BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23785_g1_i1 len=1493 path=[1883:0-1492]

Length=1493
                                                                      Score     E

ref|XP_004244682.2|  PREDICTED: uncharacterized protein LOC101248898    289   1e-88   
ref|XP_009589915.1|  PREDICTED: uncharacterized protein LOC104087...    283   2e-86   
ref|XP_009589914.1|  PREDICTED: uncharacterized protein LOC104087...    283   2e-86   
ref|XP_009799834.1|  PREDICTED: protein notum homolog                   282   3e-86   
ref|XP_007040900.1|  Pectinacetylesterase family protein                282   5e-86   
ref|XP_010942974.1|  PREDICTED: protein notum homolog                   279   4e-85   
ref|XP_008797987.1|  PREDICTED: protein notum homolog isoform X1        279   5e-85   
gb|EYU29129.1|  hypothetical protein MIMGU_mgv1a023759mg                279   5e-85   
ref|XP_009803843.1|  PREDICTED: uncharacterized protein LOC104249167    277   3e-84   
ref|XP_009779347.1|  PREDICTED: protein notum homolog isoform X1        277   4e-84   
ref|XP_010911666.1|  PREDICTED: protein notum homolog                   275   2e-83   
gb|KDP28066.1|  hypothetical protein JCGZ_19474                         275   2e-83   
ref|XP_002303225.2|  pectinacetylesterase family protein                275   3e-83   Populus trichocarpa [western balsam poplar]
ref|XP_006361594.1|  PREDICTED: protein notum homolog                   278   6e-83   
ref|XP_002519912.1|  pectin acetylesterase, putative                    274   2e-82   Ricinus communis
ref|XP_011012520.1|  PREDICTED: protein notum homolog                   272   3e-82   
ref|XP_009600038.1|  PREDICTED: protein notum homolog                   271   5e-82   
ref|XP_006385133.1|  pectinacetylesterase family protein                271   5e-82   
ref|XP_009605804.1|  PREDICTED: protein notum homolog                   271   6e-82   
ref|XP_011028476.1|  PREDICTED: protein notum homolog                   271   8e-82   
ref|XP_009778395.1|  PREDICTED: protein notum homolog                   271   1e-81   
gb|KHN27509.1|  Protein notum like                                      270   1e-81   
ref|XP_003547731.1|  PREDICTED: protein notum homolog isoform X1        270   3e-81   
ref|XP_009607289.1|  PREDICTED: protein notum homolog                   268   7e-81   
gb|ADR82372.1|  pectin acetylesterase                                   268   9e-81   
ref|XP_010248193.1|  PREDICTED: uncharacterized protein LOC104591101    267   2e-80   
gb|KDP28067.1|  hypothetical protein JCGZ_19475                         266   3e-80   
ref|XP_008808367.1|  PREDICTED: uncharacterized protein LOC103720...    267   4e-80   
ref|XP_008808368.1|  PREDICTED: uncharacterized protein LOC103720...    266   4e-80   
ref|XP_006587657.1|  PREDICTED: protein notum homolog isoform X3        265   2e-79   
ref|XP_006573492.1|  PREDICTED: protein notum homolog isoform X2        265   2e-79   
gb|KHN41756.1|  Protein notum like                                      266   4e-79   
ref|XP_006573491.1|  PREDICTED: protein notum homolog isoform X1        265   5e-79   
ref|XP_006587656.1|  PREDICTED: protein notum homolog isoform X2        265   5e-79   
gb|EYU37455.1|  hypothetical protein MIMGU_mgv1a007934mg                263   5e-79   
dbj|BAJ97261.1|  predicted protein                                      263   6e-79   
ref|XP_007158098.1|  hypothetical protein PHAVU_002G123900g             264   6e-79   
ref|XP_003613922.1|  Notum-like protein                                 263   7e-79   
gb|KHG09455.1|  Protein notum                                           263   1e-78   
ref|XP_006432880.1|  hypothetical protein CICLE_v10001467mg             262   2e-78   
gb|AFK37852.1|  unknown                                                 261   3e-78   
ref|XP_008451861.1|  PREDICTED: protein notum homolog isoform X2        261   4e-78   
ref|XP_008451860.1|  PREDICTED: protein notum homolog isoform X1        261   4e-78   
ref|XP_002867940.1|  hypothetical protein ARALYDRAFT_492921             261   4e-78   
ref|XP_008808370.1|  PREDICTED: uncharacterized protein LOC103720...    261   5e-78   
ref|XP_004509558.1|  PREDICTED: protein notum homolog                   261   5e-78   
ref|XP_010536189.1|  PREDICTED: uncharacterized protein LOC104811...    261   5e-78   
gb|EYU37453.1|  hypothetical protein MIMGU_mgv1a007583mg                261   6e-78   
ref|NP_567585.1|  pectinacetylesterase family protein                   260   9e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011082153.1|  PREDICTED: protein notum homolog                   260   1e-77   
ref|XP_009590663.1|  PREDICTED: protein notum homolog isoform X1        260   1e-77   
ref|XP_006878664.1|  hypothetical protein AMTR_s00011p00266820          260   1e-77   
ref|XP_010439720.1|  PREDICTED: uncharacterized protein LOC104723107    259   2e-77   
ref|XP_006587655.1|  PREDICTED: protein notum homolog isoform X1        261   2e-77   
ref|XP_009784099.1|  PREDICTED: protein notum homolog                   259   2e-77   
ref|XP_004300392.1|  PREDICTED: protein notum homolog                   259   2e-77   
ref|XP_004512351.1|  PREDICTED: protein notum homolog isoform X3        261   2e-77   
emb|CDX99378.1|  BnaC01g11740D                                          259   2e-77   
gb|KHN27511.1|  Protein notum like                                      259   2e-77   
ref|XP_009128780.1|  PREDICTED: uncharacterized protein LOC103853624    259   3e-77   
ref|XP_009132784.1|  PREDICTED: uncharacterized protein LOC103857370    259   3e-77   
ref|XP_010434425.1|  PREDICTED: uncharacterized protein LOC104718...    258   4e-77   
ref|XP_004172255.1|  PREDICTED: protein notum homolog                   259   4e-77   
emb|CDX87799.1|  BnaC02g31500D                                          258   4e-77   
ref|XP_009624847.1|  PREDICTED: protein notum homolog isoform X2        258   4e-77   
ref|XP_010244169.1|  PREDICTED: protein notum homolog                   258   6e-77   
ref|XP_004512349.1|  PREDICTED: protein notum homolog isoform X1        261   6e-77   
gb|ABK24994.1|  unknown                                                 258   6e-77   Picea sitchensis
gb|ABK24433.1|  unknown                                                 258   6e-77   Picea sitchensis
ref|XP_010314004.1|  PREDICTED: protein notum homolog isoform X2        258   6e-77   
ref|XP_010314003.1|  PREDICTED: protein notum homolog isoform X1        258   6e-77   
ref|XP_006432881.1|  hypothetical protein CICLE_v10001426mg             258   6e-77   
ref|XP_010434424.1|  PREDICTED: uncharacterized protein LOC104718...    258   7e-77   
emb|CDX78932.1|  BnaA01g09990D                                          258   8e-77   
ref|XP_010449359.1|  PREDICTED: uncharacterized protein LOC104731629    258   8e-77   
ref|XP_003548585.1|  PREDICTED: protein notum homolog                   258   9e-77   
ref|XP_003628996.1|  Carboxylic ester hydrolase                         258   9e-77   
ref|XP_010318089.1|  PREDICTED: protein notum homolog                   258   1e-76   
ref|XP_011082149.1|  PREDICTED: protein notum homolog isoform X1        258   1e-76   
ref|XP_003580427.1|  PREDICTED: uncharacterized protein LOC100827...    257   1e-76   
ref|XP_002865253.1|  pectin acetylesterase                              257   1e-76   
ref|XP_010240371.1|  PREDICTED: uncharacterized protein LOC100827...    257   2e-76   
ref|XP_004509522.1|  PREDICTED: uncharacterized protein LOC101493...    257   2e-76   
ref|NP_001190770.1|  pectinacetylesterase family protein                261   2e-76   
emb|CDP15690.1|  unnamed protein product                                257   2e-76   
ref|XP_010536210.1|  PREDICTED: uncharacterized protein LOC104811251    256   2e-76   
ref|XP_011073252.1|  PREDICTED: protein notum homolog isoform X2        257   2e-76   
ref|XP_006283887.1|  hypothetical protein CARUB_v10005004mg             256   2e-76   
ref|XP_004244767.2|  PREDICTED: protein notum homolog                   256   4e-76   
gb|AAM65412.1|  pectin acetylesterase                                   256   4e-76   Arabidopsis thaliana [mouse-ear cress]
gb|ACF05806.1|  PAE                                                     256   5e-76   Litchi chinensis [litchi]
ref|XP_010441760.1|  PREDICTED: uncharacterized protein LOC104724893    256   5e-76   
ref|XP_003547821.1|  PREDICTED: protein notum homolog                   256   5e-76   
ref|XP_008667853.1|  PREDICTED: hypothetical protein isoform X1         256   5e-76   
ref|XP_010266384.1|  PREDICTED: uncharacterized protein LOC104603...    256   5e-76   
ref|XP_010481611.1|  PREDICTED: uncharacterized protein LOC104760390    256   5e-76   
ref|XP_006280604.1|  hypothetical protein CARUB_v10026563mg             256   5e-76   
ref|XP_009601364.1|  PREDICTED: protein notum homolog                   256   6e-76   
ref|XP_010494620.1|  PREDICTED: uncharacterized protein LOC104771742    255   6e-76   
ref|XP_009413211.1|  PREDICTED: protein notum homolog                   256   6e-76   
ref|XP_011073171.1|  PREDICTED: protein notum homolog isoform X1        256   7e-76   
emb|CDY26383.1|  BnaA02g23870D                                          255   8e-76   
ref|XP_006652763.1|  PREDICTED: protein notum homolog                   255   9e-76   
ref|XP_009397056.1|  PREDICTED: protein notum homolog                   255   1e-75   
ref|XP_006494119.1|  PREDICTED: protein notum homolog isoform X1        254   1e-75   
ref|XP_010266383.1|  PREDICTED: uncharacterized protein LOC104603...    256   1e-75   
tpg|DAA36176.1|  TPA: pectinacetylesterase                              258   1e-75   
gb|KDO40409.1|  hypothetical protein CISIN_1g016608mg                   254   2e-75   
ref|XP_004150551.1|  PREDICTED: protein notum homolog                   259   2e-75   
ref|XP_010529277.1|  PREDICTED: protein notum homolog                   254   2e-75   
ref|XP_010536220.1|  PREDICTED: protein notum homolog isoform X1        254   2e-75   
gb|KCW72723.1|  hypothetical protein EUGRSUZ_E01170                     254   2e-75   
ref|XP_002447050.1|  hypothetical protein SORBIDRAFT_06g027560          254   2e-75   Sorghum bicolor [broomcorn]
ref|XP_010244170.1|  PREDICTED: uncharacterized protein LOC104588061    254   3e-75   
ref|NP_199341.1|  pectinacetylesterase family protein                   254   3e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDY09287.1|  BnaC03g63170D                                          253   3e-75   
ref|XP_010676220.1|  PREDICTED: uncharacterized protein LOC104892094    255   3e-75   
ref|XP_010056136.1|  PREDICTED: protein notum homolog                   254   3e-75   
ref|XP_009624845.1|  PREDICTED: protein notum homolog isoform X1        253   3e-75   
ref|XP_009108426.1|  PREDICTED: protein notum homolog                   253   4e-75   
ref|XP_007209217.1|  hypothetical protein PRUPE_ppa006718mg             253   4e-75   
emb|CAA67728.1|  pectinacetylesterase precursor                         253   6e-75   Vigna radiata var. radiata [golden gram]
ref|XP_006398195.1|  hypothetical protein EUTSA_v10000914mg             253   6e-75   
ref|XP_006413981.1|  hypothetical protein EUTSA_v10024796mg             258   7e-75   
ref|XP_010677538.1|  PREDICTED: protein notum homolog isoform X1        253   7e-75   
ref|XP_003547822.1|  PREDICTED: protein notum homolog                   253   8e-75   
ref|XP_010644665.1|  PREDICTED: uncharacterized protein LOC100245856    253   9e-75   
ref|XP_007156332.1|  hypothetical protein PHAVU_003G277600g             252   1e-74   
gb|KCW72722.1|  hypothetical protein EUGRSUZ_E01170                     251   2e-74   
emb|CAD41867.2|  OSJNBa0041A02.14                                       251   3e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010056135.1|  PREDICTED: protein notum homolog                   251   3e-74   
ref|XP_006355154.1|  PREDICTED: protein notum homolog                   251   4e-74   
gb|AAP72959.1|  pectin acetylesterase                                   251   4e-74   Lactuca sativa [cultivated lettuce]
ref|XP_010942975.1|  PREDICTED: protein notum homolog isoform X1        251   5e-74   
ref|XP_008347803.1|  PREDICTED: uncharacterized protein LOC103410929    251   5e-74   
ref|XP_009627060.1|  PREDICTED: uncharacterized protein LOC104117690    251   6e-74   
ref|XP_008808358.1|  PREDICTED: protein notum homolog                   250   6e-74   
gb|KCW72721.1|  hypothetical protein EUGRSUZ_E01170                     250   6e-74   
ref|XP_009771151.1|  PREDICTED: uncharacterized protein LOC104221730    250   7e-74   
ref|XP_009592441.1|  PREDICTED: uncharacterized protein LOC104089292    250   8e-74   
ref|XP_002519911.1|  pectin acetylesterase, putative                    250   9e-74   Ricinus communis
ref|XP_004244443.1|  PREDICTED: uncharacterized protein LOC101251798    249   1e-73   
gb|KCW72720.1|  hypothetical protein EUGRSUZ_E01169                     250   1e-73   
ref|XP_010677539.1|  PREDICTED: protein notum homolog isoform X2        249   1e-73   
gb|EYU37448.1|  hypothetical protein MIMGU_mgv1a007102mg                250   2e-73   
ref|XP_010449357.1|  PREDICTED: protein notum homolog                   249   2e-73   
ref|XP_006363883.1|  PREDICTED: uncharacterized protein LOC102589191    251   2e-73   
ref|XP_011082152.1|  PREDICTED: protein notum homolog isoform X2        248   2e-73   
ref|NP_001053773.1|  Os04g0602500                                       251   2e-73   Oryza sativa Japonica Group [Japonica rice]
gb|KEH20327.1|  pectinacetylesterase family protein                     248   3e-73   
ref|XP_003628995.1|  Notum-like protein                                 249   3e-73   
ref|XP_009763242.1|  PREDICTED: protein notum homolog isoform X1        248   3e-73   
ref|XP_011028483.1|  PREDICTED: uncharacterized protein LOC105128...    249   3e-73   
ref|XP_010056131.1|  PREDICTED: protein notum homolog isoform X2        250   3e-73   
ref|XP_010056129.1|  PREDICTED: protein notum homolog isoform X1        250   3e-73   
ref|XP_010056132.1|  PREDICTED: protein notum homolog isoform X3        250   3e-73   
ref|XP_009132797.1|  PREDICTED: protein notum homolog                   248   3e-73   
gb|AFK45147.1|  unknown                                                 248   5e-73   
ref|XP_010439718.1|  PREDICTED: protein notum homolog                   248   7e-73   
ref|XP_010327577.1|  PREDICTED: uncharacterized protein LOC101244626    247   9e-73   
gb|AET03471.2|  pectinacetylesterase family protein                     248   9e-73   
ref|XP_010434420.1|  PREDICTED: protein notum homolog                   247   9e-73   
emb|CDX78933.1|  BnaA01g10000D                                          249   9e-73   
ref|XP_009350399.1|  PREDICTED: protein notum homolog                   247   1e-72   
emb|CDX99377.1|  BnaC01g11750D                                          249   1e-72   
gb|EEC77932.1|  hypothetical protein OsI_17271                          251   1e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_006385137.1|  hypothetical protein POPTR_0004s24220g             247   1e-72   
ref|XP_009797876.1|  PREDICTED: protein notum homolog isoform X2        247   1e-72   
ref|XP_009797415.1|  PREDICTED: uncharacterized protein LOC104243851    247   1e-72   
ref|XP_010325632.1|  PREDICTED: protein notum homolog isoform X1        247   1e-72   
ref|XP_009616254.1|  PREDICTED: protein notum homolog                   247   1e-72   
gb|AGT17273.1|  hypothetical protein SHCRBa_020_L15_F_100               246   1e-72   
gb|EYU29131.1|  hypothetical protein MIMGU_mgv1a007782mg                247   1e-72   
ref|XP_006359968.1|  PREDICTED: protein notum homolog                   246   2e-72   
ref|XP_006385138.1|  hypothetical protein POPTR_0004s24220g             247   2e-72   
gb|ABK26312.1|  unknown                                                 247   2e-72   Picea sitchensis
gb|KDP28068.1|  hypothetical protein JCGZ_19476                         247   2e-72   
gb|KCW72726.1|  hypothetical protein EUGRSUZ_E01170                     246   2e-72   
ref|XP_009794297.1|  PREDICTED: protein notum homolog                   246   2e-72   
ref|XP_006365947.1|  PREDICTED: uncharacterized protein LOC102601254    246   2e-72   
ref|XP_007040902.1|  Pectinacetylesterase family protein                246   2e-72   
ref|XP_002459181.1|  hypothetical protein SORBIDRAFT_03g047440          247   3e-72   Sorghum bicolor [broomcorn]
ref|XP_006385134.1|  hypothetical protein POPTR_0004s24220g             247   3e-72   
ref|XP_011028482.1|  PREDICTED: uncharacterized protein LOC105128...    248   5e-72   
ref|XP_006361581.1|  PREDICTED: protein notum homolog                   245   6e-72   
ref|XP_011028479.1|  PREDICTED: uncharacterized protein LOC105128...    248   6e-72   
tpg|DAA36173.1|  TPA: hypothetical protein ZEAMMB73_990456              244   7e-72   
ref|XP_008355284.1|  PREDICTED: uncharacterized protein LOC103418943    245   9e-72   
gb|EYU29130.1|  hypothetical protein MIMGU_mgv1a007782mg                244   1e-71   
ref|NP_001151183.1|  LOC100284816 precursor                             244   1e-71   Zea mays [maize]
ref|XP_006471634.1|  PREDICTED: uncharacterized protein LOC102628021    244   1e-71   
ref|XP_006363875.1|  PREDICTED: protein notum homolog                   244   1e-71   
ref|NP_193677.2|  putative pectinacetylesterase                         244   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EMT14315.1|  hypothetical protein F775_08483                         244   2e-71   
gb|ACG39759.1|  carboxylic ester hydrolase                              244   2e-71   Zea mays [maize]
ref|XP_009407790.1|  PREDICTED: protein notum homolog                   245   2e-71   
ref|XP_002867938.1|  pectinacetylesterase family protein                243   2e-71   
gb|ACJ85294.1|  unknown                                                 243   2e-71   Medicago truncatula
ref|XP_010920600.1|  PREDICTED: protein notum homolog isoform X2        244   3e-71   
gb|EEE61621.1|  hypothetical protein OsJ_16047                          250   3e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006599203.1|  PREDICTED: uncharacterized protein LOC100781...    243   4e-71   
ref|XP_006385136.1|  hypothetical protein POPTR_0004s24220g             243   4e-71   
gb|KHN41567.1|  Protein notum like                                      243   4e-71   
gb|KCW72718.1|  hypothetical protein EUGRSUZ_E01169                     243   7e-71   
gb|KDO40410.1|  hypothetical protein CISIN_1g013734mg                   243   8e-71   
ref|XP_009797875.1|  PREDICTED: protein notum homolog isoform X1        242   9e-71   
ref|XP_010266381.1|  PREDICTED: uncharacterized protein LOC104603...    242   1e-70   
ref|XP_007156330.1|  hypothetical protein PHAVU_003G277500g             242   1e-70   
ref|XP_010695723.1|  PREDICTED: protein notum homolog                   243   1e-70   
ref|XP_009603747.1|  PREDICTED: protein notum homolog isoform X1        241   1e-70   
ref|XP_011074219.1|  PREDICTED: protein notum homolog                   241   2e-70   
ref|XP_010266380.1|  PREDICTED: uncharacterized protein LOC104603...    241   2e-70   
ref|XP_006293476.1|  hypothetical protein CARUB_v10023292mg             241   3e-70   
ref|XP_007156331.1|  hypothetical protein PHAVU_003G277500g             241   3e-70   
ref|XP_009408703.1|  PREDICTED: protein notum homolog                   241   3e-70   
ref|XP_004971441.1|  PREDICTED: protein notum homolog                   241   4e-70   
ref|XP_006413980.1|  hypothetical protein EUTSA_v10025385mg             240   5e-70   
ref|XP_004953590.1|  PREDICTED: protein notum homolog isoform X1        240   5e-70   
ref|XP_009388128.1|  PREDICTED: protein notum homolog                   240   5e-70   
ref|XP_009398466.1|  PREDICTED: protein notum homolog                   240   5e-70   
ref|NP_001047850.1|  Os02g0702400                                       240   5e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562611.1|  PREDICTED: protein notum homolog                   240   6e-70   
ref|XP_009407792.1|  PREDICTED: protein notum homolog                   241   6e-70   
ref|XP_006351092.1|  PREDICTED: protein notum homolog                   237   7e-70   
ref|XP_009135052.1|  PREDICTED: protein notum homolog                   240   1e-69   
ref|XP_008365238.1|  PREDICTED: uncharacterized protein LOC103428882    236   1e-69   
ref|XP_002454426.1|  hypothetical protein SORBIDRAFT_04g030720          239   2e-69   Sorghum bicolor [broomcorn]
ref|XP_010920599.1|  PREDICTED: protein notum homolog isoform X1        240   2e-69   
dbj|BAD94756.1|  putative pectinacetylesterase protein                  235   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KHG23648.1|  Notum                                                   238   2e-69   
ref|XP_010235850.1|  PREDICTED: protein notum homolog isoform X1        238   2e-69   
ref|XP_008810598.1|  PREDICTED: protein notum homolog                   239   2e-69   
ref|XP_002515160.1|  pectin acetylesterase, putative                    239   3e-69   Ricinus communis
ref|XP_007205243.1|  hypothetical protein PRUPE_ppa006114mg             239   3e-69   
ref|XP_009626489.1|  PREDICTED: protein notum homolog isoform X1        238   3e-69   
ref|XP_009108427.1|  PREDICTED: protein notum homolog                   238   3e-69   
ref|XP_009776988.1|  PREDICTED: uncharacterized protein LOC104226...    238   3e-69   
ref|XP_002461086.1|  hypothetical protein SORBIDRAFT_02g040470          238   4e-69   Sorghum bicolor [broomcorn]
ref|XP_007222071.1|  hypothetical protein PRUPE_ppa007506mg             236   5e-69   
emb|CDY09289.1|  BnaC03g63190D                                          238   5e-69   
emb|CBI37039.3|  unnamed protein product                                236   5e-69   
ref|XP_009335553.1|  PREDICTED: uncharacterized protein LOC103928...    238   6e-69   
ref|NP_974575.2|  putative pectinacetylesterase                         236   6e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051327.1|  Pectinacetylesterase family protein                239   7e-69   
ref|XP_004300391.1|  PREDICTED: protein notum homolog                   237   8e-69   
ref|XP_009759657.1|  PREDICTED: uncharacterized protein LOC104212153    238   1e-68   
ref|XP_008378614.1|  PREDICTED: uncharacterized protein LOC103441693    236   1e-68   
dbj|BAJ85221.1|  predicted protein                                      238   1e-68   
ref|XP_009353455.1|  PREDICTED: protein notum homolog                   237   1e-68   
ref|XP_010111521.1|  hypothetical protein L484_021346                   236   1e-68   
gb|EPS71696.1|  hypothetical protein M569_03061                         236   1e-68   
ref|XP_009776987.1|  PREDICTED: uncharacterized protein LOC104226...    236   1e-68   
ref|XP_008373439.1|  PREDICTED: protein notum homolog isoform X2        238   2e-68   
ref|XP_002880274.1|  hypothetical protein ARALYDRAFT_483863             237   2e-68   
ref|XP_003565179.1|  PREDICTED: protein notum homolog                   237   2e-68   
ref|XP_010937638.1|  PREDICTED: protein notum homolog                   238   2e-68   
ref|XP_010325697.1|  PREDICTED: uncharacterized protein LOC101260962    241   2e-68   
ref|XP_008238012.1|  PREDICTED: protein notum homolog isoform X2        236   2e-68   
ref|XP_007209211.1|  hypothetical protein PRUPE_ppa006668mg             236   2e-68   
ref|XP_009589853.1|  PREDICTED: uncharacterized protein LOC104087...    235   2e-68   
ref|XP_009612887.1|  PREDICTED: uncharacterized protein LOC104106115    236   2e-68   
ref|XP_002280816.3|  PREDICTED: protein notum homolog                   236   2e-68   Vitis vinifera
ref|XP_006359967.1|  PREDICTED: protein notum homolog                   235   2e-68   
ref|XP_009771153.1|  PREDICTED: uncharacterized protein LOC104221731    239   3e-68   
ref|XP_010506713.1|  PREDICTED: protein notum homolog isoform X1        236   4e-68   
ref|XP_008246333.1|  PREDICTED: uncharacterized protein LOC103344...    236   4e-68   
ref|XP_009399871.1|  PREDICTED: uncharacterized protein LOC103984154    236   4e-68   
ref|XP_004288665.1|  PREDICTED: protein notum homolog                   237   4e-68   
ref|XP_010043350.1|  PREDICTED: protein notum homolog                   235   5e-68   
ref|XP_008373438.1|  PREDICTED: protein notum homolog isoform X1        237   5e-68   
ref|XP_008360208.1|  PREDICTED: protein notum homolog isoform X3        236   5e-68   
ref|XP_010464588.1|  PREDICTED: protein notum homolog                   235   5e-68   
emb|CDY07929.1|  BnaC03g35940D                                          235   5e-68   
ref|XP_009619780.1|  PREDICTED: uncharacterized protein LOC104111729    234   6e-68   
ref|XP_004296984.1|  PREDICTED: protein notum homolog                   235   6e-68   
ref|XP_009150910.1|  PREDICTED: protein notum homolog isoform X3        235   6e-68   
gb|KHG26188.1|  Protein notum                                           235   6e-68   
emb|CDX88052.1|  BnaA06g26430D                                          236   6e-68   
ref|XP_009771487.1|  PREDICTED: protein notum homolog                   234   6e-68   
ref|XP_008222318.1|  PREDICTED: protein notum homolog                   235   7e-68   
ref|XP_010511331.1|  PREDICTED: protein notum homolog                   235   8e-68   
ref|XP_010486510.1|  PREDICTED: protein notum homolog                   234   8e-68   
emb|CDY41569.1|  BnaC04g00530D                                          234   9e-68   
ref|XP_004958440.1|  PREDICTED: protein notum homolog                   235   9e-68   
ref|XP_009794027.1|  PREDICTED: uncharacterized protein LOC104240572    234   9e-68   
ref|XP_009150909.1|  PREDICTED: protein notum homolog isoform X2        235   9e-68   
ref|XP_010914803.1|  PREDICTED: protein notum homolog isoform X1        234   1e-67   
gb|EYU19372.1|  hypothetical protein MIMGU_mgv1a006907mg                233   1e-67   
ref|XP_008363956.1|  PREDICTED: protein notum homolog                   234   1e-67   
gb|KCW85365.1|  hypothetical protein EUGRSUZ_B02195                     235   1e-67   
ref|XP_004248530.1|  PREDICTED: protein notum homolog isoform X2        234   1e-67   
ref|XP_010544918.1|  PREDICTED: protein notum homolog isoform X2        234   2e-67   
ref|XP_009335552.1|  PREDICTED: protein notum homolog isoform X1        234   2e-67   
ref|XP_009150908.1|  PREDICTED: protein notum homolog isoform X1        234   2e-67   
ref|XP_010472663.1|  PREDICTED: protein notum homolog                   234   2e-67   
ref|XP_010914805.1|  PREDICTED: protein notum homolog                   233   3e-67   
ref|XP_004494487.1|  PREDICTED: protein notum homolog isoform X3        233   3e-67   
emb|CDY54379.1|  BnaAnng13100D                                          234   3e-67   
gb|ADE77373.1|  unknown                                                 233   3e-67   
ref|XP_006397884.1|  hypothetical protein EUTSA_v10001449mg             234   3e-67   
ref|XP_002512590.1|  pectin acetylesterase, putative                    233   4e-67   
ref|XP_011074200.1|  PREDICTED: protein notum homolog                   233   4e-67   
ref|XP_007140306.1|  hypothetical protein PHAVU_008G101100g             234   4e-67   
ref|XP_008238011.1|  PREDICTED: protein notum homolog isoform X1        233   4e-67   
ref|XP_008369575.1|  PREDICTED: protein notum homolog isoform X2        233   4e-67   
ref|XP_008807933.1|  PREDICTED: protein notum homolog                   233   4e-67   
ref|XP_009142580.1|  PREDICTED: protein notum homolog                   233   4e-67   
ref|XP_009123335.1|  PREDICTED: protein notum homolog isoform X1        233   5e-67   
ref|XP_010507953.1|  PREDICTED: protein notum homolog                   233   5e-67   
ref|NP_851135.1|  pectinacetylesterase family protein                   231   5e-67   
ref|XP_010544917.1|  PREDICTED: protein notum homolog isoform X1        234   5e-67   
ref|NP_001060382.1|  Os07g0634600                                       233   5e-67   
ref|XP_006654910.1|  PREDICTED: protein notum homolog                   233   5e-67   
ref|NP_001141895.1|  uncharacterized protein LOC100274042 precursor     233   6e-67   
emb|CDP15161.1|  unnamed protein product                                231   6e-67   
ref|XP_006658006.1|  PREDICTED: protein notum homolog                   232   6e-67   
ref|XP_004494486.1|  PREDICTED: protein notum homolog isoform X2        233   7e-67   
emb|CBI26039.3|  unnamed protein product                                231   7e-67   
ref|XP_007027030.1|  Pectinacetylesterase family protein isoform 1      232   8e-67   
ref|XP_002320250.2|  hypothetical protein POPTR_0014s10650g             234   8e-67   
ref|XP_010070108.1|  PREDICTED: protein notum homolog                   233   8e-67   
gb|EPS71965.1|  hypothetical protein M569_02793                         231   8e-67   
ref|XP_009359821.1|  PREDICTED: protein notum homolog                   233   9e-67   
emb|CDY67801.1|  BnaAnng25210D                                          231   1e-66   
ref|XP_002280865.3|  PREDICTED: protein notum homolog                   232   1e-66   
ref|XP_004494485.1|  PREDICTED: protein notum homolog isoform X1        233   1e-66   
ref|XP_008797988.1|  PREDICTED: protein notum homolog isoform X2        229   1e-66   
gb|AAG50747.1|AC079733_15  pectinacetylesterase precursor, putative     232   1e-66   
ref|XP_003518126.1|  PREDICTED: protein notum homolog                   232   1e-66   
dbj|BAK01215.1|  predicted protein                                      232   1e-66   
gb|EYU19373.1|  hypothetical protein MIMGU_mgv1a006907mg                232   2e-66   
ref|XP_010654289.1|  PREDICTED: protein notum homolog                   231   2e-66   
ref|NP_182216.1|  pectinacetylesterase-like protein                     231   2e-66   
gb|KHG13045.1|  Protein notum                                           233   2e-66   
ref|XP_010045528.1|  PREDICTED: protein notum homolog                   231   2e-66   
ref|XP_010327277.1|  PREDICTED: protein notum homolog isoform X1        231   2e-66   
gb|AGT16732.1|  carboxylic ester hydrolase                              231   2e-66   
ref|XP_010518382.1|  PREDICTED: protein notum homolog isoform X1        231   2e-66   
gb|AAM74495.1|  At1g57590/T8L23_6                                       231   2e-66   
ref|XP_010042497.1|  PREDICTED: protein notum homolog isoform X1        231   2e-66   
ref|XP_006368062.1|  PREDICTED: protein notum homolog                   228   2e-66   
ref|XP_009610135.1|  PREDICTED: protein notum homolog                   231   3e-66   
emb|CDX80575.1|  BnaC07g28690D                                          231   3e-66   
ref|XP_006349508.1|  PREDICTED: protein notum homolog                   231   3e-66   
ref|XP_009151150.1|  PREDICTED: protein notum homolog                   231   3e-66   
ref|XP_006602585.1|  PREDICTED: protein notum homolog isoform X2        231   3e-66   
ref|NP_176072.3|  pectinacetylesterase family protein                   231   3e-66   
ref|XP_004509524.1|  PREDICTED: uncharacterized protein LOC101493...    227   4e-66   
ref|XP_002275616.1|  PREDICTED: protein notum homolog isoform X1        231   4e-66   
ref|XP_003551467.1|  PREDICTED: protein notum homolog isoform X1        231   4e-66   
ref|XP_006302295.1|  hypothetical protein CARUB_v10020343mg             231   4e-66   
gb|KHN16240.1|  Protein notum like                                      231   4e-66   
gb|KHG11853.1|  Protein notum                                           231   4e-66   
gb|KDP28360.1|  hypothetical protein JCGZ_14131                         231   5e-66   
ref|XP_011092213.1|  PREDICTED: protein notum homolog                   230   5e-66   
gb|KHG30410.1|  Protein notum                                           230   5e-66   
gb|EEC78390.1|  hypothetical protein OsI_18172                          231   5e-66   
ref|XP_010235852.1|  PREDICTED: protein notum homolog isoform X2        228   5e-66   
ref|XP_006645404.1|  PREDICTED: protein notum homolog                   230   5e-66   
ref|XP_011074217.1|  PREDICTED: protein notum homolog                   229   6e-66   
ref|XP_009779872.1|  PREDICTED: protein notum homolog                   230   6e-66   
ref|XP_006363510.1|  PREDICTED: uncharacterized protein LOC102583822    229   6e-66   
ref|XP_010534314.1|  PREDICTED: protein notum homolog                   230   6e-66   
gb|ABG34281.1|  pectin acetylesterase                                   228   6e-66   
ref|XP_006604768.1|  PREDICTED: protein notum homolog isoform X2        230   6e-66   
ref|XP_008807936.1|  PREDICTED: protein notum homolog isoform X2        229   7e-66   
gb|EEE62081.1|  hypothetical protein OsJ_16865                          230   7e-66   
ref|XP_002884736.1|  pectinacetylesterase family protein                230   7e-66   
ref|XP_002894676.1|  hypothetical protein ARALYDRAFT_474842             230   7e-66   
ref|XP_008360206.1|  PREDICTED: protein notum homolog isoform X1        230   8e-66   
ref|XP_006604776.1|  PREDICTED: protein notum homolog isoform X1        229   1e-65   
ref|XP_008388414.1|  PREDICTED: protein notum homolog                   229   1e-65   
ref|XP_004249600.1|  PREDICTED: protein notum homolog                   229   1e-65   
dbj|BAJ90066.1|  predicted protein                                      228   1e-65   
ref|XP_004246219.1|  PREDICTED: protein notum homolog                   228   1e-65   
ref|XP_006444639.1|  hypothetical protein CICLE_v10020385mg             229   1e-65   
ref|XP_010253184.1|  PREDICTED: protein notum homolog                   229   1e-65   
ref|XP_010486511.1|  PREDICTED: protein notum homolog isoform X1        229   1e-65   
ref|XP_008807935.1|  PREDICTED: protein notum homolog isoform X1        228   1e-65   
gb|KHN14201.1|  Protein notum like                                      229   2e-65   
ref|XP_011039993.1|  PREDICTED: uncharacterized protein LOC105136378    230   2e-65   
gb|KEH43170.1|  pectinacetylesterase family protein                     228   2e-65   
ref|XP_004960515.1|  PREDICTED: protein notum homolog                   229   2e-65   
ref|XP_004165255.1|  PREDICTED: protein notum homolog                   229   2e-65   
ref|XP_010266386.1|  PREDICTED: uncharacterized protein LOC104603...    227   2e-65   
ref|NP_001154601.1|  pectinacetylesterase family protein                228   2e-65   
ref|XP_003554582.1|  PREDICTED: protein notum homolog isoform X1        230   2e-65   
ref|XP_003609911.1|  Pectin acetylesterase                              229   2e-65   
ref|XP_006407678.1|  hypothetical protein EUTSA_v10020789mg             229   2e-65   
ref|XP_002439150.1|  hypothetical protein SORBIDRAFT_09g001350          229   2e-65   
gb|KHN45022.1|  Protein notum like                                      228   2e-65   
ref|NP_001045555.1|  Os01g0974500                                       229   2e-65   
emb|CBI37040.3|  unnamed protein product                                231   3e-65   
ref|XP_008246335.1|  PREDICTED: uncharacterized protein LOC103344...    228   3e-65   
ref|XP_010524828.1|  PREDICTED: protein notum homolog                   228   3e-65   
gb|AFK38038.1|  unknown                                                 228   3e-65   
ref|XP_006394643.1|  hypothetical protein EUTSA_v10004218mg             229   3e-65   
ref|XP_003521640.1|  PREDICTED: protein notum homolog                   228   3e-65   
gb|KHN43400.1|  Protein notum like                                      230   3e-65   
ref|XP_008388417.1|  PREDICTED: uncharacterized protein LOC103450...    228   3e-65   
gb|KFK37453.1|  hypothetical protein AALP_AA4G259200                    228   3e-65   
ref|XP_006423958.1|  hypothetical protein CICLE_v10028674mg             227   3e-65   
emb|CBI39680.3|  unnamed protein product                                226   4e-65   
ref|XP_010240825.1|  PREDICTED: protein notum homolog                   228   4e-65   
gb|ABR16604.1|  unknown                                                 228   4e-65   
ref|XP_006394645.1|  hypothetical protein EUTSA_v10004218mg             229   4e-65   
ref|XP_006593986.1|  PREDICTED: protein notum homolog isoform X3        228   4e-65   
ref|XP_007154511.1|  hypothetical protein PHAVU_003G124700g             228   4e-65   
emb|CDY19761.1|  BnaA09g04140D                                          228   5e-65   
ref|XP_009617766.1|  PREDICTED: protein notum homolog                   228   5e-65   
ref|XP_002318919.2|  hypothetical protein POPTR_0013s00280g             228   5e-65   
ref|XP_008447914.1|  PREDICTED: protein notum homolog isoform X2        228   5e-65   
ref|XP_008369574.1|  PREDICTED: protein notum homolog isoform X1        228   5e-65   
gb|EMT30528.1|  hypothetical protein F775_25893                         227   5e-65   
ref|XP_006492439.1|  PREDICTED: protein notum homolog                   229   5e-65   
ref|XP_003542396.2|  PREDICTED: protein notum homolog isoform X1        227   5e-65   
ref|NP_001042886.1|  Os01g0319000                                       228   5e-65   
ref|XP_006593985.1|  PREDICTED: protein notum homolog isoform X2        228   5e-65   
ref|XP_007031285.1|  Pectinacetylesterase family protein                228   5e-65   
ref|XP_002872227.1|  hypothetical protein ARALYDRAFT_489494             228   5e-65   
ref|XP_009138739.1|  PREDICTED: protein notum homolog isoform X2        228   6e-65   
ref|XP_006432878.1|  hypothetical protein CICLE_v100013712mg            223   6e-65   
ref|XP_001771327.1|  predicted protein                                  226   6e-65   
ref|XP_004142204.1|  PREDICTED: protein notum homolog                   229   6e-65   
gb|KFK38327.1|  hypothetical protein AALP_AA3G099800                    228   6e-65   
ref|XP_010671868.1|  PREDICTED: protein notum homolog                   227   6e-65   
ref|XP_003551008.1|  PREDICTED: protein notum homolog                   227   7e-65   
ref|NP_850878.2|  pectinacetylesterase family protein                   227   8e-65   
emb|CDY67682.1|  BnaC01g44970D                                          228   8e-65   
gb|ACE86391.1|  pectinacetylesterase family protein                     228   8e-65   
ref|XP_009111712.1|  PREDICTED: protein notum homolog                   227   8e-65   
ref|XP_009590664.1|  PREDICTED: uncharacterized protein LOC104087...    226   9e-65   
ref|XP_011074218.1|  PREDICTED: protein notum homolog                   226   9e-65   
ref|XP_009626490.1|  PREDICTED: protein notum homolog isoform X2        226   1e-64   
ref|XP_006385140.1|  hypothetical protein POPTR_0004s24220g             224   1e-64   
gb|KDO40416.1|  hypothetical protein CISIN_1g013734mg                   224   1e-64   
emb|CDY44707.1|  BnaA05g28990D                                          227   1e-64   
ref|XP_003565180.2|  PREDICTED: uncharacterized protein LOC100841...    229   1e-64   
ref|XP_007205222.1|  hypothetical protein PRUPE_ppa005949mg             227   1e-64   
ref|XP_009768293.1|  PREDICTED: protein notum homolog                   226   1e-64   
ref|XP_003555771.1|  PREDICTED: uncharacterized protein LOC100793403    226   1e-64   
gb|KHN14181.1|  Protein notum like                                      226   1e-64   
ref|XP_009146930.1|  PREDICTED: protein notum homolog                   226   2e-64   
ref|XP_006480336.1|  PREDICTED: protein notum homolog                   226   2e-64   
gb|KFK27676.1|  hypothetical protein AALP_AA8G414200                    226   2e-64   
ref|XP_003626089.1|  Pectin acetylesterase                              226   2e-64   
emb|CAN62190.1|  hypothetical protein VITISV_020113                     226   2e-64   
dbj|BAH19826.1|  AT5G26670                                              226   2e-64   
ref|XP_002279030.1|  PREDICTED: protein notum homolog                   226   2e-64   
ref|NP_191765.2|  pectinacetylesterase family protein                   226   2e-64   
ref|XP_011023896.1|  PREDICTED: protein notum homolog                   226   2e-64   
ref|XP_003566691.2|  PREDICTED: uncharacterized protein LOC100837473    227   2e-64   
ref|XP_009138738.1|  PREDICTED: protein notum homolog isoform X1        227   2e-64   
ref|XP_010468989.1|  PREDICTED: protein notum homolog                   227   3e-64   
emb|CDY58759.1|  BnaA04g27440D                                          227   3e-64   
gb|KHG23649.1|  Notum                                                   224   4e-64   
emb|CDY66251.1|  BnaC04g52030D                                          224   4e-64   
ref|XP_004494501.1|  PREDICTED: uncharacterized protein LOC101497...    225   4e-64   
ref|XP_010512591.1|  PREDICTED: protein notum homolog                   226   4e-64   
ref|XP_008800308.1|  PREDICTED: protein notum homolog isoform X1        225   4e-64   
ref|XP_003626088.1|  Pectin acetylesterase                              226   4e-64   
emb|CDX76613.1|  BnaC08g31990D                                          225   4e-64   
ref|XP_010546781.1|  PREDICTED: protein notum homolog                   225   4e-64   
ref|XP_010233620.1|  PREDICTED: protein notum homolog                   224   5e-64   
ref|XP_006394896.1|  hypothetical protein EUTSA_v10004301mg             225   5e-64   
ref|XP_006338904.1|  PREDICTED: protein notum homolog isoform X1        225   5e-64   
ref|XP_010472857.1|  PREDICTED: protein notum homolog                   225   5e-64   
ref|XP_004971772.1|  PREDICTED: protein notum homolog                   225   5e-64   
ref|XP_010914807.1|  PREDICTED: protein notum homolog isoform X1        224   5e-64   
ref|XP_004495849.1|  PREDICTED: protein notum homolog isoform X1        224   6e-64   
ref|XP_010421519.1|  PREDICTED: protein notum homolog                   224   7e-64   
ref|XP_007163281.1|  hypothetical protein PHAVU_001G221400g             224   7e-64   
gb|ABG34280.1|  pectin acetylesterase                                   222   8e-64   
dbj|BAJ89162.1|  predicted protein                                      224   8e-64   
ref|XP_008447898.1|  PREDICTED: protein notum homolog isoform X1        225   8e-64   
ref|XP_008673121.1|  PREDICTED: uncharacterized protein LOC100382...    224   9e-64   
ref|XP_010454669.1|  PREDICTED: protein notum homolog                   225   9e-64   
gb|KDP23324.1|  hypothetical protein JCGZ_23157                         224   9e-64   
ref|XP_008363955.1|  PREDICTED: protein notum homolog                   224   1e-63   
ref|XP_007145083.1|  hypothetical protein PHAVU_007G208200g             224   1e-63   
gb|KDO44145.1|  hypothetical protein CISIN_1g014476mg                   224   1e-63   
ref|XP_003626125.1|  Notum-like protein                                 224   1e-63   
ref|XP_008246334.1|  PREDICTED: protein notum homolog isoform X2        224   1e-63   
emb|CDX87039.1|  BnaC09g03540D                                          224   1e-63   
ref|XP_002964389.1|  hypothetical protein SELMODRAFT_82014              223   1e-63   
ref|XP_006429076.1|  hypothetical protein CICLE_v10011803mg             224   1e-63   
gb|AFK45877.1|  unknown                                                 224   1e-63   
ref|XP_003536006.1|  PREDICTED: uncharacterized protein LOC100810716    224   1e-63   
gb|KHN14241.1|  Protein notum like                                      224   1e-63   
ref|XP_003521625.1|  PREDICTED: protein notum homolog isoformX1         223   2e-63   
ref|XP_003536008.1|  PREDICTED: protein notum homolog isoform X1        224   2e-63   
gb|EYU37452.1|  hypothetical protein MIMGU_mgv1a007583mg                221   2e-63   
ref|XP_009600844.1|  PREDICTED: protein notum homolog                   224   2e-63   
ref|XP_002876658.1|  pectinacetylesterase family protein                223   2e-63   
ref|XP_010050776.1|  PREDICTED: protein notum homolog                   224   2e-63   
ref|XP_010942978.1|  PREDICTED: uncharacterized protein LOC105060...    222   2e-63   
ref|XP_008227765.1|  PREDICTED: protein notum homolog isoform X2        223   2e-63   
ref|XP_004508066.1|  PREDICTED: protein notum homolog                   223   2e-63   
ref|XP_007163258.1|  hypothetical protein PHAVU_001G219200g             223   2e-63   
ref|XP_004304922.1|  PREDICTED: protein notum homolog                   223   3e-63   



>ref|XP_004244682.2| PREDICTED: uncharacterized protein LOC101248898 [Solanum lycopersicum]
Length=390

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/365 (43%), Positives = 222/365 (61%), Gaps = 24/365 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L   E A + GAVCLDG+PPAY++ +G  E  +NW+IY  GG WC ++ +C  RT   KG
Sbjct  35    LTILESAVSKGAVCLDGTPPAYYYEKGYGEGANNWIIYFRGGEWCYNVIDCVARTTTEKG  94

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK+ +            FYGIL+ +   NP +F NWN V++ YCDGSSFTGDVE  +P+
Sbjct  95    SSKYAL--------KQRSFYGILSNNKTINP-DFYNWNRVMVIYCDGSSFTGDVELVDPI  145

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
             + L+FRG RIF  + +  L KG+KNAK   L+GGSAG +   +HCDRF+ LLPN+ R KC
Sbjct  146   NKLHFRGARIFLALIENFLEKGMKNAKNAILSGGSAGGLPALIHCDRFKALLPNSARVKC  205

Query  737   LMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLM  916
             L DG YF+H  ++  K++   +   + ++ LH+ST MLP +CT KM   P LC+FPQY  
Sbjct  206   LADGSYFLH--REQMKEMAFMDTVNEGLIKLHHSTNMLPSSCTSKM--NPSLCLFPQYFQ  261

Query  917   DGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP  1096
             +G+KTP FI+ S +D  QIN    ++F      +  +   +T + + L+ F+   ++ALP
Sbjct  262   EGIKTPFFIVNSMFDTFQIN----KTFPGYYENLFSNT-CSTSLVKTLQDFKQDFINALP  316

Query  1097  ---NKPSVGIFINNCFFHTEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSEF  1267
                N  S G+FI++C  H++I +G   N  S  N  + +K  SDWYF      LIDK + 
Sbjct  317   KQSNSSSRGMFIDSCLIHSQITSGVGWNGFSVYNKTI-AKTFSDWYFDKSHEQLIDKPDL  375

Query  1268  IKDCY  1282
               +CY
Sbjct  376   PLNCY  380



>ref|XP_009589915.1| PREDICTED: uncharacterized protein LOC104087209 isoform X2 [Nicotiana 
tomentosiformis]
Length=399

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/366 (43%), Positives = 221/366 (60%), Gaps = 25/366 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L   E A + GAVCLDGSPPA+++ +G  E  +NW+IY  GG WC ++ +C  RT   KG
Sbjct  43    LTILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVIDCLNRTKTEKG  102

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK               FYGIL+ +   NP +F NWN V++ YCDG+SFTGDVE  +PV
Sbjct  103   SSK--------LAPKQRSFYGILSNNKTLNP-DFYNWNRVMVIYCDGASFTGDVEIVDPV  153

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG RIF+ + +  L KG+K+AK   L GGSAG +   LHCDRFR LLPN+ R KC
Sbjct  154   TNLHFRGARIFHALIEHFLAKGMKDAKNAILAGGSAGGLPALLHCDRFRALLPNSARVKC  213

Query  737   LMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLM  916
             L DG YF+H  K N K++   ++  + +++LH+S  MLP +C  KM  +P LC+FPQY  
Sbjct  214   LADGSYFLH--KKNMKEIPFMDIVNEGLITLHHSAKMLPSSCISKM--RPSLCLFPQYFQ  269

Query  917   DGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP  1096
               ++TP FI+ S +D  QIN    ++F+     +  +   AT + + L+ F+ + L ALP
Sbjct  270   QEIQTPFFIVNSMFDTFQIN----KTFLGYYEDLNNNTCSAT-LVKTLQDFKQEFLSALP  324

Query  1097  NK----PSVGIFINNCFFHTEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSE  1264
              +     S G+FI++C  H++I +G   N    V+N   ++A SDWYF    V LID  +
Sbjct  325   KQSDCSSSRGMFIDSCLIHSQILSGVGWN-GFTVHNKTIAEAFSDWYFDRSSVQLIDTPD  383

Query  1265  FIKDCY  1282
                +CY
Sbjct  384   LPLNCY  389



>ref|XP_009589914.1| PREDICTED: uncharacterized protein LOC104087209 isoform X1 [Nicotiana 
tomentosiformis]
Length=400

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/366 (43%), Positives = 221/366 (60%), Gaps = 25/366 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L   E A + GAVCLDGSPPA+++ +G  E  +NW+IY  GG WC ++ +C  RT   KG
Sbjct  44    LTILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVIDCLNRTKTEKG  103

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK               FYGIL+ +   NP +F NWN V++ YCDG+SFTGDVE  +PV
Sbjct  104   SSK--------LAPKQRSFYGILSNNKTLNP-DFYNWNRVMVIYCDGASFTGDVEIVDPV  154

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG RIF+ + +  L KG+K+AK   L GGSAG +   LHCDRFR LLPN+ R KC
Sbjct  155   TNLHFRGARIFHALIEHFLAKGMKDAKNAILAGGSAGGLPALLHCDRFRALLPNSARVKC  214

Query  737   LMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLM  916
             L DG YF+H  K N K++   ++  + +++LH+S  MLP +C  KM  +P LC+FPQY  
Sbjct  215   LADGSYFLH--KKNMKEIPFMDIVNEGLITLHHSAKMLPSSCISKM--RPSLCLFPQYFQ  270

Query  917   DGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP  1096
               ++TP FI+ S +D  QIN    ++F+     +  +   AT + + L+ F+ + L ALP
Sbjct  271   QEIQTPFFIVNSMFDTFQIN----KTFLGYYEDLNNNTCSAT-LVKTLQDFKQEFLSALP  325

Query  1097  NK----PSVGIFINNCFFHTEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSE  1264
              +     S G+FI++C  H++I +G   N    V+N   ++A SDWYF    V LID  +
Sbjct  326   KQSDCSSSRGMFIDSCLIHSQILSGVGWN-GFTVHNKTIAEAFSDWYFDRSSVQLIDTPD  384

Query  1265  FIKDCY  1282
                +CY
Sbjct  385   LPLNCY  390



>ref|XP_009799834.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/369 (43%), Positives = 216/369 (59%), Gaps = 24/369 (7%)
 Frame = +2

Query  182   TKANFYPL--IFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEEC  355
             T  +FY +     + A + GAVCLDGSPPAYHF  G  E   NW + + GGAWC S+E C
Sbjct  27    TDLDFYEVKKTIVKNAVSKGAVCLDGSPPAYHFEPGFGEGVGNWFVQLAGGAWCTSVETC  86

Query  356   KLRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFT  535
             K R  ++K  S  +M          F F GI +++ + NP +F NWN V++RYCDG +FT
Sbjct  87    KERIRDNKVGSTTIM--------GPFTFQGIYSKNQSANP-DFYNWNKVLVRYCDGGAFT  137

Query  536   GDVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKL  709
             GDVE  +P  NL+FRG RIF  + +++L KGLKNAK   L G SAG     L+CD FR L
Sbjct  138   GDVEYVDPATNLHFRGARIFEAVVEDVLAKGLKNAKNAILAGSSAGGYPAMLYCDHFRSL  197

Query  710   LPNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             LPNT R KC +DGGYFIH K  N KQ  GFE  +  +V+LH S   LP++CT KM  KP 
Sbjct  198   LPNTPRVKCFVDGGYFIHAK--NQKQARGFEEIYNGLVTLHGSGKTLPKSCTSKM--KPL  253

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGF  1069
             LC+FP+ +   +K P+FI MS++D  QIN ++  +       + E+    T   +  + F
Sbjct  254   LCLFPENMQQNIKIPLFIAMSAFDIFQINTTVEPNL----HDVIENGTCTTSQNKAFREF  309

Query  1070  RLQLLDAL--PNKPSV-GIFINNCFFHTEIATGYWANPNSQVNNVLDSKAISDWYFYGKE  1240
             R + L  L  PN P + G+FI++   HT + T +     + +NN+   KA  DWYF  K 
Sbjct  310   RSEFLSTLPKPNNPKMRGVFIDSVNHHTSLLTRWSPENATMINNLSLPKAFGDWYFDRKY  369

Query  1241  VNLIDKSEF  1267
               +ID+ + 
Sbjct  370   WYVIDEHDL  378



>ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=399

 Score =   282 bits (721),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 162/383 (42%), Positives = 227/383 (59%), Gaps = 22/383 (6%)
 Frame = +2

Query  137   QWltllvcaallvlQTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIY  316
             QWL+LLVC  L++L+ +     + + + A A GAVCLDGSPPAYHF  G+    +NWL++
Sbjct  8     QWLSLLVCCLLILLKAEGGSVGITYLQSAVAKGAVCLDGSPPAYHFDPGSGAGVNNWLVH  67

Query  317   MEGGAWCESIEECKLRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWN  496
             MEGG WCE +E C  R     GSS+ M+    F G        +L+     NP +F NWN
Sbjct  68    MEGGGWCEDVERCLSRRNTDLGSSEQMVKQFGFSG--------LLSSQQKSNP-DFYNWN  118

Query  497   LVVIRYCDGSSFTGDVEEPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVS  676
              + +RYCDGSSFTGDVE PV+NL+FRG RI+  I ++LL KG++NAK   L+G SAG ++
Sbjct  119   RIKVRYCDGSSFTGDVEAPVNNLFFRGNRIWEAIIEDLLAKGMRNAKNAILSGCSAGGLA  178

Query  677   VALHCDRFRKLLPNTRRFKCLMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLP  853
               LHCDRFR LLP   + KC+ D G+FIH K  +  Q +E F   +  V  LH S   LP
Sbjct  179   SILHCDRFRALLPAATKVKCISDAGFFIHAKDVSGGQHIENF---YSQVAKLHGSVKSLP  235

Query  854   QTCTQKMKDKPYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIRE  1024
              +CT +M  KP LC FPQY++  M+TP+F + ++YD  QI   +  +      A ++ + 
Sbjct  236   ASCTSRMSMKPELCFFPQYVVQTMQTPIFFINAAYDSWQIKNILAPTAADSGKAWKSCKL  295

Query  1025  HVQLATP-IYEGLKGFRLQLLDALP---NKPSVGIFINNCFFHTEIATGY-WANPNS-QV  1186
              ++  TP   + ++ FR Q L AL    N  S G+FI++C+ H +      W++ NS  V
Sbjct  296   DLKKCTPGQLKIIQDFRAQFLSALTGAGNSSSRGMFIDSCYAHCQAGKQITWSSNNSPAV  355

Query  1187  NNVLDSKAISDWYFYGKEVNLID  1255
              N   +KA+ DWY+    V  ID
Sbjct  356   GNTKIAKAVGDWYYERSPVQKID  378



>ref|XP_010942974.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=391

 Score =   279 bits (714),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 156/361 (43%), Positives = 210/361 (58%), Gaps = 23/361 (6%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + A A GAVCLDGSPPAYHF  G     +NWL++MEGG WC ++EECK RT   +
Sbjct  30    PLTLVQSAVAKGAVCLDGSPPAYHFTPGFGSGVNNWLVHMEGGGWCRNVEECKERTKNFR  89

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSSK+M             F GIL      NP +F NWN V IRYCDGSSFTGDVE  +P
Sbjct  90    GSSKYMKQ---------LSFSGILGNKQKLNP-DFYNWNKVKIRYCDGSSFTGDVEAVDP  139

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG R++  I D+LL KG+  A+   L+G SAG ++  LHCD FR LLP   R K
Sbjct  140   ATNLHFRGARVWRAIMDDLLAKGMSKAQNALLSGCSAGGLASILHCDSFRDLLPAGARVK  199

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C  D GYFI+ K  + K  E     +  VV+ H S   LP +CT +    P +C FPQY+
Sbjct  200   CFSDAGYFINAKDVSGK--ESIRDFYNQVVATHGSAKNLPSSCTSRF--PPSMCFFPQYV  255

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFRLQL  1081
             +  M+TP+FIL ++YD  QI   +  S     +   E      + ++   + ++GFR + 
Sbjct  256   VQSMRTPLFILNAAYDAWQIKNILAPSPSDPRKFWGECKLDIKKCSSSQLQVMQGFRSEF  315

Query  1082  LDALP-NKPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWYFYGKEVNLI  1252
             L ALP N PS+G+FI++C+ H +  A   W + +S  +N +  +KA+ DWYF    +  I
Sbjct  316   LRALPANSPSIGMFIDSCYSHCQSGAQETWLSSDSPAINKMPIAKAVGDWYFGRTAMKKI  375

Query  1253  D  1255
             D
Sbjct  376   D  376



>ref|XP_008797987.1| PREDICTED: protein notum homolog isoform X1 [Phoenix dactylifera]
Length=391

 Score =   279 bits (714),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 158/362 (44%), Positives = 210/362 (58%), Gaps = 25/362 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + A A GAVCLDGSPPAYHF  G     +NWL++MEGG WC ++EECK RT   +
Sbjct  30    PLTLVQAAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCSNVEECKERTGNFR  89

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK+M             F GIL      NP +F NWN V IRYCDGSSFTGD+E   P
Sbjct  90    GSSKYMKQ---------LSFSGILGNQQNLNP-DFYNWNKVKIRYCDGSSFTGDIEAVNP  139

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG R++  I DELL KG+  A+   L+G SAG ++  LHCD F  LLP   R K
Sbjct  140   ATNLHFRGARVWRAIMDELLAKGMNKAQNALLSGCSAGGLASILHCDSFHDLLPAGARVK  199

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C  D GYFI  K  + K  E  +  +  VV+ H S   LP +CT +    P LC FPQY+
Sbjct  200   CFSDAGYFIDAKDVSGK--ETIKDFYNQVVTTHGSAKNLPSSCTSRF--PPSLCFFPQYV  255

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYEGLKGFRLQ  1078
             +  M+TP+FIL ++YD  QI  ++     +  R I    +L     ++   + L+GFR +
Sbjct  256   VQNMRTPLFILNAAYDAWQIK-NIFAPSPSDPRKIWSECKLDIKKCSSSQLQALQGFRSE  314

Query  1079  LLDALP-NKPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWYFYGKEVNL  1249
              L ALP N PSVG+FI++C+ H +  A   W + NS  ++ +  +KA+ DW++    V  
Sbjct  315   FLRALPRNSPSVGMFIDSCYSHCQSGAQETWLSSNSPAIDRMSIAKAVGDWFYGRSAVQK  374

Query  1250  ID  1255
             ID
Sbjct  375   ID  376



>gb|EYU29129.1| hypothetical protein MIMGU_mgv1a023759mg [Erythranthe guttata]
Length=384

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 154/370 (42%), Positives = 219/370 (59%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T++++  + + E A A GAVCLDGSPPAYH  +G+ +  +NWLI++EGG WC ++  C 
Sbjct  6     RTESSYVDITYVESAVAKGAVCLDGSPPAYHLDKGSGDGTNNWLIHLEGGGWCNNVTTCI  65

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   H GSSKHM             F+GI N DP +NP +F NWN VV+RYCDG+SFTG
Sbjct  66    SRANGHLGSSKHM--------SNRTMFFGIANNDPQFNP-DFYNWNRVVVRYCDGASFTG  116

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             D+E  +P  NLY+RG R+F  + ++LL+KG+KNAK V LTG SAG ++  LHCDRF+ LL
Sbjct  117   DIEAVDPATNLYYRGARVFVAVMEDLLDKGMKNAKNVILTGCSAGGLASMLHCDRFKDLL  176

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P     KC+ D G+F++VK  +  +   FE    +VV  H S   LP +CT KM  KP L
Sbjct  177   PMGTNVKCMADAGFFLNVKDVSGNRR--FEDFINDVVETHGSAKNLPLSCTSKM--KPGL  232

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN----RTIREHVQLATPIYEGL  1060
             C FPQ ++  ++TP+FI+ ++YD  QI   +  +    +        +    +T   + L
Sbjct  233   CFFPQQVVQEIQTPLFIVNAAYDAWQIKNVLAPAIADPSGIWYNCTTDIRNCSTAQLQTL  292

Query  1061  KGFRLQLLD---ALPNKPSVGIFINNCFFHTEIATGY-WANPNS-QVNNVLDSKAISDWY  1225
              GFR + L+   A+    + G FIN+CF H +      W  PNS ++NN   +KA+ DW+
Sbjct  293   HGFRKEFLNEFSAIGTSITRGYFINSCFAHCQTEMQITWFKPNSPKLNNKTIAKAVGDWF  352

Query  1226  FYGKEVNLID  1255
             F       ID
Sbjct  353   FDRSPFQTID  362



>ref|XP_009803843.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
 ref|XP_009803844.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
Length=396

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 155/362 (43%), Positives = 219/362 (60%), Gaps = 25/362 (7%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             E A + GAVCLDGSPPA+++ +G  E  +NW+IY  GG WC ++ +C  RT   KGSSK 
Sbjct  44    ESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVLDCLNRTKTEKGSSK-  102

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
                           FYGIL  +   NP +F NWN V++ YCDGSSFTGDVE  +PV NL+
Sbjct  103   -------LAPKQRSFYGILGNNKTENP-DFYNWNRVMVIYCDGSSFTGDVEIVDPVTNLH  154

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG R+F+ + +  L  G+K+AK   L+GGSAG +   LHCDRFR LLPN+ R KCL DG
Sbjct  155   FRGARVFHALIEHFLVIGMKDAKNAILSGGSAGGLPALLHCDRFRALLPNSARVKCLADG  214

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
              YF+H  K N K++   ++  + +++LH+S  MLP +CT KM  +P LC+FPQY    ++
Sbjct  215   SYFLH--KKNMKEIPFMDIVNEGLITLHHSAKMLPSSCTSKM--RPSLCLFPQYFQQEIQ  270

Query  929   TPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALPNK--  1102
             TP FI+ S +D  QIN    ++F      +  +   AT + + L+ F+ + L ALP +  
Sbjct  271   TPFFIVNSMFDTFQIN----KTFPGYYEDLNNNTCSAT-LVKTLQDFKQEFLSALPKQSN  325

Query  1103  --PSVGIFINNCFFHTEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSEFIKD  1276
                S G+FI++C  H++I +G   N    V+N   ++A S+WYF    V LID  +   +
Sbjct  326   CSSSRGMFIDSCLIHSQILSGVGWN-GFTVHNKTIAEAFSNWYFDLSPVQLIDTPDMPLN  384

Query  1277  CY  1282
             CY
Sbjct  385   CY  386



>ref|XP_009779347.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=386

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 211/358 (59%), Gaps = 26/358 (7%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A + GAVCLDGSPPAYHF  G  +   NW++ + GGAWC ++ EC+ R L+    S +
Sbjct  38    KNAVSKGAVCLDGSPPAYHFEPGFGKGVGNWIVQLSGGAWCTNVTECQDRILDKNVGSTN  97

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
                         + F GI + +P  NP +F NWN V +RYCDG +FTGDVE  + V NL+
Sbjct  98    FT--------DSWTFQGIYSENPTANP-DFYNWNKVFVRYCDGGAFTGDVEYVDHVTNLH  148

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RIF  + ++LL KGLKNAK   L G SAG     L+CD FR LLPNT R KCL+D 
Sbjct  149   FRGARIFEAVMEDLLAKGLKNAKNAILAGSSAGGYPTMLYCDHFRSLLPNTPRVKCLVDS  208

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             GYFIHVK  NP Q  GFE  + ++++LH ST  LP++CT KM   P LC FP+ +   +K
Sbjct  209   GYFIHVK--NPMQASGFEKIYNSLLTLHGSTKALPKSCTSKM--NPPLCFFPENMQQHIK  264

Query  929   TPMFILMSSYDKHQINISM--HESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP--  1096
             TP+FI MS++D +QI  ++  +      NRT  E    A       + FR + L ALP  
Sbjct  265   TPLFIAMSAFDYYQIKTTIDPNADRCVENRTCTECQNKA------FREFRSEFLSALPIS  318

Query  1097  NKPSV-GIFINNCFFHTEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSEF  1267
             N P + G+FI++   H+ ++  +       +NN+   KA +DWYF  K   +IDK + 
Sbjct  319   NNPKLRGVFIDSVIHHSALSYRWTPENAILINNLSAPKAFADWYFDRKYWYVIDKHDL  376



>ref|XP_010911666.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=388

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 207/361 (57%), Gaps = 23/361 (6%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + A A GAVCLDGSPPAYHF  G     DNWL++MEGG WC ++EECK RT   +
Sbjct  27    PLTLVQDAVAKGAVCLDGSPPAYHFAPGFGSGVDNWLVHMEGGGWCSNVEECKQRTKNFR  86

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK+M             F GIL      +P +F NWN V IRYCDGSSFTGD+E   P
Sbjct  87    GSSKYM---------EQLSFSGILGNKQTSSP-DFYNWNKVKIRYCDGSSFTGDIEAVNP  136

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG R++  I DELL KG+  A+   L+G SAG ++  LHCD FR LLP     K
Sbjct  137   ATNLHFRGARVWRAIMDELLAKGMNKAQNALLSGCSAGGLASILHCDSFRDLLPAGATVK  196

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C  D GYFI  K  + K  E  +  +  VV++H S   LP +CT      P +C FPQY+
Sbjct  197   CFSDAGYFIDAKDVSGK--ESIKDFYSQVVTIHGSAKNLPSSCTSSF--PPSMCFFPQYV  252

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFRLQL  1081
             +  M+TP+FIL ++YD  QI   +  S    ++   E      + ++   + L+ FR + 
Sbjct  253   VQSMRTPLFILNAAYDAWQIKNILAPSPSDPSKVWGECKLDIKKCSSSQLQVLQDFRSEF  312

Query  1082  LDALP-NKPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWYFYGKEVNLI  1252
             L ALP N PS G+FI++C+ H +  A   W + NS  ++ +  +KA+ DW++    +  I
Sbjct  313   LHALPANSPSTGLFIDSCYSHCQSGAQETWLSSNSPAIDKMSIAKAVGDWFYGRSAIQKI  372

Query  1253  D  1255
             D
Sbjct  373   D  373



>gb|KDP28066.1| hypothetical protein JCGZ_19474 [Jatropha curcas]
Length=395

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 225/387 (58%), Gaps = 29/387 (7%)
 Frame = +2

Query  137   QWltllvcaallvlQTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIY  316
             QW + L+   LL+L+T+    P+   E AK  GAVCLDGSPPAYHF +G     +NW+++
Sbjct  8     QWFSYLLVFMLLLLKTEGGSIPITIVETAKTRGAVCLDGSPPAYHFDKGYGSGANNWIVH  67

Query  317   MEGGAWCESIEECKLRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWN  496
             MEGG WC+ IE C  R   +KGSS  M        +   GF GIL    A NP +F NWN
Sbjct  68    MEGGGWCDDIESCLERRDTYKGSSLKM--------EKTMGFSGILGSKQAANP-DFYNWN  118

Query  497   LVVIRYCDGSSFTGDVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGA  670
              + I+YCDGSSFTGDVE  +P   LYFRG+RI+  + D+LL KG++NA+   L+G SAG 
Sbjct  119   RIKIKYCDGSSFTGDVEAVDPKTKLYFRGERIWRAVIDDLLAKGMRNAQNAILSGCSAGG  178

Query  671   VSVALHCDRFRKLLPNTRRFKCLMDGGYFIHVKKDNPKQVEGFELT--FKNVVSLHNSTG  844
             ++  LHCD+FR LLP + + KC+ D GYFIH K        G+E+   +  VV LH S  
Sbjct  179   LASILHCDKFRSLLPASAKVKCVSDAGYFIHGK----DIAGGYEIENFYGRVVRLHGSAK  234

Query  845   MLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR-  1021
              LP +CT +M  +P LC FPQ +   M+TP+F++ S+YD  QI   +  S V    + + 
Sbjct  235   NLPTSCTSRM--RPELCFFPQNVAQTMQTPLFVINSAYDSWQIKNILAPSAVDKKGSFKS  292

Query  1022  ---EHVQLATPIYEGLKGFRLQLLDAL----PNKPSVGIFINNCFFHTEIAT-GYWANPN  1177
                +  + +    + ++ FRLQ ++AL     NKP+ G+FIN+C  H +  +   W +  
Sbjct  293   CKTDLKKCSASQLQTVQDFRLQFINALNSGVANKPANGMFINSCHAHCQSGSVSTWFDAK  352

Query  1178  SQV-NNVLDSKAISDWYFYGKEVNLID  1255
             S V +N    KA+ DW++       ID
Sbjct  353   SPVLSNTKIGKAVGDWFYDRASFKKID  379



>ref|XP_002303225.2| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ABK93778.1| unknown [Populus trichocarpa]
 gb|ABK95483.1| unknown [Populus trichocarpa]
 gb|EEE78204.2| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 155/381 (41%), Positives = 219/381 (57%), Gaps = 36/381 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+    P+   + A A GAVCLDGSPP YHF +G+    +NWL++MEGG WCES+E C 
Sbjct  21    KTEGASIPMTIVQAAVARGAVCLDGSPPGYHFEKGSGSGINNWLVHMEGGGWCESVESCV  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   +KGSS  M        +   GF GIL    A NP +F NWN + IRYCDGSSFTG
Sbjct  81    SRRDTYKGSSLKM--------EKTMGFSGILGSKQAANP-DFYNWNRIKIRYCDGSSFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   LYFRG+RI+  + D+LL KG++NA+   L+G SAG ++  LHCD+F+ LL
Sbjct  132   DVEAVDPKTKLYFRGERIWQAVIDDLLAKGMRNARNAILSGCSAGGLAAILHCDKFQSLL  191

Query  713   PNTRRFKCLMDGGYFIH-VKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P + R KC+ D GYFIH        ++E F   F  VV  H S   LP +CT K   +P 
Sbjct  192   PASARVKCVSDAGYFIHGTDISGGSRIESF---FGQVVKTHGSAKHLPASCTSKT--RPE  246

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEG  1057
             LC FPQY+   M+TP+FI+ S+YD  QI   +  + V + +  +    +  + +    + 
Sbjct  247   LCFFPQYVAQAMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKNCKLDLKKCSATQLQT  306

Query  1058  LKGFRLQLLDA----LPNKPSVGIFINNCFFHTEIA--TGYWANPNSQVNNVLDSKAISD  1219
             ++ +R Q L A    L +  S G++IN+C+ H +    + + A+ +  V NV   KA+ D
Sbjct  307   VQNYRTQFLKAVNIGLGSSSSRGLWINSCYAHCQSGSVSTWLADKSPVVGNVKIGKAVGD  366

Query  1220  WYFYGKEVNLIDKSEFIK-DC  1279
             W++        D+S F K DC
Sbjct  367   WFY--------DRSAFEKIDC  379



>ref|XP_006361594.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=518

 Score =   278 bits (710),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 214/353 (61%), Gaps = 24/353 (7%)
 Frame = +2

Query  239   VCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMNpffp  418
             VCLDG+PPAY++ +G  E  +NW+IY  GG WC ++ +C  R    +GSSK+        
Sbjct  175   VCLDGTPPAYYYEKGHGEGANNWIIYFRGGEWCYNVMDCLARATTERGSSKY--------  226

Query  419   gdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLYFRGKRIFN  592
                   FYGIL+ +   NP +F NWN V++ YCDGSSFTGDVE  +P+ NL+FRG RIF 
Sbjct  227   APKQRSFYGILSNNKTINP-DFYNWNRVMVIYCDGSSFTGDVEIVDPITNLHFRGARIFL  285

Query  593   VITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFIHVKK  772
              + +  L KG+KNAK   L+GGSAG +   +HCDRF+ LLPN+ R KCL DG YF+H K 
Sbjct  286   ALIENFLEKGMKNAKNAILSGGSAGGLPALIHCDRFKALLPNSARVKCLADGSYFLHRK-  344

Query  773   DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFILMS  952
              + K++   +   + ++ LH+S  MLP +CT KM   P LC+FPQY   G+KTP FI+ S
Sbjct  345   -HKKEMSFMDTVNEGLIKLHHSANMLPSSCTSKM--NPSLCLFPQYFQQGIKTPFFIVNS  401

Query  953   SYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP---NKPSVGIFI  1123
              +D  QIN    ++F      +  +   A+ + + L+ F+   L+ALP   N  S G+FI
Sbjct  402   MFDTFQIN----KTFPGYYEDLFSNTCSAS-LVKTLQDFKQDFLNALPKQSNSSSRGMFI  456

Query  1124  NNCFFHTEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSEFIKDCY  1282
             ++C  H++I +G   N  S V+N   +KA SDWYF      LIDK +   +CY
Sbjct  457   DSCLIHSQITSGVGWNGFS-VHNKSIAKAFSDWYFDRSHEQLIDKPDLPLNCY  508



>ref|XP_002519912.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42516.1| pectin acetylesterase, putative [Ricinus communis]
Length=452

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 215/365 (59%), Gaps = 27/365 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+   E AKA GAVCLDGSPPAYH+ +G     +NW+++MEGG WC+ +E C  R   +K
Sbjct  86    PITIVETAKARGAVCLDGSPPAYHYDKGYGTGANNWIVHMEGGGWCDDLESCSQRKDTYK  145

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSS  M        +   GF GIL    + NP +F NWN + I+YCDGSSFTGDVE  + 
Sbjct  146   GSSLKM--------EKTMGFSGILGGKQSANP-DFYNWNRIKIKYCDGSSFTGDVEVVDA  196

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG+RI+  + D+LL KG++NA+   L+G SAG ++  LHCD+FR LLP + R K
Sbjct  197   KTNLHFRGERIWQAVIDDLLAKGMRNAQNAILSGCSAGGLAAILHCDKFRSLLPASARVK  256

Query  734   CLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             C+ D G+FIH K     + +E F   F +VV LH S   LP +CT KM  +P LC FPQY
Sbjct  257   CVSDAGFFIHGKDVAGGRHIENF---FGSVVRLHGSAKSLPASCTAKM--RPELCFFPQY  311

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQ  1078
             +   M+TP+F++ S+YD  QI   +  S V    + +    +  + +    + ++ FR Q
Sbjct  312   VAQTMRTPLFLINSAYDSWQIKNVLAPSAVDKKGSWKSCKLDLKKCSAAQLQTVQDFRTQ  371

Query  1079  LLDALP----NKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYFYGKE  1240
              + AL     NKP+ G FIN+C+ H +  +   + A+ +  V+N    KA+ DW++    
Sbjct  372   FIGALSGGVTNKPANGYFINSCYAHCQSGSLATWLADKSPVVSNTKIGKAVGDWFYDRAT  431

Query  1241  VNLID  1255
                ID
Sbjct  432   FQKID  436



>ref|XP_011012520.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/381 (40%), Positives = 218/381 (57%), Gaps = 36/381 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+    P+   + A A GAVCLDGSPP YHF +G+    +NWL++MEGG WCES+E C 
Sbjct  21    KTEGASIPMTIVQTAVARGAVCLDGSPPGYHFEKGSGSGINNWLVHMEGGGWCESVESCV  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   +KGSS  M        +   GF GIL    A NP +F NWN + IRYCDGSSFTG
Sbjct  81    SRRDTYKGSSLKM--------EKTMGFSGILGSKQAANP-DFYNWNRIKIRYCDGSSFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   LYFRG+RI+  + D+LL KG++NA+   L+G SAG ++  LHCD+F+ LL
Sbjct  132   DVEAVDPKTKLYFRGERIWQAVIDDLLAKGMRNARNAILSGCSAGGLAAILHCDKFQSLL  191

Query  713   PNTRRFKCLMDGGYFIH-VKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P + R KC+ D GYFIH        ++E F   F  VV  H S   LP +CT K   +P 
Sbjct  192   PASARVKCVSDAGYFIHGTDISGGSRIESF---FGQVVKTHGSAKNLPASCTSKT--RPE  246

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEG  1057
             LC FPQY+   M+TP+FI+ S+YD  QI   +  + V + +  +    +  + +    + 
Sbjct  247   LCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKNCKLDLKKCSATQLQT  306

Query  1058  LKGFRLQLLDA----LPNKPSVGIFINNCFFHTEIA--TGYWANPNSQVNNVLDSKAISD  1219
             ++ +R Q L A    L +  S G++IN+C+ H +    + + A+ +  V N    KA+ D
Sbjct  307   VQNYRTQFLKAVNTGLGSSSSRGLWINSCYAHCQSGSVSTWLADKSPVVGNAKIGKAVGD  366

Query  1220  WYFYGKEVNLIDKSEFIK-DC  1279
             W++        D+S F K DC
Sbjct  367   WFY--------DRSAFEKIDC  379



>ref|XP_009600038.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=370

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 148/346 (43%), Positives = 204/346 (59%), Gaps = 24/346 (7%)
 Frame = +2

Query  182   TKANFYPL--IFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEEC  355
             T  +FY +     + A + GAVCLDGSPPAYHF  G  E  +NW + + GGAWC S+E C
Sbjct  27    TDLDFYEVKKTIVKNAVSKGAVCLDGSPPAYHFEPGFGEGVENWFVQLSGGAWCTSVEAC  86

Query  356   KLRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFT  535
             K R+ ++K  S   M          + F GI +++ + NP +F NWN V++RYCDG +FT
Sbjct  87    KDRSRDNKVGSTTTM--------GPYTFQGIYSKNQSANP-DFYNWNKVLVRYCDGGAFT  137

Query  536   GDVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKL  709
             GDVE  +P  NL+FRG RIF  + +++L KGLKNAK   L G SAG     L+CDRFR L
Sbjct  138   GDVEYVDPATNLHFRGARIFEAVMEDVLAKGLKNAKNAILAGSSAGGYPAMLYCDRFRSL  197

Query  710   LPNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             LPNT R KC +D GYFIH K  N KQ  GFE  +  +V+LH S   LP++CT KM  KP 
Sbjct  198   LPNTPRVKCFVDAGYFIHAK--NQKQARGFEDIYNTLVTLHGSAKTLPKSCTSKM--KPL  253

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGF  1069
             LC FP+ +   +KTP+FI MS++D  QIN ++          + E+    T   +  + F
Sbjct  254   LCFFPESMQQNIKTPLFIAMSAFDIFQINTTVEPHL----HDVIENGTCTTSQNKAFREF  309

Query  1070  RLQLLDAL--PNKPSV-GIFINNCFFHTEIATGYWANPNSQVNNVL  1198
             R + L  L  PN P + G+FI++   HT +   +     + +NN++
Sbjct  310   RSEFLSTLPKPNNPKLRGVFIDSVNHHTSLLIRWSPENATMINNLV  355



>ref|XP_006385133.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62930.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   271 bits (694),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 149/365 (41%), Positives = 210/365 (58%), Gaps = 27/365 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+   E A + GAVCLDGSPP YHF +G+    DNWL++MEGG WCES+E C  R    +
Sbjct  28    PITIVETAVSSGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCESVESCVSRRDTFR  87

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSS  M        +   GF GIL    A NP +F NWN + +RYCDGSSFTGDVE  +P
Sbjct  88    GSSSKM--------EKTMGFSGILGSKQAANP-DFYNWNRIKVRYCDGSSFTGDVEAVDP  138

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                LYFRG+R++  + DELL KG++NA+   L+G SAG ++  LHCD+F+ LLP T R K
Sbjct  139   ETKLYFRGERVWQAVIDELLAKGMQNARNAILSGCSAGGLAAILHCDKFQSLLPATARVK  198

Query  734   CLMDGGYFIH-VKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             C+ D GYFIH        ++E F   F  VV  H S   LP +CT KM   P LC FPQY
Sbjct  199   CVSDAGYFIHGTDISGGSRIESF---FGQVVKTHGSAKNLPASCTSKM--NPELCFFPQY  253

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFRLQ  1078
             +   M+TP+FI+ S+YD  QI   +  + V + +  ++      + +    + ++ +R Q
Sbjct  254   VAQTMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSASQLQTVQDYRTQ  313

Query  1079  LLDA----LPNKPSVGIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAISDWYFYGKE  1240
              L A    L +  + G++I++C+ H +  +   W N  S +V +    KA+ DW++    
Sbjct  314   FLKAVDTGLGSSSTRGLWIDSCYAHCQSGSVSTWLNDKSPEVGDTKMGKAVGDWFYDRSA  373

Query  1241  VNLID  1255
             +  ID
Sbjct  374   MEKID  378



>ref|XP_009605804.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=385

 Score =   271 bits (693),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 208/358 (58%), Gaps = 26/358 (7%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A + GAVCLDGSPPAYHF  G  +   NW++ + GGAWC +++EC+ R  +    S +
Sbjct  40    KNAVSKGAVCLDGSPPAYHFEPGFGKGIGNWIVQLSGGAWCTNVKECQDRIWDKNVGSTN  99

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
                         + F GI + +   NP +F NWN V +RYCDG +FTGDVE  + V NL+
Sbjct  100   FT--------DSWNFQGIYSENSTANP-DFYNWNKVFVRYCDGGAFTGDVEYVDHVTNLH  150

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RIF    +ELL KGLKNAK   L G SAG     L+CD FR LLPNT R KCL+D 
Sbjct  151   FRGARIFEAAMEELLAKGLKNAKNAILAGSSAGGYPTMLYCDHFRSLLPNTLRVKCLVDS  210

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             GYFIH K  NP Q  GFE  + ++++LH ST  LP++CT KM   P LC FP+ +   +K
Sbjct  211   GYFIHAK--NPMQARGFEKIYNSLLTLHGSTKALPKSCTSKM--NPLLCFFPENMQQHIK  266

Query  929   TPMFILMSSYDKHQINISM--HESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP--  1096
             TP+FI MS++D +Q+  ++  +      NRT  E    A       + FR + L ALP  
Sbjct  267   TPLFIAMSAFDYYQMKTTIDPNADRCVENRTCTERQNKA------FREFRSEFLSALPKS  320

Query  1097  NKPSV-GIFINNCFFHTEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSEF  1267
             N P + G+FI++   H+ ++  +       +NN+   KA +DWYF  K   +IDK + 
Sbjct  321   NNPKLRGVFIDSVIHHSALSYRWTLENAIMINNLSAPKAFADWYFDRKYWYVIDKHDL  378



>ref|XP_011028476.1| PREDICTED: protein notum homolog [Populus euphratica]
 ref|XP_011028477.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   271 bits (693),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 149/365 (41%), Positives = 210/365 (58%), Gaps = 27/365 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+   E A + GAVCLDGSPP YHF +G+    DNWL++MEGG WCES+E C  R    +
Sbjct  28    PITIVETAVSRGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCESVESCVSRRDTFR  87

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSS  M        +   GF GIL    A NP +F NWN + +RYCDGSSFTGDVE  +P
Sbjct  88    GSSSKM--------EKTMGFSGILGSKQAANP-DFYNWNRIKVRYCDGSSFTGDVEAVDP  138

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                LYFRG+R++  + DELL KG++NA+   L+G SAG ++  LHCD+F+ LLP T R K
Sbjct  139   ETKLYFRGERVWQAVIDELLAKGMQNARNAILSGCSAGGLAAILHCDKFQSLLPATARVK  198

Query  734   CLMDGGYFIH-VKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             C+ D GYFIH        ++E F   F  VV  H S   LP +CT KM   P LC FPQY
Sbjct  199   CVSDAGYFIHGTDISGGSRIESF---FGQVVKTHGSAKNLPASCTSKM--NPELCFFPQY  253

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFRLQ  1078
             +   M+TP+FI+ S+YD  QI   +  + V + +  ++      + +    + ++ +R Q
Sbjct  254   VAQTMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSASQLQTVQDYRAQ  313

Query  1079  LLDA----LPNKPSVGIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAISDWYFYGKE  1240
              L A    L +  + G++I++C+ H +  +   W N  S +V +    KA+ DW++    
Sbjct  314   FLKAVNTGLGSSSTRGLWIDSCYAHCQSGSVSTWLNDKSPEVGDTKMGKAVGDWFYDRSA  373

Query  1241  VNLID  1255
             +  ID
Sbjct  374   MEKID  378



>ref|XP_009778395.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=397

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 216/355 (61%), Gaps = 25/355 (7%)
 Frame = +2

Query  221   AKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMM  400
             A + GAVCLDGSPPAYHF  G  +    WL+++ GGAWC ++EEC  R+    GSS +M 
Sbjct  49    AVSKGAVCLDGSPPAYHFEPGFGDGVGKWLVHLSGGAWCTTVEECLNRSKSDFGSSNYM-  107

Query  401   MNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLYFR  574
                       + F GI ++  + NP +F NWN V +RYCDG +FTG+ E  +P  NL+FR
Sbjct  108   --------KPWWFQGIYSKTQSVNP-DFYNWNKVFVRYCDGGAFTGNAEYVDPATNLHFR  158

Query  575   GKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGY  754
             G RIF  + +++L KGLKNA+   L G SA      L+CDRFRKLLPNT R KC++D GY
Sbjct  159   GARIFKAVMEDVLAKGLKNAQSALLIGSSAAGYPAMLYCDRFRKLLPNTPRVKCMVDAGY  218

Query  755   FIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTP  934
             FIHVK  +P Q   F   +K +V+LH S   LP++CT+KM  KP +C FP+ +   +KTP
Sbjct  219   FIHVK--DPHQARNFTEMYKAIVNLHGSAKTLPKSCTKKM--KPEMCFFPENMQHKIKTP  274

Query  935   MFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP--NKPS  1108
             ++I MS++DK QIN ++++     N  I      AT   +  + FRL+ L+ALP  N P 
Sbjct  275   LYIAMSAFDKFQINTTIYDGI---NICIEGGNCTATE-NKLFREFRLEFLNALPKANNPK  330

Query  1109  V-GIFINNCFFHTEIATGYWANPN-SQVNNVLDSKAISDWYFYGKEVNLIDKSEF  1267
             + G FI+    HT++  G+W+  N + V N+   KA +DWY+      +ID+ + 
Sbjct  331   LRGAFIDARNHHTQV-QGWWSPKNVTTVKNLNLMKAFADWYYDRNYTYVIDERDL  384



>gb|KHN27509.1| Protein notum like [Glycine soja]
Length=398

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 216/364 (59%), Gaps = 26/364 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + + +  PL   E A++ GAVCLDGSPPAYHF +G  E  DNW++++EGG WC ++E C 
Sbjct  21    KAEGSSVPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNNVESCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M          D  F  IL+ +  +NP +F NWN V +RYCDGSSFTG
Sbjct  81    ERKNTRLGSSKQM---------KDIYFSAILSNEQQFNP-DFYNWNRVKVRYCDGSSFTG  130

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVEE  P  NL+FRG RIF+ + +ELL KG+KN K   L+G SAG ++  LHCD F+ LL
Sbjct  131   DVEEVDPTTNLHFRGARIFSAVMEELLAKGMKNVKNAILSGCSAGGLTTILHCDSFKALL  190

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P+    KC+ D GYF++V  ++       +  +  VVS+H S   LP +CT K+   P L
Sbjct  191   PSGANVKCVPDAGYFVNV--EDISGAHSIQEFYSEVVSIHGSAKNLPTSCTSKL--NPAL  246

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQL---ATPIYEGL  1060
             C FPQY+   + TP+F++ S+YD+ QI NI +  S   +N      + +   +T     +
Sbjct  247   CFFPQYVASHISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCSTDQLSKI  306

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             +GF+ +   AL    + PS G+FI++C+ H  TE+   +  + + Q+ N   +KA+ DW 
Sbjct  307   QGFKSEFERALSEVGDSPSKGVFIDSCYAHCQTELQETWLKSDSPQLANTTIAKAVGDW-  365

Query  1226  FYGK  1237
             FYG+
Sbjct  366   FYGR  369



>ref|XP_003547731.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
 ref|XP_006599118.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=398

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 216/364 (59%), Gaps = 26/364 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + + +  PL   E A++ GAVCLDGSPPAYHF +G  E  DNW++++EGG WC ++E C 
Sbjct  21    KAEGSSVPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGIDNWIVHIEGGGWCNNVESCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M          D  F  IL+ +  +NP +F NWN V +RYCDGSSFTG
Sbjct  81    ERKNTRLGSSKQM---------KDIYFSAILSNEQQFNP-DFYNWNRVKVRYCDGSSFTG  130

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVEE  P  NL+FRG RIF+ + +ELL KG+KN K   L+G SAG ++  LHCD F+ LL
Sbjct  131   DVEEVDPTTNLHFRGARIFSAVMEELLAKGMKNVKNAILSGCSAGGLTTILHCDSFKALL  190

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P+    KC+ D GYF++V  ++       +  +  VVS+H S   LP +CT K+   P L
Sbjct  191   PSGANVKCVPDAGYFVNV--EDISGAHSIQEFYSEVVSIHGSAKNLPTSCTSKL--NPAL  246

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQL---ATPIYEGL  1060
             C FPQY+   + TP+F++ S+YD+ QI NI +  S   +N      + +   +T     +
Sbjct  247   CFFPQYVASHISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCSTDQLSKI  306

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             +GF+ +   AL    + PS G+FI++C+ H  TE+   +  + + Q+ N   +KA+ DW 
Sbjct  307   QGFKSEFERALSEVGDSPSKGMFIDSCYAHCQTELQETWLKSDSPQLANTTIAKAVGDW-  365

Query  1226  FYGK  1237
             FYG+
Sbjct  366   FYGR  369



>ref|XP_009607289.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=399

 Score =   268 bits (686),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 150/355 (42%), Positives = 211/355 (59%), Gaps = 25/355 (7%)
 Frame = +2

Query  221   AKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMM  400
             A + GAVCLDGSPPAYHF  G  +    WL+++ GGAWC ++EEC  R+    GSSK+M 
Sbjct  49    AVSKGAVCLDGSPPAYHFEPGFGDGVGKWLVHLSGGAWCTTVEECLNRSKSDFGSSKYM-  107

Query  401   MNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLYFR  574
                       + F GI ++  + NP +F NWN V +RYCDG +FTG+ E  +P  NL+FR
Sbjct  108   --------KPWWFIGIYSKTQSVNP-DFYNWNKVFVRYCDGGAFTGNAEYVDPATNLHFR  158

Query  575   GKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGY  754
             G RIF  + +++L KGLKNA+   L G SA      L+CDRF KLLPNT R KC++D GY
Sbjct  159   GARIFKAVMEDVLAKGLKNAQSALLIGSSAAGYPAMLYCDRFHKLLPNTPRVKCMVDAGY  218

Query  755   FIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTP  934
             FIHVK  +P Q   F   +K +V+LH S   LP++C  KM  KP +C FP+ +   +KTP
Sbjct  219   FIHVK--DPHQARNFTQMYKAIVNLHGSAKTLPKSCISKM--KPEMCFFPENMQHKIKTP  274

Query  935   MFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP--NKPS  1108
             ++I MS++DK QIN ++++       T  E         +  + FRL+ L+ALP  N P 
Sbjct  275   LYIAMSAFDKFQINTTIYDGV----NTCIEGGNCTATENKLFRDFRLEFLNALPKGNNPK  330

Query  1109  V-GIFINNCFFHTEIATGYWANPN-SQVNNVLDSKAISDWYFYGKEVNLIDKSEF  1267
             + G FI+    HT++  G+W+  N + V N+   KA  DWY+      +ID+ + 
Sbjct  331   LRGAFIDARNHHTQV-QGWWSPKNVTTVKNLNLMKAFGDWYYDRNYTYVIDERDL  384



>gb|ADR82372.1| pectin acetylesterase [Populus trichocarpa]
Length=394

 Score =   268 bits (685),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 148/365 (41%), Positives = 209/365 (57%), Gaps = 27/365 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+   E A + GAVCLDGS P YHF +G+    DNWL++MEGG WCES+E C  R    +
Sbjct  28    PITIIETAVSSGAVCLDGSQPGYHFDKGSGSGIDNWLVHMEGGGWCESVESCVSRRDTFR  87

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSS  M        +   GF GIL    A NP +F NWN + +RYCDGSSFTGDVE  +P
Sbjct  88    GSSSKM--------EKTMGFSGILGSKQAANP-DFYNWNRIKVRYCDGSSFTGDVEAVDP  138

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                LYFRG+R++  + DELL KG++NA+   L+G SAG ++  LHCD+F+ LLP T R K
Sbjct  139   ETKLYFRGERVWQAVIDELLAKGMQNARNAILSGCSAGGLAAILHCDKFQSLLPATARVK  198

Query  734   CLMDGGYFIH-VKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             C+ D GYFIH        ++E F   F  VV  H S   LP +CT KM   P LC FPQY
Sbjct  199   CVSDAGYFIHGTDISGGSRIESF---FGQVVKTHGSAKNLPASCTSKM--NPELCFFPQY  253

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFRLQ  1078
             +   M+TP+FI+ S+YD  QI   +  + V + +  ++      + +    + ++ +R Q
Sbjct  254   VAQTMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSASQLQTVQDYRTQ  313

Query  1079  LLDA----LPNKPSVGIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAISDWYFYGKE  1240
              L A    L +  + G++I++C+ H +  +   W N  S +V +    KA+ DW++    
Sbjct  314   FLKAVDTGLGSSSTRGLWIDSCYAHCQSGSVSTWLNDKSPEVGDTKMGKAVGDWFYDRSA  373

Query  1241  VNLID  1255
             +  ID
Sbjct  374   MEKID  378



>ref|XP_010248193.1| PREDICTED: uncharacterized protein LOC104591101 [Nelumbo nucifera]
Length=394

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 152/375 (41%), Positives = 212/375 (57%), Gaps = 30/375 (8%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + + + A A GAVCLDGSPPAYH   G     +NWLI +EGGAWC +   C  R   
Sbjct  26    FVGITYVDNAVAKGAVCLDGSPPAYHMAPGFGSGVNNWLILLEGGAWCNNATTCLARKNT  85

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--  547
               GSSK M+    F G         L+    +NP +F NWN V +RYCDGSSFTGDVE  
Sbjct  86    RLGSSKEMVKQLSFSG--------FLSDKEKFNP-DFFNWNKVKVRYCDGSSFTGDVEAV  136

Query  548   EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
             +P  NLY+RG+RIFN + D+LL KG+KNA+   L+G SAG +SV LHCD+FR+LLP + +
Sbjct  137   DPATNLYYRGQRIFNAVVDDLLEKGMKNAQNALLSGCSAGGLSVILHCDKFRELLPQSTK  196

Query  728   FKCLMDGGYFIHVKKDNPKQVEGFELT---FKNVVSLHNSTGMLPQTCTQKMKDKPYLCM  898
              KC+ D G+FI     N K + G E     F +VV+ H S   LP +CT   K    LC 
Sbjct  197   VKCMADAGFFI-----NAKTIAGTEYIKEFFSDVVTTHQSAKNLPASCTS--KGDXTLCF  249

Query  899   FPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKG  1066
             FPQ +   + TP+FIL ++YD +Q+   +       + T  +      + +    + ++G
Sbjct  250   FPQNVAPQVTTPLFILNAAYDSYQVKNILAPGIADPHGTWHDCKLDITKCSDTQLQAIQG  309

Query  1067  FRLQLLDALP---NKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYFY  1231
             FR + L+A+      P+ G+FIN+C+ H +      W   +S V +N+  SKA+ DWYF 
Sbjct  310   FRKEFLNAIKGVEGSPTKGLFINSCYSHCQSGMQETWLREDSPVLDNMSISKAVGDWYFD  369

Query  1232  GKEVNLIDKSEFIKD  1276
                V  I++ E+  D
Sbjct  370   RGTVQKIEQCEYPCD  384



>gb|KDP28067.1| hypothetical protein JCGZ_19475 [Jatropha curcas]
Length=394

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/372 (41%), Positives = 210/372 (56%), Gaps = 27/372 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+    P++  E AKA GAVCLDGS PAYHF +G     +NW+++MEGG WC+ IE C 
Sbjct  21    KTEGGSIPIVLIENAKAKGAVCLDGSAPAYHFQKGEGTGINNWIVHMEGGGWCDDIESCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   +KGSS  M        +   GF GIL      NP +F NWN + IRYCDGSSFTG
Sbjct  81    ARRNTYKGSSSKM--------NKTMGFSGILGSKQVSNP-DFYNWNRIKIRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVEE  P  NLYFRG+R++  + DELL KG+ NA+   L+G SAG ++  LHCD+F+  L
Sbjct  132   DVEEVDPKTNLYFRGERVWQAVIDELLAKGMNNAQNAILSGCSAGGLAAILHCDKFKSFL  191

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P T   KC+ D GYFIH K      ++E F   F  +V+ H S   LP +CT KM  KP 
Sbjct  192   PATATVKCVSDAGYFIHGKDIAGGYEIENF---FGRIVTTHGSAKNLPASCTSKM--KPE  246

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEG  1057
             LC FP+ +   M+TP+F++ S+YD  Q+   +  S      T +    +  +      E 
Sbjct  247   LCFFPENVAQTMQTPLFVINSAYDFWQLKNVLAPSAADRKGTFKSCKLDLTKCKPAQLET  306

Query  1058  LKGFRLQLLDA----LPNKPSVGIFINNCFFHTEIATG--YWANPNSQVNNVLDSKAISD  1219
             ++ FR Q ++A    L NK   G FI++C+ H +  +   + A  +  +N+   +KA+ D
Sbjct  307   VQDFRTQFINALNIGLGNKTVNGYFIDSCYAHCQTGSPLVWLAEKSPVLNDTRIAKAVGD  366

Query  1220  WYFYGKEVNLID  1255
             WYF       ID
Sbjct  367   WYFDRAPFQKID  378



>ref|XP_008808367.1| PREDICTED: uncharacterized protein LOC103720446 isoform X1 [Phoenix 
dactylifera]
Length=399

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 151/362 (42%), Positives = 209/362 (58%), Gaps = 25/362 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + A A GAVCLDGSPPAYHF  G     +NWL++MEGG WC ++EECK RT   +
Sbjct  33    PLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCRNVEECKERTKNFR  92

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK+M             F GIL +    NP +F NWN V IRYCDGSSFTGD+E   P
Sbjct  93    GSSKYM---------KQLSFSGILGKKQNLNP-DFYNWNKVKIRYCDGSSFTGDIEAVNP  142

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG R++  I D+LL K +  A+   L+G SAG ++  LHCD FR L+P   R K
Sbjct  143   ATNLHFRGARVWRAIIDDLLAKRMNKAQNALLSGCSAGGLASILHCDSFRDLVPAGARVK  202

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C  D GYFI+ K  + K  E  +  +  V + H S   LP +CT +    P +C FPQY+
Sbjct  203   CFSDAGYFINGKDVSGK--ESIKDFYNQVATTHGSAKNLPSSCTSRF--PPSMCFFPQYV  258

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYEGLKGFRLQ  1078
             +  M+TP+FIL ++YD  QI   +  S  +  R +    +L     ++   + ++GFR +
Sbjct  259   VQSMRTPLFILNAAYDAWQIKNILAPS-PSDPRKVWGECKLDIKKCSSNQLQVMQGFRSE  317

Query  1079  LLDALP-NKPSVGIFINNCFFHTEI-ATGYWANPNSQVNNVLD-SKAISDWYFYGKEVNL  1249
              + ALP N  S+G+FI++C+ H +  A   W   +S V + +  +KA+ DWYF    +  
Sbjct  318   FMRALPANSSSIGMFIDSCYSHCQSGAQETWLRSDSPVIDKMPIAKAVGDWYFGRTSMRK  377

Query  1250  ID  1255
             ID
Sbjct  378   ID  379



>ref|XP_008808368.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008808369.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
Length=396

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 151/362 (42%), Positives = 209/362 (58%), Gaps = 25/362 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + A A GAVCLDGSPPAYHF  G     +NWL++MEGG WC ++EECK RT   +
Sbjct  30    PLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCRNVEECKERTKNFR  89

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK+M             F GIL +    NP +F NWN V IRYCDGSSFTGD+E   P
Sbjct  90    GSSKYM---------KQLSFSGILGKKQNLNP-DFYNWNKVKIRYCDGSSFTGDIEAVNP  139

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG R++  I D+LL K +  A+   L+G SAG ++  LHCD FR L+P   R K
Sbjct  140   ATNLHFRGARVWRAIIDDLLAKRMNKAQNALLSGCSAGGLASILHCDSFRDLVPAGARVK  199

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C  D GYFI+ K  + K  E  +  +  V + H S   LP +CT +    P +C FPQY+
Sbjct  200   CFSDAGYFINGKDVSGK--ESIKDFYNQVATTHGSAKNLPSSCTSRF--PPSMCFFPQYV  255

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYEGLKGFRLQ  1078
             +  M+TP+FIL ++YD  QI   +  S  +  R +    +L     ++   + ++GFR +
Sbjct  256   VQSMRTPLFILNAAYDAWQIKNILAPS-PSDPRKVWGECKLDIKKCSSNQLQVMQGFRSE  314

Query  1079  LLDALP-NKPSVGIFINNCFFHTEI-ATGYWANPNSQVNNVLD-SKAISDWYFYGKEVNL  1249
              + ALP N  S+G+FI++C+ H +  A   W   +S V + +  +KA+ DWYF    +  
Sbjct  315   FMRALPANSSSIGMFIDSCYSHCQSGAQETWLRSDSPVIDKMPIAKAVGDWYFGRTSMRK  374

Query  1250  ID  1255
             ID
Sbjct  375   ID  376



>ref|XP_006587657.1| PREDICTED: protein notum homolog isoform X3 [Glycine max]
 gb|KHN11801.1| Protein notum like [Glycine soja]
Length=400

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/379 (41%), Positives = 211/379 (56%), Gaps = 44/379 (12%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             ++A++ P+   + A A GAVCLDGSPPAYHF  G     +NWL+  EGG WC ++  C  
Sbjct  22    SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M             F GILN    +NP +F NWN + +RYCDGSSFTGD
Sbjct  82    RKTNRLGSSKQM--------AKLIAFSGILNNREMFNP-DFYNWNRIKVRYCDGSSFTGD  132

Query  542   VE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE   PV  L+FRG RIFN + ++LL KG+KNA+   ++G SAG ++  LHCDRFR LLP
Sbjct  133   VEAVNPVTKLHFRGGRIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLP  192

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKP  886
                R KCL D GYFI     N K V G    E  F  VV+ H S   LPQ+CT ++   P
Sbjct  193   RGARVKCLSDAGYFI-----NGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTSRL--SP  245

Query  887   YLCMFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQ  1033
              LC FPQYL+  + TP+F + ++YD  QI NI            H   +  N    + + 
Sbjct  246   RLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLD  305

Query  1034  LATPIYEGLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVL  1198
             L       ++GFR + L A   L N  S G+FI++C+ H  TE+   +  + + ++    
Sbjct  306   L-------MQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTT  358

Query  1199  DSKAISDWYFYGKEVNLID  1255
              +KA++DW++  +  + ID
Sbjct  359   IAKAVADWFYERRPFHQID  377



>ref|XP_006573492.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=400

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 211/376 (56%), Gaps = 38/376 (10%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             ++A++ P+   + A A GAVCLDGSPPAYHF +G     +NWL+  EGG WC ++  C  
Sbjct  22    SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M     F G        ILN    +NP +F NWN + +RYCDGSSFTGD
Sbjct  82    RKTNRLGSSKQMAKQIAFSG--------ILNNRAMFNP-DFYNWNRIKVRYCDGSSFTGD  132

Query  542   VEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE   PV  L+FRG RIFN + ++LL KG+KNA+   ++G SAG ++  LHCDRFR LLP
Sbjct  133   VEAVNPVTKLHFRGARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLP  192

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLC  895
                R KCL D GYFI+ K    +Q    E  F  VV  H S   LPQ+CT ++  K  LC
Sbjct  193   RGARVKCLSDAGYFINAKDVLGEQ--HIEQYFSQVVVTHGSARSLPQSCTSRLSAK--LC  248

Query  896   MFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQLAT  1042
              FPQYL+  + TP+F + ++YD  QI NI            H   +  N    + + L  
Sbjct  249   FFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDL--  306

Query  1043  PIYEGLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSK  1207
                  ++GFR + L A   L N  S G+FI++C+ H  TE+   +  + + ++     +K
Sbjct  307   -----MQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAK  361

Query  1208  AISDWYFYGKEVNLID  1255
             A++DW++  +  + ID
Sbjct  362   AVADWFYERRPFHQID  377



>gb|KHN41756.1| Protein notum like [Glycine soja]
Length=449

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 211/376 (56%), Gaps = 38/376 (10%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             ++A++ P+   + A A GAVCLDGSPPAYHF +G     +NWL+  EGG WC ++  C  
Sbjct  22    SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M     F G        ILN    +NP +F NWN + +RYCDGSSFTGD
Sbjct  82    RKTNRLGSSKQMAKQIAFSG--------ILNNRAMFNP-DFYNWNRIKVRYCDGSSFTGD  132

Query  542   VEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE   PV  L+FRG RIFN + ++LL KG+KNA+   ++G SAG ++  LHCDRFR LLP
Sbjct  133   VEAVNPVTKLHFRGARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLP  192

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLC  895
                R KCL D GYFI+ K    +Q    E  F  VV  H S   LPQ+CT ++  K  LC
Sbjct  193   RGARVKCLSDAGYFINAKDVLGEQ--HIEQYFSQVVVTHGSARSLPQSCTSRLSAK--LC  248

Query  896   MFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQLAT  1042
              FPQYL+  + TP+F + ++YD  QI NI            H   +  N    + + L  
Sbjct  249   FFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDL--  306

Query  1043  PIYEGLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSK  1207
                  ++GFR + L A   L N  S G+FI++C+ H  TE+   +  + + ++     +K
Sbjct  307   -----MQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAK  361

Query  1208  AISDWYFYGKEVNLID  1255
             A++DW++  +  + ID
Sbjct  362   AVADWFYERRPFHQID  377



>ref|XP_006573491.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=447

 Score =   265 bits (678),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 211/376 (56%), Gaps = 38/376 (10%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             ++A++ P+   + A A GAVCLDGSPPAYHF +G     +NWL+  EGG WC ++  C  
Sbjct  22    SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M     F G        ILN    +NP +F NWN + +RYCDGSSFTGD
Sbjct  82    RKTNRLGSSKQMAKQIAFSG--------ILNNRAMFNP-DFYNWNRIKVRYCDGSSFTGD  132

Query  542   VE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE   PV  L+FRG RIFN + ++LL KG+KNA+   ++G SAG ++  LHCDRFR LLP
Sbjct  133   VEAVNPVTKLHFRGARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLP  192

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLC  895
                R KCL D GYFI+ K    +Q    E  F  VV  H S   LPQ+CT ++  K  LC
Sbjct  193   RGARVKCLSDAGYFINAKDVLGEQ--HIEQYFSQVVVTHGSARSLPQSCTSRLSAK--LC  248

Query  896   MFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQLAT  1042
              FPQYL+  + TP+F + ++YD  QI NI            H   +  N    + + L  
Sbjct  249   FFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDL--  306

Query  1043  PIYEGLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSK  1207
                  ++GFR + L A   L N  S G+FI++C+ H  TE+   +  + + ++     +K
Sbjct  307   -----MQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAK  361

Query  1208  AISDWYFYGKEVNLID  1255
             A++DW++  +  + ID
Sbjct  362   AVADWFYERRPFHQID  377



>ref|XP_006587656.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=450

 Score =   265 bits (678),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 154/379 (41%), Positives = 211/379 (56%), Gaps = 44/379 (12%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             ++A++ P+   + A A GAVCLDGSPPAYHF  G     +NWL+  EGG WC ++  C  
Sbjct  22    SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M             F GILN    +NP +F NWN + +RYCDGSSFTGD
Sbjct  82    RKTNRLGSSKQMA--------KLIAFSGILNNREMFNP-DFYNWNRIKVRYCDGSSFTGD  132

Query  542   VE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE   PV  L+FRG RIFN + ++LL KG+KNA+   ++G SAG ++  LHCDRFR LLP
Sbjct  133   VEAVNPVTKLHFRGGRIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLP  192

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKP  886
                R KCL D GYFI     N K V G    E  F  VV+ H S   LPQ+CT ++   P
Sbjct  193   RGARVKCLSDAGYFI-----NGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTSRL--SP  245

Query  887   YLCMFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQ  1033
              LC FPQYL+  + TP+F + ++YD  QI NI            H   +  N    + + 
Sbjct  246   RLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLD  305

Query  1034  LATPIYEGLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVL  1198
             L       ++GFR + L A   L N  S G+FI++C+ H  TE+   +  + + ++    
Sbjct  306   L-------MQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTT  358

Query  1199  DSKAISDWYFYGKEVNLID  1255
              +KA++DW++  +  + ID
Sbjct  359   IAKAVADWFYERRPFHQID  377



>gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Erythranthe guttata]
Length=390

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 148/368 (40%), Positives = 211/368 (57%), Gaps = 28/368 (8%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  +  + + + A A GAVCLDGSPPAYH   G     +NWL+ +EGG WC ++  C 
Sbjct  15    RTEGLYVNITYVQTAVAKGAVCLDGSPPAYHLDRGFGAGVNNWLVQIEGGGWCNNVTTCL  74

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+    F          IL+  P +NP +F NWN V IRYCDGSSFTG
Sbjct  75    ARKTNRLGSSKQMIKQLAFSA--------ILSDKPQFNP-DFYNWNRVKIRYCDGSSFTG  125

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +PV  LY+RG R+F  + +ELL KG+KNA+   L+G SAG ++  LHCD F+ LL
Sbjct  126   DVEAVDPVTKLYYRGARVFVAVMEELLAKGMKNAQNAVLSGCSAGGLASILHCDSFKALL  185

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KC  D GYFI+ K  +    +  E  F +VV+ H S   LP +CT KM  KP L
Sbjct  186   PVRTKVKCFSDAGYFINTK--DISAADHIEAYFNDVVTTHGSAKNLPISCTSKM--KPSL  241

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTI-----REHVQLATPIYEG  1057
             C FPQY+   ++TP+F++ ++YD  QI  ++    VA    I      +  + +T     
Sbjct  242   CFFPQYVSKEIRTPLFVINAAYDSWQIK-NILAPGVADPHGIWHDCKTDITKCSTDQLRT  300

Query  1058  LKGFRLQLLDAL-----PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAIS  1216
             ++GFRL+ L A+     P   + G FIN+C+ H  TE+   ++A  + ++NN   +KA+ 
Sbjct  301   MQGFRLEFLKAISSGLGPLINTRGYFINSCYAHCQTEMQENWFAIDSPKLNNKTIAKAVG  360

Query  1217  DWYFYGKE  1240
             DW++   E
Sbjct  361   DWFYDTSE  368



>dbj|BAJ97261.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00807.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 149/354 (42%), Positives = 208/354 (59%), Gaps = 27/354 (8%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             ++F + A A GAVCLDGSPP YHF  G+    DNW+++MEGG WC++ EEC +R    +G
Sbjct  31    MVFVKSAVAKGAVCLDGSPPVYHFSPGSGSGADNWVVHMEGGGWCKTPEECAVRKGNFRG  90

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVD-  559
             SSK+M             F GIL     YNP +F NWN V +RYCDGSSFTGDVEE VD 
Sbjct  91    SSKYM---------KPLSFSGILGGSQQYNP-DFYNWNRVKVRYCDGSSFTGDVEE-VDS  139

Query  560   --NLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL++RG R+++ I ++LLN+G+  AK   L+G SAG ++  LHCD+F  LLP +   K
Sbjct  140   STNLHYRGARVWDAIIEDLLNRGMSKAKNAILSGCSAGGLAAILHCDKFNDLLPPSASVK  199

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C+ D GYFI        +      +FKNVV+LH S   LP +CT +    P LC FPQ++
Sbjct  200   CVSDAGYFIDGTDITGNKF--VRTSFKNVVNLHGSVKNLPSSCTSRT--SPELCFFPQHV  255

Query  914   MDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQL---ATPIYEGLKGFRLQL  1081
             +  +KTP+FIL ++YD  QI NI +  +        +  + +   ++     L+ FR + 
Sbjct  256   LPTLKTPLFILNAAYDSWQIRNILVPSAADKKKEWAKCKLDIKGCSSSQLVTLQHFRDEF  315

Query  1082  LDALP---NKPSVGIFINNCFFHTEI-ATGYW-ANPNSQVNNVLDSKAISDWYF  1228
             L ALP     PSVG+FI++CF H +  A   W A+ +  +      KA+ DW+F
Sbjct  316   LSALPKPGQSPSVGMFIDSCFAHCQSGAQDSWNADGSPSLQKTKIGKAVGDWFF  369



>ref|XP_007158098.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
 gb|ESW30092.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
Length=400

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 148/379 (39%), Positives = 211/379 (56%), Gaps = 44/379 (12%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
              +A++ P+ + + A A GAVCLDGSPP YHF  G+    +NWL+  EGG WC ++  C  
Sbjct  22    AEASYVPITYLQNAVAKGAVCLDGSPPGYHFDRGSGTGINNWLVAFEGGGWCNNVTTCLS  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R   H GSSK M             F GI++  P +NP +F NWN + +RYCDGSSFTGD
Sbjct  82    RKTNHLGSSKQM--------AKQIAFSGIMSNRPMFNP-DFYNWNRIKVRYCDGSSFTGD  132

Query  542   VEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE   PV  L+FRG RIF  + ++LL KG+KNA+   ++G SAG ++  LHCDRF+ LLP
Sbjct  133   VEAVNPVTKLHFRGARIFAAVMEDLLAKGMKNARNAIISGCSAGGLTAVLHCDRFKALLP  192

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKP  886
                R KC+ D GYFI     N + V G    +  F  VV+ H S   LPQ+CT ++   P
Sbjct  193   REARVKCVSDAGYFI-----NARDVTGAYHIQQYFSQVVATHGSARNLPQSCTSRL--TP  245

Query  887   YLCMFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQ  1033
              LC FPQYL+  + TP+F + ++YD  QI NI            H   +  N    + + 
Sbjct  246   KLCFFPQYLVSHITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLD  305

Query  1034  LATPIYEGLKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVL  1198
             L       ++GFR + L AL    N    G+FI++C+ H  TE+   +  N + ++    
Sbjct  306   L-------MQGFRTEFLRALTVLGNSSYKGMFIDSCYAHCQTEMQETWLRNDSPELEKTT  358

Query  1199  DSKAISDWYFYGKEVNLID  1255
              +KA++DW++  +  + ID
Sbjct  359   IAKAVADWFYERRTFHQID  377



>ref|XP_003613922.1| Notum-like protein [Medicago truncatula]
 gb|AES96880.1| pectinacetylesterase family protein [Medicago truncatula]
Length=394

 Score =   263 bits (672),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 154/370 (42%), Positives = 213/370 (58%), Gaps = 30/370 (8%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
              +A+F P    + A A GAVCLDGSPPAY+F +G  +  ++WL++MEGG WC ++  C  
Sbjct  24    AEADFVPTTIVQNAVAKGAVCLDGSPPAYNFDKGYGKGSNSWLVHMEGGGWCHNVTNCLG  83

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M        +    F GILN    +NP +F NWN + IRYCDGSSFTGD
Sbjct  84    RMTTRLGSSKQM--------NKTLAFSGILNDKKQFNP-DFYNWNRIKIRYCDGSSFTGD  134

Query  542   VE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE  +PV  L+FRG RIF  + +ELL KG+K A+   L+G SAG ++  LHCDRFR LLP
Sbjct  135   VEAVDPVTKLHFRGARIFEAVMEELLAKGMKKAQNAILSGCSAGGLTSLLHCDRFRALLP  194

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKP  886
                  KC+ D GYFI     N K + G   FE  F  +V+LH S   LP +CT K+  KP
Sbjct  195   KGSNVKCISDAGYFI-----NAKDISGAPHFEEYFNQIVTLHGSVKNLPGSCTSKL--KP  247

Query  887   YLCMFPQYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQLATPI-YEGL  1060
              LC FPQ  +  + TP+F++ S  D +QI NI   ++    N   +  +   TP     +
Sbjct  248   ELCFFPQNFVSQITTPIFVVNSPIDSYQIKNILAPDADDWKN--CKLDITKCTPAQLNQV  305

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             +GFR + L AL    N  SVG FI++C+ H  TE+   +  N +  + N   +K+++DW+
Sbjct  306   QGFRKEFLRALAPIGNSSSVGTFIDSCYLHCQTELQEFWLFNGSPLLANTTIAKSVADWF  365

Query  1226  FYGKEVNLID  1255
             +  +  + ID
Sbjct  366   YDRRPFHQID  375



>gb|KHG09455.1| Protein notum [Gossypium arboreum]
Length=397

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 208/363 (57%), Gaps = 24/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G+    DNW+++MEGG WCE +  C  R     G
Sbjct  31    ITYLQDAVAKGAVCLDGSPPAYHFDKGSGTGVDNWIVHMEGGGWCEDVPTCLSRKNTDLG  90

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SSK M+    F G        +L+     NP +F NWN + +RYCDGSSFTGD  +  +N
Sbjct  91    SSKQMVKQFGFSG--------LLSGQQKSNP-DFYNWNRIKVRYCDGSSFTGDAVDRANN  141

Query  563   LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLM  742
             L+F+G  I+  I  +LL KG++NAK   L+G SAG ++  LHCDRFR LLP + + KC+ 
Sbjct  142   LFFKGNSIWEFIIADLLAKGMRNAKNAILSGCSAGGLASILHCDRFRALLPASTKVKCIS  201

Query  743   DGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMD  919
             D G+F+H +     K +E F   +  V  LH S   LP +CT +M  +P LC FPQY++ 
Sbjct  202   DAGFFLHAQDVSGGKHIEEF---YGKVARLHGSVKNLPASCTSRMGARPELCFFPQYVVQ  258

Query  920   GMKTPMFILMSSYDKHQINISMHESFVAANRTIRE-HVQLATPIYEGLK---GFRLQLLD  1087
              M+TP+F + S+YD  QI   +  S    ++  +   + L       LK    FR Q L 
Sbjct  259   TMQTPIFFVNSAYDSWQIKNILAPSAADKSKEWKSCKLDLKKCTETQLKIIQDFRTQFLS  318

Query  1088  ALP-----NKPSVGIFINNCFFHTEIATGY-WANPNSQ-VNNVLDSKAISDWYFYGKEVN  1246
             AL      N PS G+FI++C+ H ++     W++ +S  V+N+  +KA+ DWY+    + 
Sbjct  319   ALNRAGVINSPSKGMFIDSCYAHCQVGKQIQWSSDSSPVVSNMKIAKAVGDWYYERSPIK  378

Query  1247  LID  1255
              +D
Sbjct  379   KLD  381



>ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
 gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 gb|KDO40407.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
 gb|KDO40408.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=386

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/376 (42%), Positives = 215/376 (57%), Gaps = 43/376 (11%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A A GAVCLDGSPPAYHF +G     +NWL++++GGAWC ++E+C  R     G
Sbjct  25    ITYVENAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNNVEDCSKRRDSSYG  84

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSKHM+    F G        IL+ +  +NP +F +WN V +RYCDG+SFTGDVE   P 
Sbjct  85    SSKHMVKEANFTG--------ILSNEQKFNP-DFYDWNRVRVRYCDGASFTGDVEAVNPE  135

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  + ++LL KG+KNA+   LTG SAG ++  LHCD FR L P   R KC
Sbjct  136   TNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKC  195

Query  737   LMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
               D GYF+     N K V G    E  +K VV+LH S   LP +CT ++   P LC FP+
Sbjct  196   FADAGYFV-----NAKDVSGESHIEEFYKQVVALHGSAKHLPASCTSRL--SPGLCFFPE  248

Query  908   YLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQLAT---PIYEGLKGFRL  1075
              +   +KTP+FI+ S+YD  QI NI + E            V + T      + ++GFR+
Sbjct  249   NVAGQIKTPLFIINSAYDSWQISNILVPEDADPKGAWSSCKVDIKTCSSTQLQTMQGFRV  308

Query  1076  QLLDALP---NKPSVGIFINNCFFHTEIATGYWANPNSQVNNVLD----SKAISDWYFYG  1234
             Q L+AL    N  S G+F+++C+ H    T Y     S  + VLD    +KA+ DWY+  
Sbjct  309   QFLNALAGLGNSSSRGMFVDSCYTHCR--TDYQETWFSADSPVLDKTPIAKAVGDWYY--  364

Query  1235  KEVNLIDKSEFIK-DC  1279
                   D+S F K DC
Sbjct  365   ------DRSPFQKIDC  374



>gb|AFK37852.1| unknown [Lotus japonicus]
Length=399

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 148/374 (40%), Positives = 214/374 (57%), Gaps = 28/374 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+    PLI  EKA + GAVCLDG+PPAYHF EG+ E  +NW++++EGG WC ++ +C 
Sbjct  21    KTEGGIVPLIRLEKAVSKGAVCLDGTPPAYHFDEGSGEGVNNWIVFLEGGGWCNNVTDCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
             LR    +GSS  M             F G L+ +  +NP +F NWN +++RYCDG+SFTG
Sbjct  81    LRKDTRRGSSDQMT--------EPRFFNGFLSENQKFNP-DFYNWNRILVRYCDGASFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVEE  P  NL+FRG R+F  + +ELL KG++NA+   L+G SAG ++  L CD F+ LL
Sbjct  132   DVEEVDPATNLHFRGARVFVAVIEELLAKGMQNAENAILSGCSAGGLATILQCDHFKSLL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KC+ D GYFI+VK  +  Q    E  +  VV+ H S   LP +CT +    P L
Sbjct  192   PAEAKVKCVPDAGYFINVKDTSGTQY--IEEYYNEVVATHGSAKNLPPSCTSRR--SPGL  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQL-----ATPIYE  1054
             C FPQY+   + TP+F + ++YD  QI NI    S  A    I  + +L     +     
Sbjct  248   CFFPQYVASEISTPIFYVNAAYDTWQIHNIFARGS--ADPHGIWHNCKLDINNCSPDQLT  305

Query  1055  GLKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISD  1219
              ++GFR + + AL    N  S G+FI++C+ H  TE    + ++ + Q+ N    KA+ D
Sbjct  306   AIQGFRTEFIKALSVTENSRSEGMFIDSCYVHCQTETQESWLSSDSPQLANTKLGKAVGD  365

Query  1220  WYFYGKEVNLIDKS  1261
             W++       ID S
Sbjct  366   WFYERSPFQKIDCS  379



>ref|XP_008451861.1| PREDICTED: protein notum homolog isoform X2 [Cucumis melo]
Length=398

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 211/363 (58%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A   GAVCLDGSPPAYHF +G     +NWLI +EGG WC ++  C  R     G
Sbjct  29    ITYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNNVTTCLQRRDTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+    F G        IL+  P +NP +F NWN + +RYCDGSSFTGDVE  +P 
Sbjct  89    SSKKMVTQLAFSG--------ILSNKPQFNP-DFYNWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  I D LL KG+KNAK   L+G SAG +S  LHCD F+ LLP T + KC
Sbjct  140   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  199

Query  737   LMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K  +  Q +EGF   + +VV+ H S   LP +CT KM  KP +C FPQ +
Sbjct  200   LSDAGYFINAKDVSGAQHIEGF---YSDVVTTHGSAKNLPISCTSKM--KPEMCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATPI-YEGLKGFRLQL  1081
             +  ++TP+F++ ++YD  QI   +       + T  E    ++  +PI    ++ FR+Q 
Sbjct  255   VQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQF  314

Query  1082  LDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             L AL    +  S G+FI++C+ H  TE+   +  + +  ++    +KA+ DW+F      
Sbjct  315   LSALTGVGSSLSRGLFIDSCYAHCQTEMQETWLRSDSPMLSKTPIAKAVGDWFFDRAPFQ  374

Query  1247  LID  1255
              ID
Sbjct  375   KID  377



>ref|XP_008451860.1| PREDICTED: protein notum homolog isoform X1 [Cucumis melo]
Length=401

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 211/363 (58%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A   GAVCLDGSPPAYHF +G     +NWLI +EGG WC ++  C  R     G
Sbjct  32    ITYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNNVTTCLQRRDTRLG  91

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+    F G        IL+  P +NP +F NWN + +RYCDGSSFTGDVE  +P 
Sbjct  92    SSKKMVTQLAFSG--------ILSNKPQFNP-DFYNWNRIKVRYCDGSSFTGDVEAVDPA  142

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  I D LL KG+KNAK   L+G SAG +S  LHCD F+ LLP T + KC
Sbjct  143   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  202

Query  737   LMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K  +  Q +EGF   + +VV+ H S   LP +CT KM  KP +C FPQ +
Sbjct  203   LSDAGYFINAKDVSGAQHIEGF---YSDVVTTHGSAKNLPISCTSKM--KPEMCFFPQNV  257

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATPI-YEGLKGFRLQL  1081
             +  ++TP+F++ ++YD  QI   +       + T  E    ++  +PI    ++ FR+Q 
Sbjct  258   VQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQF  317

Query  1082  LDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             L AL    +  S G+FI++C+ H  TE+   +  + +  ++    +KA+ DW+F      
Sbjct  318   LSALTGVGSSLSRGLFIDSCYAHCQTEMQETWLRSDSPMLSKTPIAKAVGDWFFDRAPFQ  377

Query  1247  LID  1255
              ID
Sbjct  378   KID  380



>ref|XP_002867940.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44199.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T   K
Sbjct  136   ANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTASVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C+ D GYFIH K          E  +  VV+LH S   LP +CT KM  KP LC FPQY+
Sbjct  196   CVSDAGYFIHGKDITGGSY--IESYYSKVVALHGSAKSLPVSCTSKM--KPELCFFPQYV  251

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQL  1081
             +  M+TP+F++ +++D  QI   +  + V   +  +    +  + +    + ++GFR Q+
Sbjct  252   VPSMRTPLFVINAAFDSWQIKNVLAPTAVDKGKQWKNCKLDLKKCSAAQLKTVQGFRDQM  311

Query  1082  LDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGKEV  1243
             + AL    + PS G+F+++C  H +   A  +  +   QV N   +KA+ +W FYG+  
Sbjct  312   MRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTRIAKAVGNW-FYGRSA  369



>ref|XP_008808370.1| PREDICTED: uncharacterized protein LOC103720446 isoform X3 [Phoenix 
dactylifera]
Length=401

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 148/355 (42%), Positives = 204/355 (57%), Gaps = 27/355 (8%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + A A GAVCLDGSPPAYHF  G     +NWL++MEGG WC ++EECK RT   +
Sbjct  33    PLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCRNVEECKERTKNFR  92

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK+M             F GIL +    NP +F NWN V IRYCDGSSFTGD+E   P
Sbjct  93    GSSKYM---------KQLSFSGILGKKQNLNP-DFYNWNKVKIRYCDGSSFTGDIEAVNP  142

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG R++  I D+LL K +  A+   L+G SAG ++  LHCD FR L+P   R K
Sbjct  143   ATNLHFRGARVWRAIIDDLLAKRMNKAQNALLSGCSAGGLASILHCDSFRDLVPAGARVK  202

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C  D GYFI+ K  + K  E  +  +  V + H S   LP +CT +    P +C FPQY+
Sbjct  203   CFSDAGYFINGKDVSGK--ESIKDFYNQVATTHGSAKNLPSSCTSRF--PPSMCFFPQYV  258

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYEGLKGFRLQ  1078
             +  M+TP+FIL ++YD  QI   +  S  +  R +    +L     ++   + ++GFR Q
Sbjct  259   VQSMRTPLFILNAAYDAWQIKNILAPS-PSDPRKVWGECKLDIKKCSSNQLQVMQGFRTQ  317

Query  1079  LLDALP---NKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYF  1228
              L+AL    +  S G+FIN+C+ H +      W + NS V   +  +KA+ DW++
Sbjct  318   FLNALAGFGSSSSTGMFINSCYAHCQSEMQETWLSSNSPVLEKIPIAKAVGDWFY  372



>ref|XP_004509558.1| PREDICTED: protein notum homolog [Cicer arietinum]
Length=397

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 147/372 (40%), Positives = 212/372 (57%), Gaps = 24/372 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
               + NF P+   E A + GAVCLDGSPP +HF EG  +  +NW++++EGG WC ++++C 
Sbjct  19    HAEGNFVPMTRLENAVSKGAVCLDGSPPTFHFDEGHGDGVNNWIVHIEGGGWCHNVQDCL  78

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSS HM             F G L+ +  +NP +F NWN V +RYCDGSSFTG
Sbjct  79    GRKNSRLGSSDHM--------KEKSYFSGYLSNNQQFNP-DFYNWNRVKVRYCDGSSFTG  129

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVEE  P   L+FRG RIF+ + +ELL +G+ +AK   L+G SAG ++  LHCD F+ LL
Sbjct  130   DVEEVDPTTKLHFRGARIFSAVMEELLARGMVHAKNAILSGCSAGGLTSILHCDGFKALL  189

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             PN  R KC+ D GYF++VK  + +Q    E  F+ VV  H S   LP +CT  +   P L
Sbjct  190   PNGARVKCVSDAGYFVNVKDISGEQF--IEEYFRQVVETHGSAKNLPTSCTSTL--SPGL  245

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHVQLATPIYEG-L  1060
             C FPQY+  G+KTP+FI+ ++YD  QI   +       N   R+ + ++   +P     +
Sbjct  246   CFFPQYMASGIKTPIFIVNAAYDSWQIKNILAPGAADPNGQWRSCKTNLINCSPKQLNIM  305

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + +R Q L AL    N  S G+FI++C+ H  TE    +  + +  V N   + A++DW+
Sbjct  306   QDYRSQFLKALSVVGNSSSNGMFIDSCYIHCQTEPQETWLQSDSPTVANKTIAGAVADWF  365

Query  1226  FYGKEVNLIDKS  1261
             +       ID S
Sbjct  366   YERSASREIDCS  377



>ref|XP_010536189.1| PREDICTED: uncharacterized protein LOC104811235 isoform X1 [Tarenaya 
hassleriana]
Length=391

 Score =   261 bits (666),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 150/381 (39%), Positives = 214/381 (56%), Gaps = 39/381 (10%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ +   A A GAVCLDGSPPAYHF +G     +NW+++MEGG WC  I  C  R 
Sbjct  21    AGAVPITYLNSAVARGAVCLDGSPPAYHFDKGFGSGVNNWIVHMEGGGWCNDIASCSERK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGDVE
Sbjct  81    NTMKGSSKLMNKDFGFSG--------ILGSQQSTNP-DFYNWNRIKVRYCDGSSFTGDVE  131

Query  548   E--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
                P + L+FRG R++  + D+L+ KG+  A+   L+G SAGA++  LHCD+F  +LP T
Sbjct  132   AVNPSNKLFFRGARVWRAVIDDLMAKGMNKAQNAILSGCSAGALAAILHCDQFHAILPRT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D GYFIH      K + G    E  +  VV+LH S   LP +CT +M  KP L
Sbjct  192   AKVKCVSDAGYFIH-----GKDITGGSYIESYYSKVVALHGSAKTLPVSCTSRM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATPI-YEGL  1060
             C FPQY++  M+TP+F++ +++D  QI   +  S V   +  ++    ++  TP     +
Sbjct  245   CFFPQYVVPSMRTPLFVVNAAFDSWQIKNVLAPSAVDKRKEWKDCKLDLKKCTPAQLRTV  304

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +GFR Q+L AL    +  S G+F+++C  H +   A  +  +    V N   +KA+ DW+
Sbjct  305   QGFRDQILRALAPVHSTTSRGLFLDSCHAHCQGGSAASWSGSKGPSVGNTKIAKAVGDWF  364

Query  1226  FYGKEVNLIDKSEFIK-DCYT  1285
             +        D+S F K DC T
Sbjct  365   Y--------DRSPFQKTDCPT  377



>gb|EYU37453.1| hypothetical protein MIMGU_mgv1a007583mg [Erythranthe guttata]
Length=403

 Score =   261 bits (667),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 210/369 (57%), Gaps = 29/369 (8%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
               A   GAVCLDGSP  YH+ +G  +  ++W+IY+ GG WC   + C  R        K+
Sbjct  42    SNAVEKGAVCLDGSPAGYHYAKGYGDGANSWMIYLPGGGWCGRKQSCIDRV-------KY  94

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
               M           F  IL+ +   NP +F NWN V IRYCDGSSF GDV+  +P  NL+
Sbjct  95    SPMLSSTKNITQENFGAILSPNKTSNP-DFYNWNRVFIRYCDGSSFMGDVKKVDPETNLH  153

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
              RG RIF  + DELL+KGLK+AK V LTG SAG ++  L+CDRFR L+PN    KC+ D 
Sbjct  154   KRGSRIFTSVIDELLSKGLKDAKNVMLTGNSAGGLATILNCDRFRALVPNANMVKCVSDS  213

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             G+FIH K  N     G E TF  VV  H  +  LP++CT +M  KP LC FP+ L+  +K
Sbjct  214   GFFIHAK--NLPNAAGRERTFSRVVHFHGISKFLPKSCTSRM--KPGLCFFPENLVAHIK  269

Query  929   TPMFILMSSYDKHQINISM------HESFVAANRTIREHVQLATPIYEGLKGFR---LQL  1081
             TP+F+L S +DK QI +++      +  +V   R I        P  + +K FR   L+ 
Sbjct  270   TPLFLLNSDFDKFQIQVNLKPHPVDNPGWVNCTRNI---TTCTPPQLQIIKDFRNTFLET  326

Query  1082  LDALPNKPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWYFYGKEVNLID  1255
             L  + N PS G+FIN+C+ H  +   G + +P+S +++N   ++AI DWYF    V LID
Sbjct  327   LKGVGNNPSRGLFINSCYIHDFLYLMGRYNSPDSPKLHNKTIAQAIGDWYFNRSSVRLID  386

Query  1256  -KSEFIKDC  1279
              K ++  DC
Sbjct  387   TKIDYPLDC  395



>ref|NP_567585.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AAK96722.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAL47339.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAM64921.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 dbj|BAF00825.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AEE84177.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   260 bits (665),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 207/359 (58%), Gaps = 25/359 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T   K
Sbjct  136   ANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTASVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C+ D GYFIH K          +  +  VV+LH S   LP +CT KM  KP LC FPQY+
Sbjct  196   CVSDAGYFIHGKDITGGSY--IQSYYSKVVALHGSAKSLPVSCTSKM--KPELCFFPQYV  251

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQL  1081
             +  M+TP+F++ +++D  QI   +  + V   +  +    +  + +    + ++GFR Q+
Sbjct  252   VPSMRTPLFVINAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKCSAAQLKTVQGFRDQM  311

Query  1082  LDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGKEV  1243
             + AL    + PS G+F+++C  H +   A  +  +   QV N   +KA+ +W FYG+  
Sbjct  312   MRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTRIAKAVGNW-FYGRSA  369



>ref|XP_011082153.1| PREDICTED: protein notum homolog [Sesamum indicum]
Length=395

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 152/373 (41%), Positives = 211/373 (57%), Gaps = 29/373 (8%)
 Frame = +2

Query  179   QTKANFYPLI---FPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIE  349
             Q   +F P I   F + A + GAVCLDGSP  YH+ +G     DNWL+Y+ GGAWC S  
Sbjct  26    QVHCHFNPRINVTFLDNAVSTGAVCLDGSPAGYHYEKGYGTGADNWLVYLPGGAWCGSKG  85

Query  350   ECKLRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSS  529
             +C  RT           +           F GIL+ D   NP +  NW+   IRYCDG+S
Sbjct  86    DCLART---------KTIGGTTVNVTTTWFGGILSADSLVNP-DLYNWHRTFIRYCDGAS  135

Query  530   FTGDVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFR  703
             F  DVE  +P  NL+ RG RIF  + D LL KG+KNAK + L G SAG ++  L+CDRFR
Sbjct  136   FMADVEAVDPETNLHLRGARIFRAVVDVLLAKGMKNAKNIILAGNSAGGLATILNCDRFR  195

Query  704   KLLPNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDK  883
              L+PN  R KCL D G+FI  +  N   VE  E  F +VV+ H+ T  LP++CT +M   
Sbjct  196   ALVPNASRVKCLSDSGFFIRAQ--NLPGVEKREKGFADVVAFHDITKFLPKSCTSRM--D  251

Query  884   PYLCMFPQYLMDGMKTPMFILMSSYDKHQI--NISMHESFVAANRTIREHVQLATPI-YE  1054
             P LCMFP+YL+  ++TP+F+L S++D++QI  N+  + +     +    + +L TP   +
Sbjct  252   PSLCMFPEYLVGDVQTPLFLLHSAFDQYQIQYNLKPYPAIEQGWKECTSNTRLCTPAQID  311

Query  1055  GLKGFR---LQLLDALPNKPSVGIFINNCFFHTEI---ATGYWANPNSQVNNVLDSKAIS  1216
              +K FR   LQ L A+P+ PS G+FIN+C+ H  +   A   +  P S  N +++ + I 
Sbjct  312   FMKEFRTTFLQTLKAIPDCPSRGMFINSCYIHDFLFSRARWNYQGPPSLGNKIIE-RVIG  370

Query  1217  DWYFYGKEVNLID  1255
             DWYF       ID
Sbjct  371   DWYFERCSAKAID  383



>ref|XP_009590663.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=401

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/370 (41%), Positives = 209/370 (56%), Gaps = 33/370 (9%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A F      + A + GAVCLDGSPPAYH   G      NW+I + GGAWC +I +C  R+
Sbjct  39    AYFVDTTIVQNALSKGAVCLDGSPPAYHLDRGFGHGVRNWIILLSGGAWCRNITDCLNRS  98

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                 GSSKHM           F F GI ++  + NP +F NWN V +RYCDG  FTGD+E
Sbjct  99    KTDLGSSKHMT---------PFIFLGIFSKSKSENP-DFYNWNKVFVRYCDGGGFTGDIE  148

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P  NL+FRG RIF+ + ++LL KGLK+AK   L+GGSA      L+CDRF  LL   
Sbjct  149   SIDPATNLHFRGARIFDAVIEDLLAKGLKDAKNAILSGGSANGYPAVLYCDRFHNLLHKA  208

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMF  901
              R KCL+D GYFIHVK  NP+    FE  F++VV+LH ST +LP++CT KM  KP LC F
Sbjct  209   HRVKCLVDAGYFIHVK--NPRLANVFESLFRDVVTLHGSTKVLPKSCTSKM--KPELCFF  264

Query  902   PQYLMDGMKTPMFILMSSYDKHQIN----ISMHESFVAANRTIREHVQLATPIYEGLKGF  1069
             P+ +   +KTP F +MS++D +Q++      + +   A N T  ++           K  
Sbjct  265   PENIQQDIKTPFFTVMSAFDSYQVDNIIGSDIGDCIRARNCTESQN--------NDFKEL  316

Query  1070  RLQLLDAL--PNKP-SVGIFINNCFFHTEIATGYWANPNSQ-VNNVLDSKAISDWYFYGK  1237
             R + L AL  PN P   G FI++   HT++   +W   N+  +NN+   +   DWY+  K
Sbjct  317   RSEFLSALPKPNDPKQRGAFIDSFNRHTQLEL-WWNKVNATPINNLTTIEVFGDWYYDRK  375

Query  1238  EVNLIDKSEF  1267
                +ID  + 
Sbjct  376   YSYVIDDHDL  385



>ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
 gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
Length=398

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 144/374 (39%), Positives = 214/374 (57%), Gaps = 33/374 (9%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + +   A A GAVCLDGSPPAYH  +G+    +NWL+++EGG WC ++  C  R   
Sbjct  25    FVDITYVTTAVAKGAVCLDGSPPAYHLDKGSGSGINNWLVHVEGGGWCSNVTTCFSRKNT  84

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE-  550
               GSS  M+    F G        +L    + NP +F NWN V +RYCDG+SFTGDVEE 
Sbjct  85    RLGSSNQMVKQLAFSG--------LLGNKASMNP-DFYNWNRVKVRYCDGASFTGDVEEV  135

Query  551   -PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
              P   L+FRG RI+  + ++LL KG++NA+   L+G SAG ++  LHCD FR LLP   +
Sbjct  136   DPATKLHFRGGRIWLAVIEDLLAKGMRNAENAILSGCSAGGLTSILHCDSFRALLPIGAK  195

Query  728   FKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
              KC+ D GYFI+ K  +  Q +  +  F +VV+LH+S   LPQ+CT ++  KP LC FPQ
Sbjct  196   VKCVADAGYFINAK--DVSQADHIQSFFDDVVTLHDSAKNLPQSCTSRL--KPSLCFFPQ  251

Query  908   YLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRL  1075
             Y+  G++TP F+L ++YD  Q+  ++       + T      +  +      + L+ FRL
Sbjct  252   YMAQGIRTPFFLLNAAYDSWQVKNTLAPGVADPHGTWHNCKLDIKKCTASQLQTLQDFRL  311

Query  1076  QLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKE  1240
             + L AL    + PS+G+FIN+C+ H  +E+   +  + +  +     +KA+ DW++    
Sbjct  312   EFLSALKGVGSSPSIGMFINSCYAHCQSEVQETWLRDDSPVLGGTSIAKAVGDWFY----  367

Query  1241  VNLIDKSEFIK-DC  1279
                 D+S F K DC
Sbjct  368   ----DRSPFQKIDC  377



>ref|XP_010439720.1| PREDICTED: uncharacterized protein LOC104723107 [Camelina sativa]
Length=391

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/362 (40%), Positives = 209/362 (58%), Gaps = 31/362 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTG+V    P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGNVAAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T R K
Sbjct  136   ANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D GYFIH      K + G    +  +  VV+LH S   LP +CT KM  KP LC FP
Sbjct  196   CVSDAGYFIH-----GKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR  1072
             QY++  M+TP+F++ +++D  QI   +  + V  ++  +    +  + +    + ++GFR
Sbjct  249   QYVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTVQGFR  308

Query  1073  LQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
              Q++ AL    + PS G+F+++C  H +   A  +      QV N   SKA+ +W FYG+
Sbjct  309   DQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRISKAVGNW-FYGR  367

Query  1238  EV  1243
               
Sbjct  368   SA  369



>ref|XP_006587655.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=453

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/375 (40%), Positives = 211/375 (56%), Gaps = 33/375 (9%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             ++A++ P+   + A A GAVCLDGSPPAYHF  G     +NWL+  EGG WC ++  C  
Sbjct  22    SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGINNWLVAFEGGGWCNNVTTCLA  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M             F GILN    +NP +F NWN + +RYCDGSSFTGD
Sbjct  82    RKTNRLGSSKQM--------AKLIAFSGILNNREMFNP-DFYNWNRIKVRYCDGSSFTGD  132

Query  542   VE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQV---FLTGGSAGAVSVALHCDRFRK  706
             VE   PV  L+FRG RIFN + ++LL KG+KNA+ V    ++G SAG ++  LHCDRFR 
Sbjct  133   VEAVNPVTKLHFRGGRIFNAVMEDLLAKGMKNARNVREAIISGCSAGGLTSVLHCDRFRA  192

Query  707   LLPNTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMK  877
             LLP   R KCL D GYFI     N K V G    E  F  VV+ H S   LPQ+CT ++ 
Sbjct  193   LLPRGARVKCLSDAGYFI-----NGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTSRL-  246

Query  878   DKPYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHVQLATP-  1045
               P LC FPQYL+  + TP+F + ++YD  QI   +            + +  +   +P 
Sbjct  247   -SPRLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPD  305

Query  1046  IYEGLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKA  1210
               + ++GFR + L A   L N  S G+FI++C+ H  TE+   +  + + ++     +KA
Sbjct  306   QLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKTTIAKA  365

Query  1211  ISDWYFYGKEVNLID  1255
             ++DW++  +  + ID
Sbjct  366   VADWFYERRPFHQID  380



>ref|XP_009784099.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/350 (42%), Positives = 208/350 (59%), Gaps = 29/350 (8%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A + GAVCLDGSP AYH+ +G+ +  +NW++++EGG WC S+E+C  R     GSS H
Sbjct  38    QDAFSKGAVCLDGSPAAYHYDQGSGDGVNNWIVWLEGGGWCRSVEDCGQRFNYSNGSSNH  97

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             +             FYG+L+     NP +F NW+ ++IRYCDGSS+TGDVE  + V N +
Sbjct  98    I---------DSKSFYGLLSNSKTSNP-DFYNWHRIMIRYCDGSSYTGDVELVDKVTNQH  147

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             +RG RIF  I DELL KG+KNA    L+G SAG +    HCDRFR LLP+T R KCL DG
Sbjct  148   YRGARIFQAIMDELLAKGMKNATNAILSGCSAGGLGTMFHCDRFRSLLPSTARVKCLSDG  207

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
              YF+    ++ K+V   E T+  VV+LHNS  +LP +CT +M   P  C FPQ++ + +K
Sbjct  208   AYFL--LDNDFKRVNILESTYDGVVNLHNSAKVLPPSCTSRM--NPASCFFPQHIQEDIK  263

Query  929   TPMFILMSSYDKHQINISM-----HESFVAANRTIREHVQLATPIYEG-LKGFRLQLLDA  1090
             TP+FIL S+YD  QI  ++      + F       ++++   +P  +  L+GF  + L A
Sbjct  264   TPLFILNSAYDSWQIVDTVIPFADRQDFA---ENCKKNLSKCSPHQQKLLQGFGAEFLSA  320

Query  1091  LPNKPS---VGIFINNCFFHTEIATGYWANPNSQ-VNNVLDSKAISDWYF  1228
             LP   S    G++IN+C  H +    +  N NS  +NN   +K   DW+F
Sbjct  321   LPKSYSPSQRGMYINSCLMHCQTDHDWSWNSNSDLLNNKTIAKVFGDWFF  370



>ref|XP_004300392.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=394

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/371 (40%), Positives = 210/371 (57%), Gaps = 28/371 (8%)
 Frame = +2

Query  185   KANFYP--LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             KA  +P  L   + A A GAVCLDGSPPAYHF +G     +NWL+++EGG WC+ +E C 
Sbjct  21    KAESHPVELTLVQSAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCKDVESCV  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              RT   +GSSKHM        +    F G+L +    NP +F NWN + +RYCDGSSFTG
Sbjct  81    ERTKNFRGSSKHM--------EKTISFSGVLGKKETLNP-DFYNWNRIKVRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE   P  NL+FRG R+F  + D+LL KG+ NAK   L+G SAG ++  L CD FR LL
Sbjct  132   DVEAVNPATNLHFRGGRVFLAVIDDLLAKGMMNAKNALLSGCSAGGLASILQCDNFRSLL  191

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P     KCL D GYFI+ K     +Q+E F   +  VV+LH S   LP +CT ++   P 
Sbjct  192   PAGTNVKCLADAGYFINAKSISGSQQIEAF---YSQVVALHGSAKHLPASCTSRL--NPG  246

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEG  1057
             LC FPQ ++  ++TP+F++ ++YD  QI   +  S      + ++ +  ++  +P   + 
Sbjct  247   LCFFPQNVVPTLRTPIFLVNAAYDSWQIKNILAPSAADPKGSWKSCKMGIKNCSPAQIQT  306

Query  1058  LKGFRLQLLDALP---NKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDW  1222
             ++ +R   L+ L      PS G FI++C+ H +I T   + A  +  V     +KA+ DW
Sbjct  307   MQDYRTTFLNVLNGGLTSPSHGAFIDSCYAHCQIGTQETWLAADSPVVGKTTIAKAVGDW  366

Query  1223  YFYGKEVNLID  1255
             Y+       ID
Sbjct  367   YYNRSPSKKID  377



>ref|XP_004512351.1| PREDICTED: protein notum homolog isoform X3 [Cicer arietinum]
Length=448

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/371 (39%), Positives = 210/371 (57%), Gaps = 26/371 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + +A + P+ +   A   GAVCLDGSPPAYHF +G     ++WL+  EGG WC +I  C 
Sbjct  23    KAEAAYVPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNNITTCL  82

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R +   GSSK M             F GILN    +NP +F NWN + +RYCDGSSFTG
Sbjct  83    GRKMNRLGSSKQM--------AKQIAFSGILNNRRLFNP-DFYNWNRIKVRYCDGSSFTG  133

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE   PV  L+FRG R+FN + +ELL KG+KNAK   ++G SAG ++  LHCDRFR LL
Sbjct  134   DVEIVNPVTKLHFRGARVFNAVMEELLAKGMKNAKNAIISGCSAGGLTSILHCDRFRALL  193

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P   + KCL D GYFI+ +  +  Q +E F   F  VV+ H S   LP++CT ++   P 
Sbjct  194   PQGAKVKCLSDAGYFINARDVSGTQHIEQF---FSQVVTTHGSANNLPRSCTSRL--NPK  248

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISM-------HESFVAANRTIREHVQLATPI  1048
             LC FPQY++  + TP+F + ++YD  QI   +       H  + +    I         +
Sbjct  249   LCFFPQYVVSQITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSNQLDL  308

Query  1049  YEGLKGFRLQLLDALPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
              +G +   L+ L  L N PS G+FI++C+ H  TE+   ++ + +  +     +KA++DW
Sbjct  309   MQGFRTEFLRALTVLGNSPSKGMFIDSCYAHCQTEMQETWFRSDSPLLAKTTIAKAVADW  368

Query  1223  YFYGKEVNLID  1255
             ++  +  + ID
Sbjct  369   FYERRLFHQID  379



>emb|CDX99378.1| BnaC01g11740D [Brassica napus]
Length=391

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/362 (40%), Positives = 207/362 (57%), Gaps = 31/362 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIKRKGTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL      NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQNTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T R K
Sbjct  136   ANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D GYFIH      K + G    +  +  VV+LH S   LP +CT KM  KP LC FP
Sbjct  196   CVSDAGYFIH-----GKDISGGSYIQSYYSKVVALHGSAKSLPVSCTSKM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR  1072
             QY++  M+TP+F++ +++D  QI   +  + V   +       +  + +    + ++GFR
Sbjct  249   QYVVPSMRTPLFVINAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKCSAAQLKTVQGFR  308

Query  1073  LQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
              Q++ AL    + PS G+F+++C  H +   A  +      QV N   SKA+ +W FYG+
Sbjct  309   DQMMRALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKISKAVGNW-FYGR  367

Query  1238  EV  1243
               
Sbjct  368   SA  369



>gb|KHN27511.1| Protein notum like [Glycine soja]
Length=398

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/358 (42%), Positives = 212/358 (59%), Gaps = 26/358 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + ++  GAVCLDGSPPAYHF +G  +  +NW++++EGG WC ++  C  R     
Sbjct  28    PLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNNVTSCLDRKNTTL  87

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSS HM          D  FY IL+    +NP +F NWN V +RYCDGSSFTGDVEE  P
Sbjct  88    GSSNHM---------SDISFYAILSNQQQFNP-DFYNWNRVKVRYCDGSSFTGDVEEVDP  137

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG RIF+ + +ELL KG+KNAK   L+G SAG ++  LHCD F+ LLP+    K
Sbjct  138   TTNLHFRGARIFSAVMEELLAKGMKNAKNAILSGCSAGGLTTILHCDSFKALLPSRANVK  197

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C+ D GYF++V  ++      F+  +  VVS+H S   LP +CT K+   P LC FPQY+
Sbjct  198   CVPDAGYFVNV--EDISGAHSFQEFYSEVVSIHGSAKNLPTSCTSKL--NPALCFFPQYV  253

Query  914   MDGMKTPMFILMSSYDKHQI-NISMHESFVAAN--RTIREHVQLATP-IYEGLKGFRLQL  1081
                + TP+F++ S+YD  QI NI +  S   +N   + + ++   +P     L+GF+ + 
Sbjct  254   ASHISTPIFVVNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEF  313

Query  1082  LDALP---NKPSVGIFINNCFFHTEIATG-YWANPNSQ-VNNVLDSKAISDWYFYGKE  1240
               AL    + PS G+FI++C+ H +  T   W    SQ + N   +KA+ DW FYG+ 
Sbjct  314   QRALSEVGDSPSKGMFIDSCYAHCQTETQETWFKSGSQLLANKTIAKAVGDW-FYGRS  370



>ref|XP_009128780.1| PREDICTED: uncharacterized protein LOC103853624 [Brassica rapa]
Length=391

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 210/370 (57%), Gaps = 30/370 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    AGAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E
Sbjct  81    TTMKGSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIE  131

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P + L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD+F+ +LP T
Sbjct  132   AVDPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPTT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D G+FIH      K + G    E  +  VVS H S   LP +CT  M  KP L
Sbjct  192   AKVKCVSDAGFFIH-----GKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGL  1060
             C FPQY++  M+TP+F++ +++D  QI   +  + V   +  ++      +      + +
Sbjct  245   CFFPQYVVKTMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTV  304

Query  1061  KGFRLQLLDAL-PNKPSV--GIFINNCFFHTEIATGY-WANPNS-QVNNVLDSKAISDWY  1225
             +G+R Q+L AL P + +   G+F+++C  H +  +   W+     QV N   +KA+ DW+
Sbjct  305   QGYRDQMLAALAPVQATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTKMAKAVGDWF  364

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  365   YERSTFQNID  374



>ref|XP_009132784.1| PREDICTED: uncharacterized protein LOC103857370 [Brassica rapa]
Length=391

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/362 (40%), Positives = 206/362 (57%), Gaps = 31/362 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIKRKGTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL      NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQNTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T R K
Sbjct  136   ANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D GYFIH      K + G    +  +  VV+LH S   LP +CT KM  KP LC FP
Sbjct  196   CVSDAGYFIH-----GKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR  1072
             QY++  M+TP+F++ +++D  QI   +  + V   +       +  + +      ++GFR
Sbjct  249   QYVVPSMRTPLFVINAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKCSAAQLRTVQGFR  308

Query  1073  LQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
              Q++ AL    + PS G+F+++C  H +   A  +      QV N   SKA+ +W FYG+
Sbjct  309   DQMMRALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKISKAVGNW-FYGR  367

Query  1238  EV  1243
               
Sbjct  368   SA  369



>ref|XP_010434425.1| PREDICTED: uncharacterized protein LOC104718381 isoform X2 [Camelina 
sativa]
Length=379

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 210/366 (57%), Gaps = 31/366 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R 
Sbjct  21    AGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTG+V 
Sbjct  81    GTMKGSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGNVA  131

Query  548   E--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
                P + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T
Sbjct  132   AVNPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              R KC+ D GYFIH      K + G    +  +  VV+LH S   LP +CT KM  KP L
Sbjct  192   ARVKCVSDAGYFIH-----GKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGL  1060
             C FPQY++  M+TP+F++ +++D  QI   +  + V  ++  +    +  + +    + +
Sbjct  245   CFFPQYVVPFMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTV  304

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +GFR Q++ AL    + PS G+F+++C  H +   A  +      QV N   +KA+ +W 
Sbjct  305   QGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRIAKAVGNW-  363

Query  1226  FYGKEV  1243
             FYG+  
Sbjct  364   FYGRSA  369



>ref|XP_004172255.1| PREDICTED: protein notum homolog [Cucumis sativus]
 gb|KGN53459.1| hypothetical protein Csa_4G056500 [Cucumis sativus]
Length=398

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 209/363 (58%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A   GAVCLDGSPPAYHF +G     +NWLI +EGG WC ++  C  R     G
Sbjct  29    ITYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNNVTTCLQRRDTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+    F G        IL+  P +NP +F NWN + +RYCDGSSFTGDVE  +  
Sbjct  89    SSKKMVTQLAFSG--------ILSNKPQFNP-DFYNWNRIKVRYCDGSSFTGDVEAVDSA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  I D LL KG+KNAK   L+G SAG +S  LHCD F+ LLP T + KC
Sbjct  140   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  199

Query  737   LMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K  +  Q +EGF   + +VV+ H S   LP +CT KM  KP +C FPQ +
Sbjct  200   LSDAGYFINAKDVSGAQHIEGF---YSDVVTTHGSAKNLPISCTSKM--KPEMCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATPI-YEGLKGFRLQL  1081
             +  ++TP+F++ ++YD  QI   +       + T  E    ++  +PI    ++ FR+Q 
Sbjct  255   VQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQF  314

Query  1082  LDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             L AL    +  S G+FI++C+ H  TE+   +    +  ++    +KA+ DW+F      
Sbjct  315   LSALNGVGSSLSRGLFIDSCYAHCQTEMQETWLRTDSPVLSKTTIAKAVGDWFFDRAPFQ  374

Query  1247  LID  1255
              ID
Sbjct  375   KID  377



>emb|CDX87799.1| BnaC02g31500D [Brassica napus]
Length=391

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 209/370 (56%), Gaps = 30/370 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    AGAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E
Sbjct  81    TTMKGSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIE  131

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P + L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD F+ +LP T
Sbjct  132   AVDPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDEFKSILPTT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D G+FIH      K + G    E  +  VVS H S   LP +CT  M  KP L
Sbjct  192   AKVKCVSDAGFFIH-----GKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGL  1060
             C FPQY++  M+TP+F++ +++D  QI   +  + V   +  ++      +      + +
Sbjct  245   CFFPQYVVKTMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTV  304

Query  1061  KGFRLQLLDAL-PNKPSV--GIFINNCFFHTEIATGY-WANPNS-QVNNVLDSKAISDWY  1225
             +G+R Q+L AL P + +   G+F+++C  H +  +   W+     QV N   +KA+ DW+
Sbjct  305   QGYRDQMLAALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTKMAKAVGDWF  364

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  365   YERSTFQNID  374



>ref|XP_009624847.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana tomentosiformis]
Length=388

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 200/358 (56%), Gaps = 31/358 (9%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
               A + GAVCLDGSPPAYHF  G  E   NWL+ + GG WC ++++C  R+    GSS +
Sbjct  43    HSAVSKGAVCLDGSPPAYHFDPGFGEGVGNWLVQLSGGGWCTNVKDCLNRSKSDVGSSSY  102

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             M         +   F GI +++ + NP +F NWN V +RYCDG SFTGDVE  +P  NL+
Sbjct  103   M---------HPQPFKGIFSKNQSANP-DFYNWNKVFVRYCDGGSFTGDVEYVDPATNLH  152

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RIF  + +ELL KGLKNAK   L G SAG     L+CDRFR LLPNT R KCL+D 
Sbjct  153   FRGARIFTAVLEELLAKGLKNAKNAILAGSSAGGYPAILYCDRFRNLLPNTSRVKCLVDS  212

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             GYF+H K  NP     FE  +K V +L  S   LP++CT KM  KP LC+F + +   +K
Sbjct  213   GYFVHFK--NPVLGRPFESIYKGVATLQGSAKTLPKSCTSKM--KPELCLFAENIQQDIK  268

Query  929   TPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGF---RLQLLDALP-  1096
             TP+FI MS++D      ++         TI   +Q  T      K F   R   L A+P 
Sbjct  269   TPIFISMSAFDNIMTQYTL-------GGTIYGCIQNGTCTASQNKTFQEMRSDFLSAIPK  321

Query  1097  -NKPSV-GIFINNCFFHTEIATGYWANPNSQ--VNNVLDSKAISDWYFYGKEVNLIDK  1258
              N P + G+FI+    HT +      +P     V+N+   KA SDWYF      LID+
Sbjct  322   GNNPKLRGVFIDVVHHHTSLQKQTRWSPEKPIVVHNLAAPKAFSDWYFDRNYTYLIDE  379



>ref|XP_010244169.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=401

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 147/372 (40%), Positives = 208/372 (56%), Gaps = 35/372 (9%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYH   G     +NWL++ EGG+WC ++  C  R     G
Sbjct  32    ITYLQSAVAKGAVCLDGSPPAYHMSPGFGAGVNNWLVFFEGGSWCNNVTSCLARKNTRLG  91

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M          +  F GIL+    +NP +F NWN + +RYCDGSSFTGDVE   P 
Sbjct  92    SSKQMT--------KEVSFSGILSNKEKFNP-DFYNWNKIKVRYCDGSSFTGDVEAVNPA  142

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG+RIF  + ++LL KG+KNAK   LTG SAG ++  LHCDRFR LLP + + KC
Sbjct  143   TNLHFRGQRIFLAVIEDLLAKGMKNAKNALLTGCSAGGLTAILHCDRFRTLLPASTKVKC  202

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             + D G+FI+ K       ++ F   + +VV+ H S   LP +CT +    P LC FPQY+
Sbjct  203   MADAGFFINAKSVAGTSHIQAF---YNDVVATHQSAKNLPASCTSRF--NPGLCFFPQYV  257

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFRLQL  1081
                + TP+FIL ++YD  Q+   +       + T  +      + ++   + ++GFR++ 
Sbjct  258   APQISTPLFILNAAYDSWQVKNILAPGVADPHGTWHDCKLDITKCSSSQLQIMQGFRMEF  317

Query  1082  LDALP---NKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYFYGKEVN  1246
             L  L      P+  +FIN+C+ H +  T   W   +S V +    SKA+ DWYF      
Sbjct  318   LSTLTRLMGSPTKALFINSCYSHCQTGTQETWLRDDSPVLDKTSISKAVGDWYF------  371

Query  1247  LIDKSEFIK-DC  1279
               D+S F K DC
Sbjct  372   --DRSGFQKIDC  381



>ref|XP_004512349.1| PREDICTED: protein notum homolog isoform X1 [Cicer arietinum]
 ref|XP_004512350.1| PREDICTED: protein notum homolog isoform X2 [Cicer arietinum]
Length=487

 Score =   261 bits (667),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 145/371 (39%), Positives = 210/371 (57%), Gaps = 26/371 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + +A + P+ +   A   GAVCLDGSPPAYHF +G     ++WL+  EGG WC +I  C 
Sbjct  62    KAEAAYVPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNNITTCL  121

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R +   GSSK M             F GILN    +NP +F NWN + +RYCDGSSFTG
Sbjct  122   GRKMNRLGSSKQM--------AKQIAFSGILNNRRLFNP-DFYNWNRIKVRYCDGSSFTG  172

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE   PV  L+FRG R+FN + +ELL KG+KNAK   ++G SAG ++  LHCDRFR LL
Sbjct  173   DVEIVNPVTKLHFRGARVFNAVMEELLAKGMKNAKNAIISGCSAGGLTSILHCDRFRALL  232

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P   + KCL D GYFI+ +  +  Q +E F   F  VV+ H S   LP++CT ++   P 
Sbjct  233   PQGAKVKCLSDAGYFINARDVSGTQHIEQF---FSQVVTTHGSANNLPRSCTSRL--NPK  287

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISM-------HESFVAANRTIREHVQLATPI  1048
             LC FPQY++  + TP+F + ++YD  QI   +       H  + +    I         +
Sbjct  288   LCFFPQYVVSQITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSNQLDL  347

Query  1049  YEGLKGFRLQLLDALPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
              +G +   L+ L  L N PS G+FI++C+ H  TE+   ++ + +  +     +KA++DW
Sbjct  348   MQGFRTEFLRALTVLGNSPSKGMFIDSCYAHCQTEMQETWFRSDSPLLAKTTIAKAVADW  407

Query  1223  YFYGKEVNLID  1255
             ++  +  + ID
Sbjct  408   FYERRLFHQID  418



>gb|ABK24994.1| unknown [Picea sitchensis]
Length=399

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 206/354 (58%), Gaps = 27/354 (8%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L   E A A GAVCLDGSPP YH   G     +NWL++ EGG+WC ++  C  RT    G
Sbjct  33    LTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTCSARTKTRLG  92

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK+M+            F G+L  + A NP +F NWN + +RYCDG+SFTGDVE   PV
Sbjct  93    SSKYMI--------KQVDFSGLLGNNKARNP-DFYNWNRIKVRYCDGASFTGDVEAVNPV  143

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
             D LYFRG+R+F  +  +L+ KG+ NA+Q  ++G SAG ++  LHCD FR L+P T + KC
Sbjct  144   DKLYFRGQRVFKAVIGDLMAKGMINAQQAVISGCSAGGLTSILHCDNFRALMPKTTKVKC  203

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D G+FI VK       +  F   F  V +L  S   LP  CT+K+  +   C FPQYL
Sbjct  204   LADAGFFIDVKDVSGAYHIRSF---FNEVATLQQSVKNLPLACTEKLGTQ---CFFPQYL  257

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHVQLATP-IYEGLKGFRLQL  1081
             +  ++TP+F+L + YD  QI   +       +      +  ++  +P   E ++GFRL++
Sbjct  258   LPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEM  317

Query  1082  LDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYF  1228
             L+AL    N  S G+FIN+C+ H  +E+   + AN + ++N +  ++A+ +WYF
Sbjct  318   LNALKIFQNSASGGMFINSCYAHCQSEMQETWLANDSPKLNGLSIAEAVQNWYF  371



>gb|ABK24433.1| unknown [Picea sitchensis]
Length=399

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 206/354 (58%), Gaps = 27/354 (8%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L   E A A GAVCLDGSPP YH   G     +NWL++ EGG+WC ++  C  RT    G
Sbjct  33    LTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTCSARTKTRLG  92

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK+M+            F G+L  + A NP +F NWN + +RYCDG+SFTGDVE   PV
Sbjct  93    SSKYMI--------KQVDFSGLLGNNKARNP-DFYNWNRIKVRYCDGASFTGDVEAVNPV  143

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
             D LYFRG+R+F  +  +L+ KG+ NA+Q  ++G SAG ++  LHCD FR L+P T + KC
Sbjct  144   DKLYFRGQRVFKAVIGDLMAKGMINAQQAVISGCSAGGLTSILHCDNFRALMPKTTKVKC  203

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D G+FI VK       +  F   F  V +L  S   LP  CT+K+  +   C FPQYL
Sbjct  204   LADAGFFIDVKDVSGAYHIRSF---FNEVATLQQSVKNLPLACTEKLGTQ---CFFPQYL  257

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHVQLATP-IYEGLKGFRLQL  1081
             +  ++TP+F+L + YD  QI   +       +      +  ++  +P   E ++GFRL++
Sbjct  258   LPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEM  317

Query  1082  LDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYF  1228
             L+AL    N  S G+FIN+C+ H  +E+   + AN + ++N +  ++A+ +WYF
Sbjct  318   LNALKIFQNSASGGMFINSCYAHCQSEMQETWLANDSPKLNGLSIAEAVQNWYF  371



>ref|XP_010314004.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=401

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 154/370 (42%), Positives = 208/370 (56%), Gaps = 33/370 (9%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A F  +   + A + GAVCLDGSPPAYH   G      NW+I + GGAWC +  +C  R+
Sbjct  39    AYFVDITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAWCRNTTDCLNRS  98

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                 GSS  M+          F F GI ++    NP +F NWN V +RYCDG +FTGD+E
Sbjct  99    KTDLGSSTLML---------PFIFLGIFSKSKTENP-DFYNWNKVFVRYCDGGAFTGDIE  148

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P  NL+FRG RIF+ I ++LL KGLK+AK   L+GGSA      L+CD F  LLP  
Sbjct  149   NVDPATNLHFRGARIFDAIIEDLLAKGLKDAKNAILSGGSANGYPAMLYCDHFHSLLPKA  208

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMF  901
              R KCL+D GYFI VK  NP     FE  FK+VV+LH ST +LP++CT +M  KP LC F
Sbjct  209   HRVKCLVDAGYFIRVK--NPLLTNVFESIFKDVVTLHGSTKVLPKSCTSRM--KPELCFF  264

Query  902   PQYLMDGMKTPMFILMSSYDKHQIN----ISMHESFVAANRTIREHVQLATPIYEGLKGF  1069
             P+ +   +KTP F +MS++D +Q+N      + E   A N T  ++           K  
Sbjct  265   PENIQRDIKTPFFTVMSAFDSYQVNSIIGFDIGEYIQARNCTENQN--------NAFKEL  316

Query  1070  RLQLLDALP--NKP-SVGIFINNCFFHTEIATGYWANPNSQ-VNNVLDSKAISDWYFYGK  1237
             R + L ALP  N P   G+FI++   HT++   +W   N+  VNN+   K   DWY+  K
Sbjct  317   RSEFLRALPKANDPKQRGVFIDSFNRHTQLEL-WWNKINATPVNNLTTIKVFGDWYYDRK  375

Query  1238  EVNLIDKSEF  1267
                +ID+ + 
Sbjct  376   YSYVIDEHDL  385



>ref|XP_010314003.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=404

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 154/370 (42%), Positives = 208/370 (56%), Gaps = 33/370 (9%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A F  +   + A + GAVCLDGSPPAYH   G      NW+I + GGAWC +  +C  R+
Sbjct  42    AYFVDITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAWCRNTTDCLNRS  101

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                 GSS  M+          F F GI ++    NP +F NWN V +RYCDG +FTGD+E
Sbjct  102   KTDLGSSTLML---------PFIFLGIFSKSKTENP-DFYNWNKVFVRYCDGGAFTGDIE  151

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P  NL+FRG RIF+ I ++LL KGLK+AK   L+GGSA      L+CD F  LLP  
Sbjct  152   NVDPATNLHFRGARIFDAIIEDLLAKGLKDAKNAILSGGSANGYPAMLYCDHFHSLLPKA  211

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMF  901
              R KCL+D GYFI VK  NP     FE  FK+VV+LH ST +LP++CT +M  KP LC F
Sbjct  212   HRVKCLVDAGYFIRVK--NPLLTNVFESIFKDVVTLHGSTKVLPKSCTSRM--KPELCFF  267

Query  902   PQYLMDGMKTPMFILMSSYDKHQIN----ISMHESFVAANRTIREHVQLATPIYEGLKGF  1069
             P+ +   +KTP F +MS++D +Q+N      + E   A N T  ++           K  
Sbjct  268   PENIQRDIKTPFFTVMSAFDSYQVNSIIGFDIGEYIQARNCTENQN--------NAFKEL  319

Query  1070  RLQLLDALP--NKP-SVGIFINNCFFHTEIATGYWANPNSQ-VNNVLDSKAISDWYFYGK  1237
             R + L ALP  N P   G+FI++   HT++   +W   N+  VNN+   K   DWY+  K
Sbjct  320   RSEFLRALPKANDPKQRGVFIDSFNRHTQLEL-WWNKINATPVNNLTTIKVFGDWYYDRK  378

Query  1238  EVNLIDKSEF  1267
                +ID+ + 
Sbjct  379   YSYVIDEHDL  388



>ref|XP_006432881.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
 gb|ESR46121.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
Length=392

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 212/363 (58%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A A GAVCLDGSPPAYHF +G     +NWL++++GGAWC ++ +C  R     G
Sbjct  31    ITYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNNVADCSNRRDSSHG  90

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK+M+    F G        IL+ +  +NP +F +WN V +RYCDG+SFTGDVE   P 
Sbjct  91    SSKYMVKEANFTG--------ILSNEQKFNP-DFYDWNRVKVRYCDGASFTGDVEAVNPE  141

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  + ++LL KG+KNA+   LTG SAG ++  LHCD FR L P   R KC
Sbjct  142   TNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVNTRVKC  201

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
               D GYF++VK       +E F   +K VV+LH S   LP +CT ++   P LC FPQ +
Sbjct  202   FADAGYFVNVKDVSGASHIEEF---YKQVVALHGSAKHLPASCTSRL--SPGLCFFPQNV  256

Query  914   MDGMKTPMFILMSSYDKHQI-NISMHESFVAAN---RTIREHVQLATPIYEGLKGFRLQL  1081
                +KTP+FI+ S+YD  QI NI + ++        R  ++    ++   + ++GFR+Q 
Sbjct  257   AGQVKTPLFIINSAYDSWQIRNILVPDNADPKGTWRRCKKDIKTCSSTQLQTMQGFRVQF  316

Query  1082  LDALP---NKPSVGIFINNCFFHTE-IATGYWANPNSQV-NNVLDSKAISDWYFYGKEVN  1246
             L+AL    N  S G+ I++C+ H   +    W + +S V +    +KA+ DWY+      
Sbjct  317   LNALAGLGNSSSRGMLIDSCYTHCRTVFQEAWLSADSPVLDKTPIAKAVGDWYYDRNPFQ  376

Query  1247  LID  1255
              ID
Sbjct  377   KID  379



>ref|XP_010434424.1| PREDICTED: uncharacterized protein LOC104718381 isoform X1 [Camelina 
sativa]
Length=391

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 210/366 (57%), Gaps = 31/366 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R 
Sbjct  21    AGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTG+V 
Sbjct  81    GTMKGSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGNVA  131

Query  548   E--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
                P + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T
Sbjct  132   AVNPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              R KC+ D GYFIH      K + G    +  +  VV+LH S   LP +CT KM  KP L
Sbjct  192   ARVKCVSDAGYFIH-----GKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGL  1060
             C FPQY++  M+TP+F++ +++D  QI   +  + V  ++  +    +  + +    + +
Sbjct  245   CFFPQYVVPFMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLKTV  304

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +GFR Q++ AL    + PS G+F+++C  H +   A  +      QV N   +KA+ +W 
Sbjct  305   QGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRIAKAVGNW-  363

Query  1226  FYGKEV  1243
             FYG+  
Sbjct  364   FYGRSA  369



>emb|CDX78932.1| BnaA01g09990D [Brassica napus]
Length=391

 Score =   258 bits (659),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 144/362 (40%), Positives = 206/362 (57%), Gaps = 31/362 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIKRKGTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL      NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQNTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T R K
Sbjct  136   ANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D GYFIH      K + G    +  +  VV+LH S   LP +CT KM  KP LC FP
Sbjct  196   CVSDAGYFIH-----GKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR  1072
             QY++  M+TP+F++ +++D  QI   +  + V   +       +  + +      ++GFR
Sbjct  249   QYVVPSMRTPLFVINAAFDSWQIKNVLVPTGVDKRKEWANCKLDLKKCSAAQLRTVQGFR  308

Query  1073  LQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
              Q++ AL    + PS G+F+++C  H +   A  +      QV N   SKA+ +W FYG+
Sbjct  309   DQMMRALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKISKAVGNW-FYGR  367

Query  1238  EV  1243
               
Sbjct  368   SA  369



>ref|XP_010449359.1| PREDICTED: uncharacterized protein LOC104731629 [Camelina sativa]
Length=391

 Score =   258 bits (658),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 143/362 (40%), Positives = 208/362 (57%), Gaps = 31/362 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTG+V    P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGNVAAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T R K
Sbjct  136   ANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D GYFIH      K + G    +  +  VV+LH S   LP +CT KM  KP LC FP
Sbjct  196   CVSDAGYFIH-----GKDISGGSYIQSYYSKVVALHGSAKSLPISCTSKM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR  1072
             QY++  M+TP+F++ +++D  QI   +  + V   +  +    +  + +    + ++GFR
Sbjct  249   QYVVPFMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKCSAAQLKTVQGFR  308

Query  1073  LQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
              Q++ AL    + PS G+F+++C  H +   A  +      QV N   SKA+ +W FYG+
Sbjct  309   DQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRISKAVGNW-FYGR  367

Query  1238  EV  1243
               
Sbjct  368   SA  369



>ref|XP_003548585.1| PREDICTED: protein notum homolog [Glycine max]
Length=398

 Score =   258 bits (659),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 150/358 (42%), Positives = 211/358 (59%), Gaps = 26/358 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + ++  GAVCLDGSPPAYHF +G  +  +NW++++EGG WC ++  C  R     
Sbjct  28    PLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNNVTSCLDRKNTTL  87

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSS HM          D  FY IL+    +NP +F NWN V +RYCDGSSFTGDVEE  P
Sbjct  88    GSSNHM---------SDISFYAILSNQQQFNP-DFYNWNRVKVRYCDGSSFTGDVEEVDP  137

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG RIF+ + +ELL KG+KNAK   L+G SAG ++  LHCD F+ LLP+    K
Sbjct  138   TTNLHFRGARIFSAVMEELLAKGMKNAKNAILSGCSAGGLTTILHCDSFKALLPSRANVK  197

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C+ D GYF++V  ++      F+  +  VVS+H S   LP +CT K    P LC FPQY+
Sbjct  198   CVPDAGYFVNV--EDISGAHSFQEFYSEVVSIHGSAKNLPTSCTSKH--NPALCFFPQYV  253

Query  914   MDGMKTPMFILMSSYDKHQI-NISMHESFVAAN--RTIREHVQLATP-IYEGLKGFRLQL  1081
                + TP+F++ S+YD  QI NI +  S   +N   + + ++   +P     L+GF+ + 
Sbjct  254   ASHISTPIFVVNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEF  313

Query  1082  LDALP---NKPSVGIFINNCFFHTEIATG-YWANPNSQ-VNNVLDSKAISDWYFYGKE  1240
               AL    + PS G+FI++C+ H +  T   W    SQ + N   +KA+ DW FYG+ 
Sbjct  314   QRALSEVGDSPSKGMFIDSCYAHCQTETQETWFKSGSQLLANKTIAKAVGDW-FYGRS  370



>ref|XP_003628996.1| Carboxylic ester hydrolase [Medicago truncatula]
 gb|AET03472.1| pectinacetylesterase family protein [Medicago truncatula]
Length=406

 Score =   258 bits (659),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 209/370 (56%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  + PL   E A + GAVCLDGSPPAYHF +G  E  +NW++++EGG WC ++  C 
Sbjct  21    KTQGQYVPLTRLESAVSKGAVCLDGSPPAYHFDQGHDEGANNWIVHIEGGGWCHNVTYCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSS  M        +    F G L+ +  YNP +F NWN V +RYCDGSSFTG
Sbjct  81    YRRDSRLGSSHEM--------EEQTYFSGYLSDNQQYNP-DFYNWNRVKVRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVEE  P   LY+RG RIF+ + +ELL KG+ +A+   L+G SAG ++  LHCD FR L 
Sbjct  132   DVEEVDPTTKLYYRGARIFSAVMEELLAKGMDHAENAILSGCSAGGLTTILHCDGFRALF  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             PN  R KC+ D GYF++V   +       E  +  VV+ H S   LP +CT  +   P L
Sbjct  192   PNETRVKCVSDAGYFVNVNDISGDHY--IEDYYSQVVATHGSEKSLPSSCTSML--SPGL  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHVQLATP-IYEGL  1060
             C FPQY+   ++TP+FI+ ++YD  QI   +       +   R+ + ++   +P     +
Sbjct  248   CFFPQYMASSIQTPIFIVNAAYDSWQIKNILAPGDADPDGQWRSCKTNLNNCSPEQLNIM  307

Query  1061  KGFRLQLLDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + +R Q L+AL    N PS G+FI++C+ H  TE    ++ + +  V N   +KA+ DW+
Sbjct  308   QDYRTQFLEALSPISNSPSNGMFIDSCYVHCQTEPQETWFKSDSPMVGNKTVAKAVGDWF  367

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  368   YERSPSREID  377



>ref|XP_010318089.1| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=407

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 149/348 (43%), Positives = 200/348 (57%), Gaps = 34/348 (10%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A A GAVCLDGSPPAYHF  G  +  + WL+ + GG WC  +E C  R+    GSS  
Sbjct  44    KNAVAKGAVCLDGSPPAYHFEPGFGDGAETWLVQLSGGEWCRDVEACLDRSKSDLGSSNV  103

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             M           + F G+ +++ + NP EF NWN V IRYCDG  FTGDVE  +P   L+
Sbjct  104   M---------GSWWFTGMFSKNQSGNP-EFYNWNKVFIRYCDGGGFTGDVEYVDPATKLH  153

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RIF  + DELL KGLK AK   L+G SAG     LHCD FR LLPNT R KC+ D 
Sbjct  154   FRGARIFKAVLDELLEKGLKTAKSALLSGSSAGGFPAMLHCDYFRTLLPNTPRVKCMNDA  213

Query  749   GYFIHVKKDNPKQ--VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDG  922
             GYFI     NPK+  +  F   + ++V+LH S   LP+ CT KM   P LC FP+ +   
Sbjct  214   GYFI-----NPKEPFLTNFTELYTSLVTLHGSAKALPKECTSKM--SPELCFFPENMQQY  266

Query  923   MKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALPNK  1102
             +KTP+FI  S+YDK+QIN S+         T   +        +    FR + L+ALP K
Sbjct  267   VKTPLFIASSAYDKYQINSSIANGI----NTCIGYANCTAATNQTFLEFRSRFLNALP-K  321

Query  1103  PS----VGIFINNCFFHTEIATGYWANP--NSQVNNVLDSKAISDWYF  1228
             P+     G+FI++   H+++   YW +P   + +NN+  SKA++DW++
Sbjct  322   PTNPKLKGVFIDSFNHHSQVQ--YWWSPINITTINNLTISKALADWFY  367



>ref|XP_011082149.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082150.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082151.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=398

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/380 (39%), Positives = 217/380 (57%), Gaps = 35/380 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T++ +  + +   A A GAVCLDGSPPAYH   G     +NWL+++EGG WC ++  C 
Sbjct  20    RTESFYVDITYVRSAVAKGAVCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNNVTTCL  79

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK+M+    F G        ILN    +NP +F NWN V +RYCDG+SFTG
Sbjct  80    ARKNNRLGSSKYMVKQLAFSG--------ILNNKANFNP-DFYNWNRVKVRYCDGASFTG  130

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE   PV  L++RG R+F  + ++LL KG+KNA+   L+G SAG ++  LHCD F+ LL
Sbjct  131   DVEAVNPVTKLHYRGARVFLAVMEDLLAKGMKNAENAVLSGCSAGGLAAILHCDSFKALL  190

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P   + KC  D GYFI+ K     + +E F   + +VVS H S   LP++CT +M  KP 
Sbjct  191   PMGTKVKCFSDAGYFINTKDVSGAQHIEAF---YHDVVSTHGSAKNLPRSCTSRM--KPS  245

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEG  1057
             LC FPQY+   ++TP+FI+ ++YD  QI   +       + T      +  + +    + 
Sbjct  246   LCFFPQYVAREIRTPLFIINAAYDSWQIKNILAPGVADPHGTWHNCKTDINKCSATQLQT  305

Query  1058  LKGFRLQLLDALPN---KPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
             ++GFRL+ + AL       S G FIN+C+ H  TE+   ++ + + ++NN   +KA+ DW
Sbjct  306   MQGFRLEFIRALYGLGVSTSRGYFINSCYAHCQTEMQETWYRSDSPKLNNKTIAKAVGDW  365

Query  1223  YFYGKEVNLIDKSEFIK-DC  1279
             ++        D+S F K DC
Sbjct  366   FY--------DRSPFQKGDC  377



>ref|XP_003580427.1| PREDICTED: uncharacterized protein LOC100827238 isoform X2 [Brachypodium 
distachyon]
Length=391

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 205/370 (55%), Gaps = 41/370 (11%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             ++F + A A GAVCLDGSPP YHF  G+    +NW+++MEGG WC++ EEC +R    +G
Sbjct  29    MVFLKSAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTSEECSIRKGNFRG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK+M             F GIL     +NP +F NWN V +RYCDGSSFTGDVE  E  
Sbjct  89    SSKYM---------KPLSFSGILGGSDKFNP-DFYNWNRVKVRYCDGSSFTGDVEAVETS  138

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL++RG R++  I  +LL++G+  A+   L+G SAG ++  LHCDRF  LLP + + KC
Sbjct  139   TNLHYRGNRVWQAIIQDLLDRGMSKAQNALLSGCSAGGLAAILHCDRFSDLLPASAKVKC  198

Query  737   LMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
               D GYF      +   + G      ++K++V+LH S   LP +CT K    P LC FPQ
Sbjct  199   FSDAGYFF-----DGTDITGNNYVRKSYKDIVNLHGSAKSLPSSCTSKR--SPELCFFPQ  251

Query  908   YLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---------HVQLATPIYEGL  1060
             Y++  ++TP+FIL ++YD  QI   +  +     +T  +           QL T     L
Sbjct  252   YVIPTLRTPLFILNAAYDTWQIRNILAPNAADPKKTWAKCKLDIKSCSSSQLVT-----L  306

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWY  1225
             + FR   L ALP     PS+GIFI++CF H +  A   W    S  +  +   KA+ DW+
Sbjct  307   QNFRKDFLAALPQPGQSPSLGIFIDSCFAHCQSGAQDTWIGEGSPSIQKMRIGKAVGDWF  366

Query  1226  FYGKEVNLID  1255
             +      LID
Sbjct  367   YNRHVSQLID  376



>ref|XP_002865253.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41512.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 211/374 (56%), Gaps = 30/374 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    ARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGANNWIVHMEGGGWCTDIATCVQRK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E
Sbjct  81    STMKGSSKLMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIE  131

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P + L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD+F+ +LP T
Sbjct  132   AVDPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPKT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D GYFIH      K + G    +  +  VV+ H S   LP +CT  M  KP L
Sbjct  192   AKVKCVSDAGYFIH-----GKDITGGSYIQSYYAKVVATHGSAKSLPVSCTSSM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+F++ +++D  QI   +  + V    A +T +  ++  T    + +
Sbjct  245   CFFPQYVAQTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTV  304

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +G+R Q+L AL    +  + G+F+++C  H +   A  +  +    V N   +KA+ DW+
Sbjct  305   QGYRDQVLAALAPVRSDTTSGLFLDSCHAHCQGGSAATWSGDGGPTVANTKMAKAVGDWF  364

Query  1226  FYGKEVNLIDKSEF  1267
             F       ID S  
Sbjct  365   FERSTFQNIDCSSL  378



>ref|XP_010240371.1| PREDICTED: uncharacterized protein LOC100827238 isoform X1 [Brachypodium 
distachyon]
Length=404

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 205/370 (55%), Gaps = 41/370 (11%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             ++F + A A GAVCLDGSPP YHF  G+    +NW+++MEGG WC++ EEC +R    +G
Sbjct  42    MVFLKSAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTSEECSIRKGNFRG  101

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK+M             F GIL     +NP +F NWN V +RYCDGSSFTGDVE  E  
Sbjct  102   SSKYM---------KPLSFSGILGGSDKFNP-DFYNWNRVKVRYCDGSSFTGDVEAVETS  151

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL++RG R++  I  +LL++G+  A+   L+G SAG ++  LHCDRF  LLP + + KC
Sbjct  152   TNLHYRGNRVWQAIIQDLLDRGMSKAQNALLSGCSAGGLAAILHCDRFSDLLPASAKVKC  211

Query  737   LMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
               D GYF      +   + G      ++K++V+LH S   LP +CT K    P LC FPQ
Sbjct  212   FSDAGYFF-----DGTDITGNNYVRKSYKDIVNLHGSAKSLPSSCTSKR--SPELCFFPQ  264

Query  908   YLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---------HVQLATPIYEGL  1060
             Y++  ++TP+FIL ++YD  QI   +  +     +T  +           QL T     L
Sbjct  265   YVIPTLRTPLFILNAAYDTWQIRNILAPNAADPKKTWAKCKLDIKSCSSSQLVT-----L  319

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWY  1225
             + FR   L ALP     PS+GIFI++CF H +  A   W    S  +  +   KA+ DW+
Sbjct  320   QNFRKDFLAALPQPGQSPSLGIFIDSCFAHCQSGAQDTWIGEGSPSIQKMRIGKAVGDWF  379

Query  1226  FYGKEVNLID  1255
             +      LID
Sbjct  380   YNRHVSQLID  389



>ref|XP_004509522.1| PREDICTED: uncharacterized protein LOC101493258 isoform X1 [Cicer 
arietinum]
 ref|XP_004509523.1| PREDICTED: uncharacterized protein LOC101493258 isoform X2 [Cicer 
arietinum]
Length=400

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 204/364 (56%), Gaps = 26/364 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGSPPAYHF +G     DNW+++ EGG WC ++  C  R     
Sbjct  29    PITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDNWIVHFEGGGWCNNVSTCLDRRDTRL  88

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSSK M        D    F G  +    +NP +F +WN + +RYCDG+SFTGDVE  +P
Sbjct  89    GSSKKM--------DKQLSFSGFFSNGKKFNP-DFYDWNRIKVRYCDGASFTGDVEAVDP  139

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG RIF  + ++LL KG+KNAK   L+G SAG ++  L CDRF+ LLP   + K
Sbjct  140   ATNLHFRGARIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFKTLLPAAAKVK  199

Query  734   CLMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             C+ D GYFI+VK  +  Q +E F   +  VV  H S   LPQ+CT ++   P LC FPQ 
Sbjct  200   CVSDAGYFINVKAVSGAQHIEQF---YSQVVQTHGSAKNLPQSCTSRL--SPGLCFFPQN  254

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATP-IYEGLKGFRLQ  1078
             +   +KTP+F + ++YD  QI   +       + T R     +   +P     ++GFR Q
Sbjct  255   VAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDINNCSPNQLTTMQGFRTQ  314

Query  1079  LLDA---LPNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYFYGKEV  1243
              L A   L N PS G+FI+ C+ H +      W   +S V  N   +KA+ DWY+  K  
Sbjct  315   FLQAISGLSNSPSKGLFIDGCYAHCQTGMQETWMRSDSPVLANTTIAKAVGDWYYDRKTF  374

Query  1244  NLID  1255
             + ID
Sbjct  375   HQID  378



>ref|NP_001190770.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AEE84178.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=517

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/357 (39%), Positives = 207/357 (58%), Gaps = 25/357 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T   K
Sbjct  136   ANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTASVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C+ D GYFIH K          +  +  VV+LH S   LP +CT KM  KP LC FPQY+
Sbjct  196   CVSDAGYFIHGKDITGGSY--IQSYYSKVVALHGSAKSLPVSCTSKM--KPELCFFPQYV  251

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQL  1081
             +  M+TP+F++ +++D  QI   +  + V   +  +    +  + +    + ++GFR Q+
Sbjct  252   VPSMRTPLFVINAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKCSAAQLKTVQGFRDQM  311

Query  1082  LDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
             + AL    + PS G+F+++C  H +   A  +  +   QV N   +KA+ +W FYG+
Sbjct  312   MRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQVANTRIAKAVGNW-FYGR  367



>emb|CDP15690.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 147/371 (40%), Positives = 210/371 (57%), Gaps = 26/371 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+A F  + + E A A GAVCLDGSPPAYH   G     ++WL+++EGG WC ++  C 
Sbjct  21    RTEAFFVDITYVESAVAKGAVCLDGSPPAYHLDRGFGAGINSWLVHIEGGGWCNNVTTCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M     F G        IL   P +NP +F NWN V +RYCDGSSFTG
Sbjct  81    DRKNTRLGSSKQMAKQLAFSG--------ILANKPKFNP-DFYNWNRVKVRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE   P  NL++RG R+F  + ++LL KG++NA+   L+G SAG ++  LHCD F+ LL
Sbjct  132   DVEAVNPATNLHYRGARVFVAVIEDLLAKGMRNAESAVLSGCSAGGLTSILHCDSFKALL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KC  D GYFI+ K  +   V+  E  + +VV+ H S   LP TCT +M  KP L
Sbjct  192   PLGTKVKCFADAGYFINAK--DVSGVQHIEAFYNDVVNTHGSAKNLPATCTSRM--KPGL  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYEG  1057
             C FPQY+   ++TP+FI  ++YD  QI  ++    VA    +  + +L     +    + 
Sbjct  248   CFFPQYMAQEIRTPLFITNAAYDSWQIK-NILAPGVADPHGLWHNCKLDITRCSASQLQI  306

Query  1058  LKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
             ++GFRL+ L A   L    S G FIN C+ H  TE+   +  + + ++N+   +KA+ DW
Sbjct  307   IQGFRLEFLSAVNGLGTSSSRGYFINGCYAHCQTEMQETWLRDDSPRLNDKTIAKAVGDW  366

Query  1223  YFYGKEVNLID  1255
             ++       ID
Sbjct  367   FYDRSPFQTID  377



>ref|XP_010536210.1| PREDICTED: uncharacterized protein LOC104811251 [Tarenaya hassleriana]
Length=391

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 145/381 (38%), Positives = 215/381 (56%), Gaps = 39/381 (10%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + + A A GAVCLDGSPPAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    AGAVPITYLDSAVAKGAVCLDGSPPAYHFDKGSGSGVNNWIVHMEGGGWCNDIASCSERK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGDVE
Sbjct  81    NTMKGSSKFMNKDFGFSG--------ILGSKQSSNP-DFYNWNRIKVRYCDGSSFTGDVE  131

Query  548   E--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
                P + L+FRG R++  + D+L+ KG+  A+   L+G SAGA++  LHCD+FR +LP++
Sbjct  132   AVNPSNKLFFRGARVWRAVIDDLMAKGMNKAQNAILSGCSAGALAAILHCDQFRAILPSS  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
                KC+ D GYFIH      K + G    E  +  VV+LH S   LP++CT     KP L
Sbjct  192   ANVKCVSDAGYFIH-----GKDISGGSYIESYYSKVVALHGSAKGLPESCTSTT--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGL  1060
             C FPQY+   M+TP+F++ +++D  QI   +  + V  ++  +    +  +      + +
Sbjct  245   CFFPQYVAPSMRTPLFVVNAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCTAAQLQTV  304

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +GFR Q+L+AL    +  S G+F+++C  H +   A  +  +    V++   +KA+ DW+
Sbjct  305   QGFRDQMLNALAPVQSMASGGLFLDSCHAHCQGGSAASWSGSQGPSVDDTKIAKAVGDWF  364

Query  1226  FYGKEVNLIDKSEFIK-DCYT  1285
                      D+S F K DC T
Sbjct  365   N--------DRSPFKKMDCPT  377



>ref|XP_011073252.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=398

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/380 (39%), Positives = 219/380 (58%), Gaps = 35/380 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T++ F  + + + A A GAVCLDGSPPAYH  +G+    +NWL+++EGG WC ++  C 
Sbjct  20    RTESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWLVHVEGGGWCNNVTTCL  79

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              RT    GSSK M     F G        I +  P +NP +F NWN + +RYCDG+SFTG
Sbjct  80    ARTKTRLGSSKLMAKQIAFSG--------IFSNKPQFNP-DFYNWNRIKVRYCDGASFTG  130

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   LY+RG R+F  + ++LL KG+KNA+   L+G SAG ++  LHCD F+ LL
Sbjct  131   DVEVVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILHCDNFKALL  190

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P   + KC  D G+FI+ K       ++ F   + +VV+ H S   LPQ+CT +M  KP 
Sbjct  191   PVGTKVKCFSDAGFFINAKDVSGAPHIQDF---YNDVVTTHGSAKNLPQSCTSRM--KPS  245

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQI-NI---SMHESFVAANRTIREHVQLATPIYEG  1057
             LC FPQ +  G++TP+FI+ ++YD  QI NI    + +     +    + V+ +T   + 
Sbjct  246   LCFFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCSTTQLQT  305

Query  1058  LKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
             ++ FRLQ L+AL    +  S G FIN C+ H  TE+   ++   +  + N   +KA+ DW
Sbjct  306   MQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQTEMQETWFRGDSPLLYNKTIAKAVGDW  365

Query  1223  YFYGKEVNLIDKSEFIK-DC  1279
             ++        D+S F K DC
Sbjct  366   FY--------DRSPFQKIDC  377



>ref|XP_006283887.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
 gb|EOA16785.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
Length=391

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/362 (39%), Positives = 207/362 (57%), Gaps = 31/362 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCLARKNTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTG+V    P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGNVAAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T R K
Sbjct  136   SNKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D GYFIH      K + G    +  +  VV+LH S   LP +CT KM  KP LC FP
Sbjct  196   CVSDAGYFIH-----GKDISGGSYIQSYYSKVVALHGSAKSLPLSCTSKM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR  1072
             QY++  M+TP+F++ +++D  QI   +  + V  ++  +    +  + +      ++GFR
Sbjct  249   QYVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQLRTVQGFR  308

Query  1073  LQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
              Q++ AL    + PS G+F+++C  H +   A  +      QV N   + A+ +W FYG+
Sbjct  309   DQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQVANTRIATAVGNW-FYGR  367

Query  1238  EV  1243
               
Sbjct  368   SA  369



>ref|XP_004244767.2| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=387

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 212/357 (59%), Gaps = 25/357 (7%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A + GAVCLDGSPPAY+   G  E   +W+I++ GG WC  + +C+ R+    GSSK+
Sbjct  47    KNAVSKGAVCLDGSPPAYYMDRGFGEGAQSWMIHLSGGGWCRDVRDCQNRSTTSFGSSKY  106

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             M+          F F G  + +   NP  F NWN V++ YCDG +FTGDVE  +P  NL+
Sbjct  107   MV---------PFKFRGHFSNNKIANPDLF-NWNKVMVAYCDGGAFTGDVETVDPGTNLH  156

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RIF+ + ++LL++GL +AK   L G SAGA    L+CDRF KLLPNT R KCL D 
Sbjct  157   FRGARIFSAVMEDLLSRGLNDAKNALLIGSSAGAYPAMLYCDRFSKLLPNTPRLKCLTDS  216

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             GYFI V K N ++ +GFE  +K +V+LH S   LP++CT +M  KP LC FPQ +   +K
Sbjct  217   GYFIDVNK-NLQKGKGFESIYKELVTLHGSAKALPKSCTSRM--KPELCFFPQNVQQYIK  273

Query  929   TPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALPNKP-  1105
             TP++ +MS +D  Q+  S+ + + A  +      Q      + L+  RL+LL  LPN   
Sbjct  274   TPLYTIMSPFDIVQVGTSLGDYYNAIKQNNCSANQK-----KNLRELRLELLSKLPNASD  328

Query  1106  --SVGIFINNCFFHTEIATGYWANPN-SQVNNVLDSKAISDWYFYGKEVNLIDKSEF  1267
               S G FI++ F HT + + YW   N S VNNV   KA  DWYF  +   LIDK + 
Sbjct  329   TKSRGAFIDSQFHHTRLQS-YWNPQNVSVVNNVTMIKAFGDWYFDRQYYYLIDKHDL  384



>gb|AAM65412.1| pectin acetylesterase [Arabidopsis thaliana]
Length=391

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 209/374 (56%), Gaps = 30/374 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    ARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E
Sbjct  81    STMKGSSKLMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIE  131

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P + L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD+F+  LP T
Sbjct  132   AVDPANKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSTLPKT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D GYFIH      K + G    +  +  VV+ H S   LP +CT  M  KP L
Sbjct  192   AKVKCVSDAGYFIH-----GKDITGGSYIQSYYAKVVATHGSAKSLPASCTSSM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+F++ +++D  QI   +  + V    A +T +  ++  T    + +
Sbjct  245   CFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTV  304

Query  1061  KGFRLQLLDALPNKPSV---GIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +G+R Q+L AL    S    G+F+++C  H +   A  +  +    V N   +KA+ DW+
Sbjct  305   QGYRDQVLAALAPVQSATTNGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWF  364

Query  1226  FYGKEVNLIDKSEF  1267
             F       +D S  
Sbjct  365   FERSTFQNVDCSSL  378



>gb|ACF05806.1| PAE [Litchi chinensis]
Length=399

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 147/372 (40%), Positives = 212/372 (57%), Gaps = 35/372 (9%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A A GAVCLDGSPPAYH  +G     +NWL+++EGG WC ++  C  R     G
Sbjct  29    ITYVENAVAKGAVCLDGSPPAYHLDKGFGAGINNWLVHIEGGGWCNNVTTCLSRKNTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M+            F G+L+    +NP +F NWN + +RYCDG+SFTGDVE   P 
Sbjct  89    SSKKMV--------KVVAFSGMLSNKQKFNP-DFYNWNRIKVRYCDGASFTGDVEAVNPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  I ++LL KG+KNAK   L+G SAG ++  LHCD+F+ LLP + + KC
Sbjct  140   TNLHFRGARVFLAIIEDLLAKGMKNAKNAVLSGCSAGGLTSILHCDKFQTLLPTSTKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
               D GYFI+ K     + +E F   +  VV+ H S   LP +CT ++  KP LC FPQY+
Sbjct  200   FADAGYFINTKDVSGAQHIEAF---YNEVVATHGSAKNLPASCTSRL--KPGLCFFPQYM  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRT---IREHVQLATP-IYEGLKGFRLQL  1081
                ++TP+FI+ ++YD  QI   +       + T    +  +   +P   + ++ FRLQ 
Sbjct  255   ARQIQTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNCSPNQLQTMQSFRLQF  314

Query  1082  LDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             LDAL    N  S G+FI++C+ H  TE+   +  + +  +     +KA+ DWY+      
Sbjct  315   LDALSGLGNSTSKGLFIDSCYAHCQTEMQETWLRDDSPVLGKTTIAKAVGDWYY------  368

Query  1247  LIDKSEFIK-DC  1279
               D+S F K DC
Sbjct  369   --DRSPFQKIDC  378



>ref|XP_010441760.1| PREDICTED: uncharacterized protein LOC104724893 [Camelina sativa]
Length=391

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 212/374 (57%), Gaps = 30/374 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    ARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E
Sbjct  81    STMKGSSKLMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIE  131

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P + L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD+F+ +LP T
Sbjct  132   AVDPANKLFFRGARVWRAVIDDLMAKGMNNAQNAILSGCSAGALAAILHCDQFKSILPKT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D GYFIH      K + G    +  +  VV+ H S   LP +CT  M  KP L
Sbjct  192   AKVKCVSDAGYFIH-----GKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+F++ +++D  QI   +  + V    A +T +  ++  T    + +
Sbjct  245   CFFPQYVAKALQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTV  304

Query  1061  KGFRLQLLDAL-PNKPSV--GIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +G+R Q+L AL P + +   G+F+++C  H +   A  +  +    V N   +KA+ DW+
Sbjct  305   QGYRDQVLAALAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWF  364

Query  1226  FYGKEVNLIDKSEF  1267
             +       ID S  
Sbjct  365   YERSTFQNIDCSSL  378



>ref|XP_003547821.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26083.1| Protein notum like [Glycine soja]
Length=398

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 213/364 (59%), Gaps = 26/364 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + + +  PLI  E A++ GAVCLDGSPPAYHF +G  E  ++W++++EGG WC +IE C 
Sbjct  21    KAEGSLVPLILVENAESKGAVCLDGSPPAYHFDKGFGEGINSWIVHIEGGGWCNNIESCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M          D  F GIL+ +  +NP +F NWN V +RYCDGSSFTG
Sbjct  81    DRKDTRLGSSKQM---------EDIYFSGILSNEQQFNP-DFYNWNRVKVRYCDGSSFTG  130

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVEE  P  NL+FRG RIF+ + +ELL KGL+ A+   L+G SAG ++  LHCD F+  L
Sbjct  131   DVEEVDPTTNLHFRGARIFSAVIEELLAKGLERAENAILSGCSAGGLTTILHCDSFKTFL  190

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P+    KC+ D GYF++V+  +       +  +  VVS H S   LP +CT K+   P L
Sbjct  191   PSRANVKCVPDAGYFVNVEDISGAHF--IQQYYSEVVSTHGSAKNLPTSCTSKL--SPTL  246

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQIN---ISMHESFVAANRTIREHVQLATP-IYEGL  1060
             C FPQY+   + TP+F++ S+YD  QI    +        +  + + ++   +P     L
Sbjct  247   CFFPQYVASHISTPIFVVNSAYDSWQIRYIFVPGSADPSDSWNSCKVNMSNCSPDQLSKL  306

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             +GF+ +   AL    + PS G+FI++C+ H  TE    ++   + ++ N   +KA++DW 
Sbjct  307   QGFKSEFERALSEVGDSPSKGMFIDSCYAHCQTEPQETWFKTDSPKLANTTIAKAVADW-  365

Query  1226  FYGK  1237
             FYG+
Sbjct  366   FYGR  369



>ref|XP_008667853.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF86109.1| unknown [Zea mays]
 gb|ACG43470.1| pectinacetylesterase precursor [Zea mays]
 tpg|DAA36174.1| TPA: pectinacetylesterase isoform 1 [Zea mays]
 tpg|DAA36175.1| TPA: pectinacetylesterase isoform 2 [Zea mays]
Length=397

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 202/364 (55%), Gaps = 38/364 (10%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             ++F + A A GAVCLDGSPP YHF  G+    +NW+++MEGG WC + +EC +R    +G
Sbjct  35    MVFLKAAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCRNPDECAVRKGNFRG  94

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M             F GIL  +   NP +F NWN V IRYCDGSSFTGDVE  +  
Sbjct  95    SSKFM---------KPLSFSGILGGNQKSNP-DFYNWNRVKIRYCDGSSFTGDVEAVDTA  144

Query  557   DNLYFRGKRIFNVITDELLN-KGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              +L +RG R++  + D+LL  +G+  A+   L+G SAG ++  LHCDRF  L P   + K
Sbjct  145   KDLRYRGFRVWRAVIDDLLTVRGMSKAQNALLSGCSAGGLAAILHCDRFHDLFPAKTKVK  204

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C  D GYF      + K + G       +K+VV+LH S   LP +CT K K  P LCMFP
Sbjct  205   CFSDAGYFF-----DGKDISGNFYARSIYKSVVNLHGSAKNLPASCTSKPKQSPELCMFP  259

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---------HVQLATPIYEG  1057
             QY++  M+TP+FIL ++YD  Q+   +  S     +T  +           QL T     
Sbjct  260   QYVVPTMRTPLFILNAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSASQLTT-----  314

Query  1058  LKGFRLQLLDALPNKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYFY  1231
             L+ FR   L ALP   SVG+FI++C  H +  +   + A+ +  VN     KA+ DWY Y
Sbjct  315   LQNFRTDFLAALPKTQSVGMFIDSCNAHCQSGSQDTWLADGSPTVNKTQIGKAVGDWY-Y  373

Query  1232  GKEV  1243
              +EV
Sbjct  374   DREV  377



>ref|XP_010266384.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010266385.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
Length=391

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 143/369 (39%), Positives = 220/369 (60%), Gaps = 33/369 (9%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             +  + + + + A GAVCLDGSPPAYH  +G     +NWL+++EGG WC ++  C  R   
Sbjct  24    YVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTNVTTCLFRKNT  83

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--  547
             H GSSK M+    F G        IL+ +  +NP +F NWN + +RYCDG+SFTGD+E  
Sbjct  84    HLGSSKKMVTEIAFSG--------ILSNNKQFNP-DFYNWNRIKVRYCDGASFTGDLEKV  134

Query  548   EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
             +PV NL++RG RI+  + ++LL KG+KNA+   L+G SAG ++  LHCD F  LL    +
Sbjct  135   DPVTNLHYRGARIWLAVIEDLLKKGMKNAEYALLSGCSAGGLASILHCDSFHALLSIGTK  194

Query  728   FKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
              KCL D GYF+++K+ + +  E  +  F +VV+ H S   LP  CT  M  KP +C FPQ
Sbjct  195   VKCLADAGYFVNLKEISGR--EHIKSYFNDVVTTHGSVKNLPTYCTSTM--KPSMCFFPQ  250

Query  908   YLMDGMKTPMFILMSSYDKHQI-NISM------HESFVAANRTIR--EHVQLATPIYEGL  1060
             Y++ G++TP+F+L ++YD  QI NI +      H  +++    I+    +QL T     +
Sbjct  251   YIVHGIRTPLFLLNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKNCSSIQLQT-----M  305

Query  1061  KGFRLQLLDALPNK--PSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYF  1228
             +GFR++ L AL  +   S G+FIN+C+ H  +E+   +  + +  ++N   +KA+ DWY+
Sbjct  306   QGFRMEFLSALLGQRSSSRGMFINSCYAHCQSEMQETWLQDDSPVLDNTPIAKAVGDWYY  365

Query  1229  YGKEVNLID  1255
               +    ID
Sbjct  366   DRRSFQKID  374



>ref|XP_010481611.1| PREDICTED: uncharacterized protein LOC104760390 [Camelina sativa]
Length=391

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 212/370 (57%), Gaps = 30/370 (8%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R    K
Sbjct  25    PITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E  +P
Sbjct  85    GSSKLMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIEAVDP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG++NA+   L+G SAGA++  LHCD+F+ +LP T + K
Sbjct  136   ANKLFFRGARVWRAVIDDLMAKGMRNAQNAILSGCSAGALAAILHCDQFKSILPKTAKVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D GYFIH      K + G    +  +  VV+ H S   LP +CT  M  KP LC FP
Sbjct  196   CVSDAGYFIH-----GKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEGLKGFR  1072
             QY+   ++TP+F++ +++D  QI   +  + V    A +T +  ++  T    + ++G+R
Sbjct  249   QYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYR  308

Query  1073  LQLLDAL-PNKPSV--GIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
              Q+L AL P + +   G+F+++C  H +   A  +  +    V N   +KA+ DW++   
Sbjct  309   DQVLAALAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWFYERS  368

Query  1238  EVNLIDKSEF  1267
                 ID S  
Sbjct  369   TFQNIDCSSL  378



>ref|XP_006280604.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
 gb|EOA13502.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
Length=391

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 210/374 (56%), Gaps = 30/374 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    ARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E
Sbjct  81    STMKGSSKLMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIE  131

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P + L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD+F+ +LP T
Sbjct  132   AVDPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPKT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D GYFIH      K + G    +  +  VV+ H S   LP +CT  M  KP L
Sbjct  192   AKVKCVSDAGYFIH-----GKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+F++ +++D  QI   +  + V    A +T +  ++  T    + +
Sbjct  245   CFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTASQLQTV  304

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +G+R Q+L AL       + G+F+++C  H +   A  +  +    V N   +KA+ DW+
Sbjct  305   QGYRDQVLAALAPVRADTTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWF  364

Query  1226  FYGKEVNLIDKSEF  1267
             F       ID S  
Sbjct  365   FERSTFQNIDCSSL  378



>ref|XP_009601364.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=392

 Score =   256 bits (653),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 206/350 (59%), Gaps = 29/350 (8%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A + GAVCLDGSP AYH+ +G  +  +NW++++EGG WC+ +E+C  R     G S H
Sbjct  38    QDAFSKGAVCLDGSPAAYHYDKGYGDGVNNWVVWLEGGGWCKRVEDCGRRFNYSNGFSNH  97

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             M             FYG+L+     NP EF NW+ ++IRYCDGSS+TGDVE  +   N +
Sbjct  98    M---------DSKSFYGLLSNSKTSNP-EFYNWHRIMIRYCDGSSYTGDVELVDKATNQH  147

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             +RG RIF  I +ELL KG+KNAK   L+G SAG +    HCDRFR LLP+T R KCL DG
Sbjct  148   YRGARIFQAIMEELLAKGMKNAKNAILSGCSAGGLGTMFHCDRFRSLLPSTVRVKCLSDG  207

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
              YF+    ++ K+ +  E T++ VV+LHNS  MLP +CT +M   P  C FPQ++   +K
Sbjct  208   AYFL--LDNDFKRAKILESTYRGVVNLHNSAKMLPPSCTSRM--NPTSCFFPQHIQQDIK  263

Query  929   TPMFILMSSYDKHQINISM-----HESFVAANRTIREHVQLATPIYEG-LKGFRLQLLDA  1090
             TP+FIL S+YD  QI  ++      + F       ++++   +P  +  L+GF  + L A
Sbjct  264   TPLFILNSAYDSWQIVDTVIPFADRQDFA---ENCKKNLSKCSPDQQKMLQGFGAEFLSA  320

Query  1091  LPNKPS---VGIFINNCFFHTEIATGYWANPNSQ-VNNVLDSKAISDWYF  1228
             LP   S    G++IN+C  H +    +  N NS  +NN   +K   DW+F
Sbjct  321   LPKSYSPSQRGMYINSCLMHCQTDHDWSWNSNSDLLNNKTIAKVFGDWFF  370



>ref|XP_010494620.1| PREDICTED: uncharacterized protein LOC104771742 [Camelina sativa]
Length=391

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 212/374 (57%), Gaps = 30/374 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    ARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E
Sbjct  81    STMKGSSKLMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIE  131

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P + L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD+F+ +LP T
Sbjct  132   AVDPANKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSILPKT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D GYFIH      K + G    +  +  VV+ H S   LP +CT  M  KP L
Sbjct  192   AKVKCVSDAGYFIH-----GKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+F++ +++D  QI   +  + V    A +T +  ++  T    + +
Sbjct  245   CFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTV  304

Query  1061  KGFRLQLLDAL-PNKPSV--GIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +G+R Q+L AL P + +   G+F+++C  H +   A  +  +    V N   +KA+ DW+
Sbjct  305   QGYRDQVLAALAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWF  364

Query  1226  FYGKEVNLIDKSEF  1267
             +       ID S  
Sbjct  365   YERSTFQNIDCSSL  378



>ref|XP_009413211.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=397

 Score =   256 bits (653),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 209/372 (56%), Gaps = 34/372 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+   E A   GAVCLDGSPPAYHF  G     +NWL++MEGG WC ++++C  R    +
Sbjct  34    PMTLLEGAVDEGAVCLDGSPPAYHFSPGFGSGMNNWLVHMEGGGWCTNVQDCLARRDTFR  93

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK+M             F GIL      NP +F NWN V IRYCDGSSFTGDV+E  P
Sbjct  94    GSSKYM---------KPLSFSGILGNSQNSNP-DFYNWNKVKIRYCDGSSFTGDVDEVDP  143

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                LYFRG +I+  + +ELL KG+  A+   L+G SAG ++  LHCD+F  LLP     K
Sbjct  144   ATKLYFRGAKIWLAVIEELLAKGMNKAENALLSGCSAGGLASILHCDKFGDLLPAGATVK  203

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             CL D GYFI+ K  +    E  +  +  VVS H S   LP +CT +M   P +C FPQY+
Sbjct  204   CLSDAGYFINAK--DITGTESIKAYYSEVVSTHGSAKNLPSSCTSRM--TPSMCFFPQYV  259

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFRLQL  1081
             +  M+T +FIL ++YD  QI   +  S    ++T  +      Q ++   + ++GFR + 
Sbjct  260   VPQMRTSLFILNAAYDAWQIKNILAPSAADPHKTWNDCKLDIKQCSSDQLQIMQGFRSEF  319

Query  1082  LDALP---NKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             L+AL    N  + G+FIN+C+ H +  +   + A  +  ++N+   KA+ DW++      
Sbjct  320   LNALAALGNSSARGMFINSCYAHCQSGSQDTWLAADSPALDNIPIGKAVGDWFY------  373

Query  1247  LIDKSEFIK-DC  1279
               D+S F K DC
Sbjct  374   --DRSAFRKIDC  383



>ref|XP_011073171.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=422

 Score =   256 bits (655),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 148/380 (39%), Positives = 219/380 (58%), Gaps = 35/380 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T++ F  + + + A A GAVCLDGSPPAYH  +G+    +NWL+++EGG WC ++  C 
Sbjct  44    RTESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWLVHVEGGGWCNNVTTCL  103

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              RT    GSSK M     F G        I +  P +NP +F NWN + +RYCDG+SFTG
Sbjct  104   ARTKTRLGSSKLMAKQIAFSG--------IFSNKPQFNP-DFYNWNRIKVRYCDGASFTG  154

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   LY+RG R+F  + ++LL KG+KNA+   L+G SAG ++  LHCD F+ LL
Sbjct  155   DVEVVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILHCDNFKALL  214

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P   + KC  D G+FI+ K       ++ F   + +VV+ H S   LPQ+CT +M  KP 
Sbjct  215   PVGTKVKCFSDAGFFINAKDVSGAPHIQDF---YNDVVTTHGSAKNLPQSCTSRM--KPS  269

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQI-NI---SMHESFVAANRTIREHVQLATPIYEG  1057
             LC FPQ +  G++TP+FI+ ++YD  QI NI    + +     +    + V+ +T   + 
Sbjct  270   LCFFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCSTTQLQT  329

Query  1058  LKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
             ++ FRLQ L+AL    +  S G FIN C+ H  TE+   ++   +  + N   +KA+ DW
Sbjct  330   MQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQTEMQETWFRGDSPLLYNKTIAKAVGDW  389

Query  1223  YFYGKEVNLIDKSEFIK-DC  1279
             ++        D+S F K DC
Sbjct  390   FY--------DRSPFQKIDC  401



>emb|CDY26383.1| BnaA02g23870D [Brassica napus]
Length=391

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 140/370 (38%), Positives = 209/370 (56%), Gaps = 30/370 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    AGAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E
Sbjct  81    TTMKGSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIE  131

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P + L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD+F+ +LP T
Sbjct  132   AVDPTNKLFFRGARVWRAVIDDLMAKGMNNAQNAILSGCSAGALAAILHCDQFKSILPTT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D G+FIH      K + G    E  +  VVS H S   LP +CT  M  KP L
Sbjct  192   AKVKCVSDAGFFIH-----GKDISGGSYIESYYSKVVSTHGSAKSLPASCTSSM--KPEL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGL  1060
             C FPQY++  M+TP+F++ +++D  QI   +  + V   +  ++      +      + +
Sbjct  245   CFFPQYVVKTMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKCTAAQLQTV  304

Query  1061  KGFRLQLLDAL-PNKPSV--GIFINNCFFHTEIATGY-WANPNS-QVNNVLDSKAISDWY  1225
             + +R Q+L AL P + +   G+F+++C  H +  +   W+     QV N   +KA+ DW+
Sbjct  305   QEYRDQMLAALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGNTKMAKAVGDWF  364

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  365   YERSTFQNID  374



>ref|XP_006652763.1| PREDICTED: protein notum homolog [Oryza brachyantha]
Length=383

 Score =   255 bits (651),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 150/371 (40%), Positives = 210/371 (57%), Gaps = 33/371 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
               KA    ++F + A + GAVCLDGSPP YHF  G+    +NWL++MEGG WC + +EC 
Sbjct  12    SAKAGDVDMVFLKSAVSKGAVCLDGSPPVYHFSPGSGPGANNWLVHMEGGGWCRNSQECS  71

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
             +R    +GSSK M             F GIL     YNP +F NWN V IRYCDGSSFTG
Sbjct  72    VRKGNFRGSSKFM---------RPLSFSGILGGSQKYNP-DFYNWNRVKIRYCDGSSFTG  121

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  E   NL++RG R++N I +ELL+ G+  A+   L+G SAG +S  LHCD+FR +L
Sbjct  122   DVETVETSTNLHYRGARVWNAIIEELLSMGMSKAQNALLSGCSAGGLSAILHCDKFRDML  181

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEG--FELTF-KNVVSLHNSTGMLPQTCTQKMKDK  883
             P T + KC  D GYFI     + K + G  F  TF K +V+LH S   LP +CT KM   
Sbjct  182   PATAKVKCFSDAGYFI-----DGKDITGNNFVRTFYKEIVNLHESAKNLPVSCTSKM--S  234

Query  884   PYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIY  1051
             P +C FPQ ++  ++TP+FIL ++YD  QI   +  S     +T  +        ++   
Sbjct  235   PDMCFFPQNVVPTLRTPLFILNAAYDSWQIKNVLAPSAADKKKTWAQCKLDIKSCSSSQL  294

Query  1052  EGLKGFRLQLLDALP----NKPSVGIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAI  1213
               L+ FR + L ALP    + P++ +FI++C  H +  +   W   +S +V      +A+
Sbjct  295   TILQNFRAEFLAALPKPGQSPPTMSMFIDSCHAHCQSGSQDTWLEEDSPKVEKTQIGRAV  354

Query  1214  SDWYFYGKEVN  1246
              DW FY +EV+
Sbjct  355   GDW-FYDREVS  364



>ref|XP_009397056.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009397057.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 145/361 (40%), Positives = 205/361 (57%), Gaps = 31/361 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+     A A GAVCLDGSPPAYHF  G+    +NWL++MEGG WC ++EEC  R    +
Sbjct  31    PMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLVHMEGGGWCRNVEECLERKNNFR  90

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSS HM             F GIL      NP +F NWN + IRYCDGSSFTGDVE  +P
Sbjct  91    GSSNHM---------KPLSFSGILGNSKKSNP-DFYNWNRIKIRYCDGSSFTGDVERVDP  140

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL++RG R++  I ++LL KG+  A+   L+G SAG ++  LHCD+FR LLP + + K
Sbjct  141   ATNLHYRGARVWLAIMEDLLLKGMNRAENALLSGCSAGGLASILHCDKFRSLLPASAKVK  200

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C  D GYFI  K  +          + +VV+LH S   LP +CT ++   P +C FPQ +
Sbjct  201   CFSDAGYFIDGK--DISGTTSVRSLYNDVVNLHGSGKNLPSSCTSRL--SPSMCFFPQNV  256

Query  914   MDGMKTPMFILMSSYDKHQINISM-------HESFVAANRTIREHVQLATPIYEGLKGFR  1072
             +  M TP+FIL ++YD  QI  ++        +S+ A    I+     ++   E ++ FR
Sbjct  257   VPKMSTPLFILNAAYDAWQIKNTLAPSSADPRKSWNACKLNIK---SCSSDQLEKMQEFR  313

Query  1073  LQLLDALP--NKPSVGIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAISDWYFYGKE  1240
              + L ALP    PS G+FI +C+ H +  +   W   +S  ++ +  +KA+ DW FYG+ 
Sbjct  314   SEFLRALPASGNPSTGMFIISCYAHCQSGSQDTWLGADSPMIDKMPIAKAVGDW-FYGRS  372

Query  1241  V  1243
             V
Sbjct  373   V  373



>ref|XP_006494119.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006494120.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
Length=392

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 150/372 (40%), Positives = 213/372 (57%), Gaps = 35/372 (9%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A A GAVCLDGSPPAYHF +G     +NWL++++GGAWC ++ +C  R     G
Sbjct  31    ITYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNNVADCSNRRDSSYG  90

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK+M+    F G        IL+ +  +NP +F +WN V +RYCDG+SFTGDVE   P 
Sbjct  91    SSKYMVKEANFTG--------ILSNEQNFNP-DFYDWNRVKVRYCDGASFTGDVEAVNPE  141

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  + ++LL KG+KNA+   LTG SAG ++  LHCD FR L P   R KC
Sbjct  142   TNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKC  201

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
               D GYF++VK       +  F   +K VV+LH S   LP +CT ++   P LC FPQ +
Sbjct  202   FADAGYFVNVKDVSGASHIVEF---YKQVVALHGSAKHLPASCTSRL--SPGLCFFPQNV  256

Query  914   MDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQLAT---PIYEGLKGFRLQL  1081
                +KTP+FI+ S+YD  QI NI + +            V + T      + ++GFR+Q 
Sbjct  257   AGQVKTPLFIINSAYDSWQITNILVPDDADPKGTWSSCKVDIKTCSSTQLQTMQGFRVQF  316

Query  1082  LDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             L+AL    N  S G+ I++C+ H  TE    + +  +  ++    +KA+ DWY+      
Sbjct  317   LNALAELGNSSSRGMLIDSCYTHCRTEYQEAWLSADSPVLDKTPIAKAVGDWYY------  370

Query  1247  LIDKSEFIK-DC  1279
               D+S F K DC
Sbjct  371   --DRSPFQKIDC  380



>ref|XP_010266383.1| PREDICTED: uncharacterized protein LOC104603916 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/369 (39%), Positives = 220/369 (60%), Gaps = 33/369 (9%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             +  + + + + A GAVCLDGSPPAYH  +G     +NWL+++EGG WC ++  C  R   
Sbjct  67    YVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTNVTTCLFRKNT  126

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--  547
             H GSSK M+    F G        IL+ +  +NP +F NWN + +RYCDG+SFTGD+E  
Sbjct  127   HLGSSKKMVTEIAFSG--------ILSNNKQFNP-DFYNWNRIKVRYCDGASFTGDLEKV  177

Query  548   EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
             +PV NL++RG RI+  + ++LL KG+KNA+   L+G SAG ++  LHCD F  LL    +
Sbjct  178   DPVTNLHYRGARIWLAVIEDLLKKGMKNAEYALLSGCSAGGLASILHCDSFHALLSIGTK  237

Query  728   FKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
              KCL D GYF+++K+ + +  E  +  F +VV+ H S   LP  CT  M  KP +C FPQ
Sbjct  238   VKCLADAGYFVNLKEISGR--EHIKSYFNDVVTTHGSVKNLPTYCTSTM--KPSMCFFPQ  293

Query  908   YLMDGMKTPMFILMSSYDKHQI-NISM------HESFVAANRTIR--EHVQLATPIYEGL  1060
             Y++ G++TP+F+L ++YD  QI NI +      H  +++    I+    +QL T     +
Sbjct  294   YIVHGIRTPLFLLNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKNCSSIQLQT-----M  348

Query  1061  KGFRLQLLDALPNK--PSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYF  1228
             +GFR++ L AL  +   S G+FIN+C+ H  +E+   +  + +  ++N   +KA+ DWY+
Sbjct  349   QGFRMEFLSALLGQRSSSRGMFINSCYAHCQSEMQETWLQDDSPVLDNTPIAKAVGDWYY  408

Query  1229  YGKEVNLID  1255
               +    ID
Sbjct  409   DRRSFQKID  417



>tpg|DAA36176.1| TPA: pectinacetylesterase [Zea mays]
Length=519

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 157/420 (37%), Positives = 221/420 (53%), Gaps = 51/420 (12%)
 Frame = +2

Query  74    SPLRPHLALICINMAIAQN------CHQWltllvcaal-------lvlQTKANFYPLIFP  214
             SPLRP  A  C++++++           WL      A+          +  +    ++F 
Sbjct  101   SPLRPRRATACVSVSLSARFSPMAASGAWLARATATAVLGFVLAVASAEAASGDVEMVFL  160

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A A GAVCLDGSPP YHF  G+    +NW+++MEGG WC + +EC +R    +GSSK 
Sbjct  161   KAAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCRNPDECAVRKGNFRGSSKF  220

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             M             F GIL  +   NP +F NWN V IRYCDGSSFTGDVE  +   +L 
Sbjct  221   M---------KPLSFSGILGGNQKSNP-DFYNWNRVKIRYCDGSSFTGDVEAVDTAKDLR  270

Query  569   FRGKRIFNVITDELLN-KGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMD  745
             +RG R++  + D+LL  +G+  A+   L+G SAG ++  LHCDRF  L P   + KC  D
Sbjct  271   YRGFRVWRAVIDDLLTVRGMSKAQNALLSGCSAGGLAAILHCDRFHDLFPAKTKVKCFSD  330

Query  746   GGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLM  916
              GYF      + K + G       +K+VV+LH S   LP +CT K K  P LCMFPQY++
Sbjct  331   AGYFF-----DGKDISGNFYARSIYKSVVNLHGSAKNLPASCTSKPKQSPELCMFPQYVV  385

Query  917   DGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---------HVQLATPIYEGLKGF  1069
               M+TP+FIL ++YD  Q+   +  S     +T  +           QL T     L+ F
Sbjct  386   PTMRTPLFILNAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSASQLTT-----LQNF  440

Query  1070  RLQLLDALPNKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYFYGKEV  1243
             R   L ALP   SVG+FI++C  H +  +   + A+ +  VN     KA+ DWY Y +EV
Sbjct  441   RTDFLAALPKTQSVGMFIDSCNAHCQSGSQDTWLADGSPTVNKTQIGKAVGDWY-YDREV  499



>gb|KDO40409.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=372

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 154/365 (42%), Positives = 209/365 (57%), Gaps = 43/365 (12%)
 Frame = +2

Query  236   AVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMNpff  415
             AVCLDGSPPAYHF +G     +NWL++++GGAWC ++E+C  R     GSSKHM+    F
Sbjct  22    AVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNNVEDCSKRRDSSYGSSKHMVKEANF  81

Query  416   pgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PVDNLYFRGKRIF  589
              G        IL+ +  +NP +F +WN V +RYCDG+SFTGDVE   P  NL+FRG R+F
Sbjct  82    TG--------ILSNEQKFNP-DFYDWNRVRVRYCDGASFTGDVEAVNPETNLHFRGARVF  132

Query  590   NVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFIHVK  769
               + ++LL KG+KNA+   LTG SAG ++  LHCD FR L P   R KC  D GYF+   
Sbjct  133   EAVMEDLLAKGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKCFADAGYFV---  189

Query  770   KDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMF  940
               N K V G    E  +K VV+LH S   LP +CT ++   P LC FP+ +   +KTP+F
Sbjct  190   --NAKDVSGESHIEEFYKQVVALHGSAKHLPASCTSRL--SPGLCFFPENVAGQIKTPLF  245

Query  941   ILMSSYDKHQI-NISMHESFVAANRTIREHVQLAT---PIYEGLKGFRLQLLDALP---N  1099
             I+ S+YD  QI NI + E            V + T      + ++GFR+Q L+AL    N
Sbjct  246   IINSAYDSWQISNILVPEDADPKGAWSSCKVDIKTCSSTQLQTMQGFRVQFLNALAGLGN  305

Query  1100  KPSVGIFINNCFFHTEIATGYWANPNSQVNNVLD----SKAISDWYFYGKEVNLIDKSEF  1267
               S G+F+++C+ H    T Y     S  + VLD    +KA+ DWY+        D+S F
Sbjct  306   SSSRGMFVDSCYTHCR--TDYQETWFSADSPVLDKTPIAKAVGDWYY--------DRSPF  355

Query  1268  IK-DC  1279
              K DC
Sbjct  356   QKIDC  360



>ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus]
Length=539

 Score =   259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 209/363 (58%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A   GAVCLDGSPPAYHF +G     +NWLI +EGG WC ++  C  R     G
Sbjct  29    ITYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINNWLIQLEGGGWCNNVTTCLQRRDTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+    F G        IL+  P +NP +F NWN + +RYCDGSSFTGDVE  +  
Sbjct  89    SSKKMVTQLAFSG--------ILSNKPQFNP-DFYNWNRIKVRYCDGSSFTGDVEAVDSA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  I D LL KG+KNAK   L+G SAG +S  LHCD F+ LLP T + KC
Sbjct  140   TNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSILHCDNFKSLLPPTTKVKC  199

Query  737   LMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K  +  Q +EGF   + +VV+ H S   LP +CT KM  KP +C FPQ +
Sbjct  200   LSDAGYFINAKDVSGAQHIEGF---YSDVVTTHGSAKNLPISCTSKM--KPEMCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATPI-YEGLKGFRLQL  1081
             +  ++TP+F++ ++YD  QI   +       + T  E    ++  +PI    ++ FR+Q 
Sbjct  255   VQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQF  314

Query  1082  LDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             L AL    +  S G+FI++C+ H  TE+   +    +  ++    +KA+ DW+F      
Sbjct  315   LSALNGVGSSLSRGLFIDSCYAHCQTEMQETWLRTDSPVLSKTTIAKAVGDWFFDRAPFQ  374

Query  1247  LID  1255
              ID
Sbjct  375   KID  377



>ref|XP_010529277.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=401

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 209/370 (56%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  F  + + + A A GAVCLDGSPPAYH  +G+    +NWLI +EGG WC ++  C 
Sbjct  21    RTEGLFVNITYVKTAMAKGAVCLDGSPPAYHLDKGSGTGINNWLIQLEGGGWCNNVTNCI  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M             F  IL+    YNP +F NWN V IRYCDGSSFTG
Sbjct  81    ARMHTRLGSSKQM--------AKQIAFSAILSNRKQYNP-DFYNWNRVKIRYCDGSSFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+  +P  NL+FRG R++  + ++LL KG+ NA+   L+G SAG ++  LHCD FR LL
Sbjct  132   DVQTVDPATNLHFRGARVWLAVMEDLLAKGMINAENAVLSGCSAGGLASMLHCDSFRALL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KCL D G+F++ +  +   V+     FK+VV+LH S   LP +CT K+   P L
Sbjct  192   PMGTKVKCLSDAGFFVNTR--DVSGVQYIRQYFKDVVTLHGSAKNLPPSCTSKL--NPAL  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHVQLATP-IYEGL  1060
             C FPQY+   ++TP+F+L ++YD  QI   +       N   ++    ++   P   + +
Sbjct  248   CFFPQYVARRIRTPLFLLNAAYDSWQIKNILAPRAADPNGKWQSCELDIKNCQPNQIKVM  307

Query  1061  KGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + FRLQ L A   L   PS G+FI +C+ H  TE  T ++   + ++N    ++A+ DW 
Sbjct  308   QDFRLQFLSAVTGLGKSPSRGMFIVSCYTHCQTETQTSWFWTDSPRLNRTTIARAVGDWV  367

Query  1226  FYGKEVNLID  1255
             +  K    ID
Sbjct  368   YDRKLFQKID  377



>ref|XP_010536220.1| PREDICTED: protein notum homolog isoform X1 [Tarenaya hassleriana]
Length=399

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 209/363 (58%), Gaps = 30/363 (8%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
              +A F  + + +KA A GAVCLDGSPPAYH   G+    +NWLI +EGG WC ++  C  
Sbjct  22    AEALFVDITYVQKAVAKGAVCLDGSPPAYHLDRGSGTGINNWLIQLEGGGWCNNVTNCVA  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R   H GSSK M             F  IL+    YNP +F NWN V IRYCDGSSFTGD
Sbjct  82    RMRTHLGSSKQM--------AKQIAFSAILSNRRQYNP-DFYNWNRVKIRYCDGSSFTGD  132

Query  542   VE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             V+  +P  NL+FRG R++  + ++LL KG++NA+   L+G SAG ++  LHCD FR LLP
Sbjct  133   VQTVDPDTNLHFRGGRVWLAVMEDLLAKGMRNAENAVLSGCSAGGLASMLHCDSFRALLP  192

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEGFELT---FKNVVSLHNSTGMLPQTCTQKMKDKP  886
                + KC+ D G+F+     N + V G E     FK+VV+LH S   LP +CT ++   P
Sbjct  193   MGSKVKCISDAGFFV-----NTRDVSGAEYIREYFKDVVTLHGSAKNLPLSCTSRL--NP  245

Query  887   YLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHVQLATP-IYE  1054
              LC FPQY+   ++TP+F+L ++YD  QI   +       N   ++ +  ++   P   +
Sbjct  246   ALCFFPQYVAQHIRTPLFVLNAAYDSWQIKNILAPRAADPNGKWQSCQLDIKNCQPNQLK  305

Query  1055  GLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISD  1219
              ++ FRL+ L A   L    S G+FI++C+ H  TE  T ++   + +++ V  +KA+ D
Sbjct  306   VMQDFRLEFLSAVIGLGKSSSRGMFIDSCYAHCQTESQTSWFWPDSPRLDRVTIAKAVGD  365

Query  1220  WYF  1228
             W +
Sbjct  366   WVY  368



>gb|KCW72723.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/354 (40%), Positives = 201/354 (57%), Gaps = 26/354 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NWLI  EGGAWC ++  C  R     G
Sbjct  29    ITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEGGAWCNNVTTCLARRDTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M+    F G        IL+    +NP +F NWN + +RYCDG+SFTGDVE   P 
Sbjct  89    SSKQMVKELSFSG--------ILSNKQKFNP-DFYNWNKIKVRYCDGASFTGDVEAVNPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R F  I ++L++KG+ NA+   L G SAG ++  L+CDRFR L+P   + KC
Sbjct  140   TNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAILNCDRFRALVPARTKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K       +E F   +  VV+ H S   LP +CT KM  KP LC FPQ +
Sbjct  200   LADAGYFINAKDVSGASHIENF---YSEVVATHGSAKNLPTSCTSKM--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATP-IYEGLKGFRLQL  1081
             +  ++TP+FI+ ++YD  QI   +       + T R     ++  +P   + ++ FRL+ 
Sbjct  255   VPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1082  LDALP---NKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYF  1228
             L AL      PS G+FI++C+ H +  T   +  N +  V     +KA+ DWY+
Sbjct  315   LRALSAVGTSPSRGMFIDSCYAHCQAGTQETWLRNDSPVVAKTSIAKAVGDWYY  368



>ref|XP_002447050.1| hypothetical protein SORBIDRAFT_06g027560 [Sorghum bicolor]
 gb|EES11378.1| hypothetical protein SORBIDRAFT_06g027560 [Sorghum bicolor]
Length=390

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 148/363 (41%), Positives = 202/363 (56%), Gaps = 34/363 (9%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             ++F + A A GAVCLDGSPP YHF  G+    DNW+    GG WC + +EC +R    +G
Sbjct  35    MVFLKAAVAKGAVCLDGSPPVYHFSPGSGSGADNWV----GGGWCRNPDECAVRKGNFRG  90

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M             F GIL      NP +F NWN + +RYCDGSSFTGDVE  +  
Sbjct  91    SSKFMR---------PLSFSGILGGSQKSNP-DFYNWNRIKVRYCDGSSFTGDVEAVDTA  140

Query  557   DNLYFRGKRIFNVITDELLN-KGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              NL++RG R++  I D+LL  +G+  AK   L+G SAG ++  LHCDRFR L P T + K
Sbjct  141   KNLHYRGFRVWRAIMDDLLTVRGMNKAKYALLSGCSAGGLAAILHCDRFRDLFPATTKVK  200

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C  D GYF      + K + G       +KNVV+LH S   LP +CT K   +P LCMFP
Sbjct  201   CFSDAGYFF-----DGKDISGNYYARSIYKNVVNLHGSAKNLPASCTSK---QPELCMFP  252

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRT---IREHVQLATPI-YEGLKGFR  1072
             QY++  M+TP+FIL ++YD  Q+   +  S     +T    +  ++  +P     L+ FR
Sbjct  253   QYVVPTMRTPLFILNAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSPSQLTTLQNFR  312

Query  1073  LQLLDALPNKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
                L ALP  PSVG+FI++C  H +  +   + A+ +  VN     KA+ DWYF  +   
Sbjct  313   TDFLAALPKTPSVGMFIDSCNAHCQSGSQDTWLADGSPTVNKTQIGKAVGDWYFDREVSR  372

Query  1247  LID  1255
              ID
Sbjct  373   QID  375



>ref|XP_010244170.1| PREDICTED: uncharacterized protein LOC104588061 [Nelumbo nucifera]
Length=399

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/371 (39%), Positives = 214/371 (58%), Gaps = 33/371 (9%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A A GAVCLDGSPPAYH  +G     +NWL+++EGG WC ++  C  R     G
Sbjct  29    ITYVETAVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCNNVTTCLARKNTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+    F G        IL+    +NP +F NWN V +RYCDG+SFTGDVE  +P 
Sbjct  89    SSKQMLTEIAFSG--------ILSNKQQFNP-DFYNWNRVKVRYCDGASFTGDVEAVDPT  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL++RG R++  + ++LL KG+KNA+   L+G SAG ++  LHCD FR LLP   + KC
Sbjct  140   TNLHYRGARVWLAVIEDLLEKGMKNAEYALLSGCSAGGLTSILHCDSFRALLPMGVKVKC  199

Query  737   LMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLM  916
             L D GYFI+ K  +    E  +  + +VV+ H S+  LP +CT  M  KP +C FPQY+ 
Sbjct  200   LADAGYFINAK--DVSGTEHIQAFYDDVVTTHGSSKNLPASCTSTM--KPSMCFFPQYME  255

Query  917   DGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHVQLATPI-YEGLKGFRLQLL  1084
              G++TP+F+L ++YD  QI   +       +      +  ++  +P   + ++GFR++ L
Sbjct  256   QGIRTPLFLLNAAYDSWQIKNILAPGVADPHGYWHNCKLDIKNCSPSQIQTMQGFRVEFL  315

Query  1085  DALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNL  1249
             +AL    N    G+FIN+C+ H  +E+   +  + +  ++    +KA+ DWY+       
Sbjct  316   NALSGLGNSSPRGMFINSCYAHCQSEMQETWLRDDSPVLDKTPIAKAVGDWYY-------  368

Query  1250  IDKSEFIK-DC  1279
              D+S F K DC
Sbjct  369   -DRSPFQKIDC  378



>ref|NP_199341.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 dbj|BAB10249.1| pectin acetylesterase [Arabidopsis thaliana]
 gb|AAL15296.1| AT5g45280/K9E15_6 [Arabidopsis thaliana]
 gb|AED95226.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 208/374 (56%), Gaps = 30/374 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A   P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R 
Sbjct  21    ARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRK  80

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                KGSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E
Sbjct  81    STMKGSSKLMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIE  131

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P   L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD+F+  LP T
Sbjct  132   AVDPTHKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSTLPKT  191

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KC+ D GYFIH      K + G    +  +  VV+ H S   LP +CT  M  KP L
Sbjct  192   AKVKCVSDAGYFIH-----GKDITGGSYIQSYYAKVVATHGSAKSLPASCTSSM--KPDL  244

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+F++ +++D  QI   +  + V    A +T +  ++  T    + +
Sbjct  245   CFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTV  304

Query  1061  KGFRLQLLDALPNKPSV---GIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWY  1225
             +G+R Q+L AL    S    G+F+++C  H +   A  +  +    V N   +KA+ DW+
Sbjct  305   QGYRDQVLAALAPVRSATTNGLFLDSCHAHCQGGSAATWSGDKGPTVANTKMAKAVGDWF  364

Query  1226  FYGKEVNLIDKSEF  1267
             F       +D S  
Sbjct  365   FERSTFQNVDCSSL  378



>emb|CDY09287.1| BnaC03g63170D [Brassica napus]
Length=391

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/362 (39%), Positives = 205/362 (57%), Gaps = 31/362 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCSARKNTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL      NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQNTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T R K
Sbjct  136   ANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPPTARVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D GYFIH        + G    +  +  VV+LH S   LP +CT KM  KP LC FP
Sbjct  196   CVSDAGYFIH-----GTDISGGSYIQTYYSKVVALHGSAKSLPVSCTSKM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR  1072
             Q ++  M+TP+F++ +++D  QI   +  + V   +  +    +  +      + ++GFR
Sbjct  249   QNVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKHDLKKCTAAQLKTVQGFR  308

Query  1073  LQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
              Q++ AL    + PS G+F+++C  H +   A  +      QV N   S+A+ +W FYG+
Sbjct  309   DQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANSKISQAVGNW-FYGR  367

Query  1238  EV  1243
               
Sbjct  368   SA  369



>ref|XP_010676220.1| PREDICTED: uncharacterized protein LOC104892094 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 145/360 (40%), Positives = 211/360 (59%), Gaps = 28/360 (8%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
               A A GAVCLDGS PAYH   G     ++WL+++EGG WC +I  C  R   H GSS  
Sbjct  33    RSAVAKGAVCLDGSAPAYHLHRGHGTGINSWLVHVEGGGWCNNITTCLERKYSHLGSSWK  92

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PVDNLY  568
             M        D    F GIL+ +P +NP +F NWN V IRYCDG+SFTG+VE   P+  L+
Sbjct  93    M--------DKQLAFSGILSNNPMFNP-DFYNWNRVKIRYCDGASFTGNVEAVNPITKLH  143

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RI++ + ++LL KG++NAK   L+G SAG ++  LHCD FR LLP   R KCL D 
Sbjct  144   FRGARIWHAVIEDLLLKGMRNAKNAILSGCSAGGLTSILHCDSFRALLPVGARVKCLSDA  203

Query  749   GYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGM  925
             GYFI+VK       V  +   F  +V+LH S   LP +CT+ +  KP +C FPQY+    
Sbjct  204   GYFINVKDVSGASHVASY---FNQIVNLHGSAKSLPASCTRSL--KPVMCFFPQYMAKRT  258

Query  926   KTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYEGLKGFRLQLLDA  1090
             +TP+FIL ++YD  QI  ++    VA  R +    ++     +T     ++ FR + L+A
Sbjct  259   RTPLFILNAAYDSWQIK-NILAPVVADPRGLWSDCKIDIKNCSTNQLSVMQDFRSEFLNA  317

Query  1091  ---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLID  1255
                L   PS G+FIN+C+ H  TE+   ++++ +  ++    +KA+ DW++  +++ +ID
Sbjct  318   ISKLGKSPSRGLFINSCYAHCQTEMQETWFSHHSPVLHKTTIAKAVGDWFYNRRQLQMID  377



>ref|XP_010056136.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW72724.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
 gb|KCW72725.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=399

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/354 (40%), Positives = 201/354 (57%), Gaps = 26/354 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NWLI  EGGAWC ++  C  R     G
Sbjct  29    ITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEGGAWCNNVTTCLARRDTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M+    F G        IL+    +NP +F NWN + +RYCDG+SFTGDVE   P 
Sbjct  89    SSKQMVKELSFSG--------ILSNKQKFNP-DFYNWNKIKVRYCDGASFTGDVEAVNPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R F  I ++L++KG+ NA+   L G SAG ++  L+CDRFR L+P   + KC
Sbjct  140   TNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAILNCDRFRALVPARTKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K       +E F   +  VV+ H S   LP +CT KM  KP LC FPQ +
Sbjct  200   LADAGYFINAKDVSGASHIENF---YSEVVATHGSAKNLPTSCTSKM--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATP-IYEGLKGFRLQL  1081
             +  ++TP+FI+ ++YD  QI   +       + T R     ++  +P   + ++ FRL+ 
Sbjct  255   VPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1082  LDALP---NKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYF  1228
             L AL      PS G+FI++C+ H +  T   +  N +  V     +KA+ DWY+
Sbjct  315   LRALSAVGTSPSRGMFIDSCYAHCQAGTQETWLRNDSPVVAKTSIAKAVGDWYY  368



>ref|XP_009624845.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=390

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 154/360 (43%), Positives = 200/360 (56%), Gaps = 33/360 (9%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
               A + GAVCLDGSPPAYHF  G  E   NWL+ + GG WC ++++C  R+    GSS +
Sbjct  43    HSAVSKGAVCLDGSPPAYHFDPGFGEGVGNWLVQLSGGGWCTNVKDCLNRSKSDVGSSSY  102

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             M         +   F GI +++ + NP +F NWN V +RYCDG SFTGDVE  +P  NL+
Sbjct  103   M---------HPQPFKGIFSKNQSANP-DFYNWNKVFVRYCDGGSFTGDVEYVDPATNLH  152

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RIF  + +ELL KGLKNAK   L G SAG     L+CDRFR LLPNT R KCL+D 
Sbjct  153   FRGARIFTAVLEELLAKGLKNAKNAILAGSSAGGYPAILYCDRFRNLLPNTSRVKCLVDS  212

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVS--LHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDG  922
             GYF+H K  NP     FE  +K V +  L  S   LP++CT KM  KP LC+F + +   
Sbjct  213   GYFVHFK--NPVLGRPFESIYKGVATLQLQGSAKTLPKSCTSKM--KPELCLFAENIQQD  268

Query  923   MKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGF---RLQLLDAL  1093
             +KTP+FI MS++D      ++         TI   +Q  T      K F   R   L A+
Sbjct  269   IKTPIFISMSAFDNIMTQYTL-------GGTIYGCIQNGTCTASQNKTFQEMRSDFLSAI  321

Query  1094  P--NKPSV-GIFINNCFFHTEIATGYWANPNSQ--VNNVLDSKAISDWYFYGKEVNLIDK  1258
             P  N P + G+FI+    HT +      +P     V+N+   KA SDWYF      LID+
Sbjct  322   PKGNNPKLRGVFIDVVHHHTSLQKQTRWSPEKPIVVHNLAAPKAFSDWYFDRNYTYLIDE  381



>ref|XP_009108426.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDX76482.1| BnaA08g09180D [Brassica napus]
Length=391

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 141/362 (39%), Positives = 205/362 (57%), Gaps = 31/362 (9%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCSARKNTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL      NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQNTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T R K
Sbjct  136   ANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPPTARVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D GYFIH        + G    +  +  VV+LH S   LP +CT KM  KP LC FP
Sbjct  196   CVSDAGYFIH-----GTDISGGSYIQTYYSKVVALHGSAKSLPVSCTSKM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR  1072
             Q ++  M+TP+F++ +++D  QI   +  + V   +  +    +  +      + ++GFR
Sbjct  249   QNVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKCTAAQLKTVQGFR  308

Query  1073  LQLLDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGK  1237
              Q++ AL    + PS G+F+++C  H +   A  +      QV N   S+A+ +W FYG+
Sbjct  309   DQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANSKISQAVGNW-FYGR  367

Query  1238  EV  1243
               
Sbjct  368   SA  369



>ref|XP_007209217.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|EMJ10416.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|AIA21744.1| pectin acetylesterase [Prunus persica]
Length=398

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/380 (40%), Positives = 214/380 (56%), Gaps = 37/380 (10%)
 Frame = +2

Query  185   KANFYP--LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             KA  +P  +   E A A GAVCLDGS PAYHF +G     +NWL+++EGG WC S+E C 
Sbjct  21    KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNSVETCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   ++GSS  M        +    F G+L     +NP +F NWN + +RYCDGSSFTG
Sbjct  81    DRKNTYRGSSNKM--------EKSMSFSGVLGNKQKFNP-DFYNWNRIKVRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE   P  NL+FRG R+F  I D+LL KG+KNA+   L+G SAG ++  L+CD FR LL
Sbjct  132   DVEAVNPATNLHFRGARVFRAIIDDLLAKGMKNAQSALLSGCSAGGLASILNCDNFRSLL  191

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P   + KCL D GYFI+ K     +Q++ F   +  VV+LH S   LP +CT K+   P 
Sbjct  192   PVGTKVKCLADAGYFINAKTVSGSQQIQAF---YSEVVALHGSAKNLPASCTSKL--SPG  246

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEG  1057
             LC FPQ ++   +TP+F++ ++YD  QI   +         A +  +  ++  +P   + 
Sbjct  247   LCFFPQNVVPVTRTPIFLVNAAYDSWQIKNILAPGIADPKGAWKKCKLDIKNCSPSQLQT  306

Query  1058  LKGFRLQLLDALPNKPSV---GIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDW  1222
             ++ +RLQ L AL +  S    G+FI++C+ H +I T   W   +S V +     KA+ DW
Sbjct  307   MQEYRLQFLGALSHASSSTTHGLFIDSCYAHCQIGTQETWLAADSPVLSKTTIGKAVGDW  366

Query  1223  YFYGKEVNLIDKSEFIK-DC  1279
             Y         D++ F K DC
Sbjct  367   Y--------TDRTPFQKIDC  378



>emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata]
Length=399

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 205/363 (56%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + F E A A GAVCLDGSPPAYHF +G+    +NW+++ EGG WC ++  C  R     G
Sbjct  29    ITFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNNVTSCLSRRDTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M        D    F G  +    +NP +F +WN + +RYCDGSSFTGDVE  +P 
Sbjct  89    SSKKM--------DTQLSFSGFFSNSKKFNP-DFYDWNRIKVRYCDGSSFTGDVEAVDPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  + D+LL KG+KNA+   ++G SAG ++  L+CDRF+ LLP T + KC
Sbjct  140   TNLHFRGSRVFAAVVDDLLAKGMKNAQNAIISGCSAGGLAAILNCDRFKSLLPRTTKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+VK     +++E F   +  VV  H S   LP +CT ++  +P LC FPQ +
Sbjct  200   LADAGYFINVKDVSGAQRIEEF---YSQVVQTHGSAKNLPASCTSRL--RPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFR---  1072
             +  + TP+F + ++YD  QI   +       + T RE      + ++     ++ FR   
Sbjct  255   VSQISTPIFFVNAAYDSWQIKNILAPGAADPHGTWRECKLDIKKCSSNQLSAMQVFRTDF  314

Query  1073  LQLLDALPNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYFYGKEVN  1246
             L+   A+ N PS G FI+ C+ H +  T   W   +S V  +   +KA+ DWY+  K   
Sbjct  315   LRAFGAVGNSPSKGHFIDGCYAHCQTGTQETWLRNDSPVLGSTTIAKAVGDWYYDRKPFK  374

Query  1247  LID  1255
              ID
Sbjct  375   QID  377



>ref|XP_006398195.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
 gb|ESQ39648.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
Length=391

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 208/357 (58%), Gaps = 30/357 (8%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + E A A GAVCLDGS PAYHF +G+    +NW+++MEGG WC  I  C  R    K
Sbjct  25    PITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKSTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTGD+E  +P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGDIEAVDP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+ NA+   L+G SAGA++  LHCD F+ ++P T + K
Sbjct  136   TNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDEFKSIIPKTAKVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C+ D G+FIH      K + G    E  +  VV+ H S   LP +CT  M  KP LC FP
Sbjct  196   CVSDAGFFIH-----GKDISGGSYIESYYGKVVATHGSAKSLPVSCTSSM--KPELCFFP  248

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHVQLATPI-YEGLKGFR  1072
             QY++  M+TP+F++ +++D  QI   +  + V      +T +  ++  T    + ++G+R
Sbjct  249   QYVVKTMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKTCKLDLKKCTAAQLQTVQGYR  308

Query  1073  LQLLDAL-PNKPSV--GIFINNCFFHTEIATGY-WANPNS-QVNNVLDSKAISDWYF  1228
              Q+L AL P + +   G+F+++C  H +  +   W+     QV +   +KA+ DW++
Sbjct  309   DQMLAALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQVGDTKMAKAVGDWFY  365



>ref|XP_006413981.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
 gb|ESQ55434.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
Length=564

 Score =   258 bits (658),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 209/366 (57%), Gaps = 25/366 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25    PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGINNWIVHMEGGGWCTDVASCIKRKGTMK  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
             GSSK M  +  F G        IL      NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85    GSSKFMNKDFGFSG--------ILGGKQNTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T R K
Sbjct  136   ANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C+ D GYFIH K  +       +  +  VV+LH S   LP +CT KM  +P LC FPQY+
Sbjct  196   CVSDAGYFIHGKDISGGSY--IQSYYSKVVALHGSAKSLPLSCTSKM--RPELCFFPQYV  251

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQL  1081
             +  M+TP+F++ +++D  QI   +  + V   +  +    +  + +    + ++GFR Q+
Sbjct  252   VPFMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKTCKLDLKKCSAAQLKTVQGFRDQM  311

Query  1082  LDALP---NKPSVGIFINNCFFHTE--IATGYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             + AL    + PS G+F+++C  H +   A  +      QV N   +KA+ +W FYG+   
Sbjct  312   MRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQVANTKIAKAVGNW-FYGRIFT  370

Query  1247  LIDKSE  1264
              I  S 
Sbjct  371   FIPISR  376



>ref|XP_010677538.1| PREDICTED: protein notum homolog isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   253 bits (645),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 145/363 (40%), Positives = 201/363 (55%), Gaps = 24/363 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A G VCLDGSPPAYHF +G      NWLI+MEGGAWC +   C  RT    
Sbjct  25    PITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHNWLIHMEGGAWCNNATTCLERTKTRL  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSSK M     F G        IL+    Y+P +F NWN + +RYCDGSSFTGDVE  +P
Sbjct  85    GSSKLMTKQYTFSG--------ILSNQAKYSP-DFYNWNRIKVRYCDGSSFTGDVEAVDP  135

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                +Y+RG R++  I D+LL KG+KNA+   L G SAG +   L CD FR LLP+  + K
Sbjct  136   KAKVYYRGARLWRAIMDDLLAKGMKNAENAILAGCSAGGLGAILQCDNFRALLPSGAKVK  195

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             CL D G+FI+ K  +   V   +  F +VV+ H S   LP +CT K    P LC FP+Y 
Sbjct  196   CLSDAGFFINAK--DISGVSHIQEVFADVVTTHGSAKNLPPSCTSKF--DPKLCFFPEYA  251

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFR---  1072
               G++TP+F+L ++YD  QI  ++       + T  +     ++ +    + + GFR   
Sbjct  252   ARGIQTPLFLLNAAYDAWQIKNTLAPGVADRHGTWHDCKSDIIKCSNSQIQIMHGFRQDF  311

Query  1073  LQLLDALPNKPSVGIFINNCFFHTEIATG-YWANPNSQ-VNNVLDSKAISDWYFYGKEVN  1246
             L  L +L N  S G +IN+C+ H +  T   W   +S  ++N    KA+ DW++  K   
Sbjct  312   LAALSSLGNSNSRGFYINSCYSHCQSGTQETWLRDDSPLLDNTTICKAVGDWFYDRKPFQ  371

Query  1247  LID  1255
              ID
Sbjct  372   KID  374



>ref|XP_003547822.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26082.1| Protein notum like [Glycine soja]
Length=398

 Score =   253 bits (645),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 210/364 (58%), Gaps = 26/364 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + + +  PL   + A++ GAVCLDGSPPAYHF  G  E   NW++++EGG WC ++E C 
Sbjct  21    KAEGSLVPLTLVKNAESKGAVCLDGSPPAYHFDNGFEEGIKNWIVHIEGGGWCNNVESCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M          D  F  IL+ +  YNP +F NWN V +RYCDGSSFTG
Sbjct  81    YRKDSRLGSSKQM---------EDLYFSAILSNEQEYNP-DFYNWNRVKVRYCDGSSFTG  130

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVEE     NL+FRG RIF+ + +ELL KGL+ A+   L+G SAG ++  LHCDRF+ LL
Sbjct  131   DVEEVDQTTNLHFRGARIFSAVMEELLAKGLEKAENAILSGCSAGGLTTILHCDRFKNLL  190

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P+    KC+ D GYF++V  ++       E  +  VVS H S   LP +CT K    P L
Sbjct  191   PSEANVKCVPDAGYFVNV--EDISGTHFIEKFYSEVVSTHGSAKNLPSSCTSKF--SPEL  246

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAAN--RTIREHVQLATP-IYEGL  1060
             C FPQY+   + TP+F++ ++YD  QI NI +  S   ++   + +  +   +P     +
Sbjct  247   CFFPQYVASHISTPIFVVNAAYDSWQIQNIFVPGSADPSDSWHSCKLDISNCSPDQLSKM  306

Query  1061  KGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + F+ +   A+    +  S G+FI++C+ H  TE    ++ + + Q+ N   +KA+ DW 
Sbjct  307   QDFKSEFEKAVSVVGDSSSKGMFIDSCYAHCQTESQETWYKSDSPQLANTTIAKAVGDW-  365

Query  1226  FYGK  1237
             FYG+
Sbjct  366   FYGR  369



>ref|XP_010644665.1| PREDICTED: uncharacterized protein LOC100245856 [Vitis vinifera]
 emb|CBI29219.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   253 bits (645),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 146/381 (38%), Positives = 214/381 (56%), Gaps = 37/381 (10%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  +  + + + A A GAVCLDGSPPAYH  +G     +NWL+++EGG WC +   C 
Sbjct  21    KTEGFYVGITYVDSAVAKGAVCLDGSPPAYHMDKGFGAGINNWLVHIEGGGWCNNASTCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+    F G        IL+    +NP +F NWN + +RYCDG+SFTG
Sbjct  81    ARRDNRLGSSKQMVKQIAFSG--------ILSNKQKFNP-DFYNWNKIKVRYCDGASFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P  NL++RG R+F  + ++L+ KG+KNA    L+G SAG ++  LHCD+FR LL
Sbjct  132   DVEAVDPKTNLHYRGARVFLAVIEDLMAKGMKNAANAVLSGCSAGGLTAILHCDKFRALL  191

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P + + KC  D GYFI+ K       +EGF   +  VV+ H S   LP +CT  +  +P 
Sbjct  192   PVSTKVKCFADAGYFINAKDVSGAAHIEGF---YSEVVATHGSAKNLPPSCTSSL--RPG  246

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYE  1054
             LC FPQ +   +KTP+FI+ ++YD  QI  ++    VA       + +L     ++   E
Sbjct  247   LCFFPQNMAQQIKTPLFIINAAYDSWQIK-NILAPGVADPHGTWHYCKLDIKDCSSSQLE  305

Query  1055  GLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISD  1219
              ++ FR+Q L A   L   PS G+FIN+C+ H  TE+   +  + +  +     +KA+ D
Sbjct  306   AMQDFRVQFLSAIKGLIGSPSKGMFINSCYAHCQTEMQETWLRDDSPVLGKTTIAKAVGD  365

Query  1220  WYFYGKEVNLIDKSEFIK-DC  1279
             WY+        D+S F K DC
Sbjct  366   WYY--------DRSPFQKIDC  378



>ref|XP_007156332.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
 gb|ESW28326.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
Length=399

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 144/361 (40%), Positives = 210/361 (58%), Gaps = 24/361 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + + +  PL   E A + GAVCLDGSPPAYHF +G  E  +NW+++MEGG WC+  ++C 
Sbjct  21    KAEGSLVPLTLVENALSKGAVCLDGSPPAYHFDKGDGEGINNWIVHMEGGGWCKDADDCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+ + +F G        IL+ +  YNP +F NW+ V IRYCDGSSFTG
Sbjct  81    GRKDTRLGSSKQMVEDLYFSG--------ILSNEREYNP-DFYNWDRVKIRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVEE  P +NLYFRG RIF+ + ++LL KG++ A+   L+G SAG ++  LHCD F+ LL
Sbjct  132   DVEEVDPTNNLYFRGARIFSAVMEDLLAKGMEKAENAILSGCSAGGLTTILHCDNFKALL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P+    KC+ D GYFI+V+  +  +    E  +  VVS H S   LP +CT K+     L
Sbjct  192   PSKATVKCVPDAGYFINVEDISGARF--IEDYYSKVVSTHGSAKNLPTSCTSKLSSG--L  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQLAT------PIY  1051
             C FPQY+   + TP+FI+ S+YD  QI NI    +   ++      + LA        I 
Sbjct  248   CFFPQYVASHISTPIFIVNSAYDSWQIRNILAPGAADPSDNWHSCKLDLAKCSPDQLSIV  307

Query  1052  EGLKGFRLQLLDALPNKPSVGIFINNCFFHTEIATG-YWANPNS-QVNNVLDSKAISDWY  1225
             +G K    + +  + +  S G+FIN+C+ H +  +   W+  +S  + N   SKA+ +W+
Sbjct  308   QGFKKEFEKAVSVVGDSSSNGMFINSCYDHCQTESQETWSKSDSPHLANTTISKAVGNWF  367

Query  1226  F  1228
             +
Sbjct  368   Y  368



>gb|KCW72722.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/354 (40%), Positives = 201/354 (57%), Gaps = 26/354 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NWLI  EGGAWC ++  C  R     G
Sbjct  29    ITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEGGAWCNNVTTCLARRDTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M+         +  F GIL+    +NP +F NWN + +RYCDG+SFTGDVE   P 
Sbjct  89    SSKQMV--------KELSFSGILSNKQKFNP-DFYNWNKIKVRYCDGASFTGDVEAVNPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R F  I ++L++KG+ NA+   L G SAG ++  L+CDRFR L+P   + KC
Sbjct  140   TNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAILNCDRFRALVPARTKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K       +E F   +  VV+ H S   LP +CT KM  KP LC FPQ +
Sbjct  200   LADAGYFINAKDVSGASHIENF---YSEVVATHGSAKNLPTSCTSKM--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATP-IYEGLKGFRLQL  1081
             +  ++TP+FI+ ++YD  QI   +       + T R     ++  +P   + ++ FRL+ 
Sbjct  255   VPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1082  LDALP---NKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYF  1228
             L AL      PS G+FI++C  H +  T   +  N +  V     +KA+ DWY+
Sbjct  315   LRALSAVGTSPSRGMFIDSCNTHCQAGTEATWLRNDSPIVAKTSIAKAVGDWYY  368



>emb|CAD41867.2| OSJNBa0041A02.14 [Oryza sativa Japonica Group]
 emb|CAH67867.1| B0403H10-OSIGBa0105A11.19 [Oryza sativa Indica Group]
Length=396

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 209/372 (56%), Gaps = 35/372 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
               KA    ++F + A + GAVCLDGSPP YHF  G+    +NWL++MEGG WC + +EC 
Sbjct  25    SAKAGDVDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECS  84

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
             +R    +GSSK M             F GI+  +   NP +F NWN + +RYCDGSSFTG
Sbjct  85    VRQGNFRGSSKFMR---------PLSFSGIIGGNQRNNP-DFYNWNRIKVRYCDGSSFTG  134

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  E   NL+FRG R++N I ++LL KG+  A+   L+G SAG ++  LHCD+FR LL
Sbjct  135   DVETVETSTNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLL  194

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEG--FELTF-KNVVSLHNSTGMLPQTCTQKMKDK  883
             P T   KC  D G+F+     + K + G  F  TF K+VV+LH S   LP +CT KM   
Sbjct  195   PATANVKCFSDAGFFV-----DGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKM--S  247

Query  884   PYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIY  1051
             P LC FPQ ++  ++TP+FIL ++YD  QI   +  S     +T      +    ++   
Sbjct  248   PDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQL  307

Query  1052  EGLKGFRLQLLDALPNKP-----SVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKA  1210
               L+ FR   L ALP KP     ++ IFI++C+ H +  +   + A  +  V      KA
Sbjct  308   TTLQNFRTDFLAALP-KPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKA  366

Query  1211  ISDWYFYGKEVN  1246
             + DW F+ +EV+
Sbjct  367   VGDW-FHDREVS  377



>ref|XP_010056135.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
Length=392

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 141/354 (40%), Positives = 203/354 (57%), Gaps = 26/354 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NWLI++EGG WC ++  C  R     G
Sbjct  29    ITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLIFVEGGGWCNNVTTCLARRDTRVG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M+         +  F GIL+    +NP +F NWN + +RYCDG+SFTGDVE   P 
Sbjct  89    SSKQMV--------KELSFSGILSNKQKFNP-DFYNWNKIKVRYCDGASFTGDVEAVNPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R F  I ++L++KG+ NA+   L+G SAG ++  L+CDRFR L+P   + KC
Sbjct  140   TNLHFRGARAFVAIVEDLMSKGMSNAQNAILSGCSAGGLAAILNCDRFRALMPARTKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K       +E F   +  VV+ H S   LP +CT KM  KP LC FPQ +
Sbjct  200   LADAGYFINAKDVSGASHIENF---YSEVVATHGSAKNLPTSCTSKM--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRT---IREHVQLATP-IYEGLKGFRLQL  1081
             +  ++TP+FI+ ++YD  QI   +       + T    +  ++  +P   + ++ FRL+ 
Sbjct  255   VPQIQTPLFIINAAYDAWQIKNILAPGVADPHGTWNSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1082  LDALP---NKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYF  1228
             L AL      PS G+FI++C  H +  T   +  N +  V     +KA+ DWY+
Sbjct  315   LRALSAVGTSPSRGMFIDSCNTHCQAGTEATWLRNDSPIVAKTSIAKAVGDWYY  368



>ref|XP_006355154.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=409

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 150/346 (43%), Positives = 203/346 (59%), Gaps = 30/346 (9%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A + GAVCLDGSPPAYHF  G  +    WL+ + GG WC ++E C  R+    GSS  
Sbjct  45    KNAVSKGAVCLDGSPPAYHFEPGFGDGAQTWLVQLSGGEWCRTVEACLERSKSEFGSSN-  103

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
              +MN ++          + +++ + NP EF NWN V IRYCDG  FTGDVE  +P   L+
Sbjct  104   -LMNSWWFTG-------MFSKNQSGNP-EFYNWNKVFIRYCDGGGFTGDVEYVDPATKLH  154

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RIF  + DELL KGLK AK   L G SAG     L+CD FR LLPNT R KC+ D 
Sbjct  155   FRGARIFKAVMDELLEKGLKTAKSALLGGSSAGGFPAMLYCDYFRTLLPNTPRVKCMNDA  214

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             GYFI+ K+  P +    EL +  +V+LH S   LP+ CT KM   P LC FP+ +   +K
Sbjct  215   GYFINAKE--PFRANFTEL-YTALVTLHGSAKALPKECTSKM--SPELCFFPENMQQYVK  269

Query  929   TPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALPNKPS  1108
             TP+FI  S+YDK+QIN S+    V  N  I      AT     L+ FR + L+ALP KP+
Sbjct  270   TPLFIASSAYDKYQINNSIA---VGINTCIGSSNCTATTNQTFLE-FRSRFLNALP-KPT  324

Query  1109  ----VGIFINNCFFHTEIATGYWANP--NSQVNNVLDSKAISDWYF  1228
                  G+FI++   H+++   +W +P   + +NN+  SKA +DW++
Sbjct  325   NPKLKGVFIDSFNHHSQVQ--FWWSPFNITTINNLTLSKAFADWFY  368



>gb|AAP72959.1| pectin acetylesterase [Lactuca sativa]
Length=395

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 147/372 (40%), Positives = 199/372 (53%), Gaps = 28/372 (8%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             T+A    L F   A A GAVCLDGS PAYH  +G     DNWL++ EGG WC +   C  
Sbjct  23    TEAYDVGLTFLNSAVAKGAVCLDGSAPAYHIDKGFGAGIDNWLVFFEGGGWCNNATNCLT  82

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M+    F G        + +    YNP +F +WN + +RYCDG+SFTGD
Sbjct  83    RRDTRLGSSKKMLTTETFSG--------MFHNKAKYNP-DFYDWNRIKVRYCDGASFTGD  133

Query  542   VE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE  +P   LY+RG RIF  + D+LL KG+KNAK   L G SAG ++  L CD FR  LP
Sbjct  134   VEAVDPNTKLYYRGARIFRAVVDDLLAKGMKNAKNAILAGCSAGGLTSILQCDNFRSQLP  193

Query  716   NTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              T + KCL D G+FI+ K       +EGF   + +VV  H S  +L   C  KM   P L
Sbjct  194   ATTKVKCLSDAGFFINAKTIIGQSHIEGF---YADVVRTHGSAKVLSPACLAKM--SPGL  248

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGL  1060
             C FPQ ++  +KTP+F++ ++YD  Q+   +         T RE      + ++     L
Sbjct  249   CFFPQNMVQFIKTPIFLINAAYDSWQVKNILAPGVADRKGTWRECKLDITKCSSAQLNVL  308

Query  1061  KGFRLQLLDAL-----PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISD  1219
             +G+RL+ L AL      N PS G+FIN+C+ H  T I   +  N +  + N   +KA+ D
Sbjct  309   QGYRLEFLKALNGFGNGNSPSRGMFINSCYSHCQTGIQETWLRNDSPLLGNTTIAKAVGD  368

Query  1220  WYFYGKEVNLID  1255
             WY+       ID
Sbjct  369   WYYERNTFQKID  380



>ref|XP_010942975.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
 ref|XP_010942976.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=397

 Score =   251 bits (640),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 138/361 (38%), Positives = 204/361 (57%), Gaps = 24/361 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + +  F  + + E A A GAVCLDGSPPAYH   G     +NWL+++EGG WC ++  C 
Sbjct  21    KAEGYFVDITYVESALAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEGGGWCNNVTTCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSS+HM             F GILN    +NP +F NWN V +RYCDGSSFTG
Sbjct  81    ARKNSRLGSSRHM--------AKQIAFSGILNNRQTFNP-DFYNWNKVKVRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE   P  NL++RG R++  + ++LL KG+  AK   L+G SAG ++  LHCD FR +L
Sbjct  132   DVERVNPATNLHYRGARVWLAVMEDLLAKGMSKAKNALLSGCSAGGLTSILHCDNFRAIL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   R KCL D GYFI +K  +    E  +  F +VV+ H S   LP +CT ++   P +
Sbjct  192   PLGTRAKCLSDAGYFIDMK--DVTGAEHIKAFFNDVVTTHGSAQNLPSSCTSRL--TPSM  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGL  1060
             C FPQ ++  + TP+FIL ++YD  QI   +       + T      +  Q ++P  + +
Sbjct  248   CFFPQNMVQQIHTPLFILNAAYDSWQIRNILVPGVADPHGTWHYCKLDIQQCSSPQLQIM  307

Query  1061  KGFRLQLLDALPN---KPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             +GFR + L+AL       S G+FIN+C+ H  +E+   + ++ +  +  +  +KA+ DW+
Sbjct  308   QGFRTEFLNALAGFGRSSSTGMFINSCYAHCQSEMQETWLSSDSPVLEKMPIAKAVGDWF  367

Query  1226  F  1228
             +
Sbjct  368   Y  368



>ref|XP_008347803.1| PREDICTED: uncharacterized protein LOC103410929 [Malus domestica]
Length=401

 Score =   251 bits (640),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 148/380 (39%), Positives = 212/380 (56%), Gaps = 37/380 (10%)
 Frame = +2

Query  185   KANFYP--LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             KA  +P  L   E A A GAVCLDGS  AYHF +G     +NWL+++EGG WC ++E+C 
Sbjct  24    KAESHPVALTLVENAVAKGAVCLDGSAXAYHFDKGFGAGINNWLVHVEGGGWCNTVEDCL  83

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   ++GSS  M        +    F G+L   P  NP +F NWN + +RYCDGSSFTG
Sbjct  84    DRKSNYRGSSTKM--------EKTMSFSGVLGNKPKTNP-DFYNWNRIKVRYCDGSSFTG  134

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P  NL+FRG R+F  I D LL KG+KNA+   L+G SAG ++  LHCD FR LL
Sbjct  135   DVEAVDPATNLHFRGARVFRAIIDXLLAKGMKNAQNALLSGCSAGGLTSILHCDNFRSLL  194

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P   + KCL D GYFI+ K     + ++GF   +  VV+LH S   LP +CT +M   P 
Sbjct  195   PVGTKVKCLADAGYFINAKSLSGSZHIQGF---YSEVVALHGSAKNLPASCTSRM--SPG  249

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEG  1057
             LC FPQ ++    TP+F++ ++YD  QI   +         A +  + +++  +P   + 
Sbjct  250   LCFFPQNVVPQTXTPIFLVNAAYDSWQIKNILAPGVADPKGAWKKCKLNIKNCSPSQLQT  309

Query  1058  LKGFRLQLLDALPNKPSV---GIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDW  1222
             L+ +RLQ L  +    +    G FI++CF H +I T   + A  +  ++    + A+ DW
Sbjct  310   LQEYRLQFLKTIAXSSTSSSHGAFIDSCFAHCQIGTQETWLAADSPMLSKTTIANAVGDW  369

Query  1223  YFYGKEVNLIDKSEFIK-DC  1279
             Y+        D++ F K DC
Sbjct  370   YY--------DRTAFKKFDC  381



>ref|XP_009627060.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
 ref|XP_009627061.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
Length=402

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 141/363 (39%), Positives = 207/363 (57%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NW I +EGGAWC +   C  RT    G
Sbjct  29    ITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSRTKTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+    F G        IL+    +NP +F NWN + IRYCDGSSFTGDVE  +P 
Sbjct  89    SSKLMVKTVSFSG--------ILSNKAKFNP-DFYNWNRIRIRYCDGSSFTGDVEAVDPK  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
               +Y+RG RIF+ + ++ L KG+KNA+   L G SAG+++  LHCDRF+ LLP   + KC
Sbjct  140   TKVYYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D G+FI+ K       +E F   + +VV+ H S   LPQ+CT ++  KP LC FPQ +
Sbjct  200   LSDAGFFINAKTISGAPHIEQF---YSDVVNTHGSAKNLPQSCTSRL--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQL  1081
                +KTP+F++ ++YD  QI   +         T R    + ++ ++   E ++G+R + 
Sbjct  255   AQQIKTPLFLVNAAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRTEF  314

Query  1082  LDALPN---KPSVGIFINNCFFHTEIATG-YWANPNS-QVNNVLDSKAISDWYFYGKEVN  1246
             L AL       + G +IN+C+ H +  T   W   +S ++ +   +KA+ DW++   +  
Sbjct  315   LKALNGLGPSSTRGYYINSCYAHCQTGTQETWLRDDSPRLASTTIAKAVGDWFYDRNQFQ  374

Query  1247  LID  1255
              ID
Sbjct  375   EID  377



>ref|XP_008808358.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=397

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 203/356 (57%), Gaps = 24/356 (7%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + + E A A GAVCLDGSPPAYH   G     +NWL+++EGG WC ++  C  R   
Sbjct  26    FVDITYVESAVAKGAVCLDGSPPAYHLSPGFGSGVNNWLVHIEGGGWCNNVTTCLARKST  85

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE-  550
               GSS+ M+    F G        ILN    +NP +F NWN V +RYCDGSSFTGDV+  
Sbjct  86    RLGSSRQMVKQIAFSG--------ILNNRQTFNP-DFYNWNKVKVRYCDGSSFTGDVKRV  136

Query  551   -PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
              P  NL++RG R++  + ++LL +G+  A+  FL+G SAG ++  LHCD FR LLP   R
Sbjct  137   NPTTNLHYRGARVWLAVMEDLLARGMSKAENAFLSGCSAGGLTSILHCDNFRALLPLGTR  196

Query  728   FKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
              KCL D GYFI++K  +    E  +  F +VV+ H S   LP +CT ++   P +C FPQ
Sbjct  197   VKCLSDAGYFINLK--DITGTEHIKAFFNDVVTTHGSAQNLPSSCTSRL--TPSMCFFPQ  252

Query  908   YLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFRL  1075
              ++  ++TP+FIL ++YD  QI   +       + T  +      Q ++   + ++GFR 
Sbjct  253   NMVQKIRTPLFILNAAYDSWQIKNILVPGVADPHGTWHDCKLDIQQCSSSQLQIMQGFRT  312

Query  1076  QLLDALP---NKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYF  1228
             Q L+AL    +  S G+FIN+C+ H +      W + NS V   +  +KA+ DW++
Sbjct  313   QFLNALAGFGSSSSTGMFINSCYAHCQSEMQETWLSSNSPVLEKIPIAKAVGDWFY  368



>gb|KCW72721.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 202/354 (57%), Gaps = 26/354 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NWLI  EGGAWC ++  C  R     G
Sbjct  29    ITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEGGAWCNNVTTCLARRDTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M+         +  F GIL+    +NP +F NWN + +RYCDG+SFTGDVE   P 
Sbjct  89    SSKQMV--------KELSFSGILSNKQKFNP-DFYNWNKIKVRYCDGASFTGDVEAVNPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R F  I ++L++KG+ NA+   L+G SAG ++  L+CDRFR L+P   + KC
Sbjct  140   TNLHFRGARAFVAIVEDLMSKGMSNAQNAILSGCSAGGLAAILNCDRFRALMPARTKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K       +E F   +  VV+ H S   LP +CT KM  KP LC FPQ +
Sbjct  200   LADAGYFINAKDVSGASHIENF---YSEVVATHGSAKNLPTSCTSKM--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRT---IREHVQLATP-IYEGLKGFRLQL  1081
             +  ++TP+FI+ ++YD  QI   +       + T    +  ++  +P   + ++ FRL+ 
Sbjct  255   VPQIQTPLFIINAAYDAWQIKNILAPGVADPHGTWNSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1082  LDALP---NKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYF  1228
             L AL      PS G+FI++C  H +  T   +  N +  V     +KA+ DWY+
Sbjct  315   LRALSAVGTSPSRGMFIDSCNTHCQAGTEATWLRNDSPIVAKTSIAKAVGDWYY  368



>ref|XP_009771151.1| PREDICTED: uncharacterized protein LOC104221730 [Nicotiana sylvestris]
Length=402

 Score =   250 bits (639),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 141/363 (39%), Positives = 207/363 (57%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NW I +EGGAWC +   C  RT    G
Sbjct  29    ITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSRTKTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+    F G        IL+    +NP +F NWN + IRYCDGSSFTGDVE  +P 
Sbjct  89    SSKLMVKTVSFSG--------ILSNKAKFNP-DFYNWNRIRIRYCDGSSFTGDVEAVDPR  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
               +Y+RG RIF+ + ++ L KG+KNA+   L G SAG+++  LHCDRF+ LLP   + KC
Sbjct  140   TKVYYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D G+FI+ K       +E F   + +VV+ H S   LPQ+CT ++  KP LC FPQ +
Sbjct  200   LSDAGFFINAKTISGASHIEQF---YSDVVNTHGSAKNLPQSCTSRL--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR---  1072
                +KTP+F++ ++YD  QI   +         T R    + ++ ++   E ++G+R   
Sbjct  255   AQQIKTPLFLVNAAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRNEF  314

Query  1073  LQLLDALPNKPSVGIFINNCFFHTEIATG-YWANPNS-QVNNVLDSKAISDWYFYGKEVN  1246
             L+ L+ L    + G +IN+C+ H +  T   W   +S ++ +   +KA+ DW++      
Sbjct  315   LKALNGLGPSSTRGYYINSCYAHCQTGTQETWLRDDSPRLASTTIAKAVGDWFYDRNRFQ  374

Query  1247  LID  1255
              ID
Sbjct  375   EID  377



>ref|XP_009592441.1| PREDICTED: uncharacterized protein LOC104089292 [Nicotiana tomentosiformis]
Length=394

 Score =   250 bits (638),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 207/370 (56%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T++    +   E A A GAVCLDG+PPAYH   G+    +NW+I +EGG WC++I  C 
Sbjct  19    RTESLLVNITILESAVATGAVCLDGTPPAYHLDRGSGTGLNNWVISIEGGGWCQNITHCL  78

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSS  M             F GI++ DP +NP EF NWN V +RYCDG SFTG
Sbjct  79    ERKNSRLGSSAKM--------GKQVAFSGIMSNDPKFNP-EFYNWNRVSVRYCDGGSFTG  129

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   L++RG RIF  I  +LL++G+  A+   L+G SAG ++  LHCD FR LL
Sbjct  130   DVEAVDPATGLHYRGARIFKAIMADLLSQGMSTAENAILSGCSAGGLASILHCDNFRALL  189

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P + R KC  D GYF+++K  + +     E  F +VV+LH S   LP +CT K+  KP L
Sbjct  190   PKSARVKCFSDAGYFVNLKDISGEAY--IEEYFNDVVTLHGSAKNLPPSCTSKL--KPSL  245

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NI---SMHESFVAANRTIREHVQLATPIYEGL  1060
             C FPQ +   ++TP+FI+ ++YD  Q+ NI   S  +   A      +         + L
Sbjct  246   CFFPQNVAHQLQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTLSELKVL  305

Query  1061  KGFR---LQLLDALPNKPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWY  1225
             +GFR   L++L+ L    + G +IN+CF H +     YW  PNS ++ N   ++A  DW+
Sbjct  306   QGFRLNFLKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLFNKTIAEATGDWF  365

Query  1226  FYGKEVNLID  1255
             +   +   ID
Sbjct  366   WERNQFQEID  375



>ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis]
Length=399

 Score =   250 bits (638),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 208/364 (57%), Gaps = 32/364 (9%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             T+  F  + + + A A GAVCLDGSPPAYH  +G     ++WL++ EGG WC +I  C  
Sbjct  22    TEGLFVEITYVKNAVAKGAVCLDGSPPAYHLDKGFGTGINSWLVHFEGGGWCNNITTCLS  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M             F GI++    YNP +F NWN V IRYCDGSSFTGD
Sbjct  82    RKNTRLGSSKQM--------GPQIAFSGIMSNRRRYNP-DFYNWNRVKIRYCDGSSFTGD  132

Query  542   VE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             V+   P  NL+FRG RI+  + +ELL KG+KNA+   L+G SAG ++  LHCD FR LLP
Sbjct  133   VQAVNPATNLHFRGARIWLAVIEELLAKGMKNAENALLSGCSAGGLASILHCDGFRALLP  192

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKP  886
                  KCL D GYFI     N + V G    +  F  VVSLH S   LP +CT ++  KP
Sbjct  193   MGTNVKCLSDAGYFI-----NARDVSGAAHIQTYFNEVVSLHGSAKNLPLSCTSRL--KP  245

Query  887   YLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANR----TIREHVQLATPI-Y  1051
              LC FPQYL+  ++TP+FIL ++YD  QI  ++    VA  R    + +  +   +PI  
Sbjct  246   ALCFFPQYLVQQIRTPLFILNAAYDSWQIK-NILAPGVADPRGSWNSCKLDINNCSPIQL  304

Query  1052  EGLKGFRLQLLDAL---PNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAIS  1216
             + ++ FR++ L AL    N  S G++I++C+ H +  T   W   +S V +    +KA+ 
Sbjct  305   KTMQDFRMRFLSALYRSANSSSKGLYIDSCYAHCQTETQETWFMADSPVLSKTKIAKAVG  364

Query  1217  DWYF  1228
             DW++
Sbjct  365   DWFY  368



>ref|XP_004244443.1| PREDICTED: uncharacterized protein LOC101251798 [Solanum lycopersicum]
Length=392

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/363 (39%), Positives = 207/363 (57%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NW I +EGGAWC +   C  RT    G
Sbjct  29    ITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLERTKTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+    F G        IL+    +NP +F NWN + IRYCDGSSFTGDV   +P 
Sbjct  89    SSKLMVKTVSFSG--------ILSNKAKFNP-DFYNWNRIRIRYCDGSSFTGDVAAADPR  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
               +++RG RIF+ + D+ L KG+KNA+   L G SAG+++  LHCDRF+ LLP+  + KC
Sbjct  140   TKVFYRGARIFSAVMDDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPSGAKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D G+FI+ +       +E F   +  VV+ H S   LPQ+CT ++  KP LC FPQ +
Sbjct  200   LSDAGFFINTQTISGTSHIEKF---YSEVVNTHGSAKNLPQSCTSRL--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR---  1072
                ++TP+F++ ++YD  QI   +       + T R    + ++ ++   + ++ FR   
Sbjct  255   AQQIQTPLFLVNAAYDSWQIKNILAPGVADPHGTWRNCKLDILKCSSAQLQTMQAFRSEF  314

Query  1073  LQLLDALPNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYFYGKEVN  1246
             L+ L++L    + G +IN+C+ H +  T   W   +S V +    +KA+ DWY+  K   
Sbjct  315   LKALNSLGPSSTRGYYINSCYAHCQTGTQETWLRDDSPVLSGTTIAKAVGDWYYERKRFQ  374

Query  1247  LID  1255
              ID
Sbjct  375   EID  377



>gb|KCW72720.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=420

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 214/378 (57%), Gaps = 40/378 (11%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +++A    + + + A A GAVCLDGSPPAYHF +G     +NWL+  EGG WC ++  C 
Sbjct  30    KSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNNVTTCL  89

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+    F G        IL+ + ++NP +F NWN + +RYCDG+SFTG
Sbjct  90    ARRDTRLGSSKEMVKEVAFSG--------ILSNNHSFNP-DFYNWNRIKVRYCDGASFTG  140

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   L+FRG R F  I ++LL+KG+ +A+   L+G SAG ++  LHCDRFR L+
Sbjct  141   DVEAVDPATKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALM  200

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P +   KC+ D GYFI+ K  +  Q +E F   +  VV+ H S   LP +CT ++  +P 
Sbjct  201   PTSATVKCVADAGYFINAKDISGAQHIETF---YSEVVATHGSAKNLPTSCTSRL--RPG  255

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQL  1036
             LC FPQ ++  ++TP+FIL ++YD  QI NI          + H   +  N    + +Q+
Sbjct  256   LCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQI  315

Query  1037  ATPIYEGLKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLD  1201
                    ++ FR Q LDAL      PS GIFI++C+ H  +E+   +  + +  +     
Sbjct  316   -------MQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSI  368

Query  1202  SKAISDWYFYGKEVNLID  1255
             +KA+ DWY+  +    ID
Sbjct  369   AKAVGDWYYDRRPFQKID  386



>ref|XP_010677539.1| PREDICTED: protein notum homolog isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 146/363 (40%), Positives = 202/363 (56%), Gaps = 25/363 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ + + A A G VCLDGSPPAYHF +G      NWLI+MEGGAWC +   C  RT    
Sbjct  25    PITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHNWLIHMEGGAWCNNATTCLERTKTRL  84

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVD  559
             GSSK M           + F GIL+    Y+P +F NWN + +RYCDGSSFTGDVE  VD
Sbjct  85    GSSKLMTKQ--------YTFSGILSNQAKYSP-DFYNWNRIKVRYCDGSSFTGDVEA-VD  134

Query  560   --NLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                +Y+RG R++  I D+LL KG+KNA+   L G SAG +   L CD FR LLP+  + K
Sbjct  135   PAKVYYRGARLWRAIMDDLLAKGMKNAENAILAGCSAGGLGAILQCDNFRALLPSGAKVK  194

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             CL D G+FI+ K  +   V   +  F +VV+ H S   LP +CT K    P LC FP+Y 
Sbjct  195   CLSDAGFFINAK--DISGVSHIQEVFADVVTTHGSAKNLPPSCTSKF--DPKLCFFPEYA  250

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFR---  1072
               G++TP+F+L ++YD  QI  ++       + T  +     ++ +    + + GFR   
Sbjct  251   ARGIQTPLFLLNAAYDAWQIKNTLAPGVADRHGTWHDCKSDIIKCSNSQIQIMHGFRQDF  310

Query  1073  LQLLDALPNKPSVGIFINNCFFHTEIATG-YWANPNSQ-VNNVLDSKAISDWYFYGKEVN  1246
             L  L +L N  S G +IN+C+ H +  T   W   +S  ++N    KA+ DW++  K   
Sbjct  311   LAALSSLGNSNSRGFYINSCYSHCQSGTQETWLRDDSPLLDNTTICKAVGDWFYDRKPFQ  370

Query  1247  LID  1255
              ID
Sbjct  371   KID  373



>gb|EYU37448.1| hypothetical protein MIMGU_mgv1a007102mg [Erythranthe guttata]
Length=419

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 149/369 (40%), Positives = 193/369 (52%), Gaps = 36/369 (10%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + +   A   GAVCLDG+PPAY+   G  +  DNWL+Y+EGGAWC S E C  R      
Sbjct  37    ITYVNSAVEKGAVCLDGTPPAYYHSVGFGDGADNWLVYLEGGAWCNSTETCLERV-----  91

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
               K   +             GI   +  +N + F NWN V+I YCDG+SFTGDVEE  P 
Sbjct  92    --KIKWLASTSTRPAIRYVSGIFTVNQTFNQA-FYNWNKVIIVYCDGASFTGDVEEVDPT  148

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL++RG RIF  + D+LL KG+KNAK   LTG SAG ++  L+CDRFR L+P+  R KC
Sbjct  149   TNLHYRGARIFRAVIDDLLAKGMKNAKNAVLTGSSAGGLATILNCDRFRSLVPHATRVKC  208

Query  737   LMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLM  916
             + D G+FIH K  N       E  F  V  LH     LPQ+C  KM   P LC+FP+Y++
Sbjct  209   ISDSGFFIHSK--NMPGANEREAYFTQVAELHGMAKALPQSCASKM--NPGLCLFPEYVI  264

Query  917   DGMKTPMFILMSSYDKHQINISMHESFVAA----------NRTIREHVQLATPIYEGLKG  1066
               M+TP+FIL S +D +QI   M   FV            N T+    QL     + +K 
Sbjct  265   KDMQTPLFILDSLFDLYQIK-EMLAPFVGGCKEQWDDCTTNLTLCTSSQL-----QIMKD  318

Query  1067  FRLQLLDALP--NKPSVGIFINNCFFHTEIATGYWANPNSQVNNVLDSK----AISDWYF  1228
              R   L+ L     PS+GIF++ CF HT +        +    NVL  K    AI DWY+
Sbjct  319   HRTAFLETLQEVESPSLGIFVHTCFLHTHVLDKDGWRCSFVARNVLAKKTIEEAIDDWYY  378

Query  1229  YGKEVNLID  1255
                    ID
Sbjct  379   DRSSFQQID  387



>ref|XP_010449357.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/372 (39%), Positives = 212/372 (57%), Gaps = 28/372 (8%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  F  + +   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C 
Sbjct  19    KTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLHRGSGTGVNSWLIQLEGGGWCNNVTNCL  78

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+ N  F          IL+    YNP +F NWN V +RYCDGSSFTG
Sbjct  79    SRMHTRLGSSKKMVENLAFSA--------ILSNKKQYNP-DFYNWNRVKVRYCDGSSFTG  129

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  +  ELL KG++NA+   L+G SAG ++  +HCD FR LL
Sbjct  130   DVQAVNPATNLHFRGARIWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALL  189

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   R KCL D G+F++ +  +   V+  +  F++VV+LH S   LP++CT ++   P +
Sbjct  190   PMGSRVKCLSDAGFFLNTR--DVSGVQYIKQYFQDVVTLHGSAKNLPRSCTSRL--TPAM  245

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN-----RTIREHVQLATPI-YE  1054
             C FPQY+   ++TP+FIL ++YD  QI   +     AA+     ++ +  ++   P   +
Sbjct  246   CFFPQYVARQIRTPLFILNAAYDSWQIKNILAPR--AADPYGKWQSCQLDIKNCHPSQLK  303

Query  1055  GLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISD  1219
              ++ FRL+ L A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ D
Sbjct  304   VMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGD  363

Query  1220  WYFYGKEVNLID  1255
             W +  K    ID
Sbjct  364   WVYDRKLFQKID  375



>ref|XP_006363883.1| PREDICTED: uncharacterized protein LOC102589191 [Solanum tuberosum]
Length=476

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 146/361 (40%), Positives = 202/361 (56%), Gaps = 30/361 (8%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             E A A GAVCLDGSPPAYH   G     DNW+IY++GG WCESI EC  RT  + GS+K 
Sbjct  14    ESATAQGAVCLDGSPPAYHLHRGHGTGLDNWIIYLDGGGWCESIPECLYRTTTYLGSTKK  73

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PVDNLY  568
             M             F GIL+     NP EF NWN V ++YCDGSSFTGDVE+  P + LY
Sbjct  74    M--------GQQAFFSGILHNTSKQNP-EFHNWNRVRVKYCDGSSFTGDVEQVHPENKLY  124

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RIF  I ++L +KG+KNA+   L+G SAG ++  L+CD+F+ LLP   R KC+ D 
Sbjct  125   FRGARIFKAIMEDLSSKGMKNAENAILSGTSAGGLATILNCDKFKCLLPENARVKCVADA  184

Query  749   GYFIHVKKDNPKQVEGFELT---FKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMD  919
              +FI     N K + G   T   ++N+V+LH S   LP  CT  M  +P LC FP+ +M 
Sbjct  185   SFFI-----NGKSIYGTSFTQEMYQNIVNLHESAKNLPPACTSAM--EPSLCFFPENVMP  237

Query  920   GMKTPMFILMSSYDKHQINISM-------HESFVAANRTIREHVQLATPIYEGLKGFRLQ  1078
              ++TP+FI+ S YD  QIN ++         ++ A  ++I         I +       +
Sbjct  238   YVQTPLFIINSIYDSWQINNTLVPPYLDKQHAWKACIKSISSCTSSQLIIIQAFGVEFSK  297

Query  1079  LLDALPNKPSVGIFINNCFFHTEIA-TGYWANPNS-QVNNVLDSKAISDWYFYGKEVNLI  1252
               + LP   + G F+ +C+ H  I  T YW   +S  + N   ++A++DWYF  + +   
Sbjct  298   TFEGLPPCSTRGYFLTSCYSHGGIRLTPYWLKTSSLTLFNKTIAEAVADWYFEREGIQYT  357

Query  1253  D  1255
             D
Sbjct  358   D  358



>ref|XP_011082152.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=378

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 206/360 (57%), Gaps = 35/360 (10%)
 Frame = +2

Query  239   VCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMNpffp  418
             VCLDGSPPAYH   G     +NWL+++EGG WC ++  C  R     GSSK+M+      
Sbjct  20    VCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNNVTTCLARKNNRLGSSKYMV------  73

Query  419   gdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLYFRGKRIFN  592
                   F GILN    +NP +F NWN V +RYCDG+SFTGDVE   PV  L++RG R+F 
Sbjct  74    --KQLAFSGILNNKANFNP-DFYNWNRVKVRYCDGASFTGDVEAVNPVTKLHYRGARVFL  130

Query  593   VITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFIHVKK  772
              + ++LL KG+KNA+   L+G SAG ++  LHCD F+ LLP   + KC  D GYFI+ K 
Sbjct  131   AVMEDLLAKGMKNAENAVLSGCSAGGLAAILHCDSFKALLPMGTKVKCFSDAGYFINTKD  190

Query  773   -DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFILM  949
                 + +E F   + +VVS H S   LP++CT +M  KP LC FPQY+   ++TP+FI+ 
Sbjct  191   VSGAQHIEAF---YHDVVSTHGSAKNLPRSCTSRM--KPSLCFFPQYVAREIRTPLFIIN  245

Query  950   SSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQLLDALPN---KPS  1108
             ++YD  QI   +       + T      +  + +    + ++GFRL+ + AL       S
Sbjct  246   AAYDSWQIKNILAPGVADPHGTWHNCKTDINKCSATQLQTMQGFRLEFIRALYGLGVSTS  305

Query  1109  VGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSEFIK-DC  1279
              G FIN+C+ H  TE+   ++ + + ++NN   +KA+ DW++        D+S F K DC
Sbjct  306   RGYFINSCYAHCQTEMQETWYRSDSPKLNNKTIAKAVGDWFY--------DRSPFQKGDC  357



>ref|NP_001053773.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAF15687.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAG93730.1| unnamed protein product [Oryza sativa Japonica Group]
Length=466

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 209/372 (56%), Gaps = 35/372 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
               KA    ++F + A + GAVCLDGSPP YHF  G+    +NWL++MEGG WC + +EC 
Sbjct  95    SAKAGDVDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECS  154

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
             +R    +GSSK M             F GI+  +   NP +F NWN + +RYCDGSSFTG
Sbjct  155   VRQGNFRGSSKFM---------RPLSFSGIIGGNQRNNP-DFYNWNRIKVRYCDGSSFTG  204

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  E   NL+FRG R++N I ++LL KG+  A+   L+G SAG ++  LHCD+FR LL
Sbjct  205   DVETVETSTNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLL  264

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEG--FELTF-KNVVSLHNSTGMLPQTCTQKMKDK  883
             P T   KC  D G+F+     + K + G  F  TF K+VV+LH S   LP +CT KM   
Sbjct  265   PATANVKCFSDAGFFV-----DGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKM--S  317

Query  884   PYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIY  1051
             P LC FPQ ++  ++TP+FIL ++YD  QI   +  S     +T      +    ++   
Sbjct  318   PDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQL  377

Query  1052  EGLKGFRLQLLDALPNKP-----SVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKA  1210
               L+ FR   L ALP KP     ++ IFI++C+ H +  +   + A  +  V      KA
Sbjct  378   TTLQNFRTDFLAALP-KPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKA  436

Query  1211  ISDWYFYGKEVN  1246
             + DW F+ +EV+
Sbjct  437   VGDW-FHDREVS  447



>gb|KEH20327.1| pectinacetylesterase family protein [Medicago truncatula]
Length=393

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/369 (40%), Positives = 198/369 (54%), Gaps = 36/369 (10%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ F + A A GAVCLDGSPPAYHF +G     DNW+++ EGG WC +   C  R     
Sbjct  29    PITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATTCLDRIDTRL  88

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSSK M        D    F G  +    +NP +F NWN + +RYCDGSSFTGDVE  +P
Sbjct  89    GSSKKM--------DKTLSFSGFFSSGKKFNP-DFYNWNRIKVRYCDGSSFTGDVEAVDP  139

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL++RG RIF  + ++LL KG+KNAK   L+G SAG ++  L CDRFR LLP   + K
Sbjct  140   KTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAKVK  199

Query  734   CLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             C+ D GYFI+VK       +E F   +  VV  H S   LP +CT ++   P LC FPQ 
Sbjct  200   CVSDAGYFINVKAVSGASHIEQF---YSQVVQTHGSAKNLPSSCTSRL--SPGLCFFPQN  254

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR---------EHVQLATPIYEGLK  1063
             +   +KTP+F + ++YD  QI   +       + T R            QL+T     ++
Sbjct  255   VAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLST-----MQ  309

Query  1064  GFRLQLLDAL---PNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYF  1228
             GFR + L A+    N PS G+FI+ C+ H +      W   +S V      +KA+ DWY+
Sbjct  310   GFRTEFLKAISVVSNSPSKGMFIDGCYSHCQTGMQETWMRTDSPVLAKTTIAKAVGDWYY  369

Query  1229  YGKEVNLID  1255
                    ID
Sbjct  370   DRSTFQQID  378



>ref|XP_003628995.1| Notum-like protein [Medicago truncatula]
Length=396

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/369 (40%), Positives = 198/369 (54%), Gaps = 36/369 (10%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ F + A A GAVCLDGSPPAYHF +G     DNW+++ EGG WC +   C  R     
Sbjct  32    PITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATTCLDRIDTRL  91

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSSK M        D    F G  +    +NP +F NWN + +RYCDGSSFTGDVE  +P
Sbjct  92    GSSKKM--------DKTLSFSGFFSSGKKFNP-DFYNWNRIKVRYCDGSSFTGDVEAVDP  142

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL++RG RIF  + ++LL KG+KNAK   L+G SAG ++  L CDRFR LLP   + K
Sbjct  143   KTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAKVK  202

Query  734   CLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             C+ D GYFI+VK       +E F   +  VV  H S   LP +CT ++   P LC FPQ 
Sbjct  203   CVSDAGYFINVKAVSGASHIEQF---YSQVVQTHGSAKNLPSSCTSRL--SPGLCFFPQN  257

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR---------EHVQLATPIYEGLK  1063
             +   +KTP+F + ++YD  QI   +       + T R            QL+T     ++
Sbjct  258   VAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLST-----MQ  312

Query  1064  GFRLQLLDAL---PNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYF  1228
             GFR + L A+    N PS G+FI+ C+ H +      W   +S V      +KA+ DWY+
Sbjct  313   GFRTEFLKAISVVSNSPSKGMFIDGCYSHCQTGMQETWMRTDSPVLAKTTIAKAVGDWYY  372

Query  1229  YGKEVNLID  1255
                    ID
Sbjct  373   DRSTFQQID  381



>ref|XP_009763242.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=386

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 212/374 (57%), Gaps = 32/374 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + K  +  + + E A   GAVCLDGS PA+HF  GT    ++WLI+++GG WCE+  +C 
Sbjct  20    EAKDLYVNITYLETAITKGAVCLDGSAPAFHFHPGTGSGINSWLIHLQGGGWCETTSDCL  79

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R      SSK+M             F G+L+ DP +NP +F NWN V IRYCDGSS+ G
Sbjct  80    ARATTDL-SSKNM--------SKIAYFTGVLSSDPQFNP-DFYNWNRVKIRYCDGSSYIG  129

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             D+EE  P  NL+FRG RIF  I +  L +G+  A+   L+G SAG +   LHCD+FR  L
Sbjct  130   DIEEVDPDTNLHFRGARIFEAIMEYFLGQGMIYAQNAILSGTSAGGLGAILHCDKFRLFL  189

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   R KC+ D G+F++V+  + + +   E  +K VV+LH S   LP +CT    D P L
Sbjct  190   PLIARVKCISDAGFFVNVEAISGEPL--IEEKYKRVVALHGSAKNLPLSCTALSSD-PNL  246

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRT---IREHVQLATPI-YEGL  1060
             C FPQY+   + TP+FI+ S+YD  QIN S+       N      +  + + +P   + L
Sbjct  247   CFFPQYVARHICTPLFIVNSAYDSWQINNSLVPQVADPNNEWPYCKHDINICSPSQIQTL  306

Query  1061  KGFRLQLLDALPN-KPSV--GIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAISDWY  1225
             + FRL+ L+AL    PS+  G FI++C FH  I    YW++ NS  + N   ++AI DW+
Sbjct  307   QDFRLKFLEALNELGPSISRGYFISSCHFHNGIEIQNYWSSRNSPTLANKTIAEAIGDWF  366

Query  1226  FYGKEVNLIDKSEF  1267
             F        D+SEF
Sbjct  367   F--------DRSEF  372



>ref|XP_011028483.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
 ref|XP_011028484.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
Length=427

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 209/370 (56%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  +  + + + A A GAVCLDGSPPAYH+ +G+    ++WLI+ EGG WC ++  C 
Sbjct  21    KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   H GSSK M     F G        I+N    +NP +F NWN V IRYCDGSSFTG
Sbjct  81    SRKKTHLGSSKLMGQQIAFSG--------IMNNKRPFNP-DFYNWNRVKIRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  + ++LL KGLKNA+   L+G SAG ++  LHCD FR LL
Sbjct  132   DVQAVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
                 + KCL D GYFI VK  +       +  F  +V+LH S   LP +CT  +  KP  
Sbjct  192   RMGTKVKCLSDAGYFIKVK--DVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSML--KPSF  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESF---VAANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+FIL ++YD  QI   +  S    +   ++ +  +   +P+  + +
Sbjct  248   CFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSM  307

Query  1061  KGFRLQLLDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + FRLQ L+AL    N  S G++I++C+ H  TE    ++   +  +     +KA+ DW+
Sbjct  308   QDFRLQFLNALKTSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWF  367

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  368   YDRNPFQKID  377



>ref|XP_010056131.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=448

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 214/378 (57%), Gaps = 40/378 (11%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +++A    + + + A A GAVCLDGSPPAYHF +G     +NWL+  EGG WC ++  C 
Sbjct  30    KSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNNVTTCL  89

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+    F G        IL+ + ++NP +F NWN + +RYCDG+SFTG
Sbjct  90    ARRDTRLGSSKEMVKEVAFSG--------ILSNNHSFNP-DFYNWNRIKVRYCDGASFTG  140

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   L+FRG R F  I ++LL+KG+ +A+   L+G SAG ++  LHCDRFR L+
Sbjct  141   DVEAVDPATKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALM  200

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P +   KC+ D GYFI+ K  +  Q +E F   +  VV+ H S   LP +CT ++  +P 
Sbjct  201   PTSATVKCVADAGYFINAKDISGAQHIETF---YSEVVATHGSAKNLPTSCTSRL--RPG  255

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQL  1036
             LC FPQ ++  ++TP+FIL ++YD  QI NI          + H   +  N    + +Q+
Sbjct  256   LCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQI  315

Query  1037  ATPIYEGLKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLD  1201
                    ++ FR Q LDAL      PS GIFI++C+ H  +E+   +  + +  +     
Sbjct  316   -------MQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSI  368

Query  1202  SKAISDWYFYGKEVNLID  1255
             +KA+ DWY+  +    ID
Sbjct  369   AKAVGDWYYDRRPFQKID  386



>ref|XP_010056129.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
 ref|XP_010056130.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
Length=445

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 143/378 (38%), Positives = 213/378 (56%), Gaps = 40/378 (11%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +++A    + + + A A GAVCLDGSPPAYHF +G     +NWL+  EGG WC ++  C 
Sbjct  27    KSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNNVTTCL  86

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+    F G        IL+ + ++NP +F NWN + +RYCDG+SFTG
Sbjct  87    ARRDTRLGSSKEMVKEVAFSG--------ILSNNHSFNP-DFYNWNRIKVRYCDGASFTG  137

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   L+FRG R F  I ++LL+KG+ +A+   L+G SAG ++  LHCDRFR L+
Sbjct  138   DVEAVDPATKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALM  197

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P +   KC+ D GYFI+ K     + +E F   +  VV+ H S   LP +CT ++  +P 
Sbjct  198   PTSATVKCVADAGYFINAKDISGAQHIETF---YSEVVATHGSAKNLPTSCTSRL--RPG  252

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQL  1036
             LC FPQ ++  ++TP+FIL ++YD  QI NI          + H   +  N    + +Q+
Sbjct  253   LCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQI  312

Query  1037  ATPIYEGLKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLD  1201
                    ++ FR Q LDAL      PS GIFI++C+ H  +E+   +  + +  +     
Sbjct  313   -------MQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSI  365

Query  1202  SKAISDWYFYGKEVNLID  1255
             +KA+ DWY+  +    ID
Sbjct  366   AKAVGDWYYDRRPFQKID  383



>ref|XP_010056132.1| PREDICTED: protein notum homolog isoform X3 [Eucalyptus grandis]
 gb|KCW72716.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72717.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=439

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 143/378 (38%), Positives = 213/378 (56%), Gaps = 40/378 (11%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +++A    + + + A A GAVCLDGSPPAYHF +G     +NWL+  EGG WC ++  C 
Sbjct  21    KSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNNVTTCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+    F G        IL+ + ++NP +F NWN + +RYCDG+SFTG
Sbjct  81    ARRDTRLGSSKEMVKEVAFSG--------ILSNNHSFNP-DFYNWNRIKVRYCDGASFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   L+FRG R F  I ++LL+KG+ +A+   L+G SAG ++  LHCDRFR L+
Sbjct  132   DVEAVDPATKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALM  191

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P +   KC+ D GYFI+ K     + +E F   +  VV+ H S   LP +CT ++  +P 
Sbjct  192   PTSATVKCVADAGYFINAKDISGAQHIETF---YSEVVATHGSAKNLPTSCTSRL--RPG  246

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQI-NI----------SMHESFVAANRTIREHVQL  1036
             LC FPQ ++  ++TP+FIL ++YD  QI NI          + H   +  N    + +Q+
Sbjct  247   LCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQI  306

Query  1037  ATPIYEGLKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLD  1201
                    ++ FR Q LDAL      PS GIFI++C+ H  +E+   +  + +  +     
Sbjct  307   -------MQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSI  359

Query  1202  SKAISDWYFYGKEVNLID  1255
             +KA+ DWY+  +    ID
Sbjct  360   AKAVGDWYYDRRPFQKID  377



>ref|XP_009132797.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 208/367 (57%), Gaps = 28/367 (8%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + F   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C  R   
Sbjct  24    FVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLIQLEGGGWCNNVTNCLSRMHT  83

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE-  550
               GSSK M+ N  F          IL+    YNP +F NWN V +RYCDGSSFTGDV+  
Sbjct  84    RLGSSKKMVENLAFSA--------ILSNKKQYNP-DFYNWNRVKVRYCDGSSFTGDVQAV  134

Query  551   -PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
              P  NL+FRG R++  +  ELL KG++NA+   L+G SAG ++  +HCD FR LLP   +
Sbjct  135   NPATNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTK  194

Query  728   FKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
              KCL D G+F++ +  +  Q    +  FK+VV+LH S   LP+TCT ++   P +C FPQ
Sbjct  195   VKCLSDAGFFLNTRDVSGAQY--IKSYFKDVVALHGSAKNLPRTCTSRL--TPAMCFFPQ  250

Query  908   YLMDGMKTPMFILMSSYDKHQINISMHESFVAAN-----RTIREHVQLATP-IYEGLKGF  1069
             Y+   ++TP+FIL ++YD  QI   +     AA+     ++ +  ++   P   + ++ F
Sbjct  251   YVARQIRTPVFILNAAYDSWQIKNILAPR--AADPYGKWQSCQLDIKNCQPNQLKVMQDF  308

Query  1070  RLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYG  1234
             RL+ L A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ DW +  
Sbjct  309   RLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGDWVYDR  368

Query  1235  KEVNLID  1255
             K    ID
Sbjct  369   KLFQKID  375



>gb|AFK45147.1| unknown [Lotus japonicus]
Length=394

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/365 (38%), Positives = 201/365 (55%), Gaps = 24/365 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P  F + A A GAVCLDGSPPAYHF +G     +NW+++ EGGAWC ++  C  R     
Sbjct  28    PTTFVQSAVAKGAVCLDGSPPAYHFHKGFGAGINNWIVHFEGGAWCNNVTTCLARRDTRL  87

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSSK M     F G          +    +NP +F NWN + +RYCDGSSFTGDVE  +P
Sbjct  88    GSSKKMSQTLSFSG--------FFSNGQKFNP-DFYNWNRIKVRYCDGSSFTGDVEAVDP  138

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL+FRG RIF  + ++LL  G+KNA+   L+G SAG ++  L CDRFR L+P   + K
Sbjct  139   KTNLHFRGGRIFVAVVEDLLANGMKNAQNAILSGCSAGGLTSILQCDRFRSLIPAAAKVK  198

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             CL D GYFI++K  +       E  +  VV  H S   LP +CT ++  +P LC FPQ +
Sbjct  199   CLSDAGYFINLK--DVSGAAHIEQLYSQVVETHGSAKNLPASCTSRL--RPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGLKGFRLQL  1081
                +KTP+  + ++YD +Q+   +       + T R+      + ++     ++GFR + 
Sbjct  255   AGQIKTPISFVNAAYDSYQVKNILAPGVADPHGTWRDCKLDIKKCSSNQLTVMQGFRTEF  314

Query  1082  LDALP---NKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYFYGKEVN  1246
             L A+    N PS G+F++ C+ H +      W   +S V  N   +KA+ DW++  +  +
Sbjct  315   LKAISVVENSPSKGMFVDGCYSHCQTGMQETWMRSDSPVLANTTIAKAVGDWFYERRSFS  374

Query  1247  LIDKS  1261
              ID S
Sbjct  375   QIDCS  379



>ref|XP_010439718.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   248 bits (632),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 141/363 (39%), Positives = 209/363 (58%), Gaps = 28/363 (8%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  F  + +   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C 
Sbjct  19    KTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGVNSWLIQLEGGGWCNNVTNCL  78

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+ N  F          IL+    YNP +F NWN V +RYCDGSSFTG
Sbjct  79    SRMHTRLGSSKKMVENLAFSA--------ILSNKKQYNP-DFYNWNRVKVRYCDGSSFTG  129

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  +  ELL KG++NA+   L+G SAG ++  +HCD FR LL
Sbjct  130   DVQAVNPATNLHFRGARIWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALL  189

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   R KCL D G+F++ +  +   V+  +  F++VV+LH S   LP++CT ++   P +
Sbjct  190   PMGSRVKCLSDAGFFLNTR--DVSGVQYIKQYFQDVVTLHGSAKNLPRSCTSRL--TPAM  245

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN-----RTIREHVQLATPI-YE  1054
             C FPQY+   ++TP+FIL ++YD  QI   +     AA+     ++ +  ++   P   +
Sbjct  246   CFFPQYVARQIRTPLFILNAAYDSWQIKNILAPR--AADPYGKWQSCQLDIKNCHPSQLK  303

Query  1055  GLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISD  1219
              ++ FRL+ L A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ D
Sbjct  304   VMQDFRLEFLSAVISLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGD  363

Query  1220  WYF  1228
             W +
Sbjct  364   WVY  366



>ref|XP_010327577.1| PREDICTED: uncharacterized protein LOC101244626 [Solanum lycopersicum]
Length=398

 Score =   247 bits (631),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 203/358 (57%), Gaps = 24/358 (7%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             E A A GAVCLDG+PPAYH   G+    ++W+I +EGG WC+++  C  R     GSS  
Sbjct  29    ESAVAKGAVCLDGTPPAYHLDRGSGSGVNSWVISLEGGGWCQNVTSCLTRKNTRLGSSAK  88

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             M        D+   F G+++ DP +NP EF +WN V +RYCDG SFTGDVE  +P   L+
Sbjct  89    M--------DHQLPFSGMMSNDPKFNP-EFHSWNRVSVRYCDGGSFTGDVEAIDPATRLH  139

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             +RG RIF  I +ELL +G+K ++   L+G SAG ++  LHCD FR LLPN  + KC  D 
Sbjct  140   YRGARIFKAIMEELLAQGMKKSQNAILSGCSAGGLATILHCDNFRMLLPNNVKVKCFSDA  199

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             GYFIH    + K     E  F +VV+LH S   LP +CT K+  KP LC FP+ +   +K
Sbjct  200   GYFIHRNDISGKPY--IEQYFNDVVTLHGSAKSLPSSCTSKL--KPGLCFFPENVAQQIK  255

Query  929   TPMFILMSSYDKHQIN---ISMHESFVAANRTIREHVQLATP----IYEGLKGFRLQLLD  1087
             TP+FI+ ++YD  Q+    ++       A  + + +++  TP    I +G +   L+ LD
Sbjct  256   TPLFIINAAYDHWQVRNILVAPGSDPKGAWTSCKANIKNCTPNQLKILQGFRKDFLKALD  315

Query  1088  ALPNKPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWYFYGKEVNLID  1255
              L    + G +IN+CF H +     YW   NS ++ N   ++A+ DW+    +   ID
Sbjct  316   GLGPSSTRGYYINSCFSHCQSQQQAYWFGLNSPRLFNKTIAEAVRDWFLETDQYRHID  373



>gb|AET03471.2| pectinacetylesterase family protein [Medicago truncatula]
Length=424

 Score =   248 bits (633),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 147/369 (40%), Positives = 198/369 (54%), Gaps = 36/369 (10%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ F + A A GAVCLDGSPPAYHF +G     DNW+++ EGG WC +   C  R     
Sbjct  60    PITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATTCLDRIDTRL  119

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSSK M        D    F G  +    +NP +F NWN + +RYCDGSSFTGDVE  +P
Sbjct  120   GSSKKM--------DKTLSFSGFFSSGKKFNP-DFYNWNRIKVRYCDGSSFTGDVEAVDP  170

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL++RG RIF  + ++LL KG+KNAK   L+G SAG ++  L CDRFR LLP   + K
Sbjct  171   KTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAKVK  230

Query  734   CLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             C+ D GYFI+VK       +E F   +  VV  H S   LP +CT ++   P LC FPQ 
Sbjct  231   CVSDAGYFINVKAVSGASHIEQF---YSQVVQTHGSAKNLPSSCTSRL--SPGLCFFPQN  285

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR---------EHVQLATPIYEGLK  1063
             +   +KTP+F + ++YD  QI   +       + T R            QL+T     ++
Sbjct  286   VAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLST-----MQ  340

Query  1064  GFRLQLLDAL---PNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYF  1228
             GFR + L A+    N PS G+FI+ C+ H +      W   +S V      +KA+ DWY+
Sbjct  341   GFRTEFLKAISVVSNSPSKGMFIDGCYSHCQTGMQETWMRTDSPVLAKTTIAKAVGDWYY  400

Query  1229  YGKEVNLID  1255
                    ID
Sbjct  401   DRSTFQQID  409



>ref|XP_010434420.1| PREDICTED: protein notum homolog [Camelina sativa]
 ref|XP_010434421.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   247 bits (631),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 141/363 (39%), Positives = 209/363 (58%), Gaps = 28/363 (8%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  F  + +   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C 
Sbjct  19    KTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCL  78

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+ N  F          IL+    YNP +F NWN V +RYCDGSSFTG
Sbjct  79    SRMHTRLGSSKKMVENLAFSA--------ILSNKKQYNP-DFYNWNRVKVRYCDGSSFTG  129

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  +  ELL KG++NA+   L+G SAG ++  +HCD FR LL
Sbjct  130   DVQAVNPATNLHFRGARIWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALL  189

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   R KCL D G+F++ +  +   V+  +  F++VV+LH S   LP++CT ++   P +
Sbjct  190   PMGSRVKCLSDAGFFLNTR--DVSGVQYIKQYFQDVVTLHGSAKNLPRSCTSRL--TPAM  245

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN-----RTIREHVQLATPI-YE  1054
             C FPQY+   ++TP+FIL ++YD  QI   +     AA+     ++ +  ++   P   +
Sbjct  246   CFFPQYVARQIRTPLFILNAAYDSWQIKNILAPR--AADPYGKWQSCQLDIKNCHPSQLK  303

Query  1055  GLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISD  1219
              ++ FRL+ L A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ D
Sbjct  304   VMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGD  363

Query  1220  WYF  1228
             W +
Sbjct  364   WVY  366



>emb|CDX78933.1| BnaA01g10000D [Brassica napus]
Length=452

 Score =   249 bits (636),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 208/367 (57%), Gaps = 28/367 (8%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + F   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C  R   
Sbjct  79    FVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLIQLEGGGWCNNVTNCLSRMHT  138

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE-  550
               GSSK M+ N  F          IL+    YNP +F NWN V +RYCDGSSFTGDV+  
Sbjct  139   RLGSSKKMVENLAFSA--------ILSNKKQYNP-DFYNWNRVKVRYCDGSSFTGDVQAV  189

Query  551   -PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
              P  NL+FRG R++  +  ELL KG++NA+   L+G SAG ++  +HCD FR LLP   +
Sbjct  190   NPATNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTK  249

Query  728   FKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
              KCL D G+F++ +  +  Q    +  FK+VV+LH S   LP+TCT ++   P +C FPQ
Sbjct  250   VKCLSDAGFFLNTRDVSGAQY--IKSYFKDVVALHGSAKNLPRTCTSRL--TPAMCFFPQ  305

Query  908   YLMDGMKTPMFILMSSYDKHQINISMHESFVAAN-----RTIREHVQLATP-IYEGLKGF  1069
             Y+   ++TP+FIL ++YD  QI   +     AA+     ++ +  ++   P   + ++ F
Sbjct  306   YVARQIRTPVFILNAAYDSWQIKNILAPR--AADPYGKWQSCQLDIKNCQPNQLKVMQDF  363

Query  1070  RLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYG  1234
             RL+ L A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ DW +  
Sbjct  364   RLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGDWVYDR  423

Query  1235  KEVNLID  1255
             K    ID
Sbjct  424   KLFQKID  430



>ref|XP_009350399.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=398

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 141/361 (39%), Positives = 204/361 (57%), Gaps = 26/361 (7%)
 Frame = +2

Query  185   KANFYP--LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             KA  +P  +   E A A GAVCLDGS PAYHF +G     +NWL+++EGG WC S+  C 
Sbjct  21    KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHIEGGGWCNSVATCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   ++GSS  M        +    F G+L      NP +F NWN + +RYCDGSSFTG
Sbjct  81    DRKNNYRGSSTKM--------EKTMSFSGVLGNKQQTNP-DFYNWNRIKVRYCDGSSFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P  NL+FRG R+F  I D+LL KG+KNA+   L+G SAG ++  LHCD F  LL
Sbjct  132   DVEAVDPATNLHFRGARVFRAIIDDLLAKGMKNAQTALLSGCSAGGLASILHCDNFHSLL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KCL D GYFI+ K  +  Q    +  +  VV+LH S   LP +CT +M   P L
Sbjct  192   PVGTKVKCLADAGYFINAKTLSGSQY--IQTFYSEVVALHGSAKNLPASCTSRM--SPGL  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEGL  1060
             C FPQ ++   +TP+F + ++YD  QI   +         A +  +  ++  +P   + +
Sbjct  248   CFFPQNVVPQTRTPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPSQLQTM  307

Query  1061  KGFRLQLLDALPNKPSV---GIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWY  1225
             + +RLQ L+A+    S    G+FI++C+ H +I T   + A  +  ++    +KA+ DWY
Sbjct  308   QEYRLQFLNAIAGASSSSSNGLFIDSCYAHCQIGTQETWLATDSPMLSKTTIAKAVGDWY  367

Query  1226  F  1228
             +
Sbjct  368   Y  368



>emb|CDX99377.1| BnaC01g11750D [Brassica napus]
Length=452

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 208/367 (57%), Gaps = 28/367 (8%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + F   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C  R   
Sbjct  79    FVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLIQLEGGGWCNNVTNCLSRMHT  138

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE-  550
               GSSK M+ N  F          IL+    YNP +F NWN V +RYCDGSSFTGDV+  
Sbjct  139   RLGSSKKMVENLAFSA--------ILSNKKQYNP-DFYNWNRVKVRYCDGSSFTGDVQAV  189

Query  551   -PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
              P  NL+FRG R++  +  ELL KG++NA+   L+G SAG ++  +HCD FR LLP   +
Sbjct  190   NPATNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTK  249

Query  728   FKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
              KCL D G+F++ +  +  Q    +  FK+VV+LH S   LP+TCT ++   P +C FPQ
Sbjct  250   VKCLSDAGFFLNTRDVSGAQY--IKSYFKDVVALHGSAKNLPRTCTSRL--TPAMCFFPQ  305

Query  908   YLMDGMKTPMFILMSSYDKHQINISMHESFVAAN-----RTIREHVQLATP-IYEGLKGF  1069
             Y+   ++TP+FIL ++YD  QI   +     AA+     ++ +  ++   P   + ++ F
Sbjct  306   YVARQIRTPVFILNAAYDSWQIKNILAPR--AADPYGKWQSCQLDIKNCQPNQLKVMQDF  363

Query  1070  RLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYG  1234
             RL+ L A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ DW +  
Sbjct  364   RLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGDWVYDR  423

Query  1235  KEVNLID  1255
             K    ID
Sbjct  424   KLFQKID  430



>gb|EEC77932.1| hypothetical protein OsI_17271 [Oryza sativa Indica Group]
Length=530

 Score =   251 bits (641),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 209/372 (56%), Gaps = 35/372 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
               KA    ++F + A + GAVCLDGSPP YHF  G+    +NWL++MEGG WC + +EC 
Sbjct  159   SAKAGDVDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECS  218

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
             +R    +GSSK M             F GI+  +   NP +F NWN + +RYCDGSSFTG
Sbjct  219   VRQGNFRGSSKFMR---------PLSFSGIIGGNQRNNP-DFYNWNRIKVRYCDGSSFTG  268

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  E   NL+FRG R++N I ++LL KG+  A+   L+G SAG ++  LHCD+FR LL
Sbjct  269   DVETVETSTNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLL  328

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEG--FELTF-KNVVSLHNSTGMLPQTCTQKMKDK  883
             P T   KC  D G+F+     + K + G  F  TF K+VV+LH S   LP +CT KM   
Sbjct  329   PATANVKCFSDAGFFV-----DGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKM--S  381

Query  884   PYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIY  1051
             P LC FPQ ++  ++TP+FIL ++YD  QI   +  S     +T      +    ++   
Sbjct  382   PDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQL  441

Query  1052  EGLKGFRLQLLDALPNKP-----SVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKA  1210
               L+ FR   L ALP KP     ++ IFI++C+ H +  +   + A  +  V      KA
Sbjct  442   TTLQNFRTDFLAALP-KPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKA  500

Query  1211  ISDWYFYGKEVN  1246
             + DW F+ +EV+
Sbjct  501   VGDW-FHDREVS  511



>ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=399

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 208/370 (56%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  +  + + + A A GAVCLDGSPPAYH+ +G     ++WLI+ EGG WC ++  C 
Sbjct  21    KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   H GSSK M     F G        I+N    +NP +F NWN V IRYCDGSSFTG
Sbjct  81    SRKKTHLGSSKLMGQQIAFSG--------IMNNKRPFNP-DFYNWNRVKIRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  + ++LL KGLKNA+   L+G SAG ++  LHCD FR LL
Sbjct  132   DVQAVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
                 + KCL D GYFI VK  +       +  F  +V+LH S   LP +CT  +  KP  
Sbjct  192   RMGTKVKCLSDAGYFIKVK--DVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVL--KPSF  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESF---VAANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+FIL ++YD  QI   +  S    +   ++ +  +   +P+  + +
Sbjct  248   CFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSM  307

Query  1061  KGFRLQLLDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + FRLQ L+AL    N  S G++I++C+ H  TE    ++   +  +     +KA+ DW+
Sbjct  308   QDFRLQFLNALNKSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWF  367

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  368   YDRNPFQKID  377



>ref|XP_009797876.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana sylvestris]
Length=388

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 147/353 (42%), Positives = 196/353 (56%), Gaps = 25/353 (7%)
 Frame = +2

Query  221   AKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMM  400
             A + GAVCLDGSPPAYHF  G  +   NWL+ + GG WC +++EC  R     GSS +M 
Sbjct  45    AVSKGAVCLDGSPPAYHFDPGFGDGVGNWLVQLSGGGWCTNVKECLDRAKSDLGSSNYM-  103

Query  401   MNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLYFR  574
                         F G  +++ + NP EF NWN V +RYCDG SFTGDVE  +P   L+FR
Sbjct  104   --------NPQEFQGFFSKNQSANP-EFYNWNKVFVRYCDGGSFTGDVEYVDPATKLHFR  154

Query  575   GKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGY  754
             G RIF V+ +ELL KGLKNAK   L G SAG     L+CD FR  LPNT R KCL+D GY
Sbjct  155   GARIFTVVLEELLAKGLKNAKNAILAGSSAGGYPAMLYCDGFRNSLPNTSRVKCLVDSGY  214

Query  755   FIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTP  934
             F+H K  N      FE  +K + +L  S   LP++CT KM  KP LC+F + +   +KTP
Sbjct  215   FVHFK--NTVLGRPFESIYKGIATLQGSAKTLPKSCTSKM--KPELCLFAENIQQDIKTP  270

Query  935   MFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP--NKPS  1108
             +FI MS++D      ++          I+E    A+   + L+  R   L+A+P  N P 
Sbjct  271   IFISMSAFDNIMTQYTLGGGIYGC---IQEGTCTASQ-NKTLQEMRSDFLNAIPKGNNPK  326

Query  1109  V-GIFINNCFFHTEIATGYWANPNSQ--VNNVLDSKAISDWYFYGKEVNLIDK  1258
             + G+FI+    HT +      +P     V+N+   KA +DWYF      LID+
Sbjct  327   LRGVFIDVVHHHTSLQKQTRWSPVKPIVVHNLAAPKAFADWYFDRNYTYLIDE  379



>ref|XP_009797415.1| PREDICTED: uncharacterized protein LOC104243851 [Nicotiana sylvestris]
Length=388

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 203/370 (55%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T++    +   E A A G VCLDG+PPAYH   G+    DNW+I +EGG WC++I  C 
Sbjct  17    RTESLLVNITILESAVAKGGVCLDGTPPAYHLDRGSGTGLDNWVISIEGGGWCQNITHCL  76

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSS  M             F GI++ DP +NP EF NWN V +RYCDG SFTG
Sbjct  77    QRKNSRLGSSAKM--------GKQVAFSGIMSNDPKFNP-EFYNWNRVSVRYCDGGSFTG  127

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P   L++RG RIF  I  +LL +G+   +   L+G SAG ++  LHCD FR LL
Sbjct  128   DVEAVDPATGLHYRGARIFEAIMADLLAQGMSTVENAILSGCSAGGLASILHCDNFRALL  187

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P T R KC  D GYF+++K  + +     E  F +VV+LH S   LP +CT K+   P L
Sbjct  188   PKTARVKCFSDAGYFVNLKDISGEAY--IEEYFNDVVTLHGSAKNLPPSCTSKL--NPSL  243

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NI---SMHESFVAANRTIREHVQLATPIYEGL  1060
             C FPQ +   ++TP+FI+ ++YD  Q+ NI   S  +   A      +         + L
Sbjct  244   CFFPQNVAHQIQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTLSELQVL  303

Query  1061  KGFR---LQLLDALPNKPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWY  1225
             +GFR   L++L+ L    + G +IN+CF H +     YW  PNS ++ N   ++A  DW+
Sbjct  304   QGFRLNFLKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLFNKTIAEATGDWF  363

Query  1226  FYGKEVNLID  1255
             +   +   ID
Sbjct  364   WERNQFQEID  373



>ref|XP_010325632.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=402

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/378 (39%), Positives = 209/378 (55%), Gaps = 33/378 (9%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             T+A F  + +     A GAVCLDGSPPAYH  +G     ++WLI MEGG WC ++  C  
Sbjct  22    TEALFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNNVTTCLS  81

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M+ N  F G        IL+  P +NP +F NWN V + YCDGSSFTGD
Sbjct  82    RKNTRLGSSKQMVENLAFSG--------ILSNKPQFNP-DFYNWNRVKVGYCDGSSFTGD  132

Query  542   VEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             V+E  P+  L+FRG R+F  + +ELL KG+KNA+   L+G SAG ++  LHCD F+ LLP
Sbjct  133   VQEVNPITKLHFRGARVFLAVMEELLAKGMKNAENAILSGCSAGGLTSILHCDSFKALLP  192

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLC  895
                + KC  D GYFI VK  +       E  F++VVSLH S   LP  CT ++  KP LC
Sbjct  193   MGAKVKCFSDAGYFIDVK--DISGAPHIEEYFRDVVSLHGSAKNLPPVCTSRL--KPDLC  248

Query  896   MFPQYLMDGMKTPMFILMSSYDKHQINISM-------HESFVAANRTIREHVQLATPIYE  1054
              FPQ +   ++TP+F++ ++YD  QI   +       +  ++     I +       I  
Sbjct  249   FFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPDVADPYGVWLNCKLDILKCSSRQLQIMH  308

Query  1055  GLKGFRLQLLDALPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYF  1228
             G +   L+ L+AL    S G FIN+C+ H  TE+   ++   + ++ N   +KA+ DW++
Sbjct  309   GYRLLFLRALNALGPSSSRGYFINSCYAHCQTEVQETWYRADSPKLANKTIAKALGDWFY  368

Query  1229  YGKEVNLIDKSEFIK-DC  1279
                     DK+ F K DC
Sbjct  369   --------DKNPFQKIDC  378



>ref|XP_009616254.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=404

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 151/381 (40%), Positives = 214/381 (56%), Gaps = 37/381 (10%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  F  + +     A GAVCLDGS PAYH  +G     ++WLI MEGG WC ++  C 
Sbjct  23    RTEGLFVNITYLLSGMAKGAVCLDGSSPAYHHDKGFGTGVNSWLIQMEGGGWCNNVTTCL  82

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+            F GIL+  P +NP +F NWN V +RYCDGSSFTG
Sbjct  83    SRKNTRLGSSKQMV--------KQLAFSGILSNKPQFNP-DFYNWNRVKVRYCDGSSFTG  133

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P+ NL+FRG R+F  + ++LL KG+KNA+   L+G SAG ++  LHCD F+ LL
Sbjct  134   DVQAVNPITNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGGLTSILHCDSFKALL  193

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P   + KC  D GYFI+VK       +E F   F +VV LH S   LP +CT ++  KP 
Sbjct  194   PMGAKVKCFSDAGYFINVKDISGAPHIEEF---FGDVVRLHGSAKNLPPSCTSRL--KPN  248

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYE  1054
             LC FPQ +   ++TP+F++ ++YD  QI   +  S VA  R +  + +L     ++   +
Sbjct  249   LCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPS-VADPRGVWRNCKLDILRCSSRQLQ  307

Query  1055  GLKGFRLQLLDALPN---KPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISD  1219
              ++GFRL  L AL       S G FIN+C+ H  TE+   ++   + ++ N   + A+ D
Sbjct  308   TMQGFRLGFLRALITLGPSSSRGYFINSCYAHCQTEVQETWFRADSPKLANKTIAIALGD  367

Query  1220  WYFYGKEVNLIDKSEFIK-DC  1279
             W+F        DK+ F K DC
Sbjct  368   WFF--------DKNSFQKIDC  380



>gb|AGT17273.1| hypothetical protein SHCRBa_020_L15_F_100 [Saccharum hybrid cultivar 
R570]
Length=375

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 194/357 (54%), Gaps = 44/357 (12%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             ++F + A A GAVCLDGSPP YHF  G+    DNW+++MEGG WC + +EC +R    +G
Sbjct  35    MVFLKAAVAKGAVCLDGSPPVYHFSPGSGSGADNWVVHMEGGGWCRNPDECAVRKGNFRG  94

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M             F GIL      NP +F NWN V IRYCDGSSFTGDVE  +  
Sbjct  95    SSKFMR---------PLSFSGILGGSQKSNP-DFYNWNRVKIRYCDGSSFTGDVETVDTA  144

Query  557   DNLYFRGKRIFNVITDELLN-KGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              NL++RG R+++ I D+LL  +G+  AK   L+G SAG ++  LHCDRFR L P T + K
Sbjct  145   KNLHYRGFRVWHAIIDDLLTVRGMNKAKNALLSGCSAGGLAAILHCDRFRDLFPATTKVK  204

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C  D G F                          S   LP +CT K    P LCMFPQY+
Sbjct  205   CFSDAGLFFR----------------------WGSAKNLPASCTSKQ--SPELCMFPQYV  240

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRT---IREHVQLATPI-YEGLKGFRLQL  1081
             +  M+TP+FIL ++YD  Q+   +  S     +T    +  ++  +P     L+ FR   
Sbjct  241   VPTMRTPLFILNAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSPSQLTTLQNFRTDF  300

Query  1082  LDALPNKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             L ALP  PSVG+FI++C  H +  +   + A+ +  VN     KA+ DWY Y +EV+
Sbjct  301   LAALPTTPSVGMFIDSCNAHCQSGSQDTWLADGSPTVNRTQIGKAVGDWY-YDREVS  356



>gb|EYU29131.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=394

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 141/367 (38%), Positives = 209/367 (57%), Gaps = 28/367 (8%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + + E A A GAVCLDGS PAYHF +G+    +NWL+++EGG WC +   C  R   
Sbjct  21    FVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGGGWCNNATTCLARRNG  80

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--  547
               GSSK M     F G        I +  P +NP +F NWN + +RYCDG+SFTGDVE  
Sbjct  81    RLGSSKQMAKQIAFSG--------IFSNKPQFNP-DFYNWNRLKVRYCDGASFTGDVEAV  131

Query  548   EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
             +P   LY+RG R+F  + ++LL KG+KNA+   L+G SAG ++  L+CDRF+ LLP +  
Sbjct  132   DPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILNCDRFKSLLPISTN  191

Query  728   FKCLMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
              KC  D G+FI+ K  +  Q +E F   + +VV+ H S   L Q+CT KM  KP LC FP
Sbjct  192   VKCFADAGFFINAKDVSGAQHIEQF---YNDVVTTHGSAKHLAQSCTSKM--KPSLCFFP  246

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHV-----QLATPIYEGLKGF  1069
             + ++  ++TP+F++ ++YD  QI  ++    VA    +  +      + +T   + ++ +
Sbjct  247   ENMVQAIQTPIFVVNAAYDSWQIK-NILAPGVADPHGLWHNCKTDIKKCSTTQLQTMQEY  305

Query  1070  RLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYG  1234
             RL+ L AL    +  S G FIN+C+ H  TE    +  N +  +NN   +KA+ DW++  
Sbjct  306   RLEFLKALSGLMSAKSKGYFINSCYAHCQTETQETWSTNISPMLNNKTIAKAVGDWFYER  365

Query  1235  KEVNLID  1255
                  ID
Sbjct  366   SPFEKID  372



>ref|XP_006359968.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=369

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/369 (38%), Positives = 208/369 (56%), Gaps = 24/369 (7%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             T+++   L   + A A GAVCLDGSPPAYH   G+    +NW+I +EGG WC+++ +C L
Sbjct  4     TESSLVNLTILQTAVAKGAVCLDGSPPAYHLDRGSGTGVNNWVISVEGGGWCQNVAQCLL  63

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSS  M        +    F G+L+ +  +NP EF NWN V +RYCDG SFTGD
Sbjct  64    RKNSKYGSSAKM--------ENQVFFSGMLSNEQKFNP-EFYNWNRVFVRYCDGGSFTGD  114

Query  542   VE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE  +P   L++RG RIF  I +ELL +G+  ++   L+G SAG ++  LHCD FR LLP
Sbjct  115   VEAIDPGTGLHYRGARIFKAIMEELLAQGMNKSENAILSGCSAGGLTTILHCDNFRILLP  174

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLC  895
             ++ + KC  D GYF++++  + K     +  F +VV+LH S   LP +CT K+  KP LC
Sbjct  175   SSVKVKCFSDAGYFVNIEDISGKLF--IQQFFNDVVTLHGSVRNLPPSCTSKL--KPSLC  230

Query  896   MFPQYLMDGMKTPMFILMSSYDKHQIN---ISMHESFVAANRTIREHVQLATP-IYEGLK  1063
              FPQ +   ++TP+FI+ S+YD  Q+    +        A  +   +++  TP   + L+
Sbjct  231   FFPQNVAQQIQTPLFIINSAYDSWQVRNILVPRGTDPKGAWNSCGANIKTCTPDQLKVLQ  290

Query  1064  GFRLQLLDALPN---KPSVGIFINNCFFHTEIA-TGYWANPNS-QVNNVLDSKAISDWYF  1228
             GFRL  L AL       + G +IN+CF H +      W  PNS ++ N   ++A+ DW  
Sbjct  291   GFRLNFLKALEGLGPSSTRGYYINSCFAHCQTQKQASWFGPNSPRLFNKTIAEAVGDWVL  350

Query  1229  YGKEVNLID  1255
                +   ID
Sbjct  351   ERNQFRQID  359



>ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=402

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 208/370 (56%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  +  + + + A A GAVCLDGSPPAYH+ +G     ++WLI+ EGG WC ++  C 
Sbjct  24    KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   H GSSK M     F G        I+N    +NP +F NWN V IRYCDGSSFTG
Sbjct  84    SRKKTHLGSSKLMGQQIAFSG--------IMNNKRPFNP-DFYNWNRVKIRYCDGSSFTG  134

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  + ++LL KGLKNA+   L+G SAG ++  LHCD FR LL
Sbjct  135   DVQAVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALL  194

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
                 + KCL D GYFI VK  +       +  F  +V+LH S   LP +CT  +  KP  
Sbjct  195   RMGTKVKCLSDAGYFIKVK--DVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVL--KPSF  250

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESF---VAANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+FIL ++YD  QI   +  S    +   ++ +  +   +P+  + +
Sbjct  251   CFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSM  310

Query  1061  KGFRLQLLDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + FRLQ L+AL    N  S G++I++C+ H  TE    ++   +  +     +KA+ DW+
Sbjct  311   QDFRLQFLNALNKSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWF  370

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  371   YDRNPFQKID  380



>gb|ABK26312.1| unknown [Picea sitchensis]
 gb|ACN40309.1| unknown [Picea sitchensis]
Length=421

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 143/364 (39%), Positives = 201/364 (55%), Gaps = 29/364 (8%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L   E+A   GAVCLDG+ PAY F  G     +NWL+  EGG WC   E C LR   H+G
Sbjct  59    LTLVERAANTGAVCLDGTLPAYRFDRGCGSGANNWLLQFEGGGWCNDTESCILRKTTHRG  118

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SS +M        D    F GIL+  P+ NP +F NWN V + YCDG+SF GDVEE V +
Sbjct  119   SSAYM--------DKVAVFSGILSDKPSENP-DFYNWNRVKLMYCDGASFAGDVEEKVSD  169

Query  563   LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLM  742
             LYFRG+RI++ + D+LL KG+  A++  L+G SAG ++  LHCD FR+LLP++   KC  
Sbjct  170   LYFRGQRIWHAMIDDLLAKGMDKAEKALLSGCSAGGLATYLHCDNFRELLPSSATVKCHA  229

Query  743   DGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDG  922
             D G+F+  K  +   V      +K+ V+L      LP+ C     D P  C FPQY++  
Sbjct  230   DAGFFLDAK--DIAGVYHIRSFYKSTVTLQGVVKNLPKACVSSQSD-PTQCFFPQYVLPY  286

Query  923   MKTPMFILMSSYDKHQINISMHESFVAANRTIREH--------VQLATPIYEGLKGFRLQ  1078
             ++TP+F+L ++YD  Q+    H      +     H        V   +   E L+G+R++
Sbjct  287   IQTPIFVLNAAYDTWQV----HNILAPGSEDPHGHWHYCKQNPVNCTSSQLEILQGYRME  342

Query  1079  LLDALPN-KPSV--GIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAISDWYFYGKEV  1243
             +L+AL   KPS   G+FIN+CF H +      W   NS  +NN   ++A+ DWYF    V
Sbjct  343   MLNALETFKPSETGGMFINSCFCHCQSENQDTWFQSNSPMMNNKTIAQAVGDWYFERCTV  402

Query  1244  NLID  1255
               +D
Sbjct  403   KEVD  406



>gb|KDP28068.1| hypothetical protein JCGZ_19476 [Jatropha curcas]
Length=400

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 149/368 (40%), Positives = 205/368 (56%), Gaps = 36/368 (10%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + +   A A GAVCLDGSPPAYH  +G     +NWL++ EGG WC ++  C  R     G
Sbjct  30    ITYVRNAVAKGAVCLDGSPPAYHLDKGFGTGINNWLVHFEGGGWCNNVTTCLSRKNTRLG  89

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M     F G        ILN    +NP +F NWN V IRYCDGSSFTGDV++  P 
Sbjct  90    SSKQMATQIAFSG--------ILNNRRQFNP-DFYNWNRVKIRYCDGSSFTGDVQKVNPA  140

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG RI+  + ++LL KG+KNA+   L+G SAG ++  LHCD F+ LLP     KC
Sbjct  141   TNLHFRGARIWLAVVEDLLAKGMKNAENALLSGCSAGGLASILHCDSFQALLPMGTNVKC  200

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+V+       ++ +   F  VVSLH S   LP +CT ++  KP LC FPQY+
Sbjct  201   LSDAGYFINVRDVSGAPHIQNY---FNEVVSLHGSAKNLPLSCTSRL--KPALCFFPQYV  255

Query  914   MDGMKTPMFILMSSYDKHQINISM-------HESFVAANRTIR--EHVQLATPIYEGLKG  1066
             +  ++TP+FIL ++YD  QI   +       H ++      I     +QL T     ++ 
Sbjct  256   VQQIRTPLFILNAAYDSWQIKNILAPGVADPHGAWKGCKLDISNCSLLQLKT-----MQD  310

Query  1067  FRLQLLDAL---PNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYFY  1231
             FRLQ L+AL       S G++I++C+ H +  T   W   +S V      +KA+ DW++ 
Sbjct  311   FRLQFLNALYRSTTSSSRGLYIDSCYIHCQSETQETWFMADSPVLGRSKIAKAVGDWFYD  370

Query  1232  GKEVNLID  1255
                V  ID
Sbjct  371   RISVQKID  378



>gb|KCW72726.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=373

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 190/328 (58%), Gaps = 24/328 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NWLI  EGGAWC ++  C  R     G
Sbjct  29    ITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGANNWLILFEGGAWCNNVTTCLARRDTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M+         +  F GIL+    +NP +F NWN + +RYCDG+SFTGDVE   P 
Sbjct  89    SSKQMV--------KELSFSGILSNKQKFNP-DFYNWNKIKVRYCDGASFTGDVEAVNPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R F  I ++L++KG+ NA+   L G SAG ++  L+CDRFR L+P   + KC
Sbjct  140   TNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAILNCDRFRALVPARTKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+ K       +E F   +  VV+ H S   LP +CT KM  KP LC FPQ +
Sbjct  200   LADAGYFINAKDVSGASHIENF---YSEVVATHGSAKNLPTSCTSKM--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATP-IYEGLKGFRLQL  1081
             +  ++TP+FI+ ++YD  QI   +       + T R     ++  +P   + ++ FRL+ 
Sbjct  255   VPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEF  314

Query  1082  LDALP---NKPSVGIFINNCFFHTEIAT  1156
             L AL      PS G+FI++C+ H +  T
Sbjct  315   LRALSAVGTSPSRGMFIDSCYAHCQAGT  342



>ref|XP_009794297.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=402

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/366 (41%), Positives = 211/366 (58%), Gaps = 39/366 (11%)
 Frame = +2

Query  227   AMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMN  406
             A  AVCLDGSPPAYH  +G     ++WLI MEGG WC ++  C  R     GSSK M+  
Sbjct  37    AKEAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNNVTTCLSRKNTRLGSSKQMV--  94

Query  407   pffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PVDNLYFRGK  580
                       F GIL+  P +NP +F NWN V +RYCDGSSFTGDV+   P+ NL+FRG 
Sbjct  95    ------KQLAFSGILSNKPQFNP-DFYNWNRVKVRYCDGSSFTGDVQAVNPITNLHFRGA  147

Query  581   RIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFI  760
             R+F  + ++LL KG+KNA+   L+G SAG ++  LHCD F+ LLP   + KC  D GYFI
Sbjct  148   RVFLAVMEDLLAKGMKNAENAILSGCSAGGLTSILHCDSFKALLPMGAKVKCFSDAGYFI  207

Query  761   HVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPM  937
             +VK       +E F   F +VV LH S   LP +CT ++  KP LC FPQ +   ++TP+
Sbjct  208   NVKDISGAPHIEEF---FGDVVRLHGSAKNLPPSCTSRL--KPNLCFFPQNVAQHVRTPL  262

Query  938   FILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYEGLKGFRLQLLDAL---  1093
             F++ ++YD  QI   +  S VA  R +  + +L     ++   + ++GFRL  L AL   
Sbjct  263   FLVNAAYDSWQIKNILAPS-VADPRGVWRNCKLDILRCSSRQLQTMQGFRLGFLRALYAL  321

Query  1094  -PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSE  1264
              P+  S G FIN+C+ H  TE+   ++   + ++ N   +KA+ DW+F        DK+ 
Sbjct  322   GPSS-SRGYFINSCYAHCQTEVQETWFRADSPKLANKTIAKALGDWFF--------DKNP  372

Query  1265  FIK-DC  1279
             F K DC
Sbjct  373   FQKIDC  378



>ref|XP_006365947.1| PREDICTED: uncharacterized protein LOC102601254 [Solanum tuberosum]
Length=401

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 150/369 (41%), Positives = 206/369 (56%), Gaps = 31/369 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             A F      + + + GAVCLDGSPPAYH   G      NW+I + GGAWC +  +C  R+
Sbjct  39    AYFVDKTIVQNSVSKGAVCLDGSPPAYHLDRGFGHGLRNWIILLSGGAWCRNTTDCLNRS  98

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                 GSS  M+          F F GI ++    NP +F NWN V +RYCDG +FTGD+E
Sbjct  99    KTDLGSSTLML---------PFIFLGIFSKSKRENP-DFYNWNKVFVRYCDGGAFTGDIE  148

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P  NL+FRG RIF+ I ++LL KGLK+AK   L+GGSA      L+CD FR LL   
Sbjct  149   NVDPATNLHFRGARIFDAIIEDLLAKGLKDAKNAILSGGSANGYPAMLYCDHFRSLLHKA  208

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMF  901
              R KCL+D GYFI VK  NP     FE  F++VV+LH ST +LP++CT +M  KP LC F
Sbjct  209   HRVKCLVDAGYFIRVK--NPLLANVFESIFRDVVTLHGSTKVLPKSCTSRM--KPELCFF  264

Query  902   PQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYE---GLKGFR  1072
              + +   +KTP F +MS++D +Q+N     S + ++  I E++Q            K  R
Sbjct  265   LENIQRDIKTPFFTVMSAFDSYQVN-----SIIGSD--IGEYIQARNCTESQNNAFKELR  317

Query  1073  LQLLDALP--NKP-SVGIFINNCFFHTEIATGYWANPNSQ-VNNVLDSKAISDWYFYGKE  1240
              + L ALP  N P   G FI++   HT++   +W   N+  V N+   K   DWY+  K 
Sbjct  318   SEFLRALPKANDPKQRGAFIDSFNRHTQLEL-WWNKINATPVYNLTTIKVFGDWYYDRKY  376

Query  1241  VNLIDKSEF  1267
               +ID+ + 
Sbjct  377   SYVIDEHDL  385



>ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=401

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 147/374 (39%), Positives = 208/374 (56%), Gaps = 32/374 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  + P+ + + A A GAVCLDGSPPAYH+  G     ++WLI +EGG WC ++  C 
Sbjct  21    KTQGVYVPITYVQSAVAKGAVCLDGSPPAYHWDRGYGTGINSWLIQLEGGGWCNNVTSCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
             +R   H GSSK M+            F GILN    +NP +F NWN V +RYCDGSSFTG
Sbjct  81    VRKNTHLGSSKRMVKQ--------IPFSGILNNKHQFNP-DFYNWNRVKVRYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV    PV NL+FRG R++  + ++LL KG++NA+   L+G SAG ++  LHCD F  LL
Sbjct  132   DVAAVNPVTNLHFRGARVWLAVMEDLLAKGMRNAENAVLSGCSAGGLASILHCDSFPALL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDK  883
             P   + KCL D GYFI     N K V G    E  F  +V+ H S   L  +CT +M  +
Sbjct  192   PMGTKVKCLSDAGYFI-----NAKDVSGGHYIEAFFNQLVATHGSAKNLLPSCTSRM--R  244

Query  884   PYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQLAT-----PI  1048
             P LC FP+Y+   ++TP+F + ++YD  QI  ++    +A  R   E  +L         
Sbjct  245   PGLCFFPEYMAQQIQTPLFFINAAYDSWQIR-NILAPGIADPRGYWESCKLDIKNCLPSQ  303

Query  1049  YEGLKGFRLQLLDA---LPNKPSVGIFINNCFFHTEIA-TGYWANPNSQ-VNNVLDSKAI  1213
              + ++ FRLQ L A   L    S G+FI++C+ H +    G W  P+S  +N    +KA+
Sbjct  304   IKTMQDFRLQFLVALLRLGKSSSRGMFIDSCYAHCQTEMQGLWLMPDSPLLNKTSIAKAV  363

Query  1214  SDWYFYGKEVNLID  1255
              DW++       ID
Sbjct  364   GDWFYDRNPFQKID  377



>ref|XP_002459181.1| hypothetical protein SORBIDRAFT_03g047440 [Sorghum bicolor]
 gb|EES04301.1| hypothetical protein SORBIDRAFT_03g047440 [Sorghum bicolor]
Length=431

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 210/358 (59%), Gaps = 28/358 (8%)
 Frame = +2

Query  221   AKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMM  400
             A   GAVCLDG+PPAYHF+ G  +   NWL+++EGG+WC S E C  R   + GSS HM 
Sbjct  68    ATDKGAVCLDGTPPAYHFLPGFGDGSHNWLLHLEGGSWCRSFESCARRKKTNLGSSAHM-  126

Query  401   MNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN---LYF  571
                    D    F GIL+ D + NP +F NWN V IRYCDG+SF+G V++ V N    +F
Sbjct  127   -------DTRAEFVGILSDDQSQNP-DFYNWNKVKIRYCDGASFSGHVQDEVKNGTGFFF  178

Query  572   RGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGG  751
             RG+RI+  +  ELL+KGL  AKQ FLTG SAG +S  +HCD FR +LPNT   KCL DGG
Sbjct  179   RGQRIWEAVMAELLSKGLARAKQAFLTGCSAGGLSTYIHCDDFRAVLPNTPTVKCLADGG  238

Query  752   YFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             +F+ V+  + ++ + GF   + +V  L +     P  C+  M  +P  C FPQ +   + 
Sbjct  239   FFLDVEDISGRRYMRGF---YNDVARLQDVHKRFPH-CSSDM--EPGQCFFPQEVAKSIT  292

Query  929   TPMFILMSSYDKHQI-NISMHESFVAAN--RTIREHV-QLATPIYEGLKGFRLQLLDAL-  1093
             TPMFIL  +YD  Q+ ++   E     N  +  R  + + ++   E L+GFR  LLDA+ 
Sbjct  293   TPMFILNPAYDVWQVEHVLSPEGSDPQNLWQNCRTDITKCSSKQLEVLQGFRKALLDAIN  352

Query  1094  --PNKPSVGIFINNCFFHTEIATGY-WANPN-SQVNNVLDSKAISDWYFYGKEVNLID  1255
                 +   G+FI++CF H +      W +P+ +++NN   ++A+ DW+F  +EV  ID
Sbjct  353   EFKKRRDWGMFIDSCFIHCQSMKALAWHSPSAARINNKTAAEAVGDWFFDRREVKEID  410



>ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=430

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 208/370 (56%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  +  + + + A A GAVCLDGSPPAYH+ +G     ++WLI+ EGG WC ++  C 
Sbjct  24    KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   H GSSK M     F G        I+N    +NP +F NWN V IRYCDGSSFTG
Sbjct  84    SRKKTHLGSSKLMGQQIAFSG--------IMNNKRPFNP-DFYNWNRVKIRYCDGSSFTG  134

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  + ++LL KGLKNA+   L+G SAG ++  LHCD FR LL
Sbjct  135   DVQAVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALL  194

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
                 + KCL D GYFI VK  +       +  F  +V+LH S   LP +CT  +  KP  
Sbjct  195   RMGTKVKCLSDAGYFIKVK--DVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVL--KPSF  250

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESF---VAANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+FIL ++YD  QI   +  S    +   ++ +  +   +P+  + +
Sbjct  251   CFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSM  310

Query  1061  KGFRLQLLDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + FRLQ L+AL    N  S G++I++C+ H  TE    ++   +  +     +KA+ DW+
Sbjct  311   QDFRLQFLNALNKSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWF  370

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  371   YDRNPFQKID  380



>ref|XP_011028482.1| PREDICTED: uncharacterized protein LOC105128479 isoform X2 [Populus 
euphratica]
Length=481

 Score =   248 bits (633),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 209/370 (56%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  +  + + + A A GAVCLDGSPPAYH+ +G+    ++WLI+ EGG WC ++  C 
Sbjct  103   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCL  162

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   H GSSK M             F GI+N    +NP +F NWN V IRYCDGSSFTG
Sbjct  163   SRKKTHLGSSKLM--------GQQIAFSGIMNNKRPFNP-DFYNWNRVKIRYCDGSSFTG  213

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  + ++LL KGLKNA+   L+G SAG ++  LHCD FR LL
Sbjct  214   DVQAVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALL  273

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
                 + KCL D GYFI VK  +       +  F  +V+LH S   LP +CT  +  KP  
Sbjct  274   RMGTKVKCLSDAGYFIKVK--DVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSML--KPSF  329

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESF---VAANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+FIL ++YD  QI   +  S    +   ++ +  +   +P+  + +
Sbjct  330   CFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSM  389

Query  1061  KGFRLQLLDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + FRLQ L+AL    N  S G++I++C+ H  TE    ++   +  +     +KA+ DW+
Sbjct  390   QDFRLQFLNALKTSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWF  449

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  450   YDRNPFQKID  459



>ref|XP_006361581.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=387

 Score =   245 bits (625),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 206/363 (57%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + + A A GAVCLDGSPPAYHF +G     +NWLI +EGGAWC +   C  RT    G
Sbjct  29    ITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWLIQLEGGAWCNNATTCLARTKTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+    F G        IL+    +NP +F NWN + I+YCDGSSFTGDV   +P 
Sbjct  89    SSKLMLKTVSFSG--------ILSNKAEFNP-DFYNWNRIRIKYCDGSSFTGDVAAADPK  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
               +++RG RIF+ + ++ L KG+KNA+   L G SAG+++  LHCDRF+ LLP   + KC
Sbjct  140   TKVFYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKC  199

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D G+FI+ +       +E F   +  VV+ H S   LPQ+CT ++  KP LC FPQ +
Sbjct  200   LSDAGFFINTQTISGTSHIEQF---YSEVVNTHGSVKNLPQSCTSRL--KPGLCFFPQNV  254

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFR---  1072
                ++TP+F++ ++YD  QI   +       + T R    + +  ++   + ++ FR   
Sbjct  255   AQHIQTPLFLVNAAYDSWQIKHILAPEVADPHGTWRNCKLDILNCSSTQLQTMQAFRSEF  314

Query  1073  LQLLDALPNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYFYGKEVN  1246
             L+ L++L    + G +IN+C+ H +  T   W   +S V +    +KA+ DWY+  K   
Sbjct  315   LKALNSLGPSSTRGYYINSCYAHCQTGTQETWLMDDSLVLSGTTIAKAVGDWYYERKRFQ  374

Query  1247  LID  1255
              ID
Sbjct  375   EID  377



>ref|XP_011028479.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028480.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028481.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
Length=509

 Score =   248 bits (634),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 209/370 (56%), Gaps = 24/370 (6%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  +  + + + A A GAVCLDGSPPAYH+ +G+    ++WLI+ EGG WC ++  C 
Sbjct  103   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCL  162

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   H GSSK M             F GI+N    +NP +F NWN V IRYCDGSSFTG
Sbjct  163   SRKKTHLGSSKLM--------GQQIAFSGIMNNKRPFNP-DFYNWNRVKIRYCDGSSFTG  213

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  + ++LL KGLKNA+   L+G SAG ++  LHCD FR LL
Sbjct  214   DVQAVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALL  273

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
                 + KCL D GYFI VK  +       +  F  +V+LH S   LP +CT  +  KP  
Sbjct  274   RMGTKVKCLSDAGYFIKVK--DVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSML--KPSF  329

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESF---VAANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+FIL ++YD  QI   +  S    +   ++ +  +   +P+  + +
Sbjct  330   CFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSM  389

Query  1061  KGFRLQLLDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + FRLQ L+AL    N  S G++I++C+ H  TE    ++   +  +     +KA+ DW+
Sbjct  390   QDFRLQFLNALKTSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWF  449

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  450   YDRNPFQKID  459



>tpg|DAA36173.1| TPA: hypothetical protein ZEAMMB73_990456 [Zea mays]
Length=370

 Score =   244 bits (623),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 185/330 (56%), Gaps = 35/330 (11%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             ++F + A A GAVCLDGSPP YHF  G+    +NW+++MEGG WC + +EC +R    +G
Sbjct  35    MVFLKAAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCRNPDECAVRKGNFRG  94

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M             F GIL  +   NP +F NWN V IRYCDGSSFTGDVE  +  
Sbjct  95    SSKFM---------KPLSFSGILGGNQKSNP-DFYNWNRVKIRYCDGSSFTGDVEAVDTA  144

Query  557   DNLYFRGKRIFNVITDELLN-KGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
              +L +RG R++  + D+LL  +G+  A+   L+G SAG ++  LHCDRF  L P   + K
Sbjct  145   KDLRYRGFRVWRAVIDDLLTVRGMSKAQNALLSGCSAGGLAAILHCDRFHDLFPAKTKVK  204

Query  734   CLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
             C  D GYF      + K + G       +K+VV+LH S   LP +CT K K  P LCMFP
Sbjct  205   CFSDAGYFF-----DGKDISGNFYARSIYKSVVNLHGSAKNLPASCTSKPKQSPELCMFP  259

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---------HVQLATPIYEG  1057
             QY++  M+TP+FIL ++YD  Q+   +  S     +T  +           QL T     
Sbjct  260   QYVVPTMRTPLFILNAAYDSWQVKNVLAPSPADPKKTWAQCKLDIKSCSASQLTT-----  314

Query  1058  LKGFRLQLLDALPNKPSVGIFINNCFFHTE  1147
             L+ FR   L ALP   SVG+FI++C  H +
Sbjct  315   LQNFRTDFLAALPKTQSVGMFIDSCNAHCQ  344



>ref|XP_008355284.1| PREDICTED: uncharacterized protein LOC103418943 [Malus domestica]
Length=398

 Score =   245 bits (625),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 204/361 (57%), Gaps = 26/361 (7%)
 Frame = +2

Query  185   KANFYP--LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             KA  +P  +   E A A GAVCLDGS PAYHF +G     +NWL+++EGG WC S+  C 
Sbjct  21    KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNSVATCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   ++GSS  M        +    F G+L      NP +F NWN + +RYCDGSSFTG
Sbjct  81    DRKNNYRGSSTKM--------EKTMSFSGVLGNKQQTNP-DFYNWNRIKVRYCDGSSFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P  NL+FRG R+F  I D+LL KG+KNA+   L+G SAG ++  L+CD F  LL
Sbjct  132   DVEAVDPATNLHFRGARVFRAIIDDLLAKGMKNAQTALLSGCSAGGLASILNCDNFHSLL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KCL D GYFI+ K  +  Q    +  +  VV+LH S   LP +CT +M   P L
Sbjct  192   PVGTKVKCLADAGYFINAKTVSGSQY--IQTFYSEVVALHGSAKNLPASCTSRM--SPGL  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YEGL  1060
             C FPQ ++   +TP+F + ++YD  QI   +         A +  +  ++  +P   + +
Sbjct  248   CFFPQNVVPQTRTPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPSQLQTM  307

Query  1061  KGFRLQLLDALPNKPSV---GIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWY  1225
             + +RLQ L+A+    S    G+FI++C+ H +I T   + A  +  ++    +KA+ DWY
Sbjct  308   QEYRLQFLNAVAGASSSSSNGLFIDSCYAHCQIGTQETWLATDSPMLSKTTIAKAVGDWY  367

Query  1226  F  1228
             +
Sbjct  368   Y  368



>gb|EYU29130.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=395

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 142/368 (39%), Positives = 210/368 (57%), Gaps = 29/368 (8%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + + E A A GAVCLDGS PAYHF +G+    +NWL+++EGG WC +   C  R   
Sbjct  21    FVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGGGWCNNATTCLARRNG  80

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--  547
               GSSK M     F G        I +  P +NP +F NWN + +RYCDG+SFTGDVE  
Sbjct  81    RLGSSKQMAKQIAFSG--------IFSNKPQFNP-DFYNWNRLKVRYCDGASFTGDVEAV  131

Query  548   EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
             +P   LY+RG R+F  + ++LL KG+KNA+   L+G SAG ++  L+CDRF+ LLP +  
Sbjct  132   DPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILNCDRFKSLLPISTN  191

Query  728   FKCLMDGGYFIHVKKDNPKQ-VEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
              KC  D G+FI+ K  +  Q +E F   + +VV+ H S   L Q+CT KM  KP LC FP
Sbjct  192   VKCFADAGFFINAKDVSGAQHIEQF---YNDVVTTHGSAKHLAQSCTSKM--KPSLCFFP  246

Query  905   QYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHV-----QLATPIYEGLKGF  1069
             + ++  ++TP+F++ ++YD  QI  ++    VA    +  +      + +T   + ++ +
Sbjct  247   ENMVQAIQTPIFVVNAAYDSWQIK-NILAPGVADPHGLWHNCKTDIKKCSTTQLQTMQEY  305

Query  1070  RLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNN-VLDSKAISDWYFY  1231
             RL+ L AL    +  S G FIN+C+ H  TE    +  N +  +NN V  +KA+ DW++ 
Sbjct  306   RLEFLKALSGLMSAKSKGYFINSCYAHCQTETQETWSTNISPMLNNKVTIAKAVGDWFYE  365

Query  1232  GKEVNLID  1255
                   ID
Sbjct  366   RSPFEKID  373



>ref|NP_001151183.1| LOC100284816 precursor [Zea mays]
 gb|ACG41900.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/374 (39%), Positives = 203/374 (54%), Gaps = 39/374 (10%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A A GAVCLDGS PAYH   G+   +++WL++ EGG WC ++  C  R     G
Sbjct  30    ITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNNVTTCLQRKRTRLG  89

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M     F G        IL+  P  NP +F NWN V +RYCDGSSFTGDVEE  P 
Sbjct  90    SSKEMATQIAFSG--------ILSDTPDDNP-DFYNWNKVKVRYCDGSSFTGDVEEVDPA  140

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
               L++RG RI+  + D+LL KG+  A+   ++G SAG ++  LHCDRF  LLP   R KC
Sbjct  141   TKLHYRGARIWQAVMDDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPPAARVKC  200

Query  737   LMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
             L D G+FI     N K V G       F +VV+ H S   LP +CT  +   P  C FPQ
Sbjct  201   LSDAGFFI-----NEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTL--PPGTCFFPQ  253

Query  908   YLMDGMKTPMFILMSSYDKHQI-NISM------HESFVAANRTIREHVQLATPIYEGLKG  1066
               +  ++TP+FIL ++YD  Q+ NI +      H  + +    I +       + +G +G
Sbjct  254   NEVKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRG  313

Query  1067  FRLQLLDALPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKE  1240
               L+ +  L N  S G+FIN+CF H  +EI   ++++ +  + N   + A+ DW+F    
Sbjct  314   DFLKEVAELGNSDSRGLFINSCFVHCQSEIQELWFSSDSPVLGNTTVANAVGDWFF----  369

Query  1241  VNLIDKSEFIK-DC  1279
                 D+S F K DC
Sbjct  370   ----DRSSFQKIDC  379



>ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis]
 gb|KDO40413.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=399

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 204/374 (55%), Gaps = 39/374 (10%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A   GAVCLDGSPPAYHF +G     +NWL+++EGG WC ++  C  R     G
Sbjct  29    ITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNVTTCLERKKTRLG  88

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M+            F G+L+    +NP +F NWN + +RYCDG+SFTGDVE   P 
Sbjct  89    SSKQMV--------KVVAFSGMLSNKQKFNP-DFYNWNRIKVRYCDGASFTGDVEAVNPA  139

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
             +NL+FRG R+F  + ++L+ KG+KNA+   L+G SAG ++  LHCD FR L P   + KC
Sbjct  140   NNLHFRGARVFQAVMEDLMAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKC  199

Query  737   LMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
               D GYFI     N K V G    E  +  VV+ H S   LP +CT ++   P LC FPQ
Sbjct  200   FADAGYFI-----NAKDVSGASHIEQFYAQVVATHGSAKHLPASCTSRL--SPGLCFFPQ  252

Query  908   YLMDGMKTPMFILMSSYDKHQINISMHESFVAANRT---IREHVQLATPI-YEGLKGFRL  1075
             Y+   + TP+FI+ ++YD  QI   +       + T    +  +   +P   + ++ FR 
Sbjct  253   YMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRT  312

Query  1076  QLLDALPN---KPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKE  1240
             Q L+AL       S G+FI+ C+ H  TE+   +    +  +  +  +KA+ DWY+    
Sbjct  313   QFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKMSIAKAVGDWYY----  368

Query  1241  VNLIDKSEFIK-DC  1279
                 D+S F K DC
Sbjct  369   ----DRSPFQKIDC  378



>ref|XP_006363875.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=402

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 147/384 (38%), Positives = 207/384 (54%), Gaps = 25/384 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  F  + +     A GAVCLDGSPPAYH  +G     ++WLI MEGG WC +I  C 
Sbjct  21    RTEGLFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSWLIQMEGGGWCNNISTCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+ N  F G        IL+  P +NP +F NWN V + YCDGSSFTG
Sbjct  81    SRKNTRLGSSKQMVENLAFSG--------ILSNLPQFNP-DFYNWNRVKVGYCDGSSFTG  131

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P+ NL+FRG R+F  + ++LL KG+KNA+   L+G SAG ++  LHCD F+ LL
Sbjct  132   DVQAVNPITNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGGLTSILHCDSFKALL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KC  D GYFI  K  +       E  F++VVSLH S   LP  CT ++  KP L
Sbjct  192   PMGAKVKCFSDAGYFIDAK--DISGAPHIEEYFRDVVSLHGSAKNLPPVCTSRL--KPDL  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHES-------FVAANRTIREHVQLATPIY  1051
             C FPQ +   ++TP+F++ ++YD  QI   +          ++     I +       I 
Sbjct  248   CFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPGVADPYGFWLNCKLDILKCSSRQLQIM  307

Query  1052  EGLKGFRLQLLDALPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
              G +   L+ L+AL    S G FIN+CF H  TE+   ++   + ++ N   +KA+ DW+
Sbjct  308   HGYRLLFLRALNALGPSSSRGYFINSCFAHCQTEVQETWYRADSPKLANKTIAKALGDWF  367

Query  1226  FYGKEVNLID-KSEFIKDCYTNGY  1294
             +       ID      K C+  G+
Sbjct  368   YDKNPFQKIDCPYPCDKTCHNRGF  391



>ref|NP_193677.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AAT70429.1| At4g19420 [Arabidopsis thaliana]
 gb|AAU45212.1| At4g19420 [Arabidopsis thaliana]
 gb|AEE84180.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=397

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/362 (39%), Positives = 207/362 (57%), Gaps = 28/362 (8%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             T+  F  + F   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C  
Sbjct  20    TEGLFVNITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVS  79

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R     GSSK M+ N          F  IL+    YNP +F NWN V +RYCDG+SFTGD
Sbjct  80    RMHTRLGSSKKMVEN--------LAFSAILSNKKQYNP-DFYNWNRVKVRYCDGASFTGD  130

Query  542   VEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VE   P  NL+FRG R++  +  ELL KG+ NA+   L+G SAG ++  +HCD FR LLP
Sbjct  131   VEAVNPATNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALLP  190

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLC  895
                + KCL D G+F++ +  +   V+  +  F++VV+LH S   LP++CT ++   P +C
Sbjct  191   MGTKVKCLSDAGFFLNTR--DVSGVQYIKTYFEDVVTLHGSAKNLPRSCTSRL--TPAMC  246

Query  896   MFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN-----RTIREHVQLATPI-YEG  1057
              FPQY+   ++TP+FIL ++YD  QI   +     AA+     ++ +  ++   P   + 
Sbjct  247   FFPQYVARQIRTPLFILNAAYDSWQIKNILAPR--AADPYGKWQSCQLDIKNCHPSQIKV  304

Query  1058  LKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
             ++ FRL+ L A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ DW
Sbjct  305   MQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGDW  364

Query  1223  YF  1228
              +
Sbjct  365   VY  366



>gb|EMT14315.1| hypothetical protein F775_08483 [Aegilops tauschii]
Length=400

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 204/363 (56%), Gaps = 27/363 (7%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + + E A A GAVCLDGSPPAYH   G+     +WL++ EGG WC ++  C  R+  
Sbjct  27    FVDITYVESAVAKGAVCLDGSPPAYHLARGSGSGASSWLVHFEGGGWCNNVTTCLQRSHT  86

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE-  550
               GSSK M     F G        IL+  P YNP +F NWN V +RYCDGSSFTG+ EE 
Sbjct  87    RLGSSKEMAKQVAFSG--------ILSNAPEYNPVDFYNWNKVRVRYCDGSSFTGNKEEV  138

Query  551   -PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
              P  NL++RG R++  + ++LL KG+  A+   ++G SAG ++  LHCDRF +LLP    
Sbjct  139   DPRTNLHYRGARVWQAVMEDLLAKGMNKAENALISGCSAGGLTSILHCDRFHRLLPAAAN  198

Query  728   FKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
              KCL D G+FI+VK  +   V      F +VV  H S   LP  CT K+     +C+FPQ
Sbjct  199   VKCLSDAGFFINVK--DIAGVNHAAAFFSDVVKTHGSVKNLPSLCTSKLPAG--MCLFPQ  254

Query  908   YLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQLATP-----IYEGL-KG  1066
               +  ++TP+FIL ++YD  Q+ NI +        R+ +  ++  +      + +G   G
Sbjct  255   NEVKQIQTPLFILNAAYDSWQVRNILVPGGSDPRWRSCKHDIKQCSAKQLKILQDGADAG  314

Query  1067  FR---LQLLDALPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFY  1231
             FR   L+ ++A  + P+ G+FIN+CF H  +EI   ++A  +  + +   + A+ DW FY
Sbjct  315   FRDHFLEAIEAQGDSPTRGLFINSCFAHCQSEIQEIWFAPGSPVLGDKRIASAVGDW-FY  373

Query  1232  GKE  1240
             G+ 
Sbjct  374   GRS  376



>gb|ACG39759.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/374 (39%), Positives = 202/374 (54%), Gaps = 39/374 (10%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A A GAVCLDGS PAYH   G+   + +WL++ EGG WC ++  C  R     G
Sbjct  30    ITYVESAVAKGAVCLDGSAPAYHLARGSGSGEKSWLVHFEGGGWCNNVTTCLQRKRTRLG  89

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M     F G        IL+  P  NP +F NWN V +RYCDGSSFTGDVEE  P 
Sbjct  90    SSKEMATQIAFSG--------ILSDTPDDNP-DFYNWNKVKVRYCDGSSFTGDVEEVDPA  140

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
               L++RG RI+  + D+LL KG+  A+   ++G SAG ++  LHCDRF  LLP   R KC
Sbjct  141   TKLHYRGARIWQAVMDDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPPAARVKC  200

Query  737   LMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
             L D G+FI     N K V G       F +VV+ H S   LP +CT  +   P  C FPQ
Sbjct  201   LSDAGFFI-----NEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTL--PPGTCFFPQ  253

Query  908   YLMDGMKTPMFILMSSYDKHQI-NISM------HESFVAANRTIREHVQLATPIYEGLKG  1066
               +  ++TP+FIL ++YD  Q+ NI +      H  + +    I +       + +G +G
Sbjct  254   NEVKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRG  313

Query  1067  FRLQLLDALPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKE  1240
               L+ +  L N  S G+FIN+CF H  +EI   ++++ +  + N   + A+ DW+F    
Sbjct  314   DFLKEVAELGNSDSRGLFINSCFVHCQSEIQELWFSSDSPVLGNTTVANAVGDWFF----  369

Query  1241  VNLIDKSEFIK-DC  1279
                 D+S F K DC
Sbjct  370   ----DRSSFQKIDC  379



>ref|XP_009407790.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 201/362 (56%), Gaps = 28/362 (8%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             Q + +  P+   + A A GAVCLDGS PAY+   G+    +NWL+++EGG WC ++EEC 
Sbjct  57    QVEGDNVPMTVLKGAVAEGAVCLDGSAPAYNLAPGSGSGANNWLVFVEGGGWCSTVEECL  116

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R    +GSS HM             F G+L      NP +F NWN V IRYCDG+SFTG
Sbjct  117   ARKNTFRGSSDHM---------PPQSFSGMLGGVQQSNP-DFYNWNRVKIRYCDGASFTG  166

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             D+E  +P   L+FRG R++  I  +LL KG+  A++  L G SAG ++  LHCD FR LL
Sbjct  167   DIEKVDPATGLHFRGARVWRAIMKDLLAKGMNKAQKALLGGCSAGGLTTILHCDNFRSLL  226

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P T   KC  D GYFI  K  +    +  +  + +VV LH S   LP +CT ++      
Sbjct  227   PATATVKCFSDAGYFIDAK--DISGADAIQSFYGDVVKLHGSANNLPSSCTSRLPANK--  282

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGL  1060
             C FPQ ++  +KTP+FIL ++YD+ QI+  +  S      T  +      + ++   + L
Sbjct  283   CFFPQNVVATLKTPLFILNAAYDQWQIDHILVPSSADPKNTWGDCKLDIKKCSSDQLQKL  342

Query  1061  KGFRLQLLDALP--NKPSVGIFINNCFFHTEIATG----YWANPNSQVNNVLDSKAISDW  1222
             +GFR   L+ALP     S G+FI +C  HT   +G    ++++ + +++N    KA+ DW
Sbjct  343   QGFRTTFLNALPGAGSSSTGLFILSC--HTHCLSGDADIWYSDDSPKIDNTPIGKAVGDW  400

Query  1223  YF  1228
             YF
Sbjct  401   YF  402



>ref|XP_002867938.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44197.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/361 (39%), Positives = 207/361 (57%), Gaps = 24/361 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  F  + +   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C 
Sbjct  2     KTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCV  61

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+ N  F          IL+    YNP +F NWN V +RYCDGSSFTG
Sbjct  62    SRMHTRLGSSKKMVENLAFSA--------ILSNKKQYNP-DFYNWNRVKVRYCDGSSFTG  112

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG R++  +  ELL KG+ NA+   L+G SAG ++  +HCD FR LL
Sbjct  113   DVQAVNPATNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALL  172

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KCL D G+F++ +  +   V+  +  F++VV+LH S   LP++CT ++   P +
Sbjct  173   PMGTKVKCLSDAGFFLNTR--DVSGVQYIKSYFEDVVTLHGSAKNLPRSCTSRL--TPAM  228

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANR--TIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+FIL ++YD  QI NI    +     +  + +  ++   P   + +
Sbjct  229   CFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQIKVM  288

Query  1061  KGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             + FRL+ L A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ DW 
Sbjct  289   QDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGDWV  348

Query  1226  F  1228
             +
Sbjct  349   Y  349



>gb|ACJ85294.1| unknown [Medicago truncatula]
 gb|AFK37076.1| unknown [Medicago truncatula]
Length=393

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 196/369 (53%), Gaps = 36/369 (10%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+ F + A A GAVCLDGSPPAYHF +G     DNW+++ EGG WC +   C  R     
Sbjct  29    PITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNNATTCLDRIDTRL  88

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             G SK M        D    F G  +    +NP +F NWN + +RYCDGSSFTGDVE  +P
Sbjct  89    GPSKKM--------DKTLSFSGFFSSGKKFNP-DFYNWNRIKVRYCDGSSFTGDVEAVDP  139

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL++RG RIF  + ++LL KG+KNAK   L+G SAG ++  L CDRFR LLP   + K
Sbjct  140   KTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSILQCDRFRTLLPAAAKVK  199

Query  734   CLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             C+ D GYFI+VK       +E F   +  VV  H S   LP +CT ++   P LC FPQ 
Sbjct  200   CVSDAGYFINVKAVSGASHIEQF---YSQVVQTHGSAKNLPSSCTSRL--SPGLCFFPQN  254

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR---------EHVQLATPIYEGLK  1063
             +   +KTP+F + ++YD  QI   +       + T R            QL+T     ++
Sbjct  255   VAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSANQLST-----MQ  309

Query  1064  GFRLQLLDAL---PNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYF  1228
             GFR + L A+    N PS G+FI+ C+ H +      W   +  V      +KA+ DWY+
Sbjct  310   GFRTEFLKAISVVSNSPSKGMFIDGCYSHRQTGMQETWMRTDFPVLAKTTIAKAVGDWYY  369

Query  1229  YGKEVNLID  1255
                    ID
Sbjct  370   DRSTFQQID  378



>ref|XP_010920600.1| PREDICTED: protein notum homolog isoform X2 [Elaeis guineensis]
Length=433

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/363 (42%), Positives = 205/363 (56%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L     A+  GAVCLDGSPP YHF  G    KD+WL+++EGG WC S+  C  R +   G
Sbjct  63    LTLVRDAQKKGAVCLDGSPPGYHFQRGFGSGKDSWLLHLEGGGWCNSVASCASRKMTALG  122

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SS +M     F G        IL+  P+ NP +F NWN V IRYCDG+S++GDVE  + N
Sbjct  123   SSIYMQHQVPFDG--------ILSNVPSQNP-DFYNWNKVKIRYCDGASYSGDVESGIQN  173

Query  563   ---LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                L+FRG+RI+ VI DELL KGL NAKQ FLTG SAG ++  +HC+ FR LLP     K
Sbjct  174   GTKLFFRGQRIWEVIMDELLLKGLANAKQAFLTGCSAGGLATFIHCEDFRALLPKEVIVK  233

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             CL D G+F+   + +  Q       + +V+ L N  G   Q CT +M  +P  C F   +
Sbjct  234   CLADAGFFL--DEMDISQRRFIRSFYDDVIRLQN-VGKNFQDCTSRM--EPSQCFFAHEI  288

Query  914   MDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQL---ATPIYEGLKGFRLQL  1081
             +  + TP FIL  +YD  QI +I   ES        R  + +    +   E L+GFR+ L
Sbjct  289   IKNIDTPFFILNPAYDIWQIQHILAPESSDTRQSWQRCKLNIHNCDSNQIESLQGFRVAL  348

Query  1082  LDALPN---KPSVGIFINNCFFHTEIATGY-WANPNS-QVNNVLDSKAISDWYFYGKEVN  1246
             L+AL +     + G+FIN+CF H +  +   W +PNS +VNN   ++A+ DWYF   +V 
Sbjct  349   LNALSDFQHNRNGGMFINSCFIHCQTMSNITWHSPNSPKVNNKTIAEAVGDWYFNRSKVK  408

Query  1247  LID  1255
              ID
Sbjct  409   EID  411



>gb|EEE61621.1| hypothetical protein OsJ_16047 [Oryza sativa Japonica Group]
Length=670

 Score =   250 bits (639),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 209/372 (56%), Gaps = 35/372 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
               KA    ++F + A + GAVCLDGSPP YHF  G+    +NWL++MEGG WC + +EC 
Sbjct  299   SAKAGDVDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECS  358

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
             +R    +GSSK M             F GI+  +   NP +F NWN + +RYCDGSSFTG
Sbjct  359   VRQGNFRGSSKFMR---------PLSFSGIIGGNQRNNP-DFYNWNRIKVRYCDGSSFTG  408

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  E   NL+FRG R++N I ++LL KG+  A+   L+G SAG ++  LHCD+FR LL
Sbjct  409   DVETVETSTNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAGGLAAILHCDQFRDLL  468

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEG--FELTF-KNVVSLHNSTGMLPQTCTQKMKDK  883
             P T   KC  D G+F+     + K + G  F  TF K+VV+LH S   LP +CT KM   
Sbjct  469   PATANVKCFSDAGFFV-----DGKDITGNDFVRTFYKDVVNLHGSAKNLPSSCTSKM--S  521

Query  884   PYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIY  1051
             P LC FPQ ++  ++TP+FIL ++YD  QI   +  S     +T      +    ++   
Sbjct  522   PDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDITACSSSQV  581

Query  1052  EGLKGFRLQLLDALPNKP-----SVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKA  1210
               L+ FR   L ALP KP     ++ IFI++C+ H +  +   + A  +  V      KA
Sbjct  582   TTLQNFRTDFLAALP-KPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEKTQIGKA  640

Query  1211  ISDWYFYGKEVN  1246
             + DW F+ +EV+
Sbjct  641   VGDW-FHDREVS  651



>ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine 
max]
 ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine 
max]
 ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine 
max]
Length=399

 Score =   243 bits (621),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 205/371 (55%), Gaps = 26/371 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             QT+     + F E A A GAVCLDGSPPAYHF +G+    +NW+++ EGG WC ++  C 
Sbjct  21    QTEGVPVGITFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNNVTTCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M        D    F G  +    +NP +F +WN + +RYCDGSSFTG
Sbjct  81    SRRDTRLGSSKKM--------DTSLSFSGFFSNSKKFNP-DFYDWNRIKVRYCDGSSFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P  NL+FRG R+F V+ ++LL KG+KNA+   ++G SAG ++  L+CDRF+ LL
Sbjct  132   DVEAVDPKTNLHFRGARVFAVVVEDLLAKGMKNAQNAIISGCSAGGLASILNCDRFKSLL  191

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P T + KCL D G+FI+VK     +++E F   +  VV  H S   LP +CT ++  +P 
Sbjct  192   PATTKVKCLADAGFFINVKDVSGAQRIEEF---YSQVVQTHGSAKNLPTSCTSRL--RPG  246

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATP-IYEG  1057
             LC FPQ ++  + TP+F + ++YD  QI   +           RE    ++  +P     
Sbjct  247   LCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPRGQWRECKLDIKNCSPNQLSV  306

Query  1058  LKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
             ++GFR   L A     N  S G FI+ C+ H  T I   +  N +  V     +KA+ DW
Sbjct  307   MQGFRTDFLRAFSVVGNAASKGHFIDGCYAHCQTGIQETWLRNDSPVVAKTSIAKAVGDW  366

Query  1223  YFYGKEVNLID  1255
             ++  +    ID
Sbjct  367   FYDRRPFREID  377



>ref|XP_006385136.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62933.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=391

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 137/335 (41%), Positives = 194/335 (58%), Gaps = 22/335 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+  +  + + + A A GAVCLDGSPPAYH+ +G     ++WLI+ EGG WC ++  C 
Sbjct  24    KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R   H GSSK M     F G        I+N    +NP +F NWN V IRYCDGSSFTG
Sbjct  84    SRKKTHLGSSKLMGQQIAFSG--------IMNNKRPFNP-DFYNWNRVKIRYCDGSSFTG  134

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG RI+  + ++LL KGLKNA+   L+G SAG ++  LHCD FR LL
Sbjct  135   DVQAVNPATNLHFRGARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALL  194

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
                 + KCL D GYFI VK  +       +  F  +V+LH S   LP +CT  +  KP  
Sbjct  195   RMGTKVKCLSDAGYFIKVK--DVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVL--KPSF  250

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESF---VAANRTIREHVQLATPI-YEGL  1060
             C FPQY+   ++TP+FIL ++YD  QI   +  S    +   ++ +  +   +P+  + +
Sbjct  251   CFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSM  310

Query  1061  KGFRLQLLDAL---PNKPSVGIFINNCFFHTEIAT  1156
             + FRLQ L+AL    N  S G++I++C+ H +  T
Sbjct  311   QDFRLQFLNALNKSTNSSSRGLYIDSCYAHCQTET  345



>gb|KHN41567.1| Protein notum like [Glycine soja]
Length=399

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 206/371 (56%), Gaps = 26/371 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             QT+     + F E A A GAVCLDGSPPAYHF +G+    +NW+++ EGG WC ++  C 
Sbjct  21    QTEGVPVGITFVENAVAKGAVCLDGSPPAYHFNKGSGAGINNWIVHFEGGGWCNNVTTCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M        D    F G  +    +NP +F +WN + +RYCDGSSFTG
Sbjct  81    SRRDTRLGSSKKM--------DTSLSFSGFFSNSKKFNP-DFYDWNRIKVRYCDGSSFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P  NL+FRG R+F V+ ++LL KG+KNA+   ++G SAG ++  L+CDRF+ LL
Sbjct  132   DVEAVDPKTNLHFRGARVFAVVVEDLLAKGMKNAQNAIISGCSAGGLASILNCDRFKSLL  191

Query  713   PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
             P T + KCL D G+FI+VK     +++E F   +  VV  H S   LP +CT ++  +P 
Sbjct  192   PATTKVKCLADAGFFINVKDVSGAQRIEEF---YSQVVQTHGSAKNLPTSCTSRL--RPG  246

Query  890   LCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATP-IYEG  1057
             LC FPQ ++  + TP+F + ++YD  QI   +       +   RE    ++  +P     
Sbjct  247   LCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSV  306

Query  1058  LKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
             ++GFR   L A     N  S G FI+ C+ H  T I   +  N +  V     +KA+ DW
Sbjct  307   MQGFRTDFLRAFSVVGNGASKGHFIDGCYAHCQTGIQETWLRNDSPVVAKTSIAKAVGDW  366

Query  1223  YFYGKEVNLID  1255
             ++  +    ID
Sbjct  367   FYDRRPFREID  377



>gb|KCW72718.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72719.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=403

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 139/358 (39%), Positives = 202/358 (56%), Gaps = 38/358 (11%)
 Frame = +2

Query  236   AVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMNpff  415
             AVCLDGSPPAYHF +G     +NWL+  EGG WC ++  C  R     GSSK M+    F
Sbjct  4     AVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNNVTTCLARRDTRLGSSKEMVKEVAF  63

Query  416   pgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLYFRGKRIF  589
              G        IL+ + ++NP +F NWN + +RYCDG+SFTGDVE  +P   L+FRG R F
Sbjct  64    SG--------ILSNNHSFNP-DFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARAF  114

Query  590   NVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFIHVK  769
               I ++LL+KG+ +A+   L+G SAG ++  LHCDRFR L+P +   KC+ D GYFI+ K
Sbjct  115   VAIIEDLLSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKCVADAGYFINAK  174

Query  770   KDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFILM  949
               +  Q    E  +  VV+ H S   LP +CT ++  +P LC FPQ ++  ++TP+FIL 
Sbjct  175   DISGAQ--HIETFYSEVVATHGSAKNLPTSCTSRL--RPGLCFFPQNVVKQIQTPLFILN  230

Query  950   SSYDKHQI-NI----------SMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP  1096
             ++YD  QI NI          + H   +  N    + +Q+       ++ FR Q LDAL 
Sbjct  231   AAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSLDQLQI-------MQDFRQQFLDALS  283

Query  1097  ---NKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLID  1255
                  PS GIFI++C+ H  +E+   +  + +  +     +KA+ DWY+  +    ID
Sbjct  284   RVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKID  341



>gb|KDO40410.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=437

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 140/372 (38%), Positives = 204/372 (55%), Gaps = 35/372 (9%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A   GAVCLDGSPPAYHF +G     +NWL+++EGG WC ++  C  R     G
Sbjct  67    ITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNVTTCLERKKTRLG  126

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M+            F G+L+    +NP +F NWN + +RYCDG+SFTGDVE   P 
Sbjct  127   SSKQMV--------KVVAFSGMLSNKQKFNP-DFYNWNRIKVRYCDGASFTGDVEAVNPA  177

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
             +NL+FRG R+F  + ++L+ KG+KNA+   L+G SAG ++  LHCD FR L P   + KC
Sbjct  178   NNLHFRGARVFQAVMEDLMAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKC  237

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
               D GYFI+ K       +E F   +  VV+ H S   LP +CT ++   P LC FPQY+
Sbjct  238   FADAGYFINAKDVSGASHIEQF---YAQVVATHGSAKHLPASCTSRL--SPGLCFFPQYM  292

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRT---IREHVQLATPI-YEGLKGFRLQL  1081
                + TP+FI+ ++YD  QI   +       + T    +  +   +P   + ++ FR Q 
Sbjct  293   ARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQF  352

Query  1082  LDALPN---KPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             L+AL       S G+FI+ C+ H  TE+   +    +  +  +  +KA+ DWY+      
Sbjct  353   LNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKMSIAKAVGDWYY------  406

Query  1247  LIDKSEFIK-DC  1279
               D+S F K DC
Sbjct  407   --DRSPFQKIDC  416



>ref|XP_009797875.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=390

 Score =   242 bits (617),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 147/355 (41%), Positives = 196/355 (55%), Gaps = 27/355 (8%)
 Frame = +2

Query  221   AKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMM  400
             A + GAVCLDGSPPAYHF  G  +   NWL+ + GG WC +++EC  R     GSS +M 
Sbjct  45    AVSKGAVCLDGSPPAYHFDPGFGDGVGNWLVQLSGGGWCTNVKECLDRAKSDLGSSNYM-  103

Query  401   MNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLYFR  574
                         F G  +++ + NP EF NWN V +RYCDG SFTGDVE  +P   L+FR
Sbjct  104   --------NPQEFQGFFSKNQSANP-EFYNWNKVFVRYCDGGSFTGDVEYVDPATKLHFR  154

Query  575   GKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGY  754
             G RIF V+ +ELL KGLKNAK   L G SAG     L+CD FR  LPNT R KCL+D GY
Sbjct  155   GARIFTVVLEELLAKGLKNAKNAILAGSSAGGYPAMLYCDGFRNSLPNTSRVKCLVDSGY  214

Query  755   FIHVKKDNPKQVEGFELTFKNVVS--LHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             F+H K  N      FE  +K + +  L  S   LP++CT KM  KP LC+F + +   +K
Sbjct  215   FVHFK--NTVLGRPFESIYKGIATLQLQGSAKTLPKSCTSKM--KPELCLFAENIQQDIK  270

Query  929   TPMFILMSSYDKHQINISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALP--NK  1102
             TP+FI MS++D      ++          I+E    A+   + L+  R   L+A+P  N 
Sbjct  271   TPIFISMSAFDNIMTQYTLGGGIYGC---IQEGTCTASQ-NKTLQEMRSDFLNAIPKGNN  326

Query  1103  PSV-GIFINNCFFHTEIATGYWANPNSQ--VNNVLDSKAISDWYFYGKEVNLIDK  1258
             P + G+FI+    HT +      +P     V+N+   KA +DWYF      LID+
Sbjct  327   PKLRGVFIDVVHHHTSLQKQTRWSPVKPIVVHNLAAPKAFADWYFDRNYTYLIDE  381



>ref|XP_010266381.1| PREDICTED: uncharacterized protein LOC104603915 isoform X2 [Nelumbo 
nucifera]
Length=399

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 145/380 (38%), Positives = 216/380 (57%), Gaps = 37/380 (10%)
 Frame = +2

Query  185   KAN--FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             KAN  F  + + E + A GAVCLDGSPPAYH  +G     +NWL+++EGG WC ++  C 
Sbjct  21    KANGFFVGITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHLEGGGWCSNVTICL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
                    GSSK M             F GIL+    +NP +F NWN + +RYCDGSSFTG
Sbjct  81    AHKDTRHGSSKKM--------AKQIAFSGILSNKENFNP-DFYNWNKIKVRYCDGSSFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P +NLY RG+R++  + ++LL KG+KNAK   L+G S+G ++  LHCDRFR+LL
Sbjct  132   DVEAIDPANNLYLRGERVWQAVMEDLLEKGMKNAKYALLSGCSSGGLAAILHCDRFRELL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KCL D GYFI+ K  + K  +  +  + +VV+ H S   LP +CT +   +P L
Sbjct  192   PVDAKVKCLSDAGYFINAKDVSGK--DHIQAIYNDVVTTHQSAKNLPVSCTSRT--EPSL  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYEG  1057
             C FPQ ++  M T +FIL ++YD  QI  ++    VA       + +L     ++   + 
Sbjct  248   CFFPQNVVQDMYTQLFILNAAYDSWQIKNTLAPG-VADPHGHWHYCKLDIKNCSSSQLQT  306

Query  1058  LKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
             ++GFR + L++   L +    G+FIN+C+ H  +E+   +    +  ++    +KA+ DW
Sbjct  307   MQGFRSEFLNSVGELMSSSMKGMFINSCYAHCQSEVQETWLRADSPVLDKTPIAKAVGDW  366

Query  1223  YFYGKEVNLIDKSEFIK-DC  1279
             Y         D+S+F K DC
Sbjct  367   YN--------DRSDFKKIDC  378



>ref|XP_007156330.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28324.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=397

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/363 (38%), Positives = 203/363 (56%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + F E A A GAVCLDGS PAYHF +G+    +NW+++ EGG WC ++  C  R     G
Sbjct  27    ITFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNNVTSCLSRRDTRLG  86

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M        D    F G  +    +N  +F +WN + +RYCDGSSFTGDVE  +P 
Sbjct  87    SSKKM--------DTQLSFSGFFSNSKKFN-QDFYDWNRIKVRYCDGSSFTGDVEAVDPR  137

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  + ++LL KG+KNA+   ++G SAG ++  L+CDRF+ LLP T + KC
Sbjct  138   TNLHFRGARVFAAVVEDLLAKGMKNAQNAIISGCSAGGLAAILNCDRFKALLPRTTKVKC  197

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+VK     +++E F   +  VV  H S   LP +CT ++  KP LC FPQ +
Sbjct  198   LADAGYFINVKDVSGAQRIEEF---YSQVVQTHGSAKNLPSSCTSRL--KPGLCFFPQNV  252

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATP----IYEGLKGFR  1072
             +  + TP+F + ++YD  QI   +       +   RE    ++  +P    + +  +   
Sbjct  253   VSQISTPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDF  312

Query  1073  LQLLDALPNKPSVGIFINNCFFHTEIATG-YWANPNSQV-NNVLDSKAISDWYFYGKEVN  1246
             L+   A+ N PS G FI+ C+ H +  T   W   +S V  N   ++A+ DW++  +  +
Sbjct  313   LRAFGAVGNSPSKGHFIDGCYAHCQTGTQETWLRNDSPVLGNTTIARAVGDWFYDRRAFH  372

Query  1247  LID  1255
              ID
Sbjct  373   QID  375



>ref|XP_010695723.1| PREDICTED: protein notum homolog [Beta vulgaris subsp. vulgaris]
Length=422

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/367 (38%), Positives = 196/367 (53%), Gaps = 24/367 (7%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
             +NF PL     AK  GA CLDGS P YHF +G      NW++++EGG WCES+  C LR 
Sbjct  52    SNFVPLTLLFNAKDRGAFCLDGSLPGYHFDKGYGSGSSNWVLHIEGGGWCESVATCSLRK  111

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                 GSS HM        + +  F GIL+ DPA NP +F NWN V IRYCDGSSF G  E
Sbjct  112   KTALGSSNHM--------EQEVQFSGILSSDPARNP-DFFNWNKVKIRYCDGSSFAGHPE  162

Query  548   EPVDN---LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPN  718
                 N   L+FRG+ I+  + DE L+ G+ NA+Q  L+G SAG ++  +HCD FR  LP 
Sbjct  163   SEFHNGSGLFFRGQLIWEALMDEFLSMGMSNARQALLSGCSAGGLATMIHCDDFRAKLPK  222

Query  719   TRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCM  898
                 KCL D  +F+   +++       +L + NVV+LH     LP  C  KM   P LC 
Sbjct  223   AAIVKCLADASFFL--DEEDVSGSRTMQLFYNNVVNLHGVAKSLPTDCVAKM--DPSLCF  278

Query  899   FPQYLMDGMKTPMFILMSSYDKHQIN---ISMHESFVAANRTIREHVQLA-TPIYEGLKG  1066
             FP+ ++  +KTP+F++  +YD  QI    +          R  R ++Q   +   + L+G
Sbjct  279   FPRQIIGSVKTPLFLVNPAYDFWQIQHVLVPAASDLPGEWRRCRLNIQKCNSHQMDILQG  338

Query  1067  FRLQLLDALP---NKPSVGIFINNCFFHTEIATGYWANPNS-QVNNVLDSKAISDWYFYG  1234
             FR  LL AL         G+FIN+CF H +     W  PNS ++ N   ++ + DWY   
Sbjct  339   FRNNLLKALSEFERSKGKGMFINSCFIHCQTWMETWHGPNSPRIYNKTIAETVGDWYSEK  398

Query  1235  KEVNLID  1255
             ++   +D
Sbjct  399   EDAKRVD  405



>ref|XP_009603747.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=392

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/353 (40%), Positives = 204/353 (58%), Gaps = 24/353 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A + GAVCLDGS PA+HF  GT     +WLI+++GG WCE+I  C+ R L    
Sbjct  34    ITYLETAISKGAVCLDGSAPAFHFDPGTGSGIYSWLIHLQGGGWCETISNCQYRALTDL-  92

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK+M             F G+L+ DP  NP +F NWN V ++YCDGSS+TGD+EE  P 
Sbjct  93    SSKNMQ--------NISYFTGVLSSDPQLNP-DFYNWNRVKVKYCDGSSYTGDIEEVDPD  143

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG RIF  I +  L +G+  A+   L+G SAG +   +HCD+FR  LP T R KC
Sbjct  144   TNLHFRGARIFEAIMEYFLGQGMIYAQNAILSGTSAGGLGAIIHCDKFRLFLPLTARVKC  203

Query  737   LMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLM  916
             + D G+F+ ++  + + +   E  +K VV+LH S   LP +CT    D P LC FPQY+ 
Sbjct  204   ISDAGFFVDLETISGEPL--IEEMYKRVVALHGSAKNLPLSCTALSSD-PNLCFFPQYVA  260

Query  917   DGMKTPMFILMSSYDKHQINISMHESFVAANRT---IREHVQLATPI-YEGLKGFRLQLL  1084
               + TP+FI+ S+YD  QIN S+       +      ++ + + +P   + L+ FRL  L
Sbjct  261   RHICTPLFIVNSAYDSWQINNSLVPRVADPDDEWTYCKKDINVCSPSQIQTLQDFRLTFL  320

Query  1085  DALPN---KPSVGIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAISDWYF  1228
             +AL       S G FI++C  H  I    YW++ NS  ++N   ++A+ DW+F
Sbjct  321   EALNELGPSTSRGYFISSCHSHHGIEIQNYWSSKNSPTLDNKTIAEAVGDWFF  373



>ref|XP_011074219.1| PREDICTED: protein notum homolog [Sesamum indicum]
Length=387

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 148/409 (36%), Positives = 226/409 (55%), Gaps = 48/409 (12%)
 Frame = +2

Query  80    LRPHLALICINMAIAQNCHQWltllvcaallvlQTKANFYPLIFPEKAKAMGAVCLDGSP  259
             +RP   LICI + +A   H                 +++  + F   A + GAVCLDGSP
Sbjct  14    IRP---LICILIVMATQVHG----------------SDWTTITFLPSAISKGAVCLDGSP  54

Query  260   PAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMNpffpgdydfgf  439
             PAY+F +G  +  DNW+I++EGG WC S + C  RT    GS+K          +    F
Sbjct  55    PAYYFRKGFGDGIDNWVIFLEGGGWCASNKGCLDRTNMSTGSTK--------LKEKRHYF  106

Query  440   ygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDNLY--FRGKRIFNVITDELL  613
               IL+ +   NP+ F NWN V + YCDGSS+TGDVEE   N Y   RG +IF+V+ +++L
Sbjct  107   KDILSSNHTINPN-FYNWNRVYVGYCDGSSYTGDVEE---NTYPTRRGAKIFDVVMEDML  162

Query  614   NKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFIHVKKDNPKQVE  793
              +G+KNAK   L+GGSAGA    LHCD FRKL+P   R KC+ D G+FIH K  N    +
Sbjct  163   AQGMKNAKNAILSGGSAGAWGAILHCDGFRKLIPKASRVKCISDSGFFIHAK--NLYGAK  220

Query  794   GFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFILMSSYDKHQI  973
               E  F ++++ H S   LP +CT KM     LC+FP+ ++  +KTP+F L S++D +Q+
Sbjct  221   KREEYFADLIAYHRSNKFLPASCTSKMNAS--LCLFPENIIKDIKTPIFFLESAFDYYQL  278

Query  974   NISMHESFVAANRTIR---EHVQLATPI-YEGLKGFRLQLLDALPN--KPSVGIFINNCF  1135
                  E + + + T +   +++++ TP   + +K +R   +  L      S GIF+++C+
Sbjct  279   K----EHYFSDDPTWKICVDNLKVCTPTQLQIMKDYRATFIKELQGVKSSSTGIFVHSCY  334

Query  1136  FHTEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLID-KSEFIKDC  1279
              H  +      + + ++ N   ++AISDWYF       ID ++E  ++C
Sbjct  335   RHGHLHEREGWDKSPKLGNKTVAEAISDWYFDRSSFQEIDTQNELPRNC  383



>ref|XP_010266380.1| PREDICTED: uncharacterized protein LOC104603915 isoform X1 [Nelumbo 
nucifera]
Length=412

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 145/380 (38%), Positives = 216/380 (57%), Gaps = 37/380 (10%)
 Frame = +2

Query  185   KAN--FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             KAN  F  + + E + A GAVCLDGSPPAYH  +G     +NWL+++EGG WC ++  C 
Sbjct  34    KANGFFVGITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHLEGGGWCSNVTICL  93

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
                    GSSK M             F GIL+    +NP +F NWN + +RYCDGSSFTG
Sbjct  94    AHKDTRHGSSKKM--------AKQIAFSGILSNKENFNP-DFYNWNKIKVRYCDGSSFTG  144

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P +NLY RG+R++  + ++LL KG+KNAK   L+G S+G ++  LHCDRFR+LL
Sbjct  145   DVEAIDPANNLYLRGERVWQAVMEDLLEKGMKNAKYALLSGCSSGGLAAILHCDRFRELL  204

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P   + KCL D GYFI+ K  + K  +  +  + +VV+ H S   LP +CT +   +P L
Sbjct  205   PVDAKVKCLSDAGYFINAKDVSGK--DHIQAIYNDVVTTHQSAKNLPVSCTSRT--EPSL  260

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREHVQL-----ATPIYEG  1057
             C FPQ ++  M T +FIL ++YD  QI  ++    VA       + +L     ++   + 
Sbjct  261   CFFPQNVVQDMYTQLFILNAAYDSWQIKNTLAPG-VADPHGHWHYCKLDIKNCSSSQLQT  319

Query  1058  LKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDW  1222
             ++GFR + L++   L +    G+FIN+C+ H  +E+   +    +  ++    +KA+ DW
Sbjct  320   MQGFRSEFLNSVGELMSSSMKGMFINSCYAHCQSEVQETWLRADSPVLDKTPIAKAVGDW  379

Query  1223  YFYGKEVNLIDKSEFIK-DC  1279
             Y         D+S+F K DC
Sbjct  380   YN--------DRSDFKKIDC  391



>ref|XP_006293476.1| hypothetical protein CARUB_v10023292mg [Capsella rubella]
 gb|EOA26374.1| hypothetical protein CARUB_v10023292mg [Capsella rubella]
Length=419

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 201/363 (55%), Gaps = 26/363 (7%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + A + GAVCLDG+ P YH   G+    + WLI +EGG WC +   C  R    +
Sbjct  57    PLTLIQAAGSKGAVCLDGTLPGYHLHRGSGSGANRWLIQLEGGGWCNTRRSCIFRKTTRR  116

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVD  559
             GSSK+M        +    F GIL+  P  NP +F NWN V +RYCDG+SFTGD ++   
Sbjct  117   GSSKYM--------EKVLAFTGILSNKPDENP-DFFNWNRVKLRYCDGASFTGDSQDESS  167

Query  560   NLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCL  739
              LY+RG+RI+    +ELL+KG++ A+Q  L+G SAG ++  LHCD+F+ LLP T + KCL
Sbjct  168   QLYYRGQRIWQAAMEELLSKGMQKAEQALLSGCSAGGLASILHCDQFKDLLPGTTKVKCL  227

Query  740   MDGGYFIHVKKDNPKQVEGFEL--TFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
              D G F+    D      G  L   F+ VV++ N    L  TCT+ M   P  C FPQ L
Sbjct  228   SDAGMFM----DAVDVSGGHSLRKMFQGVVTVQNLQKELSTTCTKHM--DPTSCFFPQNL  281

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQL  1081
             +  +KTPMF+L ++YD  Q+  S+    V  + + +    +H    +   +  + FR Q+
Sbjct  282   VSNIKTPMFLLNAAYDAWQVQESLAPPSVDLSGSWKACKSDHSHCNSSQIQFFQDFRTQM  341

Query  1082  LDALPNKPSV---GIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             +DA+ +  +    G+FIN+CF H  +E    ++A  +  ++    +K++ DWYF    V 
Sbjct  342   VDAVKSFATSTHNGVFINSCFAHCQSERQDTWYAPDSPTLHGKTVAKSVGDWYFDRTTVK  401

Query  1247  LID  1255
              ID
Sbjct  402   AID  404



>ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=417

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/363 (37%), Positives = 203/363 (56%), Gaps = 26/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + F E A A GAVCLDGS PAYHF +G+    +NW+++ EGG WC ++  C  R     G
Sbjct  47    ITFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGWCNNVTSCLSRRDTRLG  106

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M        D    F G  +    +N  +F +WN + +RYCDGSSFTGDVE  +P 
Sbjct  107   SSKKM--------DTQLSFSGFFSNSKKFN-QDFYDWNRIKVRYCDGSSFTGDVEAVDPR  157

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R+F  + ++LL KG+KNA+   ++G SAG ++  L+CDRF+ LLP T + KC
Sbjct  158   TNLHFRGARVFAAVVEDLLAKGMKNAQNAIISGCSAGGLAAILNCDRFKALLPRTTKVKC  217

Query  737   LMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             L D GYFI+VK     +++E F   +  VV  H S   LP +CT ++  KP LC FPQ +
Sbjct  218   LADAGYFINVKDVSGAQRIEEF---YSQVVQTHGSAKNLPSSCTSRL--KPGLCFFPQNV  272

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATP----IYEGLKGFR  1072
             +  + TP+F + ++YD  QI   +       +   RE    ++  +P    + +  +   
Sbjct  273   VSQISTPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDF  332

Query  1073  LQLLDALPNKPSVGIFINNCFFHTEIAT--GYWANPNSQVNNVLDSKAISDWYFYGKEVN  1246
             L+   A+ N PS G FI+ C+ H +  T   +  N +  + N   ++A+ DW++  +  +
Sbjct  333   LRAFGAVGNSPSKGHFIDGCYAHCQTGTQETWLRNDSPVLGNTTIARAVGDWFYDRRAFH  392

Query  1247  LID  1255
              ID
Sbjct  393   QID  395



>ref|XP_009408703.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=398

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 197/360 (55%), Gaps = 24/360 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             Q + +  P+   + A A GAVCLDGSP AY+   G+    +NWL+++EGG WC ++ +C 
Sbjct  24    QVEGDNVPMTLLKSAVAEGAVCLDGSPAAYNLAPGSGSGANNWLLFVEGGGWCSTVNDCV  83

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R    +GSS HM      P  +     G+  R+P     +F NWN V IRYCDG+SFTG
Sbjct  84    ERKGNFRGSSNHM-----PPVSFSGMLGGVQERNP-----DFYNWNRVKIRYCDGASFTG  133

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             D+E  +P   LYFRG R++  I  +LL +G+  A+   L G SAG ++  LHCD FR LL
Sbjct  134   DIEKVDPATGLYFRGARVWRAIMKDLLARGMNKAQNAILGGCSAGGLTTILHCDSFRSLL  193

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P     KC  D GYFI  K  +    +     + +V++LH S   LP +CT  +      
Sbjct  194   PANATVKCFSDAGYFIDAK--DISGADSILSFYSDVINLHASANNLPSSCTSSLPANK--  249

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIREH----VQLATPIYEGL  1060
             C FPQ ++  MKTP+FIL ++YD+ QI   +  +    N+T  +      + ++   + L
Sbjct  250   CFFPQNVVATMKTPLFILNAAYDQWQIRNILVPNSADTNKTWGDCKLDIKKCSSDQLQTL  309

Query  1061  KGFRLQLLDALP--NKPSVGIFINNCFFHTEI--ATGYWANPNSQVNNVLDSKAISDWYF  1228
             +GFR   L+ALP     S G+FI +C  H +   A  ++A  + +++N    KA+ DWYF
Sbjct  310   QGFRTTFLNALPGAGSSSTGMFILSCHTHCQSGDADTWFAADSPRIDNTPIGKAVGDWYF  369



>ref|XP_004971441.1| PREDICTED: protein notum homolog [Setaria italica]
Length=422

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/353 (39%), Positives = 201/353 (57%), Gaps = 26/353 (7%)
 Frame = +2

Query  233   GAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMNpf  412
             GAVCLDG+PP YHF+ G  +   NWL+++EGG+WC + + C  R   + GSS HM     
Sbjct  63    GAVCLDGTPPGYHFLPGFGDGSHNWLLHLEGGSWCRNFKSCAQRKQTNLGSSDHM-----  117

Query  413   fpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN---LYFRGKR  583
                D    F GIL+ D + NP +F NWN V IRYCDG+SF+G+V+  V N    +FRG+R
Sbjct  118   ---DTRAEFVGILSDDQSQNP-DFYNWNKVKIRYCDGASFSGNVQHEVKNGTDFFFRGQR  173

Query  584   IFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFIH  763
             I+  +  +LL+KGL  AKQ FLTG SAG +S  +HCD FR LLP TR  KCL DGG+F+ 
Sbjct  174   IWEAVMADLLSKGLSRAKQAFLTGCSAGGLSTYIHCDDFRALLPKTRTVKCLADGGFFLD  233

Query  764   VKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFI  943
             V+  + ++       + +V  L +     P  C+  M  +P  C FP+ +   + TPMFI
Sbjct  234   VEDISGRRY--MRAFYNDVARLQDVRKKFPH-CSSDM--EPGQCFFPREVAKSISTPMFI  288

Query  944   LMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQLLDAL---PNK  1102
             L  +YD  Q+   +           R    +  + ++   E L+GFR  LLDA+     +
Sbjct  289   LNPAYDVWQVEHVLSPQGSDPQNLWRNCRMDITKCSSKQLEVLQGFRKALLDAIDEFKTR  348

Query  1103  PSVGIFINNCFFHTE-IATGYWANP-NSQVNNVLDSKAISDWYFYGKEVNLID  1255
                G+FI++CF H + +    W +P  +++NN   ++A+ DW+F  +EV  ID
Sbjct  349   REWGMFIDSCFIHCQSMKAITWHSPLAARINNKTAAEAVGDWFFDRREVKEID  401



>ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
 gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
Length=397

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 141/366 (39%), Positives = 205/366 (56%), Gaps = 34/366 (9%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             +T+A +  + F   A A GAVCLDGSPPAYH   G     ++WLI +EGG WC ++  C 
Sbjct  19    ETEALYVNITFVRNAVAKGAVCLDGSPPAYHLDRGFGTGINSWLIQLEGGGWCNNVTNCV  78

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSSK M+            F  IL+    YNP +F NWN V +RYCDGSSFTG
Sbjct  79    SRMHTRLGSSKRMV--------EKLAFSAILSNKRQYNP-DFYNWNRVKVRYCDGSSFTG  129

Query  539   DVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DV+   P  NL+FRG R++  +  ELL KG+ NA+   L+G SAG ++  +HCD FR LL
Sbjct  130   DVQAVNPATNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLATLMHCDSFRALL  189

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELT---FKNVVSLHNSTGMLPQTCTQKMKDK  883
             P   + KCL D G+F+     N + V G +     F +VV+LH S   LP++CT ++   
Sbjct  190   PMGAKVKCLSDAGFFL-----NTRDVAGAQYIKSYFNDVVTLHGSAKNLPRSCTSRL--T  242

Query  884   PYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN-----RTIREHVQLATP-  1045
             P +C FPQY+   ++TP+FIL ++YD  QI   +     AA+     ++ +  ++   P 
Sbjct  243   PAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPR--AADPYGKWQSCQLDIKNCQPN  300

Query  1046  IYEGLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKA  1210
               + ++ FRL+ L A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA
Sbjct  301   QLKVMQDFRLEFLRAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKA  360

Query  1211  ISDWYF  1228
             + DW +
Sbjct  361   VGDWVY  366



>ref|XP_004953590.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=401

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 150/397 (38%), Positives = 208/397 (52%), Gaps = 43/397 (11%)
 Frame = +2

Query  140   WltllvcaallvlQTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYM  319
             W   L  A   +++  A    + + E A A GAVCLDGS PAYH   G+    ++WL++ 
Sbjct  12    WCCALASALSALVKVDALLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVHF  71

Query  320   EGGAWCESIEECKLRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNL  499
             EGG WC ++  C  R     GSSK M     F G        IL+  P YNP +F NWN 
Sbjct  72    EGGGWCSNVTTCLQRKRTRLGSSKEMATQIAFSG--------ILSDTPDYNP-DFYNWNK  122

Query  500   VVIRYCDGSSFTGDVEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAV  673
             V +RYCDGSSFTGDVEE  P   L++RG RI+  + ++LL KG+  A+   ++G SAG +
Sbjct  123   VKVRYCDGSSFTGDVEEVDPTTKLHYRGARIWQAVMEDLLAKGMDKAENALISGCSAGGL  182

Query  674   SVALHCDRFRKLLPNTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTG  844
             +  LHCDRF  LLP   R KCL D G+FI     N K V G       F +VV+ H S  
Sbjct  183   TSILHCDRFHDLLPLGARVKCLSDAGFFI-----NEKDVAGVGYIAAFFNDVVTTHGSAK  237

Query  845   MLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE  1024
              LP +CT  +   P +C FP   +  ++TP+FIL ++YD  Q+   +      A+R    
Sbjct  238   NLPSSCTSIL--PPGVCFFPSNEVKQIQTPLFILNAAYDYWQVRNILVPG--VADRRGTW  293

Query  1025  HV------QLATPIYEGLKGFRLQLLDALP---NKPSVGIFINNCFFH--TEIATGYWAN  1171
             H       Q +      L+GFR   L A+    N  S G+FIN+CF H  +EI   ++++
Sbjct  294   HSCKHDIDQCSAAQLRVLQGFRDDFLKAVAEQGNSTSRGLFINSCFVHCQSEIQELWFSS  353

Query  1172  PNSQVNNVLDSKAISDWYFYGKEVNLIDKSEFIK-DC  1279
              +  + N   + A+ DW+F        D+S F K DC
Sbjct  354   DSPMLGNTTIAAAVGDWFF--------DRSPFQKIDC  382



>ref|XP_009388128.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 202/365 (55%), Gaps = 30/365 (8%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             P+     A A GAVCLDGSPPAYHF  G+    +NWL++MEGG WC ++EEC  R    +
Sbjct  31    PMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLVHMEGGGWCRNVEECLERKNNFR  90

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EP  553
             GSS HM             F GIL +   YNP +F NWN V IRYCDGSSFTGDVE  +P
Sbjct  91    GSSNHM---------KPLSFSGILGKSKKYNP-DFYNWNRVKIRYCDGSSFTGDVERVDP  140

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
               NL++RG R++  I ++LL KG+  A+   L+G SAG ++  LHCD+FR LLP + + K
Sbjct  141   ATNLHYRGARVWLAIMEDLLAKGMNKAENALLSGCSAGGLASILHCDKFRSLLPASAKVK  200

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             C  D GYFI  K  +          + +VV+LH S   LP   +      P LC FPQ +
Sbjct  201   CFSDAGYFIDGK--DITGTTSIRSLYNDVVNLHGSGKNLPS--SCTSSLSPSLCFFPQNV  256

Query  914   MDGMKTPMFILMSSYDKHQINISM-------HESFVAANRTIREHVQLATPIYEGLKGFR  1072
             +  M TP+FIL ++YD  QI  ++       H+S+ A    I      ++   E ++ FR
Sbjct  257   VPKMSTPLFILNAAYDAWQIKNTLAPSSADPHKSWNACKLNI---TSCSSDQLEKMQDFR  313

Query  1073  LQLLDALP--NKPSVGIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAISDWYFYGKE  1240
              + L ALP     S G+FI +C+ H +  +   W+  +S  ++ +  +KA+ DWY     
Sbjct  314   SEFLRALPASGNSSTGMFIISCYAHCQSGSRDIWSGTDSPMIDKMSIAKAVGDWYSGRSV  373

Query  1241  VNLID  1255
             V  ID
Sbjct  374   VRKID  378



>ref|XP_009398466.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398467.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398468.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398469.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=395

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 144/373 (39%), Positives = 211/373 (57%), Gaps = 31/373 (8%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             + +ANF  + + E A   GAVCLDGSPPAYH   G     +NWL+++EGG WC +I  C 
Sbjct  20    KAEANFVDITYVESAIPKGAVCLDGSPPAYHLSPGFGSGVNNWLVHLEGGGWCNNITTCL  79

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R     GSS  M             F GIL+   ++NP +F NWN V +RYCDGSSFTG
Sbjct  80    ARKNTRLGSSGQM--------AKQLAFSGILSNTQSFNP-DFYNWNKVKVRYCDGSSFTG  130

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P  NL++RG R++  + +ELL +G+  A+   L+G SAG ++  LHCD FR LL
Sbjct  131   DVERVDPATNLHYRGARVWLAVMEELLARGMSKAENALLSGCSAGGLASILHCDSFRNLL  190

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P + + KCL D GYFI+VK  +    E  +  + +VV+ H S   LP  CT  +  +P +
Sbjct  191   PASAKVKCLSDAGYFINVK--DISGAEHIKAFYNDVVTTHGSAKNLP-LCTSMI--EPGM  245

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREH-----VQLATPI-Y  1051
             C FPQY+   +++P+FIL ++YD  QI NI +      A+R    H     ++L +    
Sbjct  246   CFFPQYMAQEIESPLFILNAAYDSWQIKNILVP---TVADRHGSWHNCKLDIKLCSSAQL  302

Query  1052  EGLKGFRLQLLDA---LPNKPSVGIFINNCFFHTEIATG-YWANPNS-QVNNVLDSKAIS  1216
             + ++ FRL+ L+A   L    S G+FIN+C+ H +      W  PNS  ++ +  ++A+ 
Sbjct  303   QIMQEFRLEFLNAVNGLGTPSSRGLFINSCYAHCQSEMQETWLLPNSPMLDKIPIAEAVG  362

Query  1217  DWYFYGKEVNLID  1255
             DW++       ID
Sbjct  363   DWFYNRSAFQKID  375



>ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group]
Length=397

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 197/370 (53%), Gaps = 30/370 (8%)
 Frame = +2

Query  188   ANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRT  367
              +F  + +   A A GAVCLDGSPPAYH   G     ++WL++ EGG WC ++  C  R 
Sbjct  24    GDFVDITYVASAVAKGAVCLDGSPPAYHLARGFGSGVNSWLVHFEGGGWCSNVTTCLQRK  83

Query  368   LEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE  547
                 GSSK M     F G        IL+  P YNP +F NWN V +RYCDGSSFTGDVE
Sbjct  84    RTRLGSSKQMAKQIAFSG--------ILSNTPDYNP-DFYNWNKVKVRYCDGSSFTGDVE  134

Query  548   --EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNT  721
               +P   L++RG R++  + D+LL KG+ +A    ++G SAG ++  LHCDRFR L P  
Sbjct  135   KVDPATKLHYRGARVWQAVMDDLLAKGMNSANNALISGCSAGGLTSILHCDRFRDLFPVD  194

Query  722   RRFKCLMDGGYFIHVKKDNPKQVEGFELT---FKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
              + KCL D G+FI     N K + G E     F  V + H S   LP  CT ++   P +
Sbjct  195   TKVKCLSDAGFFI-----NEKDIAGVEYIVAFFNGVATTHGSAKNLPSACTSRL--SPGM  247

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFVAAN---RTIREHV-QLATPIYEGL  1060
             C FPQ  +  ++TP+FIL ++YD  Q+   +   F   +    + +  + Q      + L
Sbjct  248   CFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGFADPHGKWHSCKHDIDQCPASQLQIL  307

Query  1061  KGFRLQLLDALPNK--PSV-GIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWY  1225
             +GFR   L AL  +  PS  G+FIN+CF H  +E    ++A+ +  +     + A+ DW+
Sbjct  308   QGFRDDFLKALKEQGTPSTRGLFINSCFVHCQSETQETWFASGSPMLETKTIADAVGDWF  367

Query  1226  FYGKEVNLID  1255
             +       ID
Sbjct  368   YDRNPFQKID  377



>ref|XP_003562611.1| PREDICTED: protein notum homolog [Brachypodium distachyon]
Length=412

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 194/364 (53%), Gaps = 24/364 (7%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  L   + A A GAVCLDGS P YH   G      NWL+ +EGG WC  ++ C  R   
Sbjct  44    FVGLTLIQSAAAKGAVCLDGSLPGYHLHRGFGSGSKNWLVNLEGGGWCNDVKSCVFRKSS  103

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEP  553
              +GSS HM        +    F GI++  P  NP +F NWN V +RYCDG SFTGD  + 
Sbjct  104   RRGSSNHM--------EKQLQFTGIMSNRPEENP-DFYNWNRVKVRYCDGGSFTGDGADA  154

Query  554   VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                LYFRG+RI+    D+L+++G+++A Q  L+G SAG  S  LHCD FR L P+  R K
Sbjct  155   ASGLYFRGQRIWQAAMDDLMSQGMRSASQALLSGCSAGGASTILHCDEFRGLFPSNTRVK  214

Query  734   CLMDGGYFIH-VKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQY  910
             CL D G F+  V     +++  F   F  +V L  S   LP++CT +M DK   C FPQ 
Sbjct  215   CLADAGMFLDTVDVAGRREMREF---FNGIVRLQGSGRSLPRSCTSRM-DKTS-CFFPQN  269

Query  911   LMDGMKTPMFILMSSYDKHQINISMHESFVAA----NRTIREHVQLATPIYEGLKGFRLQ  1078
             ++  ++TP FIL ++YD  Q+  S+            R  + H   +    + L GFR +
Sbjct  270   VLPNIQTPTFILNTAYDVWQLQQSVAPKTADPQGLWQRCKQNHAFCSGNQLQFLNGFRNE  329

Query  1079  LLDAL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEV  1243
             +LDA+         G+FIN+CF H  +E    +++N + ++ N   ++A+ DW+F   + 
Sbjct  330   MLDAVKGFSGSRQNGVFINSCFAHCQSERQDTWYSNNSPRLGNRRIAEAVGDWFFERGDA  389

Query  1244  NLID  1255
                D
Sbjct  390   KYTD  393



>ref|XP_009407792.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score =   241 bits (615),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 136/360 (38%), Positives = 201/360 (56%), Gaps = 24/360 (7%)
 Frame = +2

Query  179   QTKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             Q + +  P+   + A A GAVCLDGSP AY+   G+    +NWL+++EGG WC ++ +C 
Sbjct  57    QVEGDNVPMTLLKGAVAEGAVCLDGSPAAYNLAPGSGSGANNWLLFVEGGGWCSTVNDCV  116

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
             +R    +GSS HM      P  +     G+  R+P     +F NWN V IRYCDG+SFTG
Sbjct  117   VRKGNFRGSSNHM-----PPVSFSGMLGGVQQRNP-----DFYNWNRVKIRYCDGASFTG  166

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             D+E  +P   LYFRG R++  I  +LL +G+  A++  L G SAG ++  LHCD FR LL
Sbjct  167   DIEKVDPATGLYFRGARVWRAIMKDLLARGMNKAQKALLGGCSAGGLTTILHCDSFRSLL  226

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYL  892
             P +   KC  D GYFI  K  +    +  +  + +VV+LH S   LP +CT ++      
Sbjct  227   PASATVKCFSDAGYFIDAK--DISGADSIQSFYSDVVNLHGSANNLPSSCTSRLPANK--  282

Query  893   CMFPQYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANR---TIREHVQLATPIYEGL  1060
             C FP  ++  MKTP+FIL ++YD+ QI NI +  S    N       +  + ++   + L
Sbjct  283   CFFPLNVVATMKTPLFILNAAYDQWQIKNILVPPSADPNNAWGDCKLDIKKCSSDQLQTL  342

Query  1061  KGFRLQLLDALPNKPS--VGIFINNCFFHTEI--ATGYWANPNSQVNNVLDSKAISDWYF  1228
             +GFR   L+ALP   S   G+FI +C  H +   A  ++A  + +++N    KA+ DWYF
Sbjct  343   QGFRTTFLNALPGAGSSATGLFILSCHTHCQSGDADTWFAADSPRIDNTPIGKAVGDWYF  402



>ref|XP_006351092.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=318

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 163/265 (62%), Gaps = 14/265 (5%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A + GAVCLDGSPPAY+   G  E   +W+I++ GG WC  + EC+ R+    GSSKH
Sbjct  46    KNAVSKGAVCLDGSPPAYYMDRGFEEGAQSWMIHLSGGGWCRDVRECQNRSTTPFGSSKH  105

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             M                  + +   NP  F NWN V++ YCDG +FTGDVE  +P  NLY
Sbjct  106   M--------PPFKFRGHDFSNNKNANPDLF-NWNKVMVAYCDGVAFTGDVETVDPATNLY  156

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             FRG RIF+ + ++LL KGLK+ K   L G SAGA    L+CDRF KLLPNT R KCL D 
Sbjct  157   FRGARIFSAVMEDLLAKGLKDDKNALLIGSSAGAYPAMLYCDRFSKLLPNTPRIKCLTDS  216

Query  749   GYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMK  928
             GYFI V K N ++ +GFE  +K +V+LH S   LP++CT +M  KP LC FPQ +   +K
Sbjct  217   GYFIDVNK-NLQKGKGFETIYKALVTLHGSAKALPKSCTSRM--KPELCFFPQNMQQYIK  273

Query  929   TPMFILMSSYDKHQINISMHESFVA  1003
             TP++ +MS +D  Q+  S+ + + A
Sbjct  274   TPLYTIMSPFDIVQVGTSLGDYYNA  298



>ref|XP_009135052.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDX73981.1| BnaA03g30660D [Brassica napus]
Length=414

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 142/375 (38%), Positives = 208/375 (55%), Gaps = 35/375 (9%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             +  N   L    KAK  GA CLDGS P YHF +G+    ++WL++++GG WC +I  C  
Sbjct  47    SPTNLVKLKLSSKAKERGAFCLDGSLPGYHFDKGSGSGSNSWLLHLQGGGWCNTIASCSA  106

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R +   GSS +         + +  F G+L+ DP+ NP +F NWN VVIRYCDG+SF G 
Sbjct  107   RAMTRLGSSNYF--------EDEVEFPGVLSNDPSQNP-DFFNWNRVVIRYCDGASFAGH  157

Query  542   VEEPVDN---LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
              E    N   L+FRG+ I+  I DELL  G+ +AKQ  LTG SAG ++  +HCD FR  L
Sbjct  158   PEAEFKNGTGLFFRGQLIWEAIMDELLLMGMSDAKQGILTGCSAGGLATLIHCDYFRDHL  217

Query  713   PNTRRFKCLMDGGYFIHVKK--DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKP  886
             P     KC+ DGG+F++V     NP  +  F   +++VV+L      L Q C  KM  +P
Sbjct  218   PKDADVKCVSDGGFFLNVLDVLGNPT-MRSF---YQDVVTLQGVDKSLDQNCVAKM--EP  271

Query  887   YLCMFPQYLMDGMKTPMFILMSSYDKHQI-------NISMHESFVAANRTIREHVQLATP  1045
               CMFPQ  +  ++TP+F++ ++YD  QI       +    +S+     +I+E       
Sbjct  272   STCMFPQEFVSNIRTPVFLVNAAYDSWQIQNVLVPASADSDKSWAKCRLSIKECDAAQMN  331

Query  1046  IYEGLKGFRLQLLDALPN---KPSVGIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKA  1210
             +   L+GFR  L+DA+       + G+FI++CF H +  T G W +P S ++ N   +++
Sbjct  332   V---LQGFRSSLMDAIGTFHQNKAGGMFIDSCFIHCQTVTQGTWHSPTSTRIENKTIAES  388

Query  1211  ISDWYFYGKEVNLID  1255
             + DWYF  K V LID
Sbjct  389   VGDWYFNRKPVKLID  403



>ref|XP_008365238.1| PREDICTED: uncharacterized protein LOC103428882 [Malus domestica]
Length=311

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 165/268 (62%), Gaps = 19/268 (7%)
 Frame = +2

Query  185  KANFYP--LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
            KA  +P  L   E A A GAVCLDGS PAYHF +G     +NWL+++EGG WC ++E+C 
Sbjct  21   KAESHPVALTLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNTVEDCL  80

Query  359  LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
             R   ++GSS  M        +    F G+L   P  NP +F NWN + +RYCDGSSFTG
Sbjct  81   DRKSNYRGSSTKM--------EKTMSFSGVLGNKPKTNP-DFYNWNRIKVRYCDGSSFTG  131

Query  539  DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
            DVE  +P  NL+FRG R+F  I D LL KG+KNA+   L+G SAG ++  LHCD FR LL
Sbjct  132  DVEAVDPATNLHFRGARVFRAIIDXLLAKGMKNAQNALLSGCSAGGLTSILHCDNFRSLL  191

Query  713  PNTRRFKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPY  889
            P   + KCL D GYFI+ K     + ++GF   +  VV+LH S   LP +CT +M   P 
Sbjct  192  PVGTKVKCLADAGYFINAKSLSGSZHIQGF---YSEVVALHGSAKNLPASCTSRM--SPG  246

Query  890  LCMFPQYLMDGMKTPMFILMSSYDKHQI  973
            LC FPQ ++   +TP+F++ ++YD  QI
Sbjct  247  LCFFPQNVVPQTRTPIFLVNAAYDSWQI  274



>ref|XP_002454426.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
 gb|EES07402.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Length=398

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/379 (37%), Positives = 200/379 (53%), Gaps = 30/379 (8%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + + E A A GAVCLDGS PAYH   G+   +++WL++ EGG WC ++  C  R     G
Sbjct  30    ITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNNVTTCLQRKRTRLG  89

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PV  556
             SSK M     F G        IL+  P  NP +F NWN V +RYCDGSSFTGDVEE  P 
Sbjct  90    SSKEMATQIAFSG--------ILSDTPDGNP-DFYNWNKVKVRYCDGSSFTGDVEEVDPT  140

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
               L+FRG RI+  + ++LL KG+  A+   ++G SAG ++  LHCDRF  LLP   R KC
Sbjct  141   TKLHFRGARIWQAVMEDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPLAARVKC  200

Query  737   LMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQ  907
             L D G+FI     N K V G       F +VV+ H S   LP +CT  +   P +C FP+
Sbjct  201   LSDAGFFI-----NEKDVAGVGYIAAFFNDVVTTHGSANNLPPSCTSML--PPGMCFFPK  253

Query  908   YLMDGMKTPMFILMSSYDKHQI-NISM------HESFVAANRTIREHVQLATPIYEGLKG  1066
               +  + TP+FIL ++YD  Q+ NI +      H  + +    I +       + +G +G
Sbjct  254   NEVKQIHTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIGQCSASQLRVLQGFRG  313

Query  1067  FRLQLLDALPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKE  1240
               L+ +    N  S G+FIN+CF H  +E    ++++ + ++ N   + A+ DW+F    
Sbjct  314   DFLKEVSEQANSDSRGLFINSCFVHCQSESQELWFSSDSPKLGNTTIANAVGDWFFGRSS  373

Query  1241  VNLIDKSEFIKDCYTNGYY  1297
                ID          NG Y
Sbjct  374   FQKIDCPYPCDSTCHNGIY  392



>ref|XP_010920599.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=435

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 205/365 (56%), Gaps = 28/365 (8%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L     A+  GAVCLDGSPP YHF  G    KD+WL+++EGG WC S+  C  R +   G
Sbjct  63    LTLVRDAQKKGAVCLDGSPPGYHFQRGFGSGKDSWLLHLEGGGWCNSVASCASRKMTALG  122

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SS +M     F G        IL+  P+ NP +F NWN V IRYCDG+S++GDVE  + N
Sbjct  123   SSIYMQHQVPFDG--------ILSNVPSQNP-DFYNWNKVKIRYCDGASYSGDVESGIQN  173

Query  563   ---LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                L+FRG+RI+ VI DELL KGL NAKQ FLTG SAG ++  +HC+ FR LLP     K
Sbjct  174   GTKLFFRGQRIWEVIMDELLLKGLANAKQAFLTGCSAGGLATFIHCEDFRALLPKEVIVK  233

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             CL D G+F+   + +  Q       + +V+ L N  G   Q CT +M  +P  C F   +
Sbjct  234   CLADAGFFL--DEMDISQRRFIRSFYDDVIRLQN-VGKNFQDCTSRM--EPSQCFFAHEI  288

Query  914   MDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQL---ATPIYEGLKGFRLQL  1081
             +  + TP FIL  +YD  QI +I   ES        R  + +    +   E L+GFR+ L
Sbjct  289   IKNIDTPFFILNPAYDIWQIQHILAPESSDTRQSWQRCKLNIHNCDSNQIESLQGFRVAL  348

Query  1082  LDALPN---KPSVGIFINNCFFHTEIATGY-WANPNS-QVNNVLDS--KAISDWYFYGKE  1240
             L+AL +     + G+FIN+CF H +  +   W +PNS +VNN   +  +A+ DWYF   +
Sbjct  349   LNALSDFQHNRNGGMFINSCFIHCQTMSNITWHSPNSPKVNNKEQTIAEAVGDWYFNRSK  408

Query  1241  VNLID  1255
             V  ID
Sbjct  409   VKEID  413



>dbj|BAD94756.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
Length=285

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 160/260 (62%), Gaps = 15/260 (6%)
 Frame = +2

Query  200  PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
            P+ + + A A GAVCLDGS PAYHF +G     +NW+++MEGG WC  +  C  R    K
Sbjct  25   PITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTMK  84

Query  380  GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--P  553
            GSSK M  +  F G        IL    + NP +F NWN + +RYCDGSSFTG+VE   P
Sbjct  85   GSSKFMNKDFGFSG--------ILGGKQSTNP-DFYNWNRIKVRYCDGSSFTGNVEAVNP  135

Query  554  VDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
             + L+FRG R++  + D+L+ KG+KNA+   L+G SAGA++  LHCD FR +LP T   K
Sbjct  136  ANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTASVK  195

Query  734  CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
            C+ D GYFIH K          +  +  VV+LH S   LP +CT KM  KP LC FPQY+
Sbjct  196  CVSDAGYFIHGKDITGGSY--IQSYYSKVVALHGSAKSLPVSCTSKM--KPELCFFPQYV  251

Query  914  MDGMKTPMFILMSSYDKHQI  973
            +  M+TP+F++ +++D  QI
Sbjct  252  VPSMRTPLFVINAAFDSWQI  271



>gb|KHG23648.1| Notum [Gossypium arboreum]
Length=395

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/375 (38%), Positives = 204/375 (54%), Gaps = 41/375 (11%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             T   + P+ + + A A GAVCLDG+PPAYH+ +G     ++WLI +EGG WC ++  C +
Sbjct  23    TNGAYVPITYVQSAVAKGAVCLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLV  82

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R   H GSSK M+    F G        ILN         F NWN + +RYCDGSSFTGD
Sbjct  83    RKNTHLGSSKRMVKQIPFSG--------ILNN------KHFYNWNRIKVRYCDGSSFTGD  128

Query  542   VEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             V    PV NL+FRG R++  + ++LL+KG++NA+   L+G SAG ++  LHCD FR LLP
Sbjct  129   VAAVNPVANLHFRGARVWLAVMEDLLSKGMRNAENAILSGCSAGGLASILHCDSFRALLP  188

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDKP  886
                + KC+ D GYFI     N + V G    +  F  +V+ H S   L  +CT +M  KP
Sbjct  189   MGTKVKCISDAGYFI-----NTRDVSGGHYIQTFFDQLVATHGSAKNLLPSCTSRM--KP  241

Query  887   YLCMFPQYLMDGMKTPMFILMSSYDKHQINISM-------HESFVAANRTIREHVQLATP  1045
              LC FPQY+   ++TP+FI+ ++YD  QI   +       H  + +    I+  +     
Sbjct  242   GLCFFPQYIAQQIRTPLFIINAAYDSWQIRNILAPGIADPHGHWESCKLDIKNCLPSQIK  301

Query  1046  IYEGLKGFRLQLLDA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKA  1210
             +   ++ FRLQ L A   L    S G+FI++CF H  TE+   ++   +  +N     KA
Sbjct  302   V---MQDFRLQFLVALLRLGKSASRGMFIDSCFAHCQTEMQELWFMQDSPLLNKTKIGKA  358

Query  1211  ISDWYFYGKEVNLID  1255
             + DW++       ID
Sbjct  359   VGDWFYDRNPFQKID  373



>ref|XP_010235850.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
 ref|XP_010235851.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
Length=395

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/364 (39%), Positives = 199/364 (55%), Gaps = 24/364 (7%)
 Frame = +2

Query  194   FYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLE  373
             F  + + + A A GAVCLDGS PAYH   G     D+WL++ EGG WC ++  C  R   
Sbjct  28    FVDITYVDSAVAKGAVCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSNVTTCLERKNT  87

Query  374   HKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE-  550
               GSSK M     F G        IL+  P +NP +F NWN V +RYCDGSSFTGD EE 
Sbjct  88    RLGSSKEMAKQVAFSG--------ILSNTPDHNP-DFYNWNKVRVRYCDGSSFTGDKEEV  138

Query  551   -PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRR  727
              P   L++RG R++  + ++LL KG+  A+   ++G SAG ++  LHCDRFR  +P    
Sbjct  139   DPTTKLHYRGARVWQAVMEDLLAKGMDRAENALISGCSAGGLTSVLHCDRFRDRMPVEAN  198

Query  728   FKCLMDGGYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFP  904
              KCL D G+FI VK     K    F   F +VV+ H S   LP +CT K+   P +C+FP
Sbjct  199   VKCLSDAGFFIDVKDIAGEKHAADF---FNDVVTTHGSAKNLPSSCTSKL--PPGMCLFP  253

Query  905   QYLMDGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHV-QLATPIYEGLKGFRLQ  1078
             Q  +  ++TP+FIL ++YD  Q+ NI +        R+ +  + Q +    + L+GFR  
Sbjct  254   QNEVKQIQTPLFILNAAYDSWQVRNILVPGGSDPHWRSCKHDINQCSEKQLKTLQGFRDD  313

Query  1079  LLDALPNK---PSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEV  1243
              L AL  +    S G+FIN+CF H  +EI   ++A  +  + N   + AI DW++     
Sbjct  314   FLKALEEQGSSSSRGLFINSCFAHCQSEIQEIWFAPDSPVLGNKKIANAIGDWFYDRSPF  373

Query  1244  NLID  1255
               ID
Sbjct  374   QEID  377



>ref|XP_008810598.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=422

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 146/364 (40%), Positives = 203/364 (56%), Gaps = 28/364 (8%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L   E A   GA+CLDGSPP YH  +G     D+WL+++EGG WC S+E C  RT+   G
Sbjct  60    LTLLENADEKGALCLDGSPPGYHVQKGFGSGSDSWLLHLEGGGWCNSVESCTERTMTRFG  119

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SS++M             F GIL+   + NP +F NWN V +RYCDG+SF G+ E  V N
Sbjct  120   SSRYM---------EREAFVGILSNIQSENP-DFYNWNKVKVRYCDGASFAGEGETEVQN  169

Query  563   ---LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFK  733
                LYFRG RI+  I  +LL KGL+NAK+ FLTG SAG ++  +HCD FR LLP     K
Sbjct  170   GKKLYFRGLRIWKAIMQDLLLKGLENAKEAFLTGCSAGGLATFIHCDDFRALLPKEVTAK  229

Query  734   CLMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
             CL D G+FI  K  + K+       + +VV L N    LP+ C  +M+     C FP+ +
Sbjct  230   CLADAGFFIDEKDISGKRT--IRSFYNDVVRLQNVGKNLPKECISRMEASQ--CFFPEEI  285

Query  914   MDGMKTPMFILMSSYDKHQINISMHESFVAANRTIRE-----HVQLATPIYEGLKGFRLQ  1078
             ++ + TP+FIL S+YD  Q+   +      + +  R+     H   ++ I E L+GFR  
Sbjct  286   VNNINTPLFILNSAYDSWQVQHILAPEESDSQQLWRKCKMNIHDCDSSQI-EVLQGFRNA  344

Query  1079  LLDAL---PNKPSVGIFINNCFFHT-EIATGYWANPNS-QVNNVLDSKAISDWYFYGKEV  1243
             LL  L       + G+ IN+CF H   + +  W + +S +VNN   ++AI DWYF  +EV
Sbjct  345   LLKDLREFQKNSNGGMLINSCFIHCYSMTSNTWHSLDSPKVNNKTIAEAIGDWYFNRREV  404

Query  1244  NLID  1255
               ID
Sbjct  405   KDID  408



>ref|XP_002515160.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF47144.1| pectin acetylesterase, putative [Ricinus communis]
Length=422

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/360 (38%), Positives = 196/360 (54%), Gaps = 22/360 (6%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L   + A A GAVCLDG+ PAYH   G+   +++WLI +EGG WC +I  C  R    +G
Sbjct  61    LTLIQGADAKGAVCLDGTLPAYHLHRGSGSGQNSWLIQLEGGGWCNTIRSCVYRKTTRRG  120

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SSK M        +    F GIL+  P  NP +F NWN V +RYCDG+SF+GD  +    
Sbjct  121   SSKFM--------EKVLPFTGILSNKPDENP-DFFNWNRVKLRYCDGASFSGDYHDEAAQ  171

Query  563   LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLM  742
             LYFRG+RI++   + L+ +G+ NA Q  L+G SAG ++  LHCD FR L P + + KCL 
Sbjct  172   LYFRGQRIWSAAMENLMAEGMLNATQALLSGCSAGGLASILHCDEFRDLFPQSTKVKCLS  231

Query  743   DGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDG  922
             D G F+     +  +       ++ VVSL      LP TCT ++   P  C FPQ L+  
Sbjct  232   DAGLFLDAIDVSGNRT--LRNMYEGVVSLQKVQKNLPSTCTSRL--DPTSCFFPQNLIAN  287

Query  923   MKTPMFILMSSYDKHQINISMHESFV----AANRTIREHVQLATPIYEGLKGFRLQLLDA  1090
             +KTP+FIL ++YD  Q+  S+         + N   + H Q  +   + L+ FR Q+LDA
Sbjct  288   IKTPLFILNAAYDTWQVQASLAPPTADPQGSWNECKQNHAQCNSSQIQFLQDFRNQMLDA  347

Query  1091  L---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLID  1255
             +         G+FIN+CF H  +E    ++A  +  + +   S+++ DWYF   +V  ID
Sbjct  348   INVFSMTTQNGLFINSCFSHCQSERQDTWFATDSPVIRDKRISQSVGDWYFDRVDVKAID  407



>ref|XP_007205243.1| hypothetical protein PRUPE_ppa006114mg [Prunus persica]
 gb|EMJ06442.1| hypothetical protein PRUPE_ppa006114mg [Prunus persica]
Length=426

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/363 (39%), Positives = 199/363 (55%), Gaps = 25/363 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L   E A A GAVCLDG+ PAYH   G     ++WLI++EGGAWC  I  C  R     G
Sbjct  69    LTLIEGAGAKGAVCLDGTLPAYHLHPGHGSGANSWLIHLEGGAWCNDIRSCSNRKNSAYG  128

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SS  M        + +  F GIL+ +   NP EF NWN V++RYCDG+SF+GD E    N
Sbjct  129   SSSLM--------EKERAFTGILSNEAEDNP-EFFNWNRVMLRYCDGASFSGDSENKEAN  179

Query  563   LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLM  742
             L FRG+RI+    ++L+ KG++ A Q  LTGGSAG ++  LHCD FR L P T + KC+ 
Sbjct  180   LQFRGQRIWLSAMEDLMLKGMRYANQALLTGGSAGGLASILHCDEFRGLFPTTTKVKCMS  239

Query  743   DGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDG  922
             D G+F+     +  +       +  VV L      LP  CT  +   P  C FP+ L+  
Sbjct  240   DAGFFLDAVDISGGRT--LRNLYTGVVGLQGVQENLPHYCTSHL--DPTSCFFPENLIAN  295

Query  923   MKTPMFILMSSYDKHQINISMHESFVAAN-----RTIREHVQLATPI-YEGLKGFRLQLL  1084
             + TP+FIL ++YD  QI  S+    ++A+        R ++   +P   + L+GFR Q+L
Sbjct  296   ITTPLFILNAAYDSWQIQNSLAP--LSADPHGDWNGCRLNLASCSPSQMQFLQGFRNQML  353

Query  1085  DALPN---KPSVGIFINNCFFHTEIATGYWANPNS-QVNNVLDSKAISDWYFYGKEVNLI  1252
             DAL         G+FIN+C+ H +   G W  P+S  V N   ++A+ DWYF   EV ++
Sbjct  354   DALKQFSMSDQNGMFINSCYVHGQTGQGAWFAPDSPAVGNKTIAEAVGDWYFDRAEVKVV  413

Query  1253  DKS  1261
             D++
Sbjct  414   DET  416



>ref|XP_009626489.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=386

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 145/363 (40%), Positives = 199/363 (55%), Gaps = 30/363 (8%)
 Frame = +2

Query  182   TKANFYPLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKL  361
             T+A +      E A A GAVCLDGS PA++F +GT      WL+++EGG WC++   C  
Sbjct  19    TQAQYVNTTILESAVAEGAVCLDGSAPAFNFYQGTGARVRRWLLHLEGGGWCDTTSNCLT  78

Query  362   RTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGD  541
             R  +  GSSK +             F GIL+ DP  NP +F +WN V IRYCDG+S+TGD
Sbjct  79    RAGQVYGSSKQI--------PPQAYFTGILSNDPELNP-DFYDWNKVKIRYCDGASYTGD  129

Query  542   VEE--PVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLP  715
             VEE  P  NL++RG RIF  I   LL KG+  A+   L+G SAG ++  L+CD+F  LLP
Sbjct  130   VEEVDPSTNLHYRGARIFKAIVQHLLAKGMYKAENAILSGTSAGGLAAILNCDKFNNLLP  189

Query  716   NTRRFKCLMDGGYFIHVKKDNPKQVEGF---ELTFKNVVSLHNSTGMLPQTCTQKMKDKP  886
              + R +C+ D G+F++V+      + G+   +  F  VV LH S   LPQ C     DK 
Sbjct  190   LSVRVRCISDSGFFVNVET-----ISGYPHIQELFYRVVKLHGSAKNLPQACAFDY-DKS  243

Query  887   YLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-YE  1054
              LC FPQY+   M+TP+FI+ S+YD  Q+N S    +V         + H+   TP   +
Sbjct  244   -LCFFPQYVAPYMQTPLFIINSAYDSWQVNYSFVPKYVDPLGVWNNCKHHISQCTPSQLQ  302

Query  1055  GLKGFRLQLLDALPN---KPSVGIFINNCFFHTEIA-TGYWANPNS-QVNNVLDSKAISD  1219
              L  +RL+ L AL       S G FI +C  H  +    YW   NS  ++N   +KA+ D
Sbjct  303   ILDDYRLKFLKALQGLGPSSSRGYFIISCHTHNIVERQSYWMYKNSPTLDNKKIAKAVGD  362

Query  1220  WYF  1228
             WYF
Sbjct  363   WYF  365



>ref|XP_009108427.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/353 (39%), Positives = 196/353 (56%), Gaps = 24/353 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + F   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C  R     G
Sbjct  27    ITFVRNAVAKGAVCLDGSPPAYHIDRGSGTGINSWLIQLEGGGWCHNVTNCISRMHTKLG  86

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+ N  F          IL+     NP +F NWN V +RYCDGSSFTGDV+   P 
Sbjct  87    SSKKMVENLAFSA--------ILSNKEQRNP-DFYNWNRVKVRYCDGSSFTGDVKTVNPA  137

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R++  +  ELL KG++NA+   L+G SAG ++  +HCD FR LLP     KC
Sbjct  138   TNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKC  197

Query  737   LMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLM  916
             L D G+F++ +  +  Q    +  F +VV+LH S   LP++CT ++   P +C FPQY+ 
Sbjct  198   LSDAGFFLNTRDVSGAQY--IKSYFNDVVTLHGSAKNLPRSCTSRL--NPAMCFFPQYVA  253

Query  917   DGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQLATPIYEGLK---GFRLQLL  1084
               ++TP+F+L ++YD  QI NI    +     +     + +       LK    FRL+ L
Sbjct  254   RQIRTPVFVLNAAYDSWQIKNILAPRAADPEGKWQSCQLDIKNCQRSQLKVMQDFRLEFL  313

Query  1085  DA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYF  1228
              A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ DW +
Sbjct  314   SAVIGLGRSASRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGDWVY  366



>ref|XP_009776988.1| PREDICTED: uncharacterized protein LOC104226656 isoform X2 [Nicotiana 
sylvestris]
Length=386

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 152/359 (42%), Positives = 198/359 (55%), Gaps = 38/359 (11%)
 Frame = +2

Query  209   FPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSS  388
             F E A A GAVCLDGS PA++F  GT     NWLI ++GG WC+S  +C+ R     G+S
Sbjct  28    FLESAIAKGAVCLDGSAPAFNFHPGTGSGVYNWLIQLQGGGWCDSASDCQDRATNGYGTS  87

Query  389   KHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PVDN  562
             K++             F G+L+ D   NP +F NWN + +RYCDGSS+TGD+EE  P  N
Sbjct  88    KNI--------SKIGYFMGVLSNDSQLNP-DFYNWNRIKVRYCDGSSYTGDIEEVDPATN  138

Query  563   LYFRGKRIFNVITDELL-NKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCL  739
             L+FRG RIF  I DELL +KG+  A+   L+G SAG +   LHCD+FR     T R KC+
Sbjct  139   LHFRGARIFKAIMDELLYHKGMIYAENAILSGTSAGGLGAILHCDKFRLFFSLTARVKCI  198

Query  740   MDGGYFIHVK--KDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYL  913
              D G+FI+ K   D P   E     FK VV+LH S   LP +CT    D P LC FPQY 
Sbjct  199   SDAGFFINAKTITDEPHIKE----YFKRVVALHGSAKNLPLSCTFLSLD-PSLCFFPQYA  253

Query  914   MDGMKTPMFILMSSYDKHQINISM--HES-------FVAANRTIREHVQLATPIYEGLKG  1066
                + TP+FI+ S+YD  QIN S+   E+       F   N       Q+ T     L+ 
Sbjct  254   AQHICTPLFIINSAYDSWQINNSLVPQEADPRHVWDFCKGNINNCSLSQIQT-----LQD  308

Query  1067  FRLQLLDALPN---KPSVGIFINNCFFHTEI-ATGYWANPNS-QVNNVLDSKAISDWYF  1228
             FRL  L+AL       S G FI++C  H  I A  YW+  NS  + N   ++A+ DW+F
Sbjct  309   FRLTFLEALNELGPSTSRGYFISSCHSHKGIEAQAYWSYNNSPTLANKTIAEAVGDWFF  367



>ref|XP_002461086.1| hypothetical protein SORBIDRAFT_02g040470 [Sorghum bicolor]
 gb|EER97607.1| hypothetical protein SORBIDRAFT_02g040470 [Sorghum bicolor]
Length=414

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 141/405 (35%), Positives = 206/405 (51%), Gaps = 33/405 (8%)
 Frame = +2

Query  92    LALI---CINMAIAQNCHQWltllvcaallvlQTKAN--FYPLIFPEKAKAMGAVCLDGS  256
             LAL+    +  ++A+    W               +N  F  L   + A A GAVCLDGS
Sbjct  8     LALVLALSVGASVARGSEPWWNETQVYTTTANSGGSNGVFVGLTLIQSAAAKGAVCLDGS  67

Query  257   PPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMNpffpgdydfg  436
              P YH   G     ++WL+ +EGG WC  +  C  R    +GSS HM        +    
Sbjct  68    LPGYHLHRGFGSGANSWLVNLEGGGWCNDVSSCVFRKGSRRGSSNHM--------ERQLQ  119

Query  437   fygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDNLYFRGKRIFNVITDELLN  616
             F GI++  P  NP +F NWN V +RYCDG SFTGD  +    LYFRG+RI+    D+L+ 
Sbjct  120   FTGIMSNRPDENP-DFYNWNRVKVRYCDGGSFTGDGSDAAAGLYFRGQRIWQAAMDDLMA  178

Query  617   KGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFIH-VKKDNPKQVE  793
             +G++ A Q  L+G SAG VS  LHCD FR L P+  R KCL D G F+  V     +++ 
Sbjct  179   QGMRYANQALLSGCSAGGVSTILHCDEFRGLFPSNTRVKCLADAGMFLDTVDVSGRREMR  238

Query  794   GFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFILMSSYDKHQI  973
              F   F  +V L  S   LP++CT +M      C FPQ ++  ++TP F+L ++YD  Q+
Sbjct  239   SF---FNGIVRLQGSGRSLPRSCTARMDKTS--CFFPQNVLPNIQTPTFVLNTAYDVWQL  293

Query  974   NISMH------ESFVAANRTIREHVQLATPIYEGLKGFRLQLLDALPNKPSV---GIFIN  1126
               S+       +   +  RT   H    +   + L+GFR Q+LDA+    +    G+FIN
Sbjct  294   QQSVAPRTADPQGLWSKCRT--NHAFCNSNQLQFLQGFRNQMLDAVKGFSASRRNGLFIN  351

Query  1127  NCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLID  1255
             +CF H  +E    ++AN + ++ N   + A+ DW+F   +    D
Sbjct  352   SCFAHCQSERQDTWYANNSPRLGNKKIADAVGDWFFERGDAKYTD  396



>ref|XP_007222071.1| hypothetical protein PRUPE_ppa007506mg [Prunus persica]
 gb|EMJ23270.1| hypothetical protein PRUPE_ppa007506mg [Prunus persica]
Length=365

 Score =   236 bits (603),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 132/360 (37%), Positives = 192/360 (53%), Gaps = 22/360 (6%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L     A A GAVCLDG+ P +H   G     ++WLI +EGG WC++I  C  R    +G
Sbjct  4     LTLINGAAAKGAVCLDGTLPGFHIHRGYGSGANSWLIQLEGGGWCDTIRNCVYRKKTRRG  63

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SS +M        +    F GIL+     NP +F NWN V +RYCDG+SF GD +     
Sbjct  64    SSAYM--------EKQIPFAGILSNKAGENP-DFYNWNRVKVRYCDGASFGGDSQNEAAQ  114

Query  563   LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLM  742
             LYFRG+RI+     +L++KG++ A Q  L+G SAG V+  LHCD FR +   T R KCL 
Sbjct  115   LYFRGQRIWEAAMADLMSKGMRYANQALLSGCSAGGVATVLHCDEFRAMFRGTTRVKCLS  174

Query  743   DGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDG  922
             D G F+ V   + ++       F+ VVSL  +   LP +CT ++   P LC FPQ+L+  
Sbjct  175   DAGLFLDVIDVSGRRT--LRNMFRRVVSLQGAYKSLPWSCTNRL--NPTLCFFPQHLIAS  230

Query  923   MKTPMFILMSSYDKHQINISMHESFVAAN----RTIREHVQLATPIYEGLKGFRLQLLDA  1090
             +KTP+F++ ++YD  QI  S+       N       + H + A      L+GFR Q+L A
Sbjct  231   VKTPLFLVNAAYDTWQIQASLASPTADPNGLWHECTKNHARCAAWQMNFLQGFRNQMLKA  290

Query  1091  LPNKPSV---GIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLID  1255
             +         G+FIN+CF H  TE    +++  +  + N   +K++ +WYF    +  ID
Sbjct  291   VSGFSRASKNGLFINSCFAHCQTERQDTWFSQNSPHIGNKGIAKSVGNWYFDRVNIKAID  350



>emb|CDY09289.1| BnaC03g63190D [Brassica napus]
Length=397

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 137/353 (39%), Positives = 196/353 (56%), Gaps = 24/353 (7%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             + F   A A GAVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C  R     G
Sbjct  27    ITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCHNVTNCISRMHTKLG  86

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPV  556
             SSK M+ N  F          IL+     NP +F NWN V +RYCDGSSFTGDV+   P 
Sbjct  87    SSKKMVENLAFSA--------ILSNKEQRNP-DFYNWNRVKVRYCDGSSFTGDVKTVNPA  137

Query  557   DNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKC  736
              NL+FRG R++  +  ELL KG++NA+   L+G SAG ++  +HCD FR LLP     KC
Sbjct  138   TNLHFRGARVWLAVMRELLAKGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKC  197

Query  737   LMDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLM  916
             L D G+F++ +  +  Q    +  F +VV+LH S   LP++CT ++   P +C FPQY+ 
Sbjct  198   LSDAGFFLNTRDVSGAQY--IKSYFNDVVTLHGSAKNLPRSCTSRL--TPAMCFFPQYVA  253

Query  917   DGMKTPMFILMSSYDKHQI-NISMHESFVAANRTIREHVQLATPIYEGLK---GFRLQLL  1084
               ++TP+F+L ++YD  QI NI    +     +     + +       LK    FRL+ L
Sbjct  254   RQIRTPVFVLNAAYDSWQIKNILAPRAADPDGKWQSCQLDIKNCQRSQLKVMQDFRLEFL  313

Query  1085  DA---LPNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYF  1228
              A   L    S G+FI++C+ H  TE  T ++   +  +N    +KA+ DW +
Sbjct  314   SAVIGLGRSASRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGDWVY  366



>emb|CBI37039.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   236 bits (603),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 135/356 (38%), Positives = 195/356 (55%), Gaps = 26/356 (7%)
 Frame = +2

Query  221   AKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMM  400
             A A GAVCLDG+ P YHF  G     ++WLI +EGG WC +I+ C  R    +GSSK+M 
Sbjct  10    AAARGAVCLDGTLPGYHFHPGFGSGANSWLIQLEGGGWCNNIKSCVFRKTTRRGSSKYM-  68

Query  401   MNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDNLYFRGK  580
                    +    F GIL+     NP +F NWN V +RYCDG+SF+G+ +     LYFRG+
Sbjct  69    -------EKTLAFTGILSNKAEENP-DFFNWNRVKLRYCDGASFSGEGQNKATGLYFRGQ  120

Query  581   RIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFI  760
             RIF    +EL++KG+KNA Q  L+G SAG ++  LHCD F  L P T + KCL D G+F+
Sbjct  121   RIFEAGMEELMSKGMKNADQALLSGCSAGGLASILHCDEFGDLFPKTTKVKCLSDAGFFL  180

Query  761   HVKKDNPKQVEGFELT--FKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTP  934
                 D      G  +   +  VVSL      LP TCT ++   P  C FP+ L+D +KTP
Sbjct  181   ----DATDAAGGHTMRNLYAGVVSLQGVEKNLPSTCTTRL--DPTSCFFPENLIDNIKTP  234

Query  935   MFILMSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQLLD---AL  1093
             +F+L ++YD  Q   S+  S    +   +     HV   +   + L+ FR+++LD     
Sbjct  235   LFLLNAAYDAWQFQESLVPSSADPHGEWKGCKLNHVNCNSTQIQFLQDFRMEMLDDVKGF  294

Query  1094  PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLID  1255
                   G+FIN+CF H  TE+   ++A+ +  +     ++++ DWYF  + V  ID
Sbjct  295   ARDDQNGLFINSCFAHCQTELQDTWFADDSPFLGKRKIAESVGDWYFDRRPVKAID  350



>ref|XP_009335553.1| PREDICTED: uncharacterized protein LOC103928265 isoform X2 [Pyrus 
x bretschneideri]
Length=407

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 194/362 (54%), Gaps = 23/362 (6%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             +   E A A GAVCLDG+ PAYH   G     ++WLI+++GGAWC   + C  R L   G
Sbjct  53    ITLVEGAAAKGAVCLDGTVPAYHLHRGYGSGVNSWLIHLQGGAWCNDTKSCSNRKLSAYG  112

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SS HM        + +  F GIL+     NP EF NWN V +RYCDG+SF+GD E     
Sbjct  113   SSAHM--------EKERAFSGILSNKSEENP-EFFNWNRVELRYCDGASFSGDSENQEAQ  163

Query  563   LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLM  742
             L FRG+RI+    D+L++KG++NA Q  L+G SAG +S  LHCD FR L P T + KCL 
Sbjct  164   LQFRGQRIWLSAMDDLMSKGMRNANQALLSGCSAGGLSSILHCDEFRSLFPTTTKVKCLS  223

Query  743   DGGYFIH-VKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMD  919
             D G+F+  V     + +  +   +  VVSL      LPQ CT  +   P  C FP+ L+ 
Sbjct  224   DAGFFLDAVDISGGRTLRDY---YGGVVSLQGVQENLPQFCTSHL--DPTSCFFPENLIA  278

Query  920   GMKTPMFILMSSYDKHQINISMHESFVAA----NRTIREHVQLATPIYEGLKGFRLQLLD  1087
              +  P+FIL ++YD  QI  S+           N         +    + L+GFR Q+L+
Sbjct  279   NITPPLFILNAAYDSWQIYNSLAPPSADPRGKWNSCRLNLASCSASQMQILQGFRNQMLN  338

Query  1088  ALPN---KPSVGIFINNCFFHTEIATGYWANPNS-QVNNVLDSKAISDWYFYGKEVNLID  1255
             A+         G+FIN+CF H +     W+  +S  V N   ++A+ DWYF   EV ++D
Sbjct  339   AVKQFSVSNQTGMFINSCFAHCQTGQSAWSAHDSPAVGNKTIAEAVGDWYFDRAEVKVVD  398

Query  1256  KS  1261
             ++
Sbjct  399   ET  400



>ref|NP_974575.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE84179.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=365

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 198/342 (58%), Gaps = 24/342 (7%)
 Frame = +2

Query  236   AVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMNpff  415
             AVCLDGSPPAYH   G+    ++WLI +EGG WC ++  C  R     GSSK M+ N  F
Sbjct  6     AVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVSRMHTRLGSSKKMVENLAF  65

Query  416   pgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PVDNLYFRGKRIF  589
                       IL+    YNP +F NWN V +RYCDG+SFTGDVE   P  NL+FRG R++
Sbjct  66    SA--------ILSNKKQYNP-DFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARVW  116

Query  590   NVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFIHVK  769
               +  ELL KG+ NA+   L+G SAG ++  +HCD FR LLP   + KCL D G+F++ +
Sbjct  117   LAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTR  176

Query  770   KDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFILM  949
               +   V+  +  F++VV+LH S   LP++CT ++   P +C FPQY+   ++TP+FIL 
Sbjct  177   --DVSGVQYIKTYFEDVVTLHGSAKNLPRSCTSRL--TPAMCFFPQYVARQIRTPLFILN  232

Query  950   SSYDKHQI-NISMHESFVAANR--TIREHVQLATPI-YEGLKGFRLQLLDA---LPNKPS  1108
             ++YD  QI NI    +     +  + +  ++   P   + ++ FRL+ L A   L    S
Sbjct  233   AAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSS  292

Query  1109  VGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYF  1228
              G+FI++C+ H  TE  T ++   +  +N    +KA+ DW +
Sbjct  293   RGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGDWVY  334



>ref|XP_007051327.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOX95484.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=458

 Score =   239 bits (609),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 132/361 (37%), Positives = 194/361 (54%), Gaps = 22/361 (6%)
 Frame = +2

Query  200   PLIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHK  379
             PL   + A + GAVCLDG+PP YH   G     ++WLI++EGG WC +I  C  R    +
Sbjct  54    PLTLIQGAASKGAVCLDGTPPGYHLDRGFGSGSNSWLIHLEGGGWCNNIRTCVFRKTTRR  113

Query  380   GSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVD  559
             GSSK M             F GIL+     NP +F NWN V +RYCDG+SF G+ +   +
Sbjct  114   GSSKFM--------AKQTNFTGILSNKAEENP-DFYNWNRVKLRYCDGASFAGEGQNEAN  164

Query  560   NLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCL  739
              LYFRG+RI++   +EL+ KG++NA+Q  L+G SAG ++  LHCD F+ L P T + KCL
Sbjct  165   QLYFRGQRIWSAAMEELMAKGMQNAEQALLSGCSAGGLASILHCDEFKDLFPKTTKVKCL  224

Query  740   MDGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMD  919
              D G F+     N          +  VV+L      LP TCT +M   P  C FPQ L+ 
Sbjct  225   SDAGMFLDAT--NVAGGHSLRDMYGGVVTLQGVQKNLPNTCTSQM--DPTSCFFPQNLVA  280

Query  920   GMKTPMFILMSSYDKHQINISMHESFVAANRTIRE----HVQLATPIYEGLKGFRLQLLD  1087
              ++TP+F+L ++YD  Q+  S+  S    + + RE         +   + L+ FR Q+L+
Sbjct  281   NIRTPLFLLNAAYDAWQVQESLIPSSADPHGSWRECKMDRSHCNSTQMQFLQDFRSQMLN  340

Query  1088  AL---PNKPSVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLI  1252
             A+         G+FIN+CF H  +E    ++ N + ++ N   + ++ DW+F    V  I
Sbjct  341   AINVFSKSNQNGLFINSCFAHCQSERQDTWYENDSPRIGNKAVAVSVGDWFFDRTAVKAI  400

Query  1253  D  1255
             D
Sbjct  401   D  401



>ref|XP_004300391.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=399

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 143/369 (39%), Positives = 208/369 (56%), Gaps = 36/369 (10%)
 Frame = +2

Query  215   EKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKH  394
             + A A GAVCLDGSPPAYH+ +G     +NWL+++EGG WC ++  C  R     GSSK 
Sbjct  33    QTAVAKGAVCLDGSPPAYHWDKGFGSGLNNWLVHIEGGGWCHNVTNCLGRKNTRLGSSKK  92

Query  395   MMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVE--EPVDNLY  568
             M+            F GIL+   + NP  F NWN + +RYCDGSSFTGDV   +P   LY
Sbjct  93    MLKE--------IPFSGILSNRQSLNPG-FYNWNRIKVRYCDGSSFTGDVAAVDPATGLY  143

Query  569   FRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKL-LPNTRRFKCLMD  745
             FRG R+F  +  +LL KG+  A    L+G SAG ++  LHCD FR L LP+  + KC+ D
Sbjct  144   FRGARVFRAVMADLLAKGMGKAVNAVLSGCSAGGLTSILHCDNFRALFLPSGTKVKCVSD  203

Query  746   GGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGM  925
              GYFI+VK  +  Q    +  F ++V+ H S   LP +CT K+  +P LC FPQY++  +
Sbjct  204   AGYFINVKDISGAQ--HVQEYFTDIVTTHGSAKNLPPSCTSKL--RPDLCFFPQYVVPQI  259

Query  926   KTPMFILMSSYDKHQINISMHESFVAANRTIRE---HVQLATPI-YEGLKGFRLQLLDAL  1093
             +TP+F + ++YD  QI   +       + T R     ++  +P   + ++ FRLQ L A+
Sbjct  260   RTPIFYVNAAYDSWQIKNIVVPGVADPHGTWRNCKLDIKNCSPTQLKTMQNFRLQFLSAI  319

Query  1094  ---PNKPSVGIFINNCFFH--TEIATGYWANPNSQ-VNNVLDSKAISDWYFYGKEVNLID  1255
                 N    G+FI++C+ H  TE+    W+ PNS  +N    ++A+ DW++        D
Sbjct  320   GGVSNSAVKGMFIDSCYLHCQTELQE-TWSMPNSPLLNKTTIARAVGDWFY--------D  370

Query  1256  KSEFIK-DC  1279
             ++ F K DC
Sbjct  371   RTSFQKIDC  379



>ref|XP_009759657.1| PREDICTED: uncharacterized protein LOC104212153 [Nicotiana sylvestris]
Length=429

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 202/371 (54%), Gaps = 45/371 (12%)
 Frame = +2

Query  218   KAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHM  397
              A A GAVCLDGS PA+HF  GT     +WLI+++GG WCE+  +C+ R      SSKH 
Sbjct  40    SAIAKGAVCLDGSAPAFHFYPGTGSGVYSWLIHLQGGGWCETTSDCQNRA-RSDLSSKHA  98

Query  398   MMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PVDNLYF  571
              +           F G+L+ DP  NP +F NWNLV IRYCDGSS+TGD+EE  P  NL++
Sbjct  99    PI--------VAHFSGVLSNDPQLNP-DFYNWNLVKIRYCDGSSYTGDIEEVDPDTNLHY  149

Query  572   RGKRIFNVITDELL-NKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDG  748
             RG RIF  I +ELL  KG+  A+   L+G SAG +   LHCD+FR   P T R KC+ D 
Sbjct  150   RGARIFEAIMEELLYRKGMIYAQNAILSGTSAGGLGAILHCDKFRYFFPLTVRVKCISDA  209

Query  749   GYFIHVKK-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGM  925
              +F++VK      Q+E +   +K VV+LH S   LP +CT  + D P LC FPQY     
Sbjct  210   AFFLNVKTITGEPQIEEY---YKRVVALHGSAKNLPLSCTLSLND-PSLCFFPQYAAQHT  265

Query  926   KTPMFILMSSYDKHQINISMHES---------FVAANRTIREHVQLATPIYEGLKGFRLQ  1078
              TP+FI+ S+YD  QIN S+  S         +   N       QL T     ++ FRL 
Sbjct  266   YTPLFIINSAYDAFQINHSLIPSEADPQHVWDYCKGNLNSCSPSQLQT-----IQDFRLT  320

Query  1079  LLDALPN-KPSV--GIFINNCFFHTEIAT-GYWANPNS-QVNNVLDSKAISDWYFYGKEV  1243
              L+AL    PS   G FI++C  H  I    YW+  NS  + N   ++A+  W+F     
Sbjct  321   FLEALNELGPSTTRGYFISSCHSHHGIEIQSYWSYTNSPTLANKTIAEAVGGWFF-----  375

Query  1244  NLIDKSEFIKD  1276
                D+S F  D
Sbjct  376   ---DRSGFQGD  383



>ref|XP_008378614.1| PREDICTED: uncharacterized protein LOC103441693 [Malus domestica]
 ref|XP_008347801.1| PREDICTED: uncharacterized protein LOC103410927 [Malus domestica]
Length=393

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 141/364 (39%), Positives = 201/364 (55%), Gaps = 32/364 (9%)
 Frame = +2

Query  185   KANFYP--LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECK  358
             KA  +P  +   E A A GAVCLDGS PAYHF +G     +NWL+Y EGG WC ++  C 
Sbjct  21    KAEXHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVYFEGGGWCNTVATCL  80

Query  359   LRTLEHKGSSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTG  538
              R+    GSS  M        +    F G+L+     NP +F NWN + +RYCDGSSFTG
Sbjct  81    DRSNYSLGSSTKM--------EKTMLFSGVLSNKQKTNP-DFYNWNRIKVRYCDGSSFTG  131

Query  539   DVE--EPVDNLYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLL  712
             DVE  +P  NL+FRG R+F  I D+LL KG+KNA+   L+G SAG ++  LHCD FR LL
Sbjct  132   DVEAVDPATNLHFRGARVFRAIMDDLLAKGMKNAQSALLSGCSAGGLASILHCDNFRSLL  191

Query  713   PNTRRFKCLMDGGYFIHVKKDNPKQVEG---FELTFKNVVSLHNSTGMLPQTCTQKMKDK  883
             P   + KC+ D GYFI     N + V G    +  +  VV+LH S   LP +CT +M   
Sbjct  192   PVDAKVKCVPDAGYFI-----NARTVSGSPYIQAFYSEVVALHGSAKNLPASCTSRM--S  244

Query  884   PYLCMFPQYLMDGMKTPMFILMSSYDKHQINISMHESFV---AANRTIREHVQLATPI-Y  1051
             P LC FPQ ++   +TP+F + ++YD  QI   +         A +  + +++  +P   
Sbjct  245   PGLCFFPQNVVPLTRTPIFFVNAAYDWWQIQNILAPDVADPEGAWKKCKLNIKNCSPSQL  304

Query  1052  EGLKGFRLQLLDAL---PNKPSVGIFINNCFFHTEI--ATGYWANPNSQVNNVLDSKAIS  1216
             + ++ FRLQ L  +    N  S G FI++C+ H +I     + A  +  +     ++A+ 
Sbjct  305   QTMQEFRLQFLKTITGASNSSSHGWFIHSCYAHCQIEMQETWLAADSPMLCKTTIAEAVG  364

Query  1217  DWYF  1228
             DWY+
Sbjct  365   DWYY  368



>dbj|BAJ85221.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87576.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 188/347 (54%), Gaps = 24/347 (7%)
 Frame = +2

Query  221   AKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMM  400
             AK  GAVCLDG+PP YH   G+ E  D WL+++EGG WC +++EC  R L  +GSS  M 
Sbjct  66    AKEKGAVCLDGTPPGYHLQRGSGEGADRWLVHLEGGGWCSTVKECSDRRLSSQGSSNFM-  124

Query  401   MNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN---LYF  571
                       F   GIL  D   NP +F NWN V +RYCDG+SF+GD E   ++   LYF
Sbjct  125   ------RSIRFMGNGILGGDQLQNP-DFYNWNKVYVRYCDGASFSGDAEAQAEDGTTLYF  177

Query  572   RGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGG  751
             RG RI+  + DEL+ KGL +A Q   TG SAGA+S+ LHCD FR   P     KC  D G
Sbjct  178   RGLRIYEAVIDELMEKGLASATQALFTGCSAGALSMMLHCDDFRARFPQEVSVKCFADAG  237

Query  752   YFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKT  931
             +FI  K  + K+       +  V+ L N   +LP+ C      +P  C FP  L+  ++T
Sbjct  238   FFIDEKDISGKR--SLWSLYDRVIHLQNVRKVLPKDCL--ANKEPTECFFPAELIKSIRT  293

Query  932   PMFILMSSYDKHQI-------NISMHESFVAANRTIREHVQLATPIYEGLKGFRLQLLDA  1090
             PMFIL  SYD  QI       + +  +S+++    IR        +  GL+   +  L  
Sbjct  294   PMFILNPSYDSWQIRNVLVPDSSAPDKSWLSCKENIRNCNSTQVEVLNGLRNKMVNDLKV  353

Query  1091  LPNKPSVGIFINNCFFHTEIATGY-WANPNS-QVNNVLDSKAISDWY  1225
             + +K   G+FI++CF H +  +G  W +P S ++ N   ++A+ DW+
Sbjct  354   VEDKEDWGMFIDSCFTHCQSLSGISWHSPTSPRLENKTIAEAVGDWH  400



>ref|XP_009353455.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=428

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/360 (37%), Positives = 194/360 (54%), Gaps = 22/360 (6%)
 Frame = +2

Query  203   LIFPEKAKAMGAVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKG  382
             L     A A GAVCLDG+ PAYH   G     ++WLI +EGG WC++I  C  R   H+G
Sbjct  67    LTLINGAAAKGAVCLDGTLPAYHIHHGYGSGANSWLIQLEGGGWCDTIRNCVYRKKTHRG  126

Query  383   SSKHMMMNpffpgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEEPVDN  562
             SS +M        +    F GIL+     NP +F NWN V +RYCDG+SF GD       
Sbjct  127   SSAYM--------EKYIPFAGILSNKAGENP-DFYNWNRVKVRYCDGASFAGDSHNAAAQ  177

Query  563   LYFRGKRIFNVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLM  742
             L+FRG+RI+    ++L+++G++ A Q  L+G SAG V+  LHCD FR + P T R KCL 
Sbjct  178   LHFRGQRIWKAAMEDLMSRGMRYANQALLSGCSAGGVATVLHCDEFRGMFPATTRVKCLS  237

Query  743   DGGYFIHVKKDNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDG  922
             D G F+ V   +  +       F+ VVSL      LP +CT ++   P LC FPQ+L+  
Sbjct  238   DAGLFLDVVDVSGSRT--LRSMFRRVVSLQGVQKNLPWSCTNRL--HPTLCFFPQHLIAS  293

Query  923   MKTPMFILMSSYDKHQINISMHESFVAAN----RTIREHVQLATPIYEGLKGFRLQLLDA  1090
             +KTP+F++ ++YD  QI  S+       N       + + + A      L+GFR+Q+L A
Sbjct  294   VKTPLFLVNAAYDTWQIQASLAPRTADPNGHWHACTKNNGRCAAWQMNFLQGFRIQMLKA  353

Query  1091  LPNKPSV---GIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLID  1255
             +         G+FIN+CF H  TE    +++  +  + N   +K++ +WYF    +  ID
Sbjct  354   VSGFSRAGKNGLFINSCFSHCQTERQDTWFSQNSPLIGNKGIAKSVGNWYFDRYSIKAID  413



>ref|XP_010111521.1| hypothetical protein L484_021346 [Morus notabilis]
 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis]
Length=386

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 202/361 (56%), Gaps = 35/361 (10%)
 Frame = +2

Query  236   AVCLDGSPPAYHFVEGTVENKDNWLIYMEGGAWCESIEECKLRTLEHKGSSKHMMMNpff  415
             + CLDGSPPAYHF  G     +NWL+ +EGG WC ++  C  R     GSSK M+    F
Sbjct  28    SFCLDGSPPAYHFSHGFGSGVNNWLVQIEGGGWCNNVTTCLARKNTRLGSSKAMVKELSF  87

Query  416   pgdydfgfygILNRDPAYNPSEFVNWNLVVIRYCDGSSFTGDVEE--PVDNLYFRGKRIF  589
              G        IL+    +NP +F +WN + +RYCDGSSFTGDVE   P  NL+FRG R+F
Sbjct  88    SG--------ILSNKQKFNP-DFYDWNRIKVRYCDGSSFTGDVEAVNPATNLHFRGARVF  138

Query  590   NVITDELLNKGLKNAKQVFLTGGSAGAVSVALHCDRFRKLLPNTRRFKCLMDGGYFIHVK  769
               I ++L  KG+KNA+   L+G SAG ++  LHCD+F+ L+P+T + KCL D GYFI+  
Sbjct  139   LAIIEDLQAKGMKNAQNAILSGCSAGGLASILHCDKFKSLMPSTTKVKCLSDAGYFINTN  198

Query  770   K-DNPKQVEGFELTFKNVVSLHNSTGMLPQTCTQKMKDKPYLCMFPQYLMDGMKTPMFIL  946
                  K +E F   +  VV+ H S   LP +CT ++   P LC FPQY++  ++TP+F +
Sbjct  199   DVSGAKHIETF---YTEVVATHGSAKNLPSSCTSRL--SPGLCFFPQYVVSQIQTPIFFV  253

Query  947   MSSYDKHQINISMHESFVAANRTIR----EHVQLATPIYEGLKGFRLQLLDALP---NKP  1105
              ++YD  QI   +       + T      +  + ++   + ++ FRL+ L A+    N  
Sbjct  254   NAAYDSWQIKNILAPGVADPHGTWHYCKLDITKCSSIQLKTMQDFRLEFLKAISVVGNSL  313

Query  1106  SVGIFINNCFFH--TEIATGYWANPNSQVNNVLDSKAISDWYFYGKEVNLIDKSEFIK-D  1276
             S G+FI++C+ H  TE+   +    + ++     +KA+ DW++        D+S F K D
Sbjct  314   SKGLFIDSCYAHCQTEMQETWLRANSPRLGATTIAKAVGDWFY--------DRSAFQKID  365

Query  1277  C  1279
             C
Sbjct  366   C  366



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4153250619084