFIMPTTALLQAHYYSISGVFTD  404

Query  659   DFPGNPPVAFNYTGAGPA-NLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP +FNYTG   A NLQT  GT+ YRL +N+TVQLVLQ T IIAPE+HP HLHGF
Sbjct  405   DFPAMPPNSFNYTGNNTALNLQTINGTRTYRLAFNSTVQLVLQGTTIIAPESHPFHLHGF  464

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG+G GNF+   DP KFNL DPVERNTI VP+ GW AIRFRADNPGVWF+HCHLEV
Sbjct  465   NFFVVGKGFGNFDADNDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVWFLHCHLEV  524

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKM F+VDNG+GP+ES
Sbjct  525   HTTWGLKMVFVVDNGEGPDES  545



>ref|XP_002530417.1| laccase, putative [Ricinus communis]
 gb|EEF31987.1| laccase, putative [Ricinus communis]
Length=554

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/440 (66%), Positives = 360/440 (82%), Gaps = 3/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK GVPYPFPKP+ E ++VL EWW
Sbjct  107   QSYLYNFTLTGQRGTLLWHAHISWLRTTVHGAIVILPKKGVPYPFPKPNKEKLIVLGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+DTEAVI +A+++GLAPN+SD+HTINGH GPV  C S G Y L V+ GK+Y++R++NAA
Sbjct  167   KTDTEAVIKQAMQTGLAPNISDSHTINGHTGPVPGCTSPG-YTLHVERGKTYLIRLVNAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             +N+ELFFKIAGH +TVVEVDA Y KPF T+ + + PGQTT+ ++TA+Q +GKY++A SPF
Sbjct  226   VNDELFFKIAGHNLTVVEVDACYTKPFNTDIVFVGPGQTTSFLLTADQPTGKYLIAVSPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MD  +AVDN T  A L Y   +     VLT+TP  NAT   + F+D LRSLNSK+YP  V
Sbjct  286   MDTIVAVDNATGIAFLRYKDTVKFSPPVLTTTPAINATSETSIFLDKLRSLNSKRYPCNV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P TVDHSL+FT+G+G+N CP+C   NGSR V  +NNV+FVMPT+ LL+AH++NI GVFT 
Sbjct  346   PLTVDHSLYFTIGVGINSCPTC--VNGSRAVGDINNVSFVMPTMDLLEAHYYNISGVFTD  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG       T+ GT++YRL +N+TVQ+VLQ TGI+APE+HP HLHGFN
Sbjct  404   DFPANPPTPFNYTGNYTGGFATSNGTRLYRLAFNSTVQVVLQGTGILAPESHPFHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FFA+GRG+GN++P  DP KFNLVDPVERNT  VP+GGWVAIRFRADNPGVWF+HCHLEVH
Sbjct  464   FFAIGRGVGNYDPVNDPKKFNLVDPVERNTNSVPTGGWVAIRFRADNPGVWFLHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLKMAF+VDNG+GPN+S
Sbjct  524   TSWGLKMAFVVDNGEGPNDS  543



>ref|XP_006602642.1| PREDICTED: laccase-4-like isoform X2 [Glycine max]
Length=533

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/417 (75%), Positives = 355/417 (85%), Gaps = 4/417 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNFT+TGQRGTL WHAHV WLRST+HGA+VILPK GVPYPFPKPD E VV+L EWW
Sbjct  106   QSYLYNFTLTGQRGTLLWHAHVNWLRSTLHGAIVILPKRGVPYPFPKPDKELVVILGEWW  165

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPG--PVTNCPSQGGYKLSVDPGKSYMLRVIN  1206
             KSDTE VINEA+KSGLAPNVSDAHTING PG   V NC +Q  YKL V+ GK+Y+LR+IN
Sbjct  166   KSDTEDVINEALKSGLAPNVSDAHTINGLPGIVSVANCSTQDVYKLPVESGKTYLLRIIN  225

Query  1205  AALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAAS  1026
             AALNEELFFKIAGH  TVVEVDA+YVKPFKT+T+ IAPGQTTN ++TA+Q SGKY + AS
Sbjct  226   AALNEELFFKIAGHPFTVVEVDASYVKPFKTDTLSIAPGQTTNALLTADQNSGKYTIVAS  285

Query  1025  PFMDAPI-AVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
              FMD+P+ AVDN TATATLHY+G L+   T+LT+ PP+NAT VANNF ++L+SLNSK+YP
Sbjct  286   TFMDSPVVAVDNLTATATLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYP  345

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
             A+VPQ VDHSL  TVGLG+NPCPSC   NGSRVVA+VNNVTFVMPT ALLQAH+FNIKGV
Sbjct  346   AKVPQKVDHSLLLTVGLGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGV  405

Query  668   FTTDFPGNPPVAFNYTGAGP-ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHL  492
             FTTDFPGNP   +NYT   P A  QTT GTK YRL +N+TVQ+VLQDTG+IAPE+HPVHL
Sbjct  406   FTTDFPGNPSHVYNYTATPPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPESHPVHL  465

Query  491   HGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
             HGFNFF VG G+GN++PKTD   FNL DPVERNTIGVP+GGWVA RFRADNPG + M
Sbjct  466   HGFNFFVVGSGVGNYDPKTDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGAYNM  522



>gb|AAK37829.1|AF132125_1 laccase [Pinus taeda]
Length=555

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/440 (66%), Positives = 356/440 (81%), Gaps = 4/440 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q++VYNFTITGQRGTLFWHAH+LWLR+T++G +VILP  G PYPFPKP  E +++L EWW
Sbjct  109   QTFVYNFTITGQRGTLFWHAHILWLRATLYGPIVILPPKG-PYPFPKPHKEVILILGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              SDTE VIN+A+ SGLAPN SD+HTING  GP+  CP++  + LSV+P K+Y+LR+I A 
Sbjct  168   NSDTETVINQAMNSGLAPNSSDSHTINGKAGPLFYCPTKDTFALSVEPDKTYLLRIIKA-  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+E+FF +A H +TVVEVDA Y KPF+T  IV APGQTTN ++  ++ +G+Y +AA  F
Sbjct  227   LNQEVFFGVANHHLTVVEVDAVYTKPFETKAIVSAPGQTTNALLHTDKKAGRYFMAARVF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATA L Y+G+ + L  V+   P  N T  ++NF +AL+SLNS QYPA+V
Sbjct  287   MDAPIAVDNKTATAILQYTGSSNSLNPVMPLIPALNDTAFSSNFSNALKSLNSPQYPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQ++D +LFFTVGL LN CP+C   NG+R  ASVNN++F MPT+ALLQ+H+FNI GVFTT
Sbjct  347   PQSIDRNLFFTVGLALNACPTC--INGARPAASVNNISFTMPTIALLQSHYFNISGVFTT  404

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  P NLQ++ GT++ R+P+N+TVQLVLQDT  +  ENHPVHLHGFN
Sbjct  405   DFPDNPPATFNYTGTPPKNLQSSNGTRLSRIPFNSTVQLVLQDTSALTVENHPVHLHGFN  464

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VGRG GN+NPK DP KFNLVDP ERNT+GVP+GGW  IRFRADNPGVWFMHCHLEVH
Sbjct  465   FFIVGRGFGNYNPKKDPAKFNLVDPPERNTVGVPTGGWTVIRFRADNPGVWFMHCHLEVH  524

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NG GP +S
Sbjct  525   TTWGLKMAFLVENGHGPEQS  544



>gb|KGN45770.1| hypothetical protein Csa_6G009490 [Cucumis sativus]
Length=555

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 354/439 (81%), Gaps = 2/439 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT++ QRGTL WHAH  W+R+TVHGA+VI PK GVPYPFP P  +  ++L EWW
Sbjct  107   QNYVYNFTLSSQRGTLLWHAHFSWIRATVHGAIVIFPKHGVPYPFPHPYKQKTIILGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD EA++N++ + G  PNVSDA TINGHPG V  C ++ G+ L V+ GK+Y+LR+INAA
Sbjct  167   KSDVEAMVNKSTQLGQPPNVSDAQTINGHPGHVPGCATKRGFTLHVETGKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LNE+ FFKIA H  T+VEVDA+Y KPFKTNTI I+PGQTTN +V A++  GKY++AASPF
Sbjct  227   LNEDFFFKIASHHFTIVEVDASYTKPFKTNTIFISPGQTTNALVRAHRPIGKYLIAASPF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+A+DN TATA L Y         V T  PP N+T + N F D+LRSLNS++YPA+V
Sbjct  287   MDAPVAIDNLTATAFLRYKRTPKNSPIVFTHIPPPNSTLLTNQFTDSLRSLNSEEYPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +DH+LFFTVG+G+NPC +C   NG R+VA+VNNVTF+MP ++LLQ+H++NI GVFT 
Sbjct  347   PLFIDHNLFFTVGVGVNPCETC--VNGVRLVAAVNNVTFLMPQISLLQSHYYNIPGVFTD  404

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  ++YTG  P N QT+ GTKVYRL +N+TVQLVLQDT +IAPE+HP+HLHGFN
Sbjct  405   DFPANPPFVYDYTGKPPTNNQTSNGTKVYRLRFNSTVQLVLQDTAVIAPESHPIHLHGFN  464

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
              F VG G+GNF+P  D   FNLVDPVERNT GVP+GGW+AIRFRADNPGVWF+HCHLEVH
Sbjct  465   VFIVGTGLGNFDPIEDWKGFNLVDPVERNTFGVPNGGWIAIRFRADNPGVWFLHCHLEVH  524

Query  299   TTWGLKMAFLVDNGKGPNE  243
             TTWGL+MAFLV+NG+GPNE
Sbjct  525   TTWGLRMAFLVENGEGPNE  543



>gb|ACN39933.1| unknown [Picea sitchensis]
Length=559

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/441 (66%), Positives = 352/441 (80%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY YNFTITGQRGTL+WHAH+LWLR+T+HGA+VILP     YPFPKP  E  ++L EWW
Sbjct  110   QSYAYNFTITGQRGTLWWHAHILWLRATIHGAIVILPPKHHLYPFPKPHKEITLLLGEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +D EAVINEA+KSG APNVSDAHTING PGP+  CP++  + +SV+ GK+Y+LR+IN A
Sbjct  170   NADVEAVINEALKSGGAPNVSDAHTINGKPGPLFKCPTKDTFVVSVEHGKTYLLRIINVA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF +A H + VVEVDA Y KP +T +IVIAPGQTTN ++ AN+GSG+Y +A   F
Sbjct  230   LNDELFFDVADHHLKVVEVDAVYTKPLRTKSIVIAPGQTTNALLYANKGSGRYFIATRTF  289

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTV-LTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             MDAP+AVDN+TATA L Y  + S    + +   P +N T  A NF ++LRSLNS ++PA+
Sbjct  290   MDAPVAVDNKTATAILQYVNSNSNTDFIAMPRIPSQNDTSFATNFSNSLRSLNSARFPAK  349

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VPQTVD  L FTVGL ++ CP+C   NGSRV AS+NN++FVMP ++LLQAHFFNI GVFT
Sbjct  350   VPQTVDRHLLFTVGLAMDSCPTCN--NGSRVAASINNISFVMPKISLLQAHFFNITGVFT  407

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             TDFP  PP  FNYTGA P N  T+ GT++ R+P+N+TVQLVLQ T ++A E HP+HLHGF
Sbjct  408   TDFPDRPPTPFNYTGAPPQNPMTSKGTRLTRIPFNSTVQLVLQGTSVLAMEKHPLHLHGF  467

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRG GN+NP  DP KFNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLEV
Sbjct  468   NFFIVGRGFGNYNPNKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEV  527

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+V+NG GPN+S
Sbjct  528   HTTWGLKMAFVVENGDGPNQS  548



>ref|XP_010098906.1| hypothetical protein L484_006544 [Morus notabilis]
 gb|EXB76109.1| hypothetical protein L484_006544 [Morus notabilis]
Length=545

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/440 (66%), Positives = 354/440 (80%), Gaps = 12/440 (3%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK GVPYPFPKPD E +++LAEWW
Sbjct  107   QNYVYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRGVPYPFPKPDKEKIIILAEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             K+D EAV+N+A +SG  PNVSDAHTING PG V +C SQG Y L V  GK+Y+LR+INAA
Sbjct  167   KADVEAVVNQATQSGQPPNVSDAHTINGFPGQVPSCSSQG-YTLHVKTGKTYLLRIINAA  225

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFFKIAGH +TVVE DA+Y KPF+T+TI ++PGQTTN ++  +Q  GKY++A +PF
Sbjct  226   LNDELFFKIAGHNLTVVEADASYTKPFETDTIFLSPGQTTNALLKTDQAIGKYLIAINPF  285

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI  +N T+ ATL Y       +T+LT  PP+N TP    F+D+LRSLNSKQYPA+V
Sbjct  286   MDAPIGYNNVTSFATLRYKKTPPNPKTILTKIPPQNDTPKTKAFIDSLRSLNSKQYPAKV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  V HSLF T+ +G+NPC +C   NG+++VA +NNV+FV+P++ALLQAH++NI  VFT 
Sbjct  346   PLNVHHSLFLTIAVGVNPCDTC--VNGTKLVADINNVSFVLPSIALLQAHYYNIGAVFTD  403

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPGNPP  FNYTG  PAN+QTT GT++YRL YN++VQ+VLQ T +IAPENHP HLHGFN
Sbjct  404   DFPGNPPFRFNYTGPSPANIQTTNGTRLYRLAYNSSVQVVLQGTSVIAPENHPTHLHGFN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             F+ VG G+GNF+P  DP KFNLVDPVERNT+GVP+ GW AIRFRADNP         EVH
Sbjct  464   FYVVGMGLGNFDPVEDPKKFNLVDPVERNTLGVPTAGWAAIRFRADNP---------EVH  514

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAFLV+NG GPNES
Sbjct  515   TTWGLKMAFLVENGFGPNES  534



>ref|XP_010690098.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=565

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/445 (66%), Positives = 355/445 (80%), Gaps = 7/445 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY+YNF+I GQRGTLFWHAH+ WLR+T+HGA+VILPK G PYPFP+P  E ++VLAEWW
Sbjct  112   QSYLYNFSIIGQRGTLFWHAHISWLRATMHGAIVILPKKGTPYPFPQPVKEKIIVLAEWW  171

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCP--SQGGYKLSVDPGKSYMLRVIN  1206
             K+DTEAVIN+   SG+ PNVSDAHT+NG+ GP+ NC   SQG Y L V+  K+Y+LR+IN
Sbjct  172   KADTEAVINQGTLSGMPPNVSDAHTMNGYTGPIRNCSISSQGTYTLHVEHNKTYLLRIIN  231

Query  1205  AALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQG-SGKYMVAA  1029
             AA+N+E+FF+IAGH+ TVVEVDA+Y KPF T+TI IAPGQTTN ++ A+Q  S KY++  
Sbjct  232   AAINDEIFFRIAGHKFTVVEVDASYTKPFVTDTIYIAPGQTTNALLKADQSPSKKYLIGM  291

Query  1028  SPFMDAP-IAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQY  852
             S FMDAP +AVDN T    L Y+G   G R VLT+ PP NAT    NF +ALRSLNSK+Y
Sbjct  292   SSFMDAPSVAVDNTTNYGLLRYNGGPLGSRLVLTTMPPINATKAQLNFSNALRSLNSKKY  351

Query  851   PARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKG  672
             PA+VP T+DHSL FT G+G+NPC +C   NGS++V ++NNVTFVMP++ALLQA+++NI G
Sbjct  352   PAQVPLTIDHSLLFTTGVGVNPCATC--LNGSKLVGNINNVTFVMPSIALLQAYYYNISG  409

Query  671   VFTTDFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVH  495
             VFT DFP  PP  F+YT A     L T  GTKVYRL YNATVQ+VLQDT IIAPE+HP+H
Sbjct  410   VFTDDFPSKPPTNFDYTIANYTGGLATMNGTKVYRLSYNATVQVVLQDTSIIAPESHPLH  469

Query  494   LHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHC  315
             LHG NFF VG G GN+N   D   FNLVDPVERNTI VP+GGW AIRFRADNPGVWFMHC
Sbjct  470   LHGTNFFVVGMGTGNYNATKDFKNFNLVDPVERNTIDVPTGGWTAIRFRADNPGVWFMHC  529

Query  314   HLEVHTTWGLKMAFLVDNGKGPNES  240
             HLEVHT+WGLKMAFL++NG GPN+S
Sbjct  530   HLEVHTSWGLKMAFLIENGDGPNKS  554



>gb|EMS48198.1| Laccase-22 [Triticum urartu]
Length=537

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/423 (67%), Positives = 353/423 (83%), Gaps = 8/423 (2%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             S++YNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPKLGVPYPFP P  EAVVVL EWWK
Sbjct  114   SFLYNFTVTGQRGTLLWHAHINWLRATVHGAIVILPKLGVPYPFPAPHKEAVVVLGEWWK  173

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNC-PSQGGYKLSVDPGKSYMLRVINAA  1200
             +DTE VIN+A++ G+ PN+SD+HTINGHPGP+++C  SQ G+ L V+  K+YMLR+INA 
Sbjct  174   ADTETVINQAMQLGVGPNISDSHTINGHPGPMSDCASSQDGFNLDVENDKTYMLRIINAG  233

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFFKIAGH +TVVEVDA Y KP+KT+ ++I PGQTTNV+VTA+Q +G+Y+++ SPF
Sbjct  234   LNDDLFFKIAGHGLTVVEVDAVYTKPYKTDILLITPGQTTNVLVTADQSAGRYLLSVSPF  293

Query  1019  MDAPIAVDNQTATATLHYSGALSGL-RTVLTSTPPKNATPVANNFVDALRSLNSKQYPAR  843
             +DAP+ VDN+T TATLHY+  +S   R  L   PP+NATP+A+ F ++LRSLNSK+YPA 
Sbjct  294   LDAPLQVDNKTGTATLHYANTVSATARLTLVKPPPQNATPIASKFSESLRSLNSKEYPAN  353

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFT  663
             VPQTVDHSLFFT+G+G+NPC +C   NG+RVV ++NN TFVMP+  +LQA +++I GVFT
Sbjct  354   VPQTVDHSLFFTIGVGVNPCANC--INGTRVVGTINNSTFVMPSTPILQARYYSIPGVFT  411

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFP  PP  FNYTG+GP NLQT  GT+VYRLPYNA+VQ++LQDTGII+ E+HP+HLHGF
Sbjct  412   EDFPATPPHKFNYTGSGPKNLQTMKGTRVYRLPYNASVQVILQDTGIISTESHPIHLHGF  471

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM----HC  315
             NFF VGRG+GN+NPKT P+ FNL+DPVERNTIGVP+GGW AIRFRADNPG  F     +C
Sbjct  472   NFFVVGRGVGNYNPKTSPSTFNLIDPVERNTIGVPTGGWTAIRFRADNPGRDFNPTLPYC  531

Query  314   HLE  306
              LE
Sbjct  532   LLE  534



>ref|XP_010543748.1| PREDICTED: laccase-22-like [Tarenaya hassleriana]
Length=555

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/440 (64%), Positives = 344/440 (78%), Gaps = 4/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             +++YNFT+TGQRGTL WHAH+ WLR+TVHGA+VILP+  V YPFP+P  E +++  EWWK
Sbjct  108   TFIYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPRHRVAYPFPRPHKEKIIIFGEWWK  167

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD EAVIN++  +GL PNVSDAHTING  GP+  C S G Y L V+ GK+YMLR+INAAL
Sbjct  168   SDVEAVINQSTFTGLPPNVSDAHTINGQSGPLLGCNSPG-YTLHVESGKTYMLRIINAAL  226

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFFKIAGH +TV+EVDA+Y KPF  +T+ + PGQTTN ++TA+Q SGKY++  SPFM
Sbjct  227   NDELFFKIAGHTLTVIEVDASYTKPFSADTLFLGPGQTTNALLTADQSSGKYLITISPFM  286

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             D  + VDN T TA LHY+   S    V    PP NAT VA  F D LRSLNS+ YPA VP
Sbjct  287   DTIVTVDNVTGTAFLHYNDTTSSPSLVSDKIPPVNATSVALGFSDNLRSLNSRDYPANVP  346

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VDHSLFFT+G+G+NPC +C   N ++ V  +NNV+FVMPT+ +LQAH++NI GVFT D
Sbjct  347   LRVDHSLFFTIGVGINPCETC--INNTKAVGDINNVSFVMPTIGILQAHYYNISGVFTDD  404

Query  656   FPGNPPVAFNYTGAGP-ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FPG P + FNYT     AN++T  GTK YRL YN+TVQLV+Q T +IAPE+HP HLHGFN
Sbjct  405   FPGKPLIPFNYTANNSTANMRTMNGTKAYRLAYNSTVQLVIQGTSVIAPESHPTHLHGFN  464

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF +G+G+GNF+P  DP KFNLVDPVERNT+ VP+ GW AIRFRADNPGVWF HCHLEVH
Sbjct  465   FFVIGKGVGNFDPLNDPKKFNLVDPVERNTVSVPTAGWTAIRFRADNPGVWFFHCHLEVH  524

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLKM FLV+NGKGPNE+
Sbjct  525   TSWGLKMVFLVENGKGPNET  544



>ref|XP_006401026.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
 gb|ESQ42479.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
Length=512

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/446 (67%), Positives = 350/446 (78%), Gaps = 25/446 (6%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGV YPFPKP  E  +VL EWW
Sbjct  75    QNYIYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVTYPFPKPYKEKTIVLGEWW  134

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +IN+A + G AP  SDAHTINGH GP++NCPSQ GY L V PGK+YMLR+INAA
Sbjct  135   KSDVEQLINDASRIGTAPIASDAHTINGHSGPISNCPSQRGYNLPVRPGKTYMLRIINAA  194

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSG-KYMVAASP  1023
             LNE+LFFKIAGH++TVVEVDA Y KPFKT+T++IAPGQTTNV++TAN  +G KYMVAA+ 
Sbjct  195   LNEDLFFKIAGHELTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLTANANAGSKYMVAATT  254

Query  1022  FMDAPIAVDNQTATATLHYSGALS---GLRTVLTSTPPKNATPVANNFVDALRSLNSKQY  852
             FMDAPI  DN TATATLHY G  +     +TVL S PP+NAT VA  F  +LRSLNS++Y
Sbjct  255   FMDAPILFDNVTATATLHYIGNTTVPASKKTVLASLPPQNATWVATRFTRSLRSLNSREY  314

Query  851   PARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKG  672
             PARVP TV+HSL FTVGLG NPC SC   NG R+VA +NNVTF MP+ ALLQAHFFNI  
Sbjct  315   PARVPTTVEHSLLFTVGLGANPCRSC--INGVRLVAGINNVTFTMPSTALLQAHFFNIPH  372

Query  671   VFTTDFPGNPPVAFNYTG--AGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPV  498
             VFT DFP  P   +NYT       N  T  GTK+YRLPYNATVQ+VLQ+T +        
Sbjct  373   VFTDDFPARPLNPYNYTAPVTQSVNAATMKGTKLYRLPYNATVQVVLQNTAM--------  424

Query  497   HLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMH  318
                      VGRG+G+F+P+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNPGVWFMH
Sbjct  425   ---------VGRGLGDFDPEKDPKVFNLVDPVERNTVGVPAGGWTAIRFLADNPGVWFMH  475

Query  317   CHLEVHTTWGLKMAFLVDNGKGPNES  240
             CHLE+HT+WGLKMAF+VDNG GP++S
Sbjct  476   CHLEIHTSWGLKMAFVVDNGHGPDQS  501



>ref|XP_004138572.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis sativus]
Length=561

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/446 (64%), Positives = 353/446 (79%), Gaps = 10/446 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+YVYNFT++ QRGTL WHAH  W+R+TVHGA+VI PK GVPYPFP P  +  ++L EWW
Sbjct  107   QNYVYNFTLSSQRGTLLWHAHFSWIRATVHGAIVIFPKHGVPYPFPHPYKQKTIILGEWW  166

Query  1379  KSDTEAVINE-------AIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYM  1221
             KSD EA++N+       + + G  PNVSDA TINGHPG V  C ++  + L V+ GK+Y+
Sbjct  167   KSDVEAMVNDVEAMVNKSTQLGQPPNVSDAQTINGHPGHVPGCATKS-FTLHVETGKTYL  225

Query  1220  LRVINAALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKY  1041
             LR+INAALNE+ FFKIA H  T+VEVDA+Y KPFKTNTI I+PGQTTN +V A++  GKY
Sbjct  226   LRIINAALNEDFFFKIASHHFTIVEVDASYTKPFKTNTIFISPGQTTNALVRAHRPIGKY  285

Query  1040  MVAASPFMDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNS  861
             ++AASPFMDAP+A+DN TATA L Y         V T  PP N+T + N F D+LRSLNS
Sbjct  286   LIAASPFMDAPVAIDNLTATAFLRYKRTPKNSPIVFTHIPPPNSTLLTNQFTDSLRSLNS  345

Query  860   KQYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFN  681
             ++YPA+VP  +DH+LFFTVG+G+NPC +C   NG R+VA+VNNVTF+MP ++LLQ+H++N
Sbjct  346   EEYPAKVPLFIDHNLFFTVGVGVNPCETC--VNGVRLVAAVNNVTFLMPQISLLQSHYYN  403

Query  680   IKGVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHP  501
             I GVFT DFP NPP  ++YTG  P N QT+ GTKVYRL +N+TVQLVLQDT +IAPE+HP
Sbjct  404   IPGVFTDDFPANPPFVYDYTGKPPTNNQTSNGTKVYRLRFNSTVQLVLQDTAVIAPESHP  463

Query  500   VHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFM  321
             +HLHGFN F VG G+GNF+P  D   FNLVDPVERNT GVP+GGW+AIRFRADNPGVWF+
Sbjct  464   IHLHGFNVFIVGTGLGNFDPIEDWKGFNLVDPVERNTFGVPNGGWIAIRFRADNPGVWFL  523

Query  320   HCHLEVHTTWGLKMAFLVDNGKGPNE  243
             HCHLEVHTTWGL+MAFLV+NG+GPNE
Sbjct  524   HCHLEVHTTWGLRMAFLVENGEGPNE  549



>ref|XP_010924287.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=559

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/441 (64%), Positives = 350/441 (79%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             +SY Y+F +TGQRGTL+WHAH+LWLR+T+HGA+VI+PK GVPYPFP+P  EA +VL EWW
Sbjct  110   RSYTYDFNVTGQRGTLWWHAHILWLRATIHGAIVIMPKEGVPYPFPQPHAEAELVLGEWW  169

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +D E V  +    GL PN+SDAHTING PGP+  C  +  + + V+ GK+Y+LR++NAA
Sbjct  170   HADVEEVEKQGNMLGLPPNMSDAHTINGKPGPLFPCSEKHTFAMEVEWGKTYLLRIVNAA  229

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF IAGH MT+VE+DA Y KPF TN IVIAPGQTT+V+V A++  G+Y +AA PF
Sbjct  230   LNDELFFAIAGHSMTMVEIDAVYCKPFTTNAIVIAPGQTTSVLVKADKNPGRYFMAARPF  289

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATA L Y G  + +  +L   P  N T   N+F+D LRSLNS Q+PA V
Sbjct  290   MDAPIAVDNRTATAILQYKGIPTTIVPILPQLPAPNDTEFVNDFLDKLRSLNSPQFPANV  349

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P +VD  LF+T  LG++PCP+C   NG+R+ AS+NN+TFVMPT+ LLQAH+FNIKGVF  
Sbjct  350   PLSVDRHLFYTASLGVDPCPTC--LNGTRLTASLNNITFVMPTIGLLQAHYFNIKGVFRL  407

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  P   FNYTGA   ANL T+ GT++ R+PYN+TV+LVLQDT ++APE+HP HLHG+
Sbjct  408   DFPDKPATTFNYTGAPLTANLGTSLGTRLSRIPYNSTVELVLQDTNLLAPESHPFHLHGY  467

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRGIGNF+PK DP K+NLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+
Sbjct  468   NFFVVGRGIGNFDPKKDPAKYNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEL  527

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+V+NG G  +S
Sbjct  528   HTTWGLKMAFVVENGNGTEQS  548



>emb|CDP09155.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/457 (64%), Positives = 351/457 (77%), Gaps = 31/457 (7%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVL----  1392
             Q+YVYNFTIT QRGTL+WHAH+ WLR+TVHGALVILPKLG+PYPFP PD E V++L    
Sbjct  291   QTYVYNFTITDQRGTLWWHAHIGWLRATVHGALVILPKLGLPYPFPPPDSEVVIILDLAE  350

Query  1391  -------------AEWWKSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYK  1251
                          A  + SD E +IN A+K GL   VSDA+TING   P++NC S+GG+ 
Sbjct  351   NKNLMDYLFYMVAAIVFYSDIETLINSAMKEGLPFQVSDAYTINGQSRPISNCSSEGGFS  410

Query  1250  LSVDPGKSYMLRVINAALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVI  1071
               V+PGK YMLR+INAALNEELFFKIAGH +TVVEVDATYVKPFKT TI I PGQTTN I
Sbjct  411   FPVEPGKKYMLRIINAALNEELFFKIAGHSLTVVEVDATYVKPFKTGTIFITPGQTTNAI  470

Query  1070  VTANQGSGKYMVAASPFMDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANN  891
             + A+ G+G Y++AASPFM  P+ +D   ATAT+HYSG  S   T  T  PP+NATP+A  
Sbjct  471   LEADLGTGNYLMAASPFMAEPVPIDYTAATATVHYSGTQSSAATTFTDLPPRNATPLATA  530

Query  890   FVDALRSLNSKQYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPT  711
             FVD+L+SLNS++YPARVP TVDHSL FT+GLG NPC +C    GSR+ A  NN++F+ P 
Sbjct  531   FVDSLKSLNSQRYPARVPLTVDHSLLFTMGLGFNPCATC--IRGSRIAAYFNNISFIRPA  588

Query  710   VALLQAHFFNIKGVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQD  531
             ++LL AHFFNI GVF  DFPGNPP+            +T  GT++YRL +N+TVQLVLQD
Sbjct  589   ISLLNAHFFNISGVFADDFPGNPPI------------RTMEGTRLYRLAFNSTVQLVLQD  636

Query  530   TGIIAPENHPVHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRF  351
             T +I PENHP+HLHG NFF VGRG+GNF+P+ DP+ FNLVDPVERNT+GVPSGGWVA+RF
Sbjct  637   TAMITPENHPIHLHGMNFFVVGRGLGNFDPEKDPSNFNLVDPVERNTVGVPSGGWVAVRF  696

Query  350   RADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  240
             RADNPGVWFMHCHLE HT  GL+MAF+VDNG+GPN+S
Sbjct  697   RADNPGVWFMHCHLESHTLVGLEMAFVVDNGQGPNQS  733


 Score =   166 bits (419),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -2

Query  524  IIAPENHPVHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRA  345
            +I+PE+HP HLHGFNFF VG GIGNFNP  DP  FNLVDPVERNT+GVP+GGWVAIRFRA
Sbjct  1    MISPESHPFHLHGFNFFVVGSGIGNFNPNKDPPNFNLVDPVERNTVGVPTGGWVAIRFRA  60

Query  344  DNPGVWFMHCHLEVHTTWGLKMAF  273
            DNPGVWF+HCHLEVHTTWGLKMAF
Sbjct  61   DNPGVWFLHCHLEVHTTWGLKMAF  84



>gb|AAK37830.1|AF132126_1 laccase [Pinus taeda]
Length=577

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/446 (63%), Positives = 343/446 (77%), Gaps = 8/446 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPF-PKPDHEAVVVLAEW  1383
             Q+YVYNFT+TGQRGTL+WHAH+LWLR+T++GA+VILP   VPYPF PKP  E  +VL EW
Sbjct  123   QTYVYNFTVTGQRGTLWWHAHILWLRATLYGAIVILPPPNVPYPFEPKPHKEITLVLGEW  182

Query  1382  WKSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINA  1203
             W +D EAVINEA+++G APN+SDAHTING PG +  CP +  + L V+ GK Y+LR++NA
Sbjct  183   WNADVEAVINEALQTGAAPNISDAHTINGKPGEIFKCPVKDTFTLPVEHGKVYLLRIVNA  242

Query  1202  ALNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASP  1023
             ALN+ELFF++A H + VVEVDA Y KPF T  IVIAPGQTTNV++ AN+ SG Y VAA P
Sbjct  243   ALNDELFFEVANHLVKVVEVDAVYTKPFDTKAIVIAPGQTTNVLLEANKRSGSYFVAARP  302

Query  1022  FMDAPIAVDNQTATATLHY-----SGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSK  858
             FMDAP+ V+N+TATA LHY        +  +  ++   P  N T  A +F   LRSLNS 
Sbjct  303   FMDAPVTVNNKTATAILHYISRNSESDIPAVNPLMPRLPLLNDTAFATSFTSKLRSLNSV  362

Query  857   QYPARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNI  678
             Q+PA+VPQT+D +LFF VGL    C +C    G R  AS+NN++FVMP+++LL AH FNI
Sbjct  363   QFPAKVPQTIDRNLFFAVGLATESCQTCN--GGLRASASINNISFVMPSISLLDAHIFNI  420

Query  677   KGVFTTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPV  498
              GVFT DFP  PP  FNYTG  P NL T+ GT++ RLP+N+TVQLVLQDT ++  ENHP+
Sbjct  421   SGVFTADFPDKPPTPFNYTGTPPKNLITSKGTRLSRLPFNSTVQLVLQDTSVLTVENHPI  480

Query  497   HLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMH  318
             HLHGFNFF VGRG GN++P TDP  FNLVDP ERNT+GVP+GGW  IRFRADNPGVWFMH
Sbjct  481   HLHGFNFFIVGRGFGNYDPNTDPASFNLVDPPERNTVGVPTGGWTVIRFRADNPGVWFMH  540

Query  317   CHLEVHTTWGLKMAFLVDNGKGPNES  240
             CHLEVHTTWGLKMAFLV+NG GP++S
Sbjct  541   CHLEVHTTWGLKMAFLVENGDGPDQS  566



>emb|CAA74102.1| laccase [Populus trichocarpa]
Length=437

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/426 (65%), Positives = 339/426 (80%), Gaps = 4/426 (1%)
 Frame = -2

Query  1514  LFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINEAIKSG  1335
             L WHAH+ WLR+T+HGA+VILP+ GVPYPFPKPD E +++L EWWK+D EAV+N+A ++G
Sbjct  4     LLWHAHISWLRATIHGAIVILPQKGVPYPFPKPDKEKIIILGEWWKADVEAVVNQATQTG  63

Query  1334  LAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAALNEELFFKIAGHQMT  1155
             L PN+SDAH +NG  G V  CPS G + L V+ GK+Y+LR+INAALN+ELFFKIAGH +T
Sbjct  64    LPPNISDAHIVNGQTGAVPGCPSPG-FTLHVESGKTYLLRIINAALNDELFFKIAGHNIT  122

Query  1154  VVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNQTATAT  975
             VVEVDA Y KPF T+TI I PGQTTN ++TA++  GKY++A SPFMD  +AVDN TA A 
Sbjct  123   VVEVDAAYTKPFSTDTIFIGPGQTTNALLTADKSVGKYLMAVSPFMDTVVAVDNVTAIAF  182

Query  974   LHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVPQTVDHSLFFTVGLG  795
             L Y   L      L +TP  NATPV + F+D LRSLNSK++PA VP TVDHSL+FT+G+G
Sbjct  183   LRYREPLHFPHQSLNTTPAINATPVTSTFMDNLRSLNSKKFPANVPLTVDHSLYFTIGVG  242

Query  794   LNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTDFPGNPPVAFNYTGA  615
             ++PC +C   NGS+ V ++NN++F+MPT ALLQAH+++I GVFT DFP  PP +FNYTG 
Sbjct  243   IDPCATC--VNGSKAVGAINNISFIMPTTALLQAHYYSISGVFTDDFPAMPPNSFNYTGN  300

Query  614   GPA-NLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFNFFAVGRGIGNFNPK  438
               A NLQT  GT+ YRL +N+TVQLVLQ T IIAPE+HP HLHGFNFF VG+G GNF+  
Sbjct  301   NTALNLQTINGTRTYRLAFNSTVQLVLQGTTIIAPESHPFHLHGFNFFVVGKGFGNFDAD  360

Query  437   TDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNG  258
              DP KFNL DPVERNTI VP+ GW AIRFRADNPGVWF+HCHLEVHTTWGLKM F+VDNG
Sbjct  361   NDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVDNG  420

Query  257   KGPNES  240
             +GP+ES
Sbjct  421   EGPDES  426



>gb|KFK27419.1| hypothetical protein AALP_AA8G380300 [Arabis alpina]
Length=524

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/415 (69%), Positives = 335/415 (81%), Gaps = 7/415 (2%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             Q+Y+YNFT+TGQRGTL+WHAH+LWLR+TVHGA+VILPKLGVPYPFPKP  E  +VL+EWW
Sbjct  112   QNYIYNFTVTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKPYKEKTIVLSEWW  171

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
             KSD E +INEA K G AP  SDAHTINGH GPV+NCPSQ GY L V  GK+YMLR+INAA
Sbjct  172   KSDVEELINEASKIGTAPIASDAHTINGHSGPVSNCPSQNGYGLPVRLGKTYMLRIINAA  231

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSG-KYMVAASP  1023
             LNEELFFKIAGH++TVVEVDA Y KPFKT+T++IAPGQTTNV++TAN  +G KYMVAA+ 
Sbjct  232   LNEELFFKIAGHKLTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLTANANAGSKYMVAATT  291

Query  1022  FMDAPIAVDNQTATATLHYSGAL--SGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYP  849
             FMDAP+  DN TATA LHY G    +  +TVL S PP+NAT VA+ F+ +LRSLNS++YP
Sbjct  292   FMDAPLPFDNVTATAILHYIGHTVPTSKKTVLASLPPQNATWVASKFIRSLRSLNSREYP  351

Query  848   ARVPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGV  669
              RVP  +DHSL FTVGLG NPCPSC   NG+R+VA +NN+TF MP  ALLQAHFFNI  V
Sbjct  352   VRVPTKIDHSLSFTVGLGANPCPSC--INGTRLVAGINNITFTMPKTALLQAHFFNISNV  409

Query  668   FTTDFPGNPPVAFNYTGAGP--ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVH  495
             FT DFP  P   ++YT   P   N  T  GTK+YRLPYNATVQ+VLQ+T ++  ENHP H
Sbjct  410   FTDDFPAKPLNPYDYTAPVPQSVNAATMKGTKLYRLPYNATVQIVLQNTAMVLSENHPFH  469

Query  494   LHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGV  330
             LHGFNFF VGRG+GNFNP+ DP  FNLVDPVERNT+GVP+GGW AIRF ADNP V
Sbjct  470   LHGFNFFEVGRGLGNFNPEKDPKTFNLVDPVERNTVGVPAGGWTAIRFIADNPEV  524



>ref|XP_010926015.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=847

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/441 (63%), Positives = 346/441 (78%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             +SY Y+F +TGQRGTL+WHAH+LWLR+T+HGA+VI+PK GVPYPFP+P  E  +VL EWW
Sbjct  398   RSYTYDFNVTGQRGTLWWHAHILWLRATIHGAIVIMPKEGVPYPFPQPQAETELVLGEWW  457

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +D E V  +    GL PN+SDAHTING PGP+  C  +  + + V+ GK+Y+LR++NAA
Sbjct  458   HADVEEVEKQGNMLGLPPNMSDAHTINGKPGPLFPCSEKHTFAMEVEWGKTYLLRIVNAA  517

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF IAGH MTVVE+DA Y KPF TN I+IAPGQTTNV+V A++  G+Y +AA PF
Sbjct  518   LNDELFFAIAGHNMTVVEIDAVYCKPFTTNGILIAPGQTTNVLVKADKIPGRYFMAARPF  577

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATA L Y    + +  +L   P  N T   ++F+  LRSLNS Q+PA+V
Sbjct  578   MDAPIAVDNKTATAILQYKCVPTTVIPILPQLPAPNDTKFVDDFLGKLRSLNSPQFPAKV  637

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  +D  LF+TV LG++PCP+C   NG+R+ AS+NN+TFVMP + LLQAH+FNIKGVF  
Sbjct  638   PLNIDRHLFYTVSLGIDPCPTC--LNGTRLTASLNNITFVMPQIGLLQAHYFNIKGVFGL  695

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  P   FNYTGA   ANL T+ GT++ R+PYN+TV+LVLQDT ++A E+HP HLHG+
Sbjct  696   DFPDKPLNTFNYTGAPLTANLGTSLGTRLSRIPYNSTVELVLQDTNLLAAESHPFHLHGY  755

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRGIGNF+P  DP KFNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLEV
Sbjct  756   NFFVVGRGIGNFDPTKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEV  815

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HTTWGLKMAF+V+NG GP ES
Sbjct  816   HTTWGLKMAFVVENGNGPEES  836



>dbj|BAN10308.1| laccase [Chamaecyparis obtusa]
Length=555

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/440 (63%), Positives = 336/440 (76%), Gaps = 2/440 (0%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QS+VYNFTITGQRGTL +HAH+LWLR+T+HG +VILPK  VPYPFPKP  E  +VL EWW
Sbjct  107   QSFVYNFTITGQRGTLLYHAHILWLRATLHGPIVILPKKHVPYPFPKPHKEVTLVLGEWW  166

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +DTEAVIN+A+K+G APN S+AHTING PGP+ NC ++  + L+V+P K+Y+LR+INAA
Sbjct  167   NADTEAVINQAMKTGGAPNASNAHTINGKPGPLFNCSTKDTHALAVEPDKTYLLRIINAA  226

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+++FF I  H + VVEVDA Y KPF+T  I I+PGQTTNV++  ++ +G+Y +    F
Sbjct  227   LNDQVFFSIGNHHLKVVEVDAVYTKPFETKAIAISPGQTTNVLLDTSKKTGRYFMTVRAF  286

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI VDN T+   L Y G  +    ++   P  N T    NF  +++SLNS  YPA+V
Sbjct  287   MDAPIPVDNLTSAGILQYIGTSNTSNPIMPVIPKINDTAFYTNFSSSIKSLNSALYPAKV  346

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             PQTVD +LFF +GL L+ C +C   NGSR  AS+NNV+FVMPT+ALLQAH  NI GVFT 
Sbjct  347   PQTVDRNLFFAMGLALDKCSTC--VNGSRASASINNVSFVMPTIALLQAHVNNISGVFTK  404

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFP NPP  FNYTG  P NL T+ GT+   L YN+TVQLVLQDT I+  +NHPVHLHGFN
Sbjct  405   DFPDNPPTPFNYTGTPPKNLFTSKGTRATSLTYNSTVQLVLQDTSILTVDNHPVHLHGFN  464

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG G GN+N KTDP  FNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLEVH
Sbjct  465   FFIVGTGFGNYNSKTDPANFNLVDPAERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVH  524

Query  299   TTWGLKMAFLVDNGKGPNES  240
             TTWGLKMAF+V+NG G  +S
Sbjct  525   TTWGLKMAFVVENGNGAEQS  544



>ref|XP_009392410.1| PREDICTED: laccase-11 [Musa acuminata subsp. malaccensis]
Length=559

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/440 (62%), Positives = 340/440 (77%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY Y+F +TGQRGTL+WHAH+LWLR+TVHGA+VI+P+ GVPYPFP+P  E  ++L EWW 
Sbjct  111   SYTYHFNVTGQRGTLWWHAHILWLRATVHGAIVIMPEQGVPYPFPQPYQETELILGEWWN  170

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +D E V  +    GL PN SDAHTING PGP+  CP +  Y L V+ GK+Y+LR+INAAL
Sbjct  171   ADVEKVEQQGNLLGLPPNTSDAHTINGKPGPLFPCPEKHTYALEVESGKTYLLRIINAAL  230

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N++LFF IAGH MTVVE+DATY KPF T+ +VIAPGQTTNV+V A+Q  G+Y +A   FM
Sbjct  231   NDDLFFAIAGHSMTVVEIDATYCKPFNTSALVIAPGQTTNVLVRADQAPGRYFMATRSFM  290

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             D PI VDN+TATA L Y G  + +  V+   P  N T    +F D LRSLNS +YPA VP
Sbjct  291   DIPIPVDNKTATAILQYRGVPTTVVPVMPQLPAPNDTSFVASFSDQLRSLNSPRYPASVP  350

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD  LF+T+GLG+NPCP+C   NG+R+ AS+NN+TFV+P VALLQAH++++KGVF  D
Sbjct  351   LDVDRRLFYTIGLGVNPCPTC--LNGTRLTASLNNITFVLPQVALLQAHYYDMKGVFRLD  408

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PP +FNYTG    ANL T+ GT++ R+ +N+TV+LVLQDT ++  E+HP HLHG+N
Sbjct  409   FPDKPPTSFNYTGTPLTANLGTSLGTRLSRIAFNSTVELVLQDTNLLMVESHPFHLHGYN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+P  DP  FNL+DP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLEVH
Sbjct  469   FFVVGTGIGNFDPAKDPETFNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLKMAF+V+NG GP ES
Sbjct  529   TSWGLKMAFVVENGDGPEES  548



>ref|XP_009146739.1| PREDICTED: laccase-22-like [Brassica rapa]
Length=560

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/443 (62%), Positives = 343/443 (77%), Gaps = 7/443 (2%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             +++YNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK GVPYPFP+P  + V+V  EWWK
Sbjct  108   NFIYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTDKVIVFGEWWK  167

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD E VI ++ +SGL PN+SDAHTING  GP+T C +  GY + V+ GKSY+LR+INAA+
Sbjct  168   SDVEDVIKQSTQSGLPPNLSDAHTINGLTGPITGCNNSHGYTIHVETGKSYLLRIINAAV  227

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFFKIA H +TVVEVDA+Y KP+ T T+ + PGQT N ++TAN  +G +++  SPFM
Sbjct  228   NDELFFKIAQHNLTVVEVDASYTKPYNTETLFLGPGQTANAVLTANHPTGNFLMTISPFM  287

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             D  + VDN TATA L Y    +     +++TPP NAT +A NF D+LRSLNS +YP  VP
Sbjct  288   DTVVPVDNATATAFLRYKNTTTTDSLTMSNTPPINATSIAQNFSDSLRSLNSLKYPTNVP  347

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFN-IKGVFTT  660
               +DHSLFF +G+G+NPC +C   NG++ +A +NNVTFVMP +ALLQAH+FN  +GVFT 
Sbjct  348   LKIDHSLFFAIGVGVNPCATC--INGTKTIADINNVTFVMPAMALLQAHYFNKSQGVFTN  405

Query  659   DFPGNPPVAFNYTGAGP----ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHL  492
             DFPG P   F+YTG       +NLQT  GT+VYRL +NATVQ+V+Q T +IAPE+HP HL
Sbjct  406   DFPGRPLTPFDYTGGNNSIPLSNLQTKNGTQVYRLEFNATVQIVIQGTSVIAPESHPTHL  465

Query  491   HGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCH  312
             HG NFF VG+G+GNF+P  DP KFNLVDPVERNT+ VP+ GW AIRF ADNPGVWF HCH
Sbjct  466   HGSNFFVVGKGLGNFDPLMDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFHCH  525

Query  311   LEVHTTWGLKMAFLVDNGKGPNE  243
             LEVHT+WGLKMAFLV++GK  NE
Sbjct  526   LEVHTSWGLKMAFLVEDGKYSNE  548



>ref|XP_008357173.1| PREDICTED: laccase-11-like [Malus domestica]
Length=562

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/441 (63%), Positives = 342/441 (78%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SY YN TITGQRGTL+WHAH+ WLR+TV+GA+VI+PK G  +PFP+P  EA +VL EWW
Sbjct  113   HSYTYNITITGQRGTLWWHAHIFWLRATVYGAIVIMPKQGEGFPFPQPYREANIVLGEWW  172

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +D E V+ +  K GL PN+SDAHTING PGP+  C  +  Y L V+ GK+Y+LR+INAA
Sbjct  173   NNDVEEVVKQGNKKGLPPNMSDAHTINGKPGPLFPCSEKHTYALEVEQGKTYLLRIINAA  232

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF IAGH +TVVE+DA Y KPF T  I+IAPGQTTNV+V A Q  G+Y +AA PF
Sbjct  233   LNDELFFAIAGHNLTVVEIDAVYTKPFTTQAILIAPGQTTNVLVQATQAPGRYFMAARPF  292

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP++VDN+TATA L Y G  + ++ VL   P  N T  A N+ D LRSLN+ Q+PA V
Sbjct  293   MDAPVSVDNKTATAILQYKGIPNSVQPVLPQLPAPNNTAFALNYDDNLRSLNTAQFPAHV  352

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VD  LF+T+GLG+NPCP+C   NG+++ AS+NN+TFVMP + LLQAHFFN KGVFTT
Sbjct  353   PLKVDRHLFYTIGLGINPCPTC--LNGTQLTASLNNITFVMPKIGLLQAHFFNTKGVFTT  410

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP +FN+TGA   ANL T  GT++ ++ +N+TV+LVLQDT ++  E+HP HLHG+
Sbjct  411   DFPDRPPTSFNFTGAPLTANLGTKQGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGY  470

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG GIGNF+PK DP  FNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+
Sbjct  471   NFFIVGSGIGNFDPKKDPATFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEL  530

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLK AF+V+NGK  + S
Sbjct  531   HTSWGLKTAFVVENGKDTDHS  551



>gb|KDP41783.1| hypothetical protein JCGZ_26801 [Jatropha curcas]
Length=840

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/440 (62%), Positives = 344/440 (78%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY Y+F ITGQRGTL+WHAH+ WLR+TV+GA+VI+P+LG P+PFP+P+ E V++L EWW 
Sbjct  392   SYTYDFNITGQRGTLWWHAHIFWLRATVYGAIVIMPQLGTPFPFPQPEREEVLLLGEWWN  451

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +D E ++N+  K GL PN SDAHTING PGP+  C  +  + + V+ GK+Y+LR+INAAL
Sbjct  452   NDVEQLVNQGNKLGLPPNASDAHTINGKPGPLFPCSEKHTFAMEVEQGKTYLLRIINAAL  511

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF +AGH +TVVE+DA Y KPF T  I+IAPGQTT+V++ A Q  G+Y +AA PFM
Sbjct  512   NDELFFAVAGHNLTVVEIDAVYTKPFTTQAILIAPGQTTSVLIQATQSPGRYFMAARPFM  571

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAPI++DN+TATA L Y G  + +  +L   P  N T  A ++   LRSLNSKQ+PA VP
Sbjct  572   DAPISIDNKTATAILQYKGIPNTILPILPQLPSPNDTAFALDYNSKLRSLNSKQFPANVP  631

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD  L FT GLG+N CPSC   NG+++ AS+NN+TFVMP + LLQAH+F IKGVF TD
Sbjct  632   LKVDRHLLFTAGLGINACPSC--LNGTKLTASLNNITFVMPQIGLLQAHYFKIKGVFRTD  689

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP NPP  FNYTGA   ANL TT GT++ ++ YN+TVQLVLQDT ++  E+HP HLHG+N
Sbjct  690   FPDNPPTPFNYTGAPLTANLGTTLGTRLSKIAYNSTVQLVLQDTNLLTVESHPFHLHGYN  749

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+PK DP KFNLVDP ERNT+GVP+GGW A+RFRADNPGVWFMHCHLE+H
Sbjct  750   FFVVGTGIGNFDPKKDPAKFNLVDPPERNTVGVPTGGWTAVRFRADNPGVWFMHCHLELH  809

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLK AF+V+NG GP+ES
Sbjct  810   TSWGLKTAFVVENGNGPDES  829



>emb|CDY01010.1| BnaC05g41900D [Brassica napus]
Length=559

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/444 (63%), Positives = 343/444 (77%), Gaps = 8/444 (2%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             ++VYNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK GVPYPFP+P  + ++V  EWWK
Sbjct  108   TFVYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTDKIIVFGEWWK  167

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD E VI ++ +SGL PN+SDAHTING  GP+T C +  GY + V+ GKSY+LR+INAA+
Sbjct  168   SDVEDVIKQSTQSGLPPNLSDAHTINGLTGPITGCNNSHGYTIHVETGKSYLLRIINAAV  227

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFFKIA H +TVVEVDA+Y KPF T T+ + PGQT N I+TAN  +G +++  SPFM
Sbjct  228   NDELFFKIAQHNLTVVEVDASYTKPFNTETLFLGPGQTANAILTANHPTGNFLMTISPFM  287

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             D  + V+N TATA L Y    +     L+  PP NAT +A NF DALRSLNS+ YP  VP
Sbjct  288   DTVVPVNNATATAFLRYK-TTTTQSLTLSKIPPINATSIAQNFSDALRSLNSRDYPTNVP  346

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFN-IKGVFTT  660
               VDHSLFF +G+G+NPC +C   NG++ +A +NNVTFVMPT+ALLQAH+FN  KGVFT 
Sbjct  347   LKVDHSLFFAIGVGVNPCATC--INGTKNIADINNVTFVMPTMALLQAHYFNKSKGVFTD  404

Query  659   DFPGNPPVAFNYTGAGP----ANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHL  492
             DFPG P   F+YTG       +NLQT  GT+VYRL +NATVQ+V+Q T +IAPE+HP HL
Sbjct  405   DFPGRPLTPFDYTGGNKSIPLSNLQTKNGTQVYRLEFNATVQIVIQGTSVIAPESHPTHL  464

Query  491   HGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCH  312
             HG NFF VG+G+GNF+P  DP KFNLVDPVERNT+ VP+ GW AIRF ADNPGVWF HCH
Sbjct  465   HGSNFFVVGKGLGNFDPLMDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFHCH  524

Query  311   LEVHTTWGLKMAFLVDNGKGPNES  240
             LEVHT+WGLKMAFLV++GKG NE 
Sbjct  525   LEVHTSWGLKMAFLVEDGKGSNEK  548



>ref|XP_003632636.1| PREDICTED: laccase-11 [Vitis vinifera]
 emb|CBI32739.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/441 (62%), Positives = 342/441 (78%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SY YNF ++GQRGTL+WHAH+LWLR+TV+GA+VI+PK G P+PFP+P  EA +VL EWW
Sbjct  113   HSYTYNFQVSGQRGTLWWHAHILWLRATVYGAIVIMPKQGTPFPFPQPYFEANIVLGEWW  172

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              SD E ++N+A K GL P +SDAHTING PGP+  C  +  + + V+ GK+Y+LR++NAA
Sbjct  173   SSDVETIVNQANKLGLPPPMSDAHTINGKPGPLFPCSEKHTFAMEVESGKTYLLRIVNAA  232

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF IAGH MTVVE+DA Y KPF T  ++IAPGQTTNV+V A+Q   +Y +A  PF
Sbjct  233   LNDELFFAIAGHNMTVVEIDAVYTKPFTTQALLIAPGQTTNVLVKADQSPSRYFMAVRPF  292

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+ VDN+TATA L Y G  + +   L   P  N T  A ++   L+SLN+ Q+PA V
Sbjct  293   MDAPVPVDNKTATAILQYKGIPNTVLPTLAQLPAPNDTNFALSYNSKLKSLNTPQFPANV  352

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VD  LF+T+GLG NPCP+C+  NG+++ AS+NN+TFVMP VALLQAH+FNIKGVF T
Sbjct  353   PLQVDRHLFYTIGLGQNPCPTCQ--NGTQLTASLNNITFVMPKVALLQAHYFNIKGVFRT  410

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  P   FNYTGA   ANL T+ GT++ +L +N+T++LVLQDT ++  E+HP HLHG+
Sbjct  411   DFPDRPLAPFNYTGAPLTANLGTSLGTRLSKLAFNSTIELVLQDTNLLTVESHPFHLHGY  470

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG GIGNF+PK DP KFNL+DP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+
Sbjct  471   NFFVVGNGIGNFDPKKDPAKFNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEL  530

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT WGLKMAF+V+NGK P ES
Sbjct  531   HTMWGLKMAFVVENGKSPEES  551



>ref|XP_009378520.1| PREDICTED: laccase-11-like [Pyrus x bretschneideri]
 ref|XP_009378525.1| PREDICTED: laccase-11-like [Pyrus x bretschneideri]
Length=562

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/441 (62%), Positives = 341/441 (77%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SY YN TIT QRGTL+WHAH+ WLR+TV+GA+VI+PK G  +PFP+P  EA +VL EWW
Sbjct  113   HSYTYNITITAQRGTLWWHAHIFWLRATVYGAIVIMPKQGAGFPFPQPYREANIVLGEWW  172

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +D E ++ +  K GL PN+SDAHTING PGP+  C  +  Y L V+ GK+Y+LR+INAA
Sbjct  173   NNDVEEIVKQGNKLGLPPNMSDAHTINGKPGPLFPCSEKHTYALEVEQGKTYLLRIINAA  232

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF IAGH +TVVE+DA Y KPF T  I+IAPGQTTNV+V A Q  G+Y +AA PF
Sbjct  233   LNDELFFAIAGHNLTVVEIDAVYTKPFTTQAILIAPGQTTNVLVQATQAPGRYFMAARPF  292

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP++VDN+TATA L Y G  + ++ +L   P  N T  A N+ D LRSLN+ Q+PA V
Sbjct  293   MDAPVSVDNKTATAILQYKGIPNSVQPLLPQLPALNNTAFALNYDDKLRSLNTAQFPANV  352

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VD  LF+T+GLG+NPCP+C   NG+++ AS+NN+TFVMP + LLQAHFFN KGVFTT
Sbjct  353   PLKVDRHLFYTIGLGINPCPTC--LNGTQLTASLNNITFVMPKIGLLQAHFFNTKGVFTT  410

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP +FN+TGA   ANL T  GT++ ++ +N+TV+LVLQDT ++  E+HP HLHG+
Sbjct  411   DFPDRPPTSFNFTGAPLTANLGTKQGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGY  470

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG GIGNF+PK DP  FNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+
Sbjct  471   NFFIVGSGIGNFDPKKDPATFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEL  530

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLK AF+V+NGK  + S
Sbjct  531   HTSWGLKTAFVVENGKDTDHS  551



>ref|XP_009590676.1| PREDICTED: laccase-11-like [Nicotiana tomentosiformis]
Length=559

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/440 (62%), Positives = 342/440 (78%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SYVY+F +TGQRGTL+WHAH+LWLR+TV+GA+VILP+ G P+PFP+PD E V+VL EWW 
Sbjct  111   SYVYDFNVTGQRGTLWWHAHILWLRATVYGAIVILPQQGTPFPFPQPDREEVIVLGEWWN  170

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +D E V N+    GL PN+SDAHTING PGP+  C  +  Y + V+ GK+Y+LR+INAAL
Sbjct  171   ADVEQVENQGNALGLPPNMSDAHTINGKPGPLFPCSEKYTYAMEVEKGKTYLLRIINAAL  230

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF +A H +TVVE+DA Y KPF T  I+IAPGQTTNV+V ANQ  G+Y +AA PFM
Sbjct  231   NDELFFSVANHTLTVVEIDAVYTKPFSTEAILIAPGQTTNVLVRANQIPGRYFMAARPFM  290

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAPI+VDN+TATA   Y G    +   L   P  N T  A ++ + LRSLNS +YPA VP
Sbjct  291   DAPISVDNKTATAIFQYKGVSETVIPKLPDLPAPNDTEFALSYDNKLRSLNSPKYPANVP  350

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD +LF+T+GLG+N CP+C   NG+R+ AS+NN++FVMP  ALLQAH+FNIKGV+TTD
Sbjct  351   LKVDRNLFYTIGLGINACPTC--LNGTRLTASLNNISFVMPQTALLQAHYFNIKGVYTTD  408

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PP  FNYTGA   ANL+TT GT++ ++ +N+TV+LV+QDT ++  E+HP HLHG+N
Sbjct  409   FPDKPPTPFNYTGAPLTANLKTTQGTRLSKVSFNSTVELVIQDTNLLTVESHPFHLHGYN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+PK DP K+NL+DP ERNT+GVP+GGW AIRFRADNPGVWF HCHLE+H
Sbjct  469   FFVVGTGIGNFDPKKDPAKYNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFFHCHLELH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLK AF+V++G G N +
Sbjct  529   TGWGLKTAFVVEDGPGSNHN  548



>ref|XP_009764219.1| PREDICTED: laccase-11-like [Nicotiana sylvestris]
Length=562

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/440 (62%), Positives = 343/440 (78%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SYVY+F +TGQRGTL+WHAH+LWLR+TV+GA+VILP+ G P+PFP+PD E V+VL EWW 
Sbjct  114   SYVYDFNVTGQRGTLWWHAHILWLRATVYGAIVILPQQGTPFPFPQPDREEVIVLGEWWN  173

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +D E V N+    GL PN+SDAHTING PGP+  C  +  Y + V+ GK+Y+LR+INAAL
Sbjct  174   ADVEQVENQGNALGLPPNMSDAHTINGKPGPLFPCSEKYTYAMEVEKGKTYLLRIINAAL  233

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF +A H +TVVE+DA Y KPF TN I+IAPGQTTNV+V ANQ  G+Y +AA PFM
Sbjct  234   NDELFFSVANHTLTVVEIDAVYTKPFSTNAILIAPGQTTNVLVRANQIPGRYFMAARPFM  293

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAPI+VDN+TATA   Y G    +   L   P  N T  A ++ + LRSLNS +YPA VP
Sbjct  294   DAPISVDNKTATAIFQYKGVSETVIPKLPDLPAPNDTEFALSYDNKLRSLNSPKYPANVP  353

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD +LF+T+GLG+N CP+C   NG+R+ AS+NN++FVMP  ALLQAH+FNIKGV+TTD
Sbjct  354   LKVDRNLFYTIGLGINACPTC--LNGTRLTASLNNISFVMPQTALLQAHYFNIKGVYTTD  411

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PP  FNYTGA   ANL+TT GT++ ++ +N+TV+LV+QDT ++  E+HP HLHG+N
Sbjct  412   FPDKPPTPFNYTGAPLTANLKTTQGTRLSKIVFNSTVELVIQDTNLLTVESHPFHLHGYN  471

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+PK DP K+NL+DP ERNT+GVP+GGW AIRFRADNPGVWF HCHLE+H
Sbjct  472   FFVVGTGIGNFDPKKDPAKYNLIDPPERNTVGVPTGGWTAIRFRADNPGVWFFHCHLELH  531

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLK AF+V++G G + +
Sbjct  532   TGWGLKTAFVVEDGPGSDHN  551



>emb|CDO97037.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/443 (61%), Positives = 344/443 (78%), Gaps = 5/443 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY Y+F +TGQRGTL+WHAH+ WLR+TV+GA+VI+PK G+ YPFP+PD E  +VL EWW
Sbjct  115   QSYTYDFNVTGQRGTLWWHAHIFWLRATVYGAIVIMPKQGMAYPFPQPDFEFNLVLGEWW  174

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
               D E V+ +  K GL P +SDAHTING PGP+  C  +  Y + V+ GK Y+ R+INAA
Sbjct  175   NDDVEEVVKQGNKLGLPPRMSDAHTINGKPGPLFPCSEKHTYAVEVEQGKKYLFRIINAA  234

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF IAGH MTVVEVDA Y KPF T+ I+IAPGQTTNV+V AN+ S +Y +AA PF
Sbjct  235   LNDELFFAIAGHNMTVVEVDAVYTKPFSTDAILIAPGQTTNVLVHANKISSRYFMAARPF  294

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+ +DN+TATA L Y G  + +   L + P  N T  A ++   LRSLNS Q+PA V
Sbjct  295   MDAPLPIDNKTATAILQYKGVPNNVLPSLPNLPAPNDTSFALSYSAKLRSLNSPQFPANV  354

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VD  LF+T+GLG+NPCP+C+  NG+R+ AS+NN+TF+MP + LLQAH+FN+ GVFTT
Sbjct  355   PLKVDRHLFYTIGLGMNPCPTCQ--NGTRLTASLNNITFIMPQIGLLQAHYFNLTGVFTT  412

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGT--KVYRLPYNATVQLVLQDTGIIAPENHPVHLH  489
             DFP  PP  FNYTGA   ANL+T   T  ++ R+ +N+TV+LVLQDT +++ E+HP+HLH
Sbjct  413   DFPDRPPTPFNYTGAPLTANLRTVRSTRPRLSRIAFNSTVELVLQDTNLLSVESHPIHLH  472

Query  488   GFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHL  309
             G+NFF VG GIGNF+PK DP K+NLVDP ERNTIGVP+GGW AIRFRADNPGVWFMHCHL
Sbjct  473   GYNFFVVGTGIGNFDPKKDPAKYNLVDPPERNTIGVPTGGWTAIRFRADNPGVWFMHCHL  532

Query  308   EVHTTWGLKMAFLVDNGKGPNES  240
             E+HT+WGLK AF+V+NG GP+++
Sbjct  533   ELHTSWGLKTAFVVENGPGPDQT  555



>ref|XP_006428774.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
 ref|XP_006481839.1| PREDICTED: laccase-11-like [Citrus sinensis]
 gb|ESR42014.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
Length=562

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/440 (62%), Positives = 339/440 (77%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY Y+F +TGQRGTL+WHAH+LWLR+TV+GA+VI+PK G  +PFP+P  E  ++L EWW 
Sbjct  114   SYTYDFNVTGQRGTLWWHAHILWLRATVYGAVVIMPKEGTSFPFPQPYQETNIILGEWWN  173

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD E ++N+  K GL P  SDAHTING  GP+  C  +  + + V+ GK+Y+LR++NAAL
Sbjct  174   SDVETIVNQGNKLGLPPQTSDAHTINGKSGPLFPCSEKHTFAMEVESGKTYLLRIVNAAL  233

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF IAGH MTVVE+DA Y KPF T  I+IAPGQTTNV+V A+Q   +Y +AA PFM
Sbjct  234   NDELFFAIAGHNMTVVEIDAVYTKPFTTQAILIAPGQTTNVLVKADQSPSRYFMAARPFM  293

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAPI VDN+T TA L Y G  + +   L S P  + T  A N+   LRSLN+ QYPA VP
Sbjct  294   DAPIPVDNKTVTAILQYKGIPNTVLPTLPSLPAPSDTNFALNYSSNLRSLNTPQYPANVP  353

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD  LF+T+GLG NPCPSC+  NG+++ AS+NN+TFVMP + LLQAH+FNI GVF TD
Sbjct  354   LRVDRHLFYTIGLGQNPCPSCQ--NGTQLTASLNNITFVMPKIGLLQAHYFNISGVFRTD  411

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PPV FNYTGA   ANL T+ GT++ ++ +N+T++LVLQDT ++  E+HP HLHG+N
Sbjct  412   FPDRPPVPFNYTGAPLTANLGTSLGTRLSKVAFNSTIELVLQDTNLLTVESHPFHLHGYN  471

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+PK DP KFNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+H
Sbjct  472   FFVVGSGIGNFDPKKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELH  531

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLKMAF+V+NGK P++S
Sbjct  532   TMWGLKMAFVVENGKSPDQS  551



>ref|XP_008800741.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=973

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/441 (61%), Positives = 343/441 (78%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             +SY Y+F +TGQRGTL+WHAH+LWLR+T+HGA+VI+PK GVPYPFP+P  E  +VL EWW
Sbjct  524   RSYTYDFNVTGQRGTLWWHAHILWLRATIHGAIVIMPKEGVPYPFPQPHAETELVLGEWW  583

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +D E V  +    GL PN+SDAHTING PGP+  C  +  + + V+ GK+Y+LR++NAA
Sbjct  584   HADVEEVEKQGSMLGLPPNMSDAHTINGKPGPLFPCSEKHTFAMEVEWGKTYLLRIVNAA  643

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN++LFF +A H MTVVE+D  Y KPF T  I IAPGQTTNV+V A++  G+Y +AA PF
Sbjct  644   LNDDLFFAVASHDMTVVEIDGVYCKPFTTEAIQIAPGQTTNVLVKADKAPGRYFMAARPF  703

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPIAVDN+TATA L Y G  + +  +L   P  N T   ++F++ LRSLNS Q+PA V
Sbjct  704   MDAPIAVDNKTATAILQYKGIPTTIIPILPQLPAPNDTEFVHDFLNKLRSLNSPQFPANV  763

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P++VD  LF+T  LG++ CP+C   NG+R+ AS+NN+TFVMP + LLQAH+FN+KGVF  
Sbjct  764   PRSVDRHLFYTASLGVDSCPTC--LNGTRLTASLNNITFVMPKIGLLQAHYFNVKGVFRL  821

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  P   FNYTGA   ANL T+ GT++ R+PYN TV+LVLQDT ++A E+HP HLHG+
Sbjct  822   DFPDKPATTFNYTGAPLTANLGTSLGTRLSRIPYNTTVELVLQDTNLLAAESHPFHLHGY  881

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VGRGIGNF+PK DP ++NLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+
Sbjct  882   NFFVVGRGIGNFDPKKDPAQYNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEL  941

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLKMAF+V+NG GP +S
Sbjct  942   HTSWGLKMAFVVENGNGPEQS  962



>ref|XP_010486777.1| PREDICTED: laccase-22-like isoform X1 [Camelina sativa]
Length=554

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/441 (63%), Positives = 343/441 (78%), Gaps = 8/441 (2%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             ++VYNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK GVPYPFP+P  E ++V  EWW 
Sbjct  109   TFVYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTERIIVFGEWWN  168

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD EAVI+++ +SGL PN+SDAHTING  G V  C S+G Y L V+ GK Y+LR+INAA+
Sbjct  169   SDVEAVISQSTQSGLPPNISDAHTINGLTGQVPGCKSRG-YTLHVETGKKYLLRIINAAV  227

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFFKIAGH +TVVEVDATY+KPF T T+ + PGQTTN I+TAN   G +++  SPFM
Sbjct  228   NDELFFKIAGHNLTVVEVDATYIKPFDTETLFLGPGQTTNAILTANHPQGNFLMTISPFM  287

Query  1016  DAPIAVDNQTATATLHYSGALS-GLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             D  + V+N TATA L Y    +  L++  +  PP NAT +A  F D+LRSLNS  YP  V
Sbjct  288   DTVVPVNNVTATAFLRYKDTRTQALKS--SKIPPVNATSIALGFSDSLRSLNSPDYPTNV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFN-IKGVFT  663
             P  VDHSLFF +G+G+NPC +C   NG++ +A +NNV+FVMPTVA+LQAH+FN  +GVFT
Sbjct  346   PLKVDHSLFFAIGVGVNPCATC--INGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVFT  403

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPG P   FNYTG G +NL+T  GTKVYRL +NATVQ+++Q T +IAPE+HP HLHG 
Sbjct  404   DDFPGKPSTPFNYTG-GLSNLRTENGTKVYRLEFNATVQVIIQGTSVIAPESHPTHLHGS  462

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF +G+G+GNF+P  D  KFNLVDPVERNT+ VP+ GW AIRF ADNPGVWF HCHLEV
Sbjct  463   NFFVIGKGLGNFDPLKDTKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFHCHLEV  522

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLKMAFLV++G G NE 
Sbjct  523   HTSWGLKMAFLVEDGNGSNEK  543



>gb|KHN36103.1| Laccase-11 [Glycine soja]
Length=554

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/440 (62%), Positives = 343/440 (78%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY Y+F +TGQRGTL+WHAH+LWLR+TV+GA+VI+PK G P+PFP+P  E  ++L EWW 
Sbjct  106   SYTYDFNVTGQRGTLWWHAHILWLRATVYGAIVIMPKPGTPFPFPQPAREFEILLGEWWN  165

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +D E + N+  K GL PN+SDAH+ING PGP+  C  +  + + V+ GK+Y+LR+INAAL
Sbjct  166   NDVEEIENQGNKMGLPPNMSDAHSINGKPGPLFPCSEKHTFAMEVEQGKTYLLRIINAAL  225

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF IAGH +TVVEVDA Y KPF T  I+IAPGQTTNV+V ANQ +G+Y +A   FM
Sbjct  226   NDELFFAIAGHSLTVVEVDAVYTKPFTTPAILIAPGQTTNVLVQANQVAGRYFMATKAFM  285

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAPI VDN+TATA L Y G  + +  VL   P  N T  A ++   LRSLNS QYPA VP
Sbjct  286   DAPIPVDNKTATAILQYKGIPNTVLPVLPQLPASNDTRFALSYNKKLRSLNSAQYPANVP  345

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD +LF+T+GLG N CP+C   NG+++VAS+NNV+FVMP  ALLQAH+FNIKGVF TD
Sbjct  346   LKVDRNLFYTIGLGQNSCPTC--LNGTQLVASLNNVSFVMPQTALLQAHYFNIKGVFRTD  403

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PP  FN+TGA   ANL T+TGT+V ++ +N+TV+LVLQDT +++ E+HP HLHG+N
Sbjct  404   FPDRPPTPFNFTGAPLTANLATSTGTRVSKIAFNSTVELVLQDTNLLSVESHPFHLHGYN  463

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG G+GNF+P  DP K+NLVDP+ERNT+GVP+GGW AIRFRADNPGVWFMHCHLEVH
Sbjct  464   FFVVGTGVGNFDPAKDPAKYNLVDPIERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVH  523

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLK AF+V+NG G ++S
Sbjct  524   TGWGLKTAFVVENGPGQDQS  543



>gb|KDO50695.1| hypothetical protein CISIN_1g036540mg [Citrus sinensis]
Length=562

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/440 (61%), Positives = 338/440 (77%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY Y+F +TGQRGTL+WHAH+LWLR+TV+GA+VI+PK    +PFP+P  E  ++L EWW 
Sbjct  114   SYTYDFNVTGQRGTLWWHAHILWLRATVYGAIVIMPKERTSFPFPQPYQETNIILGEWWN  173

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD E ++N+  K GL P  SDAHTING  GP+  C  +  + + V+ GK+Y+LR++NAAL
Sbjct  174   SDVETIVNQGNKLGLPPQTSDAHTINGKSGPLFPCSEKHTFAMEVESGKTYLLRIVNAAL  233

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF IAGH MTVVE+DA Y KPF T  I+IAPGQTTNV+V A+Q   +Y +AA PFM
Sbjct  234   NDELFFAIAGHNMTVVEIDAVYTKPFTTQAILIAPGQTTNVLVKADQSPSRYFMAARPFM  293

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAPI VDN+T TA L Y G  + +   L S P  + T  A N+   LRSLN+ QYPA VP
Sbjct  294   DAPIPVDNKTVTAILQYKGIPNTVLPTLPSLPAPSDTNFALNYSSKLRSLNTPQYPANVP  353

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD  LF+T+GLG NPCPSC+  NG+++ AS+NN+TFVMP + LLQAH+FNI GVF TD
Sbjct  354   LRVDRHLFYTIGLGQNPCPSCQ--NGTQLTASLNNITFVMPKIGLLQAHYFNISGVFRTD  411

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PPV FNYTGA   ANL T+ GT++ ++ +N+T++LVLQDT ++  E+HP HLHG+N
Sbjct  412   FPDRPPVPFNYTGAPLTANLGTSLGTRLSKVAFNSTIELVLQDTNLLTVESHPFHLHGYN  471

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+PK DP KFNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+H
Sbjct  472   FFVVGSGIGNFDPKKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELH  531

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLKMAF+V+NGK P++S
Sbjct  532   TMWGLKMAFVVENGKSPDQS  551



>ref|XP_010494695.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/442 (63%), Positives = 344/442 (78%), Gaps = 10/442 (2%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             ++VYNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK GV YPFP+P  E ++V  EWW 
Sbjct  109   TFVYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRGVLYPFPRPHTERIIVFGEWWN  168

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD EAVI+++ +SGL PN+SDAHTING  G V +C S+G Y L+V+ GK Y+LR+INAA+
Sbjct  169   SDVEAVISQSTQSGLPPNISDAHTINGLIGQVPSCKSRG-YTLNVETGKKYLLRIINAAV  227

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFFKI GH +TVVEVDA+Y KPF T T+ + PGQTTN I+TAN   G +++  SPFM
Sbjct  228   NDELFFKITGHNLTVVEVDASYTKPFDTETLFLGPGQTTNAILTANHPQGNFLMTISPFM  287

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTST--PPKNATPVANNFVDALRSLNSKQYPAR  843
             D  + V+N TATA L Y    +    VL S+  PP NAT +A  F D+LRSLNS+ YP  
Sbjct  288   DTVVPVNNVTATAFLRYKDTRT---QVLKSSKIPPVNATSIALGFSDSLRSLNSQDYPTN  344

Query  842   VPQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFN-IKGVF  666
             VP  VDHSLFF +G+G+NPC +C   NG++ +A +NNV+FVMPTVA+LQAH+FN  +GVF
Sbjct  345   VPLKVDHSLFFAIGVGVNPCATC--INGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVF  402

Query  665   TTDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHG  486
             T DFPG P   FNYTG G +NL+T  GTKVYRL +NATVQ+++Q T +IAPE+HP HLHG
Sbjct  403   TDDFPGKPSTPFNYTG-GLSNLRTENGTKVYRLEFNATVQVIIQGTSVIAPESHPTHLHG  461

Query  485   FNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLE  306
              NFF +G+G+GNF+P  DP KFNLVDPVERNT+ VP+ GW AIRF ADNPGVWF HCHLE
Sbjct  462   SNFFVIGKGLGNFDPLKDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFHCHLE  521

Query  305   VHTTWGLKMAFLVDNGKGPNES  240
             VHT+WGLKMAFLV++G G NE 
Sbjct  522   VHTSWGLKMAFLVEDGNGSNEK  543



>gb|KHN41965.1| Laccase-11 [Glycine soja]
Length=491

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/440 (62%), Positives = 342/440 (78%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY Y+F +T QRGTL+WHAH+LWLR+TV+GA+VI+PK G P+PFP+P  E  ++L EWW 
Sbjct  43    SYTYDFNVTEQRGTLWWHAHILWLRATVYGAIVIMPKAGTPFPFPQPAREFEILLGEWWN  102

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +D E + N+  K GL PN+SDAHTING PGP+  C  +  + + V+ GK+Y+LR+INAAL
Sbjct  103   NDVEEIENQGNKMGLPPNMSDAHTINGKPGPLFPCSEKHTFAMEVEQGKTYLLRIINAAL  162

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF IA H +TVVEVDA Y KPF T  I+IAPGQTTNV+V ANQ +G+Y +A   FM
Sbjct  163   NDELFFAIAHHNLTVVEVDAVYTKPFTTRAILIAPGQTTNVLVQANQVAGRYFMATKAFM  222

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAPI VDN+TATA L Y G  + +  VL   P +N T  A ++   LRSLNS QYPA VP
Sbjct  223   DAPIPVDNKTATAILQYKGIPNTVLPVLPQLPARNDTRFALSYNKKLRSLNSTQYPANVP  282

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD +LF+T+GLG N CP+C   NG+R+VAS+NNV+FVMP  ALLQAH+F+I+GVF TD
Sbjct  283   LKVDRNLFYTIGLGQNACPTC--LNGTRLVASLNNVSFVMPQTALLQAHYFSIRGVFRTD  340

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PP  FN+TGA   ANL T TGT+V ++ +N+TV+LVLQDT +++ E+HP HLHG+N
Sbjct  341   FPDRPPSPFNFTGAPLTANLATLTGTRVSKIAFNSTVELVLQDTNLLSVESHPFHLHGYN  400

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+P  DP K+NLVDP+ERNT+GVP+GGW AIRFRADNPGVWFMHCHLEVH
Sbjct  401   FFVVGTGIGNFDPAKDPAKYNLVDPIERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVH  460

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLK AF+V+NG+G ++S
Sbjct  461   TGWGLKTAFVVENGQGQDQS  480



>ref|XP_006300062.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
 gb|EOA32960.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
Length=548

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/440 (62%), Positives = 337/440 (77%), Gaps = 11/440 (3%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             ++VYNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK GVPYPFP+P  E ++V  EWWK
Sbjct  108   TFVYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTEKIIVFGEWWK  167

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD EAVIN++ +SGL PN+SDAHTING  G       + GY L V  GK Y+LR+INAA+
Sbjct  168   SDVEAVINQSTQSGLPPNISDAHTINGLTG-------RSGYTLHVKTGKKYLLRIINAAV  220

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFFKIAGH  TVVEVDA+Y KPF T+T+ + PGQTTN I+TA    G +++  SPFM
Sbjct  221   NDELFFKIAGHNFTVVEVDASYTKPFNTDTLFLGPGQTTNAILTATHPPGNFLMTISPFM  280

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             D  + V+N T TA L Y    +      +  PP NAT +A  F D+LRSLNS  YP +VP
Sbjct  281   DTVVPVNNATGTALLRYKDTTTTQSLTSSKIPPINATSIALGFSDSLRSLNSPDYPTKVP  340

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFN-IKGVFTT  660
               +DHSLFFT+G+G+NPC +C   NG++ +A +NNV+FVMPTVA+LQAH+FN  +GVFT 
Sbjct  341   LKIDHSLFFTIGVGVNPCTTC--INGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVFTD  398

Query  659   DFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             DFPG P   FNYTG G  NL+T  GTKVYRL +N+TVQ+++Q T +IAPE+HP HLHG N
Sbjct  399   DFPGRPLTPFNYTG-GLNNLRTKKGTKVYRLEFNSTVQVIIQGTSVIAPESHPTHLHGSN  457

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG+G+GNF+P  DP KFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF HCHLEVH
Sbjct  458   FFVVGKGLGNFDPLEDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFFHCHLEVH  517

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T+WGLKMAFLV++GK  NE 
Sbjct  518   TSWGLKMAFLVEDGKSSNEK  537



>ref|XP_011099634.1| PREDICTED: laccase-11-like [Sesamum indicum]
Length=565

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/440 (61%), Positives = 341/440 (78%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SYVY+F +TGQRGTL+WHAH+LWLR+TV+GA+VI+PK G P+PFP+PD E V++L EWW 
Sbjct  117   SYVYDFNVTGQRGTLWWHAHILWLRATVYGAIVIMPKQGTPFPFPQPDREEVILLGEWWN  176

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +D EAV  +    GL PN+SDAHTING PGP+  C  +  + + V+ GK+Y+LR+INAAL
Sbjct  177   ADVEAVEKQGNSLGLPPNMSDAHTINGKPGPLFPCSEKYTFAMEVEQGKTYLLRLINAAL  236

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF IAGH MTVVE+DA Y KPF T  ++IAPGQTTNV+V ANQ  G+Y +A  PFM
Sbjct  237   NDELFFAIAGHNMTVVEIDAVYTKPFSTQALLIAPGQTTNVLVRANQIPGRYFMATRPFM  296

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             D PI +DN+TATA L Y G  + +   L + P  N +  A ++ + LRSLNS Q+PA+VP
Sbjct  297   DVPIPIDNKTATAILQYKGIPNTIIPTLPNLPRPNDSAFAFSYEEKLRSLNSPQFPAKVP  356

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD  LF+T+GLG N CPSC   NG+R+ AS+NN++FVMP V LLQAH+FN+KGV+TTD
Sbjct  357   LKVDRHLFYTIGLGRNACPSC--INGTRLTASLNNISFVMPQVGLLQAHYFNMKGVYTTD  414

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP NPP  FNYTGA   ANL T+ GT++ R+ +N+TV+LVLQDT ++  E+HP HLHG+N
Sbjct  415   FPDNPPTPFNYTGAPLTANLGTSKGTRLSRISFNSTVELVLQDTNLLTVESHPFHLHGYN  474

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+P  DP K+NLVDP ERNT+GVP+GGW AIRFRADNPGVWF HCHLE+H
Sbjct  475   FFVVGTGIGNFDPTKDPAKYNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFFHCHLELH  534

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLK AF+V +G GP++ 
Sbjct  535   TGWGLKTAFVVGDGPGPDQK  554



>ref|XP_002512915.1| laccase, putative [Ricinus communis]
 gb|EEF49418.1| laccase, putative [Ricinus communis]
Length=558

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/441 (61%), Positives = 340/441 (77%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              +Y Y+F +TGQRGTL+WHAH+LWLR+TV+GA+VI+PK G P+PFP+P  E +++L EWW
Sbjct  109   HTYTYDFNVTGQRGTLWWHAHILWLRATVYGAIVIMPKPGTPFPFPQPQREELLILGEWW  168

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +D E ++ +  K GL PN SDAHTING PGP+  C  +  + + V+ GK+Y+LR+INAA
Sbjct  169   HNDVEQIVKQGNKMGLPPNASDAHTINGKPGPLFPCSEKHTFAMEVEQGKTYLLRIINAA  228

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF IAGH +TVVE+DA Y KPF T  I+IAPGQTTNV+V A Q   +Y +AA PF
Sbjct  229   LNDELFFAIAGHNLTVVEIDAVYTKPFTTRAILIAPGQTTNVLVQATQAPNRYFMAARPF  288

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP++VDN+TATA L Y G  + +  +L   P  N T  A ++   L+SLN+ Q+PA V
Sbjct  289   MDAPLSVDNRTATAILQYKGIPNTVLPILPQLPAPNDTVFALSYNSKLKSLNTLQFPANV  348

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VD  LF+T+GLG+N CP+C   NG+++ AS+NN+TFVMP + LLQAH+FNIKGVF T
Sbjct  349   PLKVDRHLFYTIGLGINLCPTC--LNGTQLTASLNNITFVMPQIGLLQAHYFNIKGVFRT  406

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP  FNYTGA   ANL TT GT++ ++ YN+TVQLVLQDT ++  E+HP HLHG+
Sbjct  407   DFPDKPPTPFNYTGAPLTANLGTTLGTRLSKIAYNSTVQLVLQDTNLLTVESHPFHLHGY  466

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG GIGNFNPK DP KFNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+
Sbjct  467   NFFVVGTGIGNFNPKKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEL  526

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT WGLK AF+V++G GP+ S
Sbjct  527   HTGWGLKTAFVVEDGSGPDLS  547



>ref|XP_007156958.1| hypothetical protein PHAVU_002G031600g [Phaseolus vulgaris]
 gb|ESW28952.1| hypothetical protein PHAVU_002G031600g [Phaseolus vulgaris]
Length=564

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/440 (62%), Positives = 341/440 (78%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY Y+F +TGQRGTL+WHAH+LWLR+TV+GA+VI+PK G P+PFP+P  E  ++L EWW 
Sbjct  116   SYTYDFNVTGQRGTLWWHAHILWLRATVYGAIVIMPKPGTPFPFPQPAREFEILLGEWWH  175

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +D EAV  +  + GL PN+SDAHTING PGP+  C  +  Y + V+ GKSY+LR+INAAL
Sbjct  176   NDVEAVETQGNQMGLPPNMSDAHTINGKPGPLFPCSEKHTYAMEVEQGKSYLLRIINAAL  235

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             ++ELFF IAGH MTVVEVDA Y KPF T TI+IAPGQTTNV+V ANQ +G+Y +A   FM
Sbjct  236   DDELFFAIAGHNMTVVEVDAVYTKPFTTQTIIIAPGQTTNVLVKANQVAGRYFMATRTFM  295

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAPI VDN++ATA   Y G  + +     S P  N TP A ++ + +RSLNS QYPA VP
Sbjct  296   DAPIPVDNKSATAIFQYKGIPNTVLPFPPSLPAANDTPFALSYNNKIRSLNSPQYPANVP  355

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD +LF+T+GL  N CP+C   NG+R++AS+NNV+FVMP  ALLQAH+FNIKGV+ TD
Sbjct  356   LEVDRNLFYTIGLAQNSCPTC--VNGTRLLASLNNVSFVMPQTALLQAHYFNIKGVYRTD  413

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  P   FNYTGA   ANL T+TGT++ ++P+N+TV+LVLQDT ++  E+HP HLHG+N
Sbjct  414   FPDKPSTTFNYTGAPLTANLGTSTGTRISKVPFNSTVELVLQDTNLLTVESHPFHLHGYN  473

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+P  DP K+NLVDP+ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+H
Sbjct  474   FFVVGTGIGNFDPSKDPAKYNLVDPIERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELH  533

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLK AFLV++G G  +S
Sbjct  534   TGWGLKTAFLVEDGPGQEQS  553



>ref|XP_010464832.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/441 (63%), Positives = 340/441 (77%), Gaps = 8/441 (2%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             ++VYNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK GVPYPFP+P  E ++V  EWW 
Sbjct  109   TFVYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTEKIIVFGEWWN  168

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD EAVI+++ +SGL PN+SD HTING  G V  C S+G Y L V+ GK Y+LR+INAA+
Sbjct  169   SDVEAVISQSTQSGLPPNISDGHTINGLTGQVPGCKSRG-YTLHVETGKKYLLRIINAAV  227

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFFKI GH +TVVEVDATY KPF T T+ + PGQTTN I+TAN   G +++  SPFM
Sbjct  228   NDELFFKITGHNLTVVEVDATYTKPFDTETLFLGPGQTTNAILTANHPQGNFLMTISPFM  287

Query  1016  DAPIAVDNQTATATLHYSGALS-GLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             D  + V+N TATA L Y    +  L++  +  PP NAT +A  F D+LRSLNS  YP  V
Sbjct  288   DTVVPVNNVTATAILRYKYTRTQSLKS--SKIPPVNATSIALGFSDSLRSLNSPDYPTNV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFN-IKGVFT  663
             P  VDHSLFF +G+G+NPC +C   NG++ +A +NNV+FVMPTVA+LQAH+FN  +GVFT
Sbjct  346   PLKVDHSLFFAIGVGVNPCATC--INGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVFT  403

Query  662   TDFPGNPPVAFNYTGAGPANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
              DFPG P   FNYTG G +NLQT  GTKVYRL +NATVQ+++Q T +IAPE+HP HLHG 
Sbjct  404   DDFPGRPSTPFNYTG-GLSNLQTKNGTKVYRLQFNATVQVIIQGTSVIAPESHPTHLHGS  462

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF +G+G+GNF+P  DP KFNLVDPVERNT+ VP+ GW AIRF ADNPGVWF HCHLEV
Sbjct  463   NFFVIGKGLGNFDPIKDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFHCHLEV  522

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLKMAFLV++G   NE 
Sbjct  523   HTSWGLKMAFLVEDGNDSNEK  543



>ref|XP_010486778.1| PREDICTED: laccase-22-like isoform X2 [Camelina sativa]
Length=565

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/451 (62%), Positives = 343/451 (76%), Gaps = 17/451 (4%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             ++VYNFT+TGQRGTL WHAH+ WLR+TVHGA+VILPK GVPYPFP+P  E ++V  EWW 
Sbjct  109   TFVYNFTLTGQRGTLLWHAHISWLRATVHGAIVILPKRGVPYPFPRPHTERIIVFGEWWN  168

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD EAVI+++ +SGL PN+SDAHTING  G V  C S+G Y L V+ GK Y+LR+INAA+
Sbjct  169   SDVEAVISQSTQSGLPPNISDAHTINGLTGQVPGCKSRG-YTLHVETGKKYLLRIINAAV  227

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFFKIAGH +TVVEVDATY+KPF T T+ + PGQTTN I+TAN   G +++  SPFM
Sbjct  228   NDELFFKIAGHNLTVVEVDATYIKPFDTETLFLGPGQTTNAILTANHPQGNFLMTISPFM  287

Query  1016  DAPIAVDNQTATATLHYSGALS-GLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             D  + V+N TATA L Y    +  L++  +  PP NAT +A  F D+LRSLNS  YP  V
Sbjct  288   DTVVPVNNVTATAFLRYKDTRTQALKS--SKIPPVNATSIALGFSDSLRSLNSPDYPTNV  345

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFN-IKGVFT  663
             P  VDHSLFF +G+G+NPC +C   NG++ +A +NNV+FVMPTVA+LQAH+FN  +GVFT
Sbjct  346   PLKVDHSLFFAIGVGVNPCATC--INGTKTIADINNVSFVMPTVAMLQAHYFNKSEGVFT  403

Query  662   TDFPGNPPVAFNYTGAGPA----------NLQTTTGTKVYRLPYNATVQLVLQDTGIIAP  513
              DFPG P   FNYTG  P+          NL+T  GTKVYRL +NATVQ+++Q T +IAP
Sbjct  404   DDFPGKPSTPFNYTGGKPSTPFNYTGGLSNLRTENGTKVYRLEFNATVQVIIQGTSVIAP  463

Query  512   ENHPVHLHGFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPG  333
             E+HP HLHG NFF +G+G+GNF+P  D  KFNLVDPVERNT+ VP+ GW AIRF ADNPG
Sbjct  464   ESHPTHLHGSNFFVIGKGLGNFDPLKDTKKFNLVDPVERNTVSVPTAGWTAIRFIADNPG  523

Query  332   VWFMHCHLEVHTTWGLKMAFLVDNGKGPNES  240
             VWF HCHLEVHT+WGLKMAFLV++G G NE 
Sbjct  524   VWFFHCHLEVHTSWGLKMAFLVEDGNGSNEK  554



>ref|XP_011088411.1| PREDICTED: laccase-11-like [Sesamum indicum]
Length=559

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/443 (62%), Positives = 341/443 (77%), Gaps = 5/443 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
             QSY Y+F +TGQRGTL+WHAH+ WLR+TV+GA+VI+PK G  YPFP+PD E  ++L EWW
Sbjct  108   QSYTYDFNVTGQRGTLWWHAHISWLRATVYGAIVIMPKQGTSYPFPQPDFEFNLLLGEWW  167

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
               D E V+ +  K GL P  SDAHTING PGP+  CP +  Y + V+ GK+Y+LR+INAA
Sbjct  168   NDDVETVVKQGNKLGLPPKTSDAHTINGKPGPLFPCPEKHTYAVEVEQGKTYLLRIINAA  227

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF +AGH MTVVE+DA Y KPF TN ++IAPGQTTNV++ ANQ  G+Y +AA PF
Sbjct  228   LNDELFFAVAGHNMTVVEIDAIYTKPFSTNAVLIAPGQTTNVLLRANQAPGRYFMAARPF  287

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAPI+VDN+TATA L Y G  + +   L   P  N +  A N+   LRSLNS  +PA V
Sbjct  288   MDAPISVDNKTATAILQYKGIQNTVIPSLPQLPALNDSAFALNYNAKLRSLNSPIFPANV  347

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VD  LF+T+GLG+NPCP+C+  NG+++ AS+NN+TFVMP  ALLQAH+FN+KGVFTT
Sbjct  348   PLKVDRHLFYTIGLGVNPCPTCQ--NGTQLTASLNNITFVMPQTALLQAHYFNLKGVFTT  405

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGT--KVYRLPYNATVQLVLQDTGIIAPENHPVHLH  489
             DFP  PP+ FNYTGA   ANLQTT     ++ ++ +N+TV+LVLQDT +++ E+HP HLH
Sbjct  406   DFPDRPPMPFNYTGAPLTANLQTTQSNRPRLSKIAFNSTVELVLQDTNLLSVESHPFHLH  465

Query  488   GFNFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHL  309
             G+NFF VG GIGNF+PK DP KFNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHL
Sbjct  466   GYNFFVVGSGIGNFDPKNDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHL  525

Query  308   EVHTTWGLKMAFLVDNGKGPNES  240
             EVHT WGLK AF+V++G   + S
Sbjct  526   EVHTGWGLKTAFVVEDGPDADHS  548



>ref|XP_008236999.1| PREDICTED: laccase-11-like [Prunus mume]
Length=563

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/441 (62%), Positives = 339/441 (77%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SY YN TITGQRGTL+WHAH+ WLR+TV+GA+VILPK G  +PF +P  EA +VL EWW
Sbjct  114   HSYTYNITITGQRGTLWWHAHIFWLRATVYGAIVILPKQGTGFPFLQPYKEANIVLGEWW  173

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +D E V+ +  K GL PN+SDAHTING PGP+  C  +  Y L V+ GK+Y+LR+INAA
Sbjct  174   NNDVEEVVKQGNKLGLPPNMSDAHTINGKPGPLFPCSEKHTYALEVEQGKTYLLRIINAA  233

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF IAGH +TVVE+DA Y KPF +  I+IAPGQTTNV+V ANQ  G+Y +AA PF
Sbjct  234   LNDELFFAIAGHNLTVVEIDAVYTKPFTSQAILIAPGQTTNVLVQANQAPGRYFMAARPF  293

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+++DN+TAT  L Y G  + ++ VL   P  N T  A +F   LRSLN+ Q+PA V
Sbjct  294   MDAPVSIDNKTATGILQYKGIPNSVQPVLPQLPALNDTAFALSFNAKLRSLNTAQFPASV  353

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VD  LF+T+GLG+N C +C   NG+++ AS+NN+TFVMP + LLQAH+FN KGVFTT
Sbjct  354   PLKVDRHLFYTIGLGINQCTTC--LNGTQLTASLNNITFVMPQIGLLQAHYFNTKGVFTT  411

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP  PP  FNYTGA   ANL T  GT++ +L +N+TV+LVLQDT ++  E+HP HLHG+
Sbjct  412   DFPDRPPTPFNYTGAPLNANLGTKIGTRLSKLDFNSTVELVLQDTNLLTVESHPFHLHGY  471

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG G+GNF+PK DP K+NLVDP ERNTIGVP+GGWVAIRFRADNPGVWFMHCHLE+
Sbjct  472   NFFVVGTGVGNFDPKNDPAKYNLVDPPERNTIGVPTGGWVAIRFRADNPGVWFMHCHLEL  531

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT+WGLK AF+V+NGK  + S
Sbjct  532   HTSWGLKTAFVVENGKDSDHS  552



>ref|XP_002519529.1| laccase, putative [Ricinus communis]
 gb|EEF42943.1| laccase, putative [Ricinus communis]
Length=559

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/440 (61%), Positives = 338/440 (77%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY Y F +TGQRGTL+WHAH+LWLR+TV+GA++I+PK G  +PFP+P  E  ++L EWW 
Sbjct  111   SYTYAFNVTGQRGTLWWHAHILWLRATVYGAIIIMPKQGTAFPFPQPYQETNIILGEWWN  170

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             SD E ++N+A K GL P  SDAHTING PGP+  C  +  + + V+ GK+Y+LR+INAAL
Sbjct  171   SDVETIVNQANKLGLPPPTSDAHTINGKPGPLFPCAEKHTFAMEVESGKTYLLRIINAAL  230

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF IAGH MTVVE+DA Y KPF TN I+IAPGQTTNV+V A+Q   +Y +A  PFM
Sbjct  231   NDELFFAIAGHNMTVVEIDAVYTKPFITNAILIAPGQTTNVLVKADQIPSRYFMAGRPFM  290

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAP+ VDN+T  A L Y G  + +  +L + P  N T  A ++   LRSLN+ Q+PA VP
Sbjct  291   DAPVPVDNKTVAAILQYKGIPNTVLPILPTMPAPNDTKFALDYNKKLRSLNTPQFPALVP  350

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD  LF+TVGLG NPCP+C+  NG+R+ AS+NN+TFVMP + LLQAH+FNI GVF TD
Sbjct  351   LQVDRHLFYTVGLGQNPCPTCQ--NGTRLTASLNNITFVMPKIGLLQAHYFNISGVFRTD  408

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PPV FNYTGA   AN+ T++GT++ ++ +N+ ++LVLQDT ++  E+HP HLHGFN
Sbjct  409   FPDRPPVPFNYTGAPLTANIATSSGTRLSKVAFNSAIELVLQDTNLLTVESHPFHLHGFN  468

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+P  DP KFNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+H
Sbjct  469   FFVVGSGIGNFDPAKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELH  528

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLKMAF+V+NGK P +S
Sbjct  529   TMWGLKMAFVVENGKLPEQS  548



>ref|XP_002313847.2| hypothetical protein POPTR_0009s10550g [Populus trichocarpa]
 gb|EEE87802.2| hypothetical protein POPTR_0009s10550g [Populus trichocarpa]
Length=561

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/441 (62%), Positives = 338/441 (77%), Gaps = 3/441 (1%)
 Frame = -2

Query  1559  QSYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWW  1380
              SY Y+F +TGQRGTL+WHAH+LWLR+TV+GA+VI+PK G P+PFP+P  E +++  EWW
Sbjct  112   HSYTYDFNVTGQRGTLWWHAHILWLRATVYGAIVIMPKPGTPFPFPQPHREEIIIFGEWW  171

Query  1379  KSDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAA  1200
              +D E +  +  K GL PN SDAHTING PGP+  C  +  + L V+  K+Y+LR+INAA
Sbjct  172   NNDVEDIEKQGNKLGLPPNASDAHTINGKPGPLFPCSEKHTFTLEVEQAKTYLLRIINAA  231

Query  1199  LNEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPF  1020
             LN+ELFF IAGH MTVVE+DA Y KPF T  I+IAPGQTTNV+V A Q   +Y +AA PF
Sbjct  232   LNDELFFAIAGHNMTVVEIDAVYTKPFTTQAILIAPGQTTNVLVQATQTPNRYFMAARPF  291

Query  1019  MDAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARV  840
             MDAP+++DN+TATA L Y G  + +  +L   P  N T  A ++   LRSLNS Q+ A V
Sbjct  292   MDAPLSIDNKTATAILQYKGIPNTVLPLLPQLPEPNDTAFARSYNAKLRSLNSPQFQANV  351

Query  839   PQTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTT  660
             P  VD  LF+T+GLG+NPCP+C   NG+++ AS+NN+TFVMP + LLQAH+FNIKGVF  
Sbjct  352   PLIVDRHLFYTIGLGINPCPTC--LNGTKLTASLNNITFVMPQIGLLQAHYFNIKGVFRL  409

Query  659   DFPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGF  483
             DFP NPP  FNYTGA   ANL TT GT+V ++ YN+TVQLVLQDT ++  E+HP HLHG+
Sbjct  410   DFPDNPPTPFNYTGAPLTANLGTTLGTRVSKIAYNSTVQLVLQDTNLLTVESHPFHLHGY  469

Query  482   NFFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEV  303
             NFF VG GIGNF+PK DP KFNLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+
Sbjct  470   NFFVVGTGIGNFDPKRDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEL  529

Query  302   HTTWGLKMAFLVDNGKGPNES  240
             HT WGLK AF+V+NGK P++S
Sbjct  530   HTGWGLKTAFVVENGKLPDQS  550



>gb|KHG01609.1| Laccase-11 -like protein [Gossypium arboreum]
Length=562

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/440 (61%), Positives = 337/440 (77%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SYVY+F +TGQRGTL+WHAH+LWLR+TV+GA+VI+PK G+PYPFPKP+ E +VVL EWW 
Sbjct  114   SYVYDFNVTGQRGTLWWHAHILWLRATVYGAIVIMPKQGMPYPFPKPNMEQLVVLGEWWH  173

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
              D E ++ +    GL PN+SDAHTING PGP+  C  +  + + V+ GK+Y+LR+INAAL
Sbjct  174   KDVEEIVKQGNNMGLPPNMSDAHTINGKPGPLFPCSEKHTFAMEVESGKTYLLRIINAAL  233

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF IA H MTVVEVDA Y KPF T  I+IAPGQTTNV++ ANQ  G+Y +AA PFM
Sbjct  234   NDELFFAIASHNMTVVEVDAVYTKPFVTQAILIAPGQTTNVLIQANQSPGRYFMAARPFM  293

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             DAPI VDN+TAT    Y+G  + +   L   P  N T  A ++   L+SLNS  +PA VP
Sbjct  294   DAPIPVDNKTATGIFQYNGIPNTVLPTLPQLPASNDTDFALSYNKKLKSLNSANFPANVP  353

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD  LF+TVG G + CP+C   NG+R++AS+NN++FVMP + LLQAH+FNI GVF TD
Sbjct  354   LKVDRKLFYTVGFGKDSCPTC--VNGTRILASLNNISFVMPKIGLLQAHYFNISGVFRTD  411

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PP  FNYTGA   ANL T  GT++ ++ +N+TV+LVLQDT ++  E+HP HLHG+N
Sbjct  412   FPDKPPKPFNYTGAPLTANLGTAHGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGYN  471

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNF+P  DP K+NLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLE+H
Sbjct  472   FFVVGTGIGNFDPVKDPAKYNLVDPVERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELH  531

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLKMAF V++GKG ++S
Sbjct  532   TGWGLKMAFEVEDGKGADQS  551



>ref|XP_008452071.1| PREDICTED: laccase-11-like [Cucumis melo]
Length=563

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/440 (61%), Positives = 339/440 (77%), Gaps = 3/440 (1%)
 Frame = -2

Query  1556  SYVYNFTITGQRGTLFWHAHVLWLRSTVHGALVILPKLGVPYPFPKPDHEAVVVLAEWWK  1377
             SY Y+F +TGQRGTL+WHAH+LWLR+TV+GA+VILPK G PYPFP+P+ E  ++L EWW 
Sbjct  115   SYTYDFNVTGQRGTLWWHAHILWLRATVYGAIVILPKQGTPYPFPQPNGEFEILLGEWWN  174

Query  1376  SDTEAVINEAIKSGLAPNVSDAHTINGHPGPVTNCPSQGGYKLSVDPGKSYMLRVINAAL  1197
             +D EAV+N+  + G+ PN+SDAHTING PGP+  C  +  + + V+ GK+Y+LR+INAAL
Sbjct  175   NDVEAVVNQGSRMGVPPNMSDAHTINGKPGPLFPCSEKHTFAMEVEAGKTYLLRIINAAL  234

Query  1196  NEELFFKIAGHQMTVVEVDATYVKPFKTNTIVIAPGQTTNVIVTANQGSGKYMVAASPFM  1017
             N+ELFF IAGH MTVVEVDA Y KPF T  I+IAPGQTTNV++ ANQ   +Y +A+  FM
Sbjct  235   NDELFFAIAGHNMTVVEVDAVYTKPFTTQAILIAPGQTTNVLLQANQAPNRYFMASRSFM  294

Query  1016  DAPIAVDNQTATATLHYSGALSGLRTVLTSTPPKNATPVANNFVDALRSLNSKQYPARVP  837
             D PI VDN+TAT  L Y G  + +  +L   P  N T  A ++   L+SLNS QYPA VP
Sbjct  295   DVPIPVDNKTATGILQYRGIPNTILPILPQLPASNDTSFALSYNKKLKSLNSPQYPANVP  354

Query  836   QTVDHSLFFTVGLGLNPCPSCKPANGSRVVASVNNVTFVMPTVALLQAHFFNIKGVFTTD  657
               VD  LF+T+GLG N CP+C   NG+++VAS+NN++FVMP + LLQ+H+FNI GVF TD
Sbjct  355   LEVDRKLFYTIGLGQNDCPTC--LNGTQLVASLNNISFVMPQIGLLQSHYFNISGVFRTD  412

Query  656   FPGNPPVAFNYTGAG-PANLQTTTGTKVYRLPYNATVQLVLQDTGIIAPENHPVHLHGFN  480
             FP  PP  FNYTGA   ANL+T  GT++ ++ +N+TV+LVLQDT ++  E+HP HLHG+N
Sbjct  413   FPDRPPTPFNYTGAPLTANLRTAVGTRLSKIAFNSTVELVLQDTNLLTVESHPFHLHGYN  472

Query  479   FFAVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHCHLEVH  300
             FF VG GIGNFNP  DP K+NLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCHLEVH
Sbjct  473   FFVVGTGIGNFNPAKDPAKYNLVDPVERNTVGVPTGGWTAIRFRADNPGVWFMHCHLEVH  532

Query  299   TTWGLKMAFLVDNGKGPNES  240
             T WGLK AF+V++G G ++S
Sbjct  533   TGWGLKTAFVVEDGPGKDQS  552



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4431748474008