BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23780_g2_i5 len=1902 path=[1112:0-441 9493:442-527 1554:528-1195
2222:1196-1226 7159:1227-1387 2648:1388-1419 2680:1420-1443
2704:1444-1463 2724:1464-1503 2749:1504-1901]

Length=1902
                                                                      Score     E

ref|XP_010325122.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    150   9e-35   
ref|XP_006364270.1|  PREDICTED: serine/arginine repetitive matrix...    146   1e-33   
ref|XP_004245196.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   1e-32   
ref|XP_011084184.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-32   
ref|XP_006364269.1|  PREDICTED: serine/arginine repetitive matrix...    134   5e-32   
ref|XP_011081940.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    135   1e-31   
emb|CDP04788.1|  unnamed protein product                                135   1e-31   
ref|XP_009783532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   3e-31   
ref|XP_009783537.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   3e-31   
ref|XP_009618666.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   1e-30   
ref|XP_009618667.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   1e-30   
ref|XP_011026473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   2e-29   
ref|XP_011026475.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   2e-29   
ref|XP_011019775.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   5e-29   
ref|XP_011019776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   5e-29   
ref|XP_011019778.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   5e-29   
ref|XP_011019777.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   5e-29   
ref|XP_011019781.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   5e-29   
ref|XP_006382072.1|  hypothetical protein POPTR_0006s26710g             123   9e-29   
ref|XP_002324283.2|  hypothetical protein POPTR_0018s01460g             125   1e-28   Populus trichocarpa [western balsam poplar]
gb|EYU29231.1|  hypothetical protein MIMGU_mgv1a002140mg                130   2e-28   
gb|EYU29229.1|  hypothetical protein MIMGU_mgv1a002072mg                129   5e-28   
ref|XP_010648638.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   7e-28   
ref|XP_002285000.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   7e-28   Vitis vinifera
gb|EYU29230.1|  hypothetical protein MIMGU_mgv1a002072mg                126   9e-28   
gb|KHG30308.1|  Peptidyl-prolyl cis-trans isomerase cyp5                121   9e-28   
ref|XP_006450486.1|  hypothetical protein CICLE_v10007495mg             126   2e-27   
ref|XP_006483322.1|  PREDICTED: serine/arginine repetitive matrix...    126   2e-27   
ref|XP_006450487.1|  hypothetical protein CICLE_v10007495mg             126   3e-27   
emb|CAN80313.1|  hypothetical protein VITISV_020758                     123   3e-27   Vitis vinifera
ref|XP_006483320.1|  PREDICTED: serine/arginine repetitive matrix...    126   3e-27   
gb|KDP33623.1|  hypothetical protein JCGZ_07194                         125   3e-27   
gb|KHG19968.1|  Peptidyl-prolyl cis-trans isomerase cyp5                125   4e-27   
ref|XP_010048237.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   7e-27   
ref|XP_010048238.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   7e-27   
ref|XP_007013817.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    124   7e-27   
ref|XP_010048233.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   8e-27   
ref|XP_010048236.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   8e-27   
ref|XP_007013820.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    124   8e-27   
ref|XP_002515550.1|  peptidyl-prolyl cis-trans isomerase, putative      125   9e-27   Ricinus communis
gb|AES58972.2|  peptidyl-prolyl cis-trans isomerase                     126   9e-27   
emb|CBI21007.3|  unnamed protein product                                121   9e-27   
gb|KHN05982.1|  E3 SUMO-protein ligase RanBP2                           120   1e-26   
ref|XP_004138866.1|  PREDICTED: uncharacterized protein LOC101210345    120   1e-26   
gb|KCW80440.1|  hypothetical protein EUGRSUZ_C01785                     124   1e-26   
ref|XP_006581366.1|  PREDICTED: serine/arginine repetitive matrix...    118   1e-26   
gb|KCW80439.1|  hypothetical protein EUGRSUZ_C01785                     123   2e-26   
ref|XP_010670674.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   2e-26   
ref|XP_003603433.1|  Peptidyl-prolyl cis-trans isomerase                120   2e-26   
ref|XP_006578154.1|  PREDICTED: serine/arginine repetitive matrix...    117   2e-26   
gb|EPS68763.1|  hypothetical protein M569_06004                         123   2e-26   
ref|XP_008445168.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   3e-26   
gb|KGN62922.1|  hypothetical protein Csa_2G380020                       118   3e-26   
ref|XP_010670673.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   4e-26   
ref|XP_010670670.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   4e-26   
ref|XP_008445172.1|  PREDICTED: serine/arginine repetitive matrix...    122   8e-26   
ref|XP_004501307.1|  PREDICTED: serine/arginine repetitive matrix...    115   1e-25   
ref|XP_008445167.1|  PREDICTED: serine/arginine repetitive matrix...    122   1e-25   
ref|XP_004501306.1|  PREDICTED: serine/arginine repetitive matrix...    115   2e-25   
ref|XP_008445171.1|  PREDICTED: serine/arginine repetitive matrix...    121   3e-25   
ref|XP_010546569.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   4e-25   
ref|XP_008445166.1|  PREDICTED: serine/arginine repetitive matrix...    120   6e-25   
ref|XP_003526420.1|  PREDICTED: serine/arginine repetitive matrix...    117   6e-25   
gb|KHN07093.1|  Peptidyl-prolyl cis-trans isomerase D                   117   7e-25   
ref|XP_006581365.1|  PREDICTED: serine/arginine repetitive matrix...    117   7e-25   
ref|XP_004498656.1|  PREDICTED: serine/arginine repetitive matrix...    120   7e-25   
ref|XP_003523694.1|  PREDICTED: serine/arginine repetitive matrix...    117   1e-24   
ref|XP_007161232.1|  hypothetical protein PHAVU_001G053000g             117   1e-24   
ref|XP_004498655.1|  PREDICTED: serine/arginine repetitive matrix...    119   1e-24   
ref|XP_004164532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    115   1e-24   
gb|KHN08115.1|  Peptidyl-prolyl cis-trans isomerase D                   116   2e-24   
ref|XP_007161230.1|  hypothetical protein PHAVU_001G052800g             118   2e-24   
gb|ACJ83900.1|  unknown                                                 110   2e-24   Medicago truncatula
ref|XP_010110347.1|  Peptidyl-prolyl cis-trans isomerase 1              113   2e-24   
gb|AES73684.2|  peptidyl-prolyl cis-trans isomerase                     117   3e-24   
ref|XP_004501305.1|  PREDICTED: serine/arginine repetitive matrix...    115   5e-24   
ref|XP_007161231.1|  hypothetical protein PHAVU_001G052900g             115   2e-23   
ref|XP_006412476.1|  hypothetical protein EUTSA_v10024440mg             111   2e-23   
ref|XP_006283087.1|  hypothetical protein CARUB_v10004106mg             111   2e-23   
ref|XP_009345297.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   6e-23   
ref|XP_010325121.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    113   7e-23   
ref|XP_010447391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    110   2e-22   
ref|XP_008219899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-22   
ref|XP_007225294.1|  hypothetical protein PRUPE_ppa001326mg             108   3e-22   
ref|XP_010249988.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   3e-22   
ref|XP_010249986.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   4e-22   
ref|XP_010432719.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   6e-22   
ref|XP_010447392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    110   9e-22   
emb|CDX75243.1|  BnaA01g04590D                                          109   1e-21   
ref|XP_004291478.1|  PREDICTED: uncharacterized protein LOC101292865    109   2e-21   
ref|XP_008378304.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   2e-21   
ref|XP_008394051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   2e-21   
ref|XP_008394052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   2e-21   
emb|CDX68845.1|  BnaC01g06080D                                          109   2e-21   
ref|XP_002867244.1|  hypothetical protein ARALYDRAFT_491484             104   3e-21   
ref|XP_009126010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   3e-21   
ref|XP_009783542.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   4e-21   
ref|XP_008378303.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   4e-21   
ref|XP_010249989.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   5e-21   
ref|XP_009334770.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   8e-21   
ref|XP_009334769.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   8e-21   
ref|XP_009618668.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   3e-20   
ref|XP_010432722.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   3e-20   
gb|AAM13845.1|  unknown protein                                         105   4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437912.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   4e-20   
ref|NP_194968.2|  cyclophilin-like peptidyl-prolyl cis-trans isom...    105   4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006483323.1|  PREDICTED: serine/arginine repetitive matrix...    101   5e-19   
ref|XP_010648639.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   9e-19   
ref|XP_010048239.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   1e-18   
gb|KCW80437.1|  hypothetical protein EUGRSUZ_C01785                     100   2e-18   
ref|XP_007013818.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    100   2e-18   
ref|XP_011019779.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    2e-18   
ref|XP_010437913.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    4e-18   
ref|XP_004498658.1|  PREDICTED: serine/arginine repetitive matrix...  95.9    3e-17   
ref|XP_006581368.1|  PREDICTED: serine/arginine repetitive matrix...  95.1    5e-17   
gb|AAP44536.1|  cyclophilin-like protein                              90.9    1e-16   Triticum aestivum [Canadian hard winter wheat]
gb|EMS62524.1|  Peptidyl-prolyl cis-trans isomerase D                 90.5    2e-16   
ref|XP_008802283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    2e-16   
ref|XP_008802286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    2e-16   
ref|XP_006838913.1|  hypothetical protein AMTR_s00002p00269760        92.8    2e-16   
ref|XP_008802285.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    2e-16   
ref|XP_008802287.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    2e-16   
ref|XP_008802288.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    2e-16   
ref|XP_009419289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.0    3e-16   
ref|XP_009399354.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    3e-16   
ref|XP_009399355.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    3e-16   
dbj|BAJ87064.1|  predicted protein                                    92.4    3e-16   
ref|XP_010546571.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    3e-16   
ref|XP_010432721.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.7    4e-16   
gb|EEE66674.1|  hypothetical protein OsJ_23316                        91.7    5e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81610.1|  hypothetical protein OsI_25113                        91.7    6e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002459423.1|  hypothetical protein SORBIDRAFT_02g004430        88.2    7e-16   Sorghum bicolor [broomcorn]
ref|XP_010935780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.2    7e-16   
ref|XP_008445173.1|  PREDICTED: serine/arginine repetitive matrix...  91.3    8e-16   
ref|XP_003557489.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.4    8e-16   
ref|XP_004341067.1|  peptidylprolyl cis-trans isomerase, cyclophi...  87.0    8e-16   
ref|NP_001170592.1|  uncharacterized protein LOC100384625             88.2    9e-16   Zea mays [maize]
ref|XP_008668501.1|  PREDICTED: uncharacterized protein LOC100384...  88.2    9e-16   
tpg|DAA42558.1|  TPA: hypothetical protein ZEAMMB73_596682            87.8    9e-16   
ref|XP_009381127.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    1e-15   
ref|XP_008792090.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    1e-15   
gb|ACJ54182.1|  PPIase domain-containing protein                      86.3    1e-15   Nicotiana benthamiana
ref|XP_009388658.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.4    1e-15   
ref|XP_006657499.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    2e-15   
ref|XP_006657500.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    2e-15   
ref|XP_004955636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    2e-15   
ref|XP_004955639.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    2e-15   
ref|XP_010914920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    2e-15   
ref|XP_010228289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    2e-15   
ref|XP_007162476.1|  hypothetical protein PHAVU_001G155500g           89.0    3e-15   
ref|XP_008785212.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    3e-15   
ref|XP_008235347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.0    4e-15   
ref|XP_010249990.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.0    4e-15   
ref|XP_004162194.1|  PREDICTED: uncharacterized LOC101219904          89.0    4e-15   
ref|XP_008235346.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.0    4e-15   
ref|XP_008235345.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.0    4e-15   
ref|XP_008219901.1|  PREDICTED: putative uncharacterized protein ...  89.0    4e-15   
ref|XP_004146961.1|  PREDICTED: uncharacterized protein LOC101219904  89.0    4e-15   
ref|XP_008345159.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.2    5e-15   
ref|XP_008368672.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    5e-15   
tpg|DAA42555.1|  TPA: hypothetical protein ZEAMMB73_596682            85.5    7e-15   
ref|XP_003521263.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    7e-15   
ref|XP_007199724.1|  hypothetical protein PRUPE_ppa002435mg           88.2    8e-15   
gb|KHN10697.1|  Peptidyl-prolyl cis-trans isomerase                   87.4    9e-15   
ref|XP_008451290.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    9e-15   
emb|CBJ33426.1|  conserved unknown protein                            85.5    1e-14   
ref|XP_010274266.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    1e-14   
ref|XP_008355416.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    1e-14   
gb|KDO68610.1|  hypothetical protein CISIN_1g006162mg                 86.7    1e-14   
ref|XP_010274264.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    1e-14   
ref|XP_010274267.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    1e-14   
gb|KDO68609.1|  hypothetical protein CISIN_1g006162mg                 87.0    1e-14   
ref|XP_010274268.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    1e-14   
ref|XP_006443958.1|  hypothetical protein CICLE_v10019230mg           87.0    2e-14   
ref|XP_006443960.1|  hypothetical protein CICLE_v10019230mg           86.7    2e-14   
ref|NP_001190888.1|  cyclophilin-like peptidyl-prolyl cis-trans i...  87.4    2e-14   
gb|KDO68608.1|  hypothetical protein CISIN_1g006162mg                 86.7    2e-14   
ref|XP_006604472.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    2e-14   
ref|XP_006604469.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    2e-14   
ref|XP_006604471.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    2e-14   
ref|XP_006604473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    2e-14   
ref|XP_006443959.1|  hypothetical protein CICLE_v10019230mg           86.3    2e-14   
ref|XP_008366532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    2e-14   
ref|XP_008366534.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    2e-14   
ref|XP_008359381.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  84.0    3e-14   
ref|XP_008350049.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    3e-14   
ref|XP_009370747.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.5    3e-14   
ref|XP_010925250.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    4e-14   
ref|XP_010432723.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    4e-14   
ref|XP_009126026.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    4e-14   
ref|XP_010326423.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.3    4e-14   
tpg|DAA59762.1|  TPA: hypothetical protein ZEAMMB73_415877            82.0    5e-14   
dbj|BAJ98045.1|  predicted protein                                    84.7    6e-14   
emb|CDP03680.1|  unnamed protein product                              81.3    8e-14   
ref|XP_010437914.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.1    8e-14   
ref|XP_010038050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.0    8e-14   
ref|XP_010038051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.0    8e-14   
ref|XP_004493728.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.6    9e-14   
ref|XP_004493727.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.6    9e-14   
ref|NP_001119097.1|  cyclophilin-like peptidyl-prolyl cis-trans i...  84.3    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447393.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.3    1e-13   
gb|KDP21391.1|  hypothetical protein JCGZ_21862                       84.0    2e-13   
gb|KEH23833.1|  peptidyl-prolyl cis-trans isomerase                   82.8    2e-13   
ref|XP_008651149.1|  PREDICTED: uncharacterized protein LOC100274...  84.0    2e-13   
ref|XP_008651150.1|  PREDICTED: uncharacterized protein LOC100274...  84.0    2e-13   
ref|XP_008651151.1|  PREDICTED: uncharacterized protein LOC100274...  83.6    2e-13   
ref|XP_003739714.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  81.3    2e-13   
ref|XP_010679137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.4    2e-13   
ref|XP_010679138.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.4    2e-13   
ref|XP_010679140.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.4    2e-13   
ref|XP_010432724.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.6    3e-13   
ref|XP_007050461.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...  82.4    4e-13   
ref|XP_009798525.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  78.6    4e-13   
ref|XP_007050460.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...  82.8    4e-13   
ref|XP_004247203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.0    4e-13   
ref|XP_006349731.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  78.6    5e-13   
ref|XP_009798520.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  78.2    6e-13   
ref|XP_009798524.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  78.2    7e-13   
ref|XP_006647052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.0    7e-13   
ref|XP_006647053.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.0    8e-13   
gb|AJA29688.1|  peptidyl-prolyl cis-trans isomerase                   81.6    8e-13   
ref|XP_009601158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.8    8e-13   
ref|XP_009601160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.8    9e-13   
ref|XP_009014518.1|  hypothetical protein HELRODRAFT_156722           77.4    9e-13   
gb|EMT10283.1|  Peptidyl-prolyl cis-trans isomerase G                 80.9    1e-12   
gb|ACF87276.1|  unknown                                               75.9    1e-12   Zea mays [maize]
ref|XP_005646868.1|  hypothetical protein COCSUDRAFT_29609            78.2    1e-12   
emb|CDY52123.1|  BnaA10g29520D                                        77.4    1e-12   
ref|XP_011079927.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.7    1e-12   
ref|XP_006401051.1|  hypothetical protein EUTSA_v10014704mg           77.4    1e-12   
ref|XP_009120386.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    2e-12   
ref|XP_002280876.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.3    2e-12   Vitis vinifera
ref|XP_002864586.1|  hypothetical protein ARALYDRAFT_495994           77.4    2e-12   
ref|XP_010646137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.3    2e-12   
ref|XP_004992532.1|  peptidyl-prolyl cis-trans isomerase E            77.8    2e-12   
emb|CBK24925.2|  unnamed protein product                              76.6    2e-12   
ref|XP_006402278.1|  hypothetical protein EUTSA_v10006033mg           79.0    3e-12   
emb|CAD10797.1|  putative cyclophilin                                 75.9    3e-12   Pleurotus ostreatus [shimeji]
gb|KDQ25375.1|  hypothetical protein PLEOSDRAFT_186045                75.9    3e-12   
gb|KDD76228.1|  hypothetical protein H632_c307p0                      75.9    3e-12   
ref|XP_010443618.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  76.6    3e-12   
ref|XP_010483473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  76.6    3e-12   
ref|XP_006281118.1|  hypothetical protein CARUB_v10027149mg           76.3    3e-12   
ref|XP_002520955.1|  cyclophilin, putative                            79.7    4e-12   Ricinus communis
ref|XP_002437567.1|  hypothetical protein SORBIDRAFT_10g029480        76.3    4e-12   Sorghum bicolor [broomcorn]
emb|CAN75764.1|  hypothetical protein VITISV_034442                   78.2    4e-12   Vitis vinifera
ref|XP_010535384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  76.3    4e-12   
ref|WP_030289924.1|  MULTISPECIES: peptidylprolyl isomerase           75.5    4e-12   
ref|XP_006656475.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  76.3    4e-12   
ref|NP_200679.1|  cyclophilin ROC7                                    76.3    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|WP_033354731.1|  peptidylprolyl isomerase                         75.5    4e-12   
ref|NP_001149847.1|  peptidyl-prolyl cis-trans isomerase CYP19-4 ...  76.3    5e-12   Zea mays [maize]
gb|AFW69420.1|  putative peptidyl-prolyl cis-trans isomerase fami...  75.9    5e-12   
emb|CEG65765.1|  Putative Peptidyl-prolyl cis-trans isomerase         75.1    6e-12   
emb|CEI92562.1|  Putative Peptidyl-prolyl cis-trans isomerase         75.1    6e-12   
ref|XP_010234009.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.0    6e-12   
ref|XP_010262860.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  75.5    6e-12   
ref|XP_010234012.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.0    6e-12   
ref|XP_010234010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.0    6e-12   
ref|XP_010527617.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    7e-12   
ref|XP_010527620.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    7e-12   
ref|XP_010527615.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    8e-12   
ref|XP_010527616.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    8e-12   
ref|XP_001760224.1|  predicted protein                                75.1    8e-12   
ref|XP_010527619.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    8e-12   
ref|XP_010527621.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    8e-12   
ref|XP_010527622.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    8e-12   
ref|XP_010527624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    8e-12   
ref|XP_010227456.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  75.5    8e-12   
ref|XP_007791043.1|  putative peptidyl-prolyl cis-trans isomerase...  75.9    8e-12   
ref|XP_010527623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  77.4    8e-12   
ref|WP_031068741.1|  peptidylprolyl isomerase                         74.7    8e-12   
gb|EHJ71137.1|  peptidyl-prolyl cis-trans isomerase                   74.7    9e-12   
gb|EAZ02313.1|  hypothetical protein OsI_24414                        75.1    9e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_004966389.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  75.1    9e-12   
ref|NP_001058535.1|  Os06g0708500                                     75.1    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ38239.1|  hypothetical protein OsJ_22614                        75.1    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ06541.1|  cyclophilin                                           75.1    1e-11   Camellia oleifera [abura-tsubaki]
ref|XP_002273217.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  75.1    1e-11   Vitis vinifera
ref|XP_003293545.1|  hypothetical protein DICPUDRAFT_90286            74.7    1e-11   
ref|XP_004966388.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  75.1    1e-11   
gb|ABI33223.1|  cyclophilin                                           74.3    1e-11   
ref|XP_001780456.1|  predicted protein                                74.7    1e-11   
ref|XP_010454144.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  74.7    1e-11   
ref|XP_010413155.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  76.6    1e-11   
ref|XP_010413154.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  76.6    1e-11   
gb|EYU46533.1|  hypothetical protein MIMGU_mgv1a002319mg              76.6    1e-11   
ref|XP_009138664.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  73.9    1e-11   
emb|CDY53714.1|  BnaAnng12550D                                        73.9    1e-11   
dbj|BAD53621.1|  putative cyclophilin                                 74.7    1e-11   
ref|XP_009772522.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  73.9    1e-11   
gb|KFE63181.1|  Peptidyl-prolyl cis-trans isomerase                   73.9    2e-11   
ref|XP_008358961.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  74.3    2e-11   
ref|XP_954481.1|  cyclophilin 1                                       74.3    2e-11   
ref|XP_004500254.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  74.3    2e-11   
ref|XP_008384800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  74.3    2e-11   
gb|AAS75310.1|  multidomain cyclophilin type peptidyl-prolyl cis-...  75.9    2e-11   
ref|XP_009420416.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  73.9    2e-11   
ref|XP_002418204.1|  PPI-III, putative; PPIase, putative; cycloph...  73.9    2e-11   
dbj|BAH57223.1|  AT3G63400                                            75.9    2e-11   
ref|XP_010468852.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  75.9    2e-11   
ref|NP_191899.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...  75.9    2e-11   
ref|WP_030245535.1|  peptidylprolyl isomerase                         73.2    2e-11   
ref|XP_009132031.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  73.9    2e-11   
gb|AFN53672.1|  peptidyl-prolyl cis-trans isomerase                   73.9    2e-11   
emb|CDX71155.1|  BnaC03g12390D                                        73.9    2e-11   
ref|XP_010512756.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  75.9    2e-11   
emb|CDY61026.1|  BnaAnng17350D                                        73.6    2e-11   
ref|XP_001579633.1|  cytosolic cyclophilin                            73.6    2e-11   
ref|XP_006657326.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  73.9    2e-11   
ref|XP_004355130.1|  cyclophilin B                                    76.6    2e-11   
ref|XP_006290850.1|  hypothetical protein CARUB_v10016960mg           75.5    3e-11   
gb|EPB84551.1|  peptidyl-prolyl cis-trans isomerase cyp5              73.2    3e-11   
ref|WP_009102295.1|  (CYCLOPHILIN 5) peptidyl-prolyl cis-trans is...  73.6    3e-11   
ref|XP_008220814.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  73.2    3e-11   
ref|XP_010530499.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.4    3e-11   
ref|XP_001695474.1|  peptidyl-prolyl cis-trans isomerase, cycloph...  73.9    3e-11   
ref|NP_850740.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...  75.5    3e-11   
gb|EME38363.1|  hypothetical protein DOTSEDRAFT_140891                73.2    3e-11   
ref|NP_001040172.1|  peptidyl-prolyl cis-trans isomerase              73.6    3e-11   
emb|CDX93909.1|  BnaC04g20680D                                        72.8    3e-11   
gb|EEE56526.1|  hypothetical protein OsJ_05815                        76.6    3e-11   
gb|ACS71332.1|  cyclophilin                                           72.8    3e-11   
gb|EEC72707.1|  hypothetical protein OsI_06299                        77.0    3e-11   
gb|KDR71894.1|  hypothetical protein GALMADRAFT_143660                72.8    3e-11   
pdb|4EYV|A  Chain A, Crystal Structure Of Cyclophilin A Like Prot...  72.8    3e-11   
ref|XP_005835963.1|  hypothetical protein GUITHDRAFT_68153            73.2    3e-11   
gb|EPS61145.1|  hypothetical protein M569_13654                       75.5    3e-11   
ref|XP_007868587.1|  hypothetical protein GLOTRDRAFT_64039            73.2    3e-11   
ref|XP_003600890.1|  Peptidyl-prolyl cis-trans isomerase              73.6    3e-11   
ref|XP_007205916.1|  hypothetical protein PRUPE_ppa011595mg           73.2    3e-11   
gb|EPS66571.1|  peptidyl-prolyl cis-trans isomerase                   73.2    4e-11   
ref|XP_005787410.1|  peptidyl-prolyl isomerase                        73.6    4e-11   
ref|XP_008344818.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.4    4e-11   
gb|AEK80448.1|  peptidyl-prolyl cis-trans isomerase                   73.2    4e-11   
ref|XP_005763896.1|  peptidyl-prolyl isomerase                        73.6    4e-11   
emb|CDQ06054.1|  Protein Bm6689                                       73.2    4e-11   
ref|XP_001267257.1|  peptidyl-prolyl cis-trans isomerase (CypB), ...  72.8    4e-11   
ref|XP_003649239.1|  hypothetical protein THITE_2107700               73.2    4e-11   
ref|XP_005537667.1|  cyclophilin                                      72.4    4e-11   
dbj|GAA85269.1|  peptidyl-prolyl cis-trans isomerase Cpr7             72.4    4e-11   
ref|XP_001895426.1|  cyclophilin-type peptidyl-prolyl cis-trans i...  72.4    4e-11   
gb|AFK34845.1|  unknown                                               72.8    4e-11   
ref|XP_007876711.1|  hypothetical protein PFL1_01020                  74.3    5e-11   
ref|NP_001279398.1|  peptidyl-prolyl cis-trans isomerase-like         72.0    5e-11   
ref|XP_002302085.2|  hypothetical protein POPTR_0002s04800g           76.3    5e-11   
gb|EWC43628.1|  peptidyl-prolyl cis-trans isomerase                   72.4    5e-11   
emb|CDY55458.1|  BnaC04g54560D                                        72.8    5e-11   
ref|XP_009144343.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.8    5e-11   
ref|XP_011032623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  75.9    5e-11   
gb|KEZ39713.1|  Peptidyl-prolyl cis-trans isomerase B                 72.8    5e-11   
gb|ACO10800.1|  Peptidyl-prolyl cis-trans isomerase                   72.0    5e-11   
ref|XP_007915686.1|  putative peptidyl-prolyl cis-trans isomerase...  73.6    5e-11   
sp|Q2UGK2.1|PPIB_ASPOR  RecName: Full=Peptidyl-prolyl cis-trans i...  72.4    5e-11   
ref|NP_001280333.1|  peptidyl-prolyl cis-trans isomerase-like         72.0    5e-11   
gb|EDP50143.1|  peptidyl-prolyl cis-trans isomerase (CypB), putative  72.8    5e-11   
ref|XP_004294264.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.8    6e-11   
ref|XP_001911375.1|  hypothetical protein                             72.8    6e-11   
ref|XP_008044439.1|  cyclophilin                                      72.0    6e-11   
ref|XP_002411471.1|  peptidyl-prolyl cis-trans isomerase, putative    72.0    6e-11   
ref|XP_009623610.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.4    6e-11   
emb|CEI93754.1|  Putative Peptidyl-prolyl cis-trans isomerase         72.0    6e-11   
gb|AFK38441.1|  unknown                                               72.8    6e-11   
emb|CDJ57377.1|  20 kDa cyclophilin precursor, putative               72.0    6e-11   
gb|AIG55642.1|  secreted protein                                      72.4    6e-11   
ref|XP_010104628.1|  Peptidyl-prolyl cis-trans isomerase CYP19-4      72.4    6e-11   
emb|CAP69837.1|  cyclophilin                                          71.2    6e-11   
ref|XP_011026088.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  75.9    6e-11   
dbj|BAM18284.1|  peptidyl-prolyl cis-trans isomerase f, ppif          72.4    6e-11   
gb|KID77583.1|  peptidyl-prolyl cis-trans isomerase B precursor       73.2    6e-11   
gb|ABK20982.1|  unknown                                               72.4    7e-11   
ref|XP_002876720.1|  hypothetical protein ARALYDRAFT_324764           74.3    7e-11   
emb|CDK28333.1|  unnamed protein product                              72.4    7e-11   
gb|KEI39112.1|  hypothetical protein L969DRAFT_88566                  71.6    7e-11   
ref|XP_007394458.1|  hypothetical protein PHACADRAFT_194209           71.6    7e-11   
ref|XP_008719134.1|  peptidyl-prolyl cis-trans isomerase B            72.4    7e-11   
gb|EIT78368.1|  peptidyl-prolyl cis-trans isomerase                   72.4    7e-11   
gb|KFM27220.1|  Peptidyl-prolyl cis-trans isomerase CYP19-4           72.4    7e-11   
ref|XP_001225362.1|  hypothetical protein CHGG_07706                  72.4    7e-11   
gb|KDO68979.1|  hypothetical protein CISIN_1g027222mg                 72.4    7e-11   
ref|XP_006486319.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.4    7e-11   
ref|XP_646208.1|  cyclophilin B                                       72.0    8e-11   
gb|KFG85290.1|  peptidyl-prolyl cis-trans isomerase B precursor       72.4    8e-11   
gb|KDO68980.1|  hypothetical protein CISIN_1g027222mg                 72.0    8e-11   
ref|WP_002655272.1|  peptidylprolyl isomerase                         72.0    8e-11   
ref|XP_007298711.1|  cyclophilin                                      71.6    8e-11   
ref|XP_002878060.1|  hypothetical protein ARALYDRAFT_907041           72.0    8e-11   
ref|WP_008676017.1|  cyclophilin                                      72.0    8e-11   
emb|CEI93756.1|  Putative Peptidyl-prolyl cis-trans isomerase         71.6    8e-11   
ref|XP_010253898.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.4    8e-11   
ref|XP_011080792.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.0    8e-11   
emb|CAA22569.1|  putative protein                                     67.0    8e-11   
ref|WP_030062173.1|  MULTISPECIES: peptidylprolyl isomerase           71.6    8e-11   
gb|AHA61585.1|  cyclophilin                                           71.6    8e-11   
ref|XP_010253897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.4    8e-11   
ref|XP_008788633.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  71.6    9e-11   
gb|KGR21932.1|  peptidyl-prolyl cis-trans isomerase                   72.0    9e-11   
gb|KID63882.1|  peptidyl-prolyl cis-trans isomerase B precursor       72.8    9e-11   
gb|KGQ88796.1|  peptidyl-prolyl cis-trans isomerase                   72.0    9e-11   
gb|AFK10904.1|  peptidyl-prolyl cis-trans isomerase                   71.6    9e-11   
ref|XP_722595.1|  hypothetical protein CaO19.1552                     72.0    9e-11   
ref|XP_002881077.1|  cyclophilin                                      72.0    9e-11   
ref|XP_004358616.1|  farnesyl-diphosphate farnesyltransferase         74.3    9e-11   
ref|WP_030697934.1|  peptidylprolyl isomerase                         71.6    9e-11   
ref|WP_023422139.1|  Peptidyl-prolyl cis-trans isomerase              71.6    9e-11   
ref|NP_001236075.1|  uncharacterized protein LOC100305485 precursor   72.0    9e-11   
gb|EKD03448.1|  cyclophilin A                                         72.4    1e-10   
gb|EHK99826.1|  putative Peptidyl-prolyl cis-trans isomerase B        72.0    1e-10   
ref|XP_007677825.1|  hypothetical protein BAUCODRAFT_534780           71.6    1e-10   
ref|XP_004143158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.0    1e-10   
gb|KCW85440.1|  hypothetical protein EUGRSUZ_B02252                   71.2    1e-10   
ref|XP_006487732.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  71.6    1e-10   
ref|XP_010253899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  72.0    1e-10   
gb|EMS25727.1|  cyclophilin, peptidyl-prolyl cis-trans isomerase      71.2    1e-10   
gb|ABS30424.1|  cyclophilin-like protein                              71.6    1e-10   
ref|XP_002777383.1|  cyclophilin 1, putative                          70.5    1e-10   
gb|EMD35966.1|  hypothetical protein CERSUDRAFT_115914                71.6    1e-10   
ref|XP_008355066.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  71.6    1e-10   
gb|EPB90057.1|  peptidyl-prolyl cis-trans isomerase A1                71.2    1e-10   
gb|EKC36742.1|  Peptidyl-prolyl cis-trans isomerase H                 70.5    1e-10   
dbj|GAM18552.1|  hypothetical protein SAMD00019534_017270             71.6    1e-10   
gb|KDE05685.1|  peptidyl-prolyl cis-trans isomerase B                 71.6    1e-10   
ref|XP_007218550.1|  hypothetical protein PRUPE_ppa012857mg           70.9    1e-10   
ref|XP_009630738.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  71.6    1e-10   
ref|XP_752060.1|  peptidyl-prolyl cis-trans isomerase (CypB)          71.6    1e-10   
emb|CDH53798.1|  cyclophilin type peptidyl-prolyl cis-transisomerase  70.9    1e-10   
gb|EJT47273.1|  hypothetical protein A1Q1_03902                       71.2    1e-10   
gb|KDO68977.1|  hypothetical protein CISIN_1g027222mg                 71.6    1e-10   
ref|XP_006435733.1|  hypothetical protein CICLE_v10032673mg           71.6    1e-10   
ref|XP_002489919.1|  Peptidyl-prolyl cis-trans isomerase (cycloph...  71.6    1e-10   
gb|KID98291.1|  peptidyl-prolyl cis-trans isomerase B precursor       71.6    1e-10   
gb|AAP76508.1|  cyclophilin                                           71.6    1e-10   
ref|XP_003661719.1|  hypothetical protein MYCTH_2301478               71.6    1e-10   
gb|AFK44786.1|  unknown                                               71.2    1e-10   
ref|XP_006435732.1|  hypothetical protein CICLE_v10032673mg           71.6    1e-10   
ref|XP_002958739.1|  hypothetical protein VOLCADRAFT_84601            71.6    1e-10   
ref|XP_002306802.2|  hypothetical protein POPTR_0005s23730g           74.7    1e-10   
ref|XP_008079474.1|  Cyclophilin-like protein                         72.4    2e-10   
ref|XP_010322200.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  70.9    2e-10   
gb|KDO68978.1|  hypothetical protein CISIN_1g027222mg                 71.2    2e-10   
ref|XP_009266267.1|  Peptidyl-prolyl cis-trans isomerase              70.9    2e-10   
gb|AFK38976.1|  unknown                                               71.2    2e-10   
ref|XP_009059433.1|  hypothetical protein LOTGIDRAFT_150571           70.9    2e-10   
ref|XP_001391670.2|  peptidyl-prolyl cis-trans isomerase D            70.1    2e-10   
emb|CAK48962.1|  unnamed protein product                              70.1    2e-10   
gb|EHA24063.1|  hypothetical protein ASPNIDRAFT_53254                 70.1    2e-10   
ref|XP_002425817.1|  peptidyl-prolyl cis-trans isomerase, putative    71.2    2e-10   
ref|WP_031227280.1|  peptidylprolyl isomerase                         70.9    2e-10   
ref|XP_009347261.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  71.2    2e-10   
ref|XP_005101705.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  70.9    2e-10   
emb|CBN80102.1|  FKBP-type peptidyl-prolyl cis-trans isomerase 12     73.9    2e-10   
ref|XP_007366439.1|  hypothetical protein DICSQDRAFT_170765           71.2    2e-10   
ref|XP_002601271.1|  hypothetical protein BRAFLDRAFT_229322           70.5    2e-10   
gb|EMD34817.1|  hypothetical protein CERSUDRAFT_67221                 70.5    2e-10   
ref|XP_001273006.1|  peptidyl-prolyl cis-trans isomerase Cpr7, pu...  70.1    2e-10   
emb|CBI15954.3|  unnamed protein product                              70.9    2e-10   
ref|XP_001744863.1|  hypothetical protein                             72.4    2e-10   
ref|XP_009409921.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  71.2    2e-10   
ref|XP_009551256.1|  hypothetical protein HETIRDRAFT_411791           70.9    2e-10   
ref|XP_007874457.1|  hypothetical protein PNEG_02449                  70.5    2e-10   
ref|XP_010043430.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  70.9    2e-10   
ref|XP_002277763.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  70.9    2e-10   
ref|XP_002525647.1|  cyclophilin, putative                            70.9    2e-10   
ref|XP_007163542.1|  hypothetical protein PHAVU_001G243000g           71.2    2e-10   
ref|XP_002065596.1|  GK14585                                          70.5    2e-10   
gb|KDQ58264.1|  hypothetical protein JAAARDRAFT_69498                 70.5    2e-10   
ref|XP_009552281.1|  hypothetical protein HETIRDRAFT_481579           70.5    2e-10   
ref|XP_799104.3|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...  72.0    2e-10   
ref|XP_749340.1|  peptidyl-prolyl cis-trans isomerase Cpr7            70.1    2e-10   
ref|XP_002410318.1|  peptidyl-prolyl cis-trans isomerase, putative    70.5    2e-10   
gb|KEY76802.1|  peptidyl prolyl cis trans isomerase Cpr7              70.1    2e-10   
ref|XP_008369251.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  70.9    2e-10   
gb|AEE62903.1|  unknown                                               70.5    2e-10   
gb|KHG08655.1|  Peptidyl-prolyl cis-trans isomerase CYP20-1 -like...  70.9    2e-10   
emb|CCF50505.1|  probable CPR1-cyclophilin (peptidylprolyl isomer...  70.5    2e-10   
ref|XP_008792092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  73.9    2e-10   
ref|XP_002988391.1|  hypothetical protein SELMODRAFT_447339           70.9    2e-10   
ref|XP_007363549.1|  cyclophilin                                      70.1    2e-10   
gb|AAX34045.1|  Mal s 6 allergen                                      70.1    2e-10   
emb|CDP09190.1|  unnamed protein product                              70.9    2e-10   
ref|XP_007750603.1|  peptidyl-prolyl cis-trans isomerase B            70.9    2e-10   
gb|KDQ17265.1|  hypothetical protein BOTBODRAFT_30083                 70.1    2e-10   
gb|EDP53867.1|  peptidyl-prolyl cis-trans isomerase Cpr7, putative    70.1    2e-10   
ref|NP_001045717.1|  Os02g0121300                                     70.5    2e-10   
ref|NP_180557.1|  peptidyl-prolyl cis-trans isomerase CYP19-4         70.5    2e-10   
gb|EWM24217.1|  Cyclophilin-like peptidyl-prolyl cis-trans isomer...  71.6    3e-10   
ref|XP_002176676.1|  predicted protein                                70.5    3e-10   
ref|XP_009409920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  70.9    3e-10   
gb|AAB71401.1|  cyclophilin                                           70.5    3e-10   
emb|CDP07829.1|  unnamed protein product                              68.9    3e-10   
ref|WP_008658978.1|  (CYCLOPHILIN 5) peptidyl-prolyl cis-trans is...  70.5    3e-10   
ref|XP_002298312.1|  peptidyl-prolyl cis-trans isomerase family p...  70.5    3e-10   
emb|CDI79350.1|  20 kDa cyclophilin precursor, putative               70.1    3e-10   
ref|XP_001265771.1|  peptidyl-prolyl cis-trans isomerase Cpr7, pu...  69.7    3e-10   
ref|XP_006442714.1|  hypothetical protein CICLE_v10022535mg           70.1    3e-10   
emb|CDW88109.1|  peptidyl-prolyl cis-trans                            73.2    3e-10   
ref|WP_030009707.1|  peptidylprolyl isomerase                         70.1    3e-10   
dbj|GAA35649.2|  peptidyl-prolyl cis-trans isomerase H                69.7    3e-10   
ref|XP_002547075.1|  peptidyl-prolyl cis-trans isomerase              70.5    3e-10   
ref|XP_007823009.1|  peptidyl-prolyl cis-trans isomerase B precursor  70.5    3e-10   



>ref|XP_010325122.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Solanum lycopersicum]
Length=746

 Score =   150 bits (378),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 93/128 (73%), Gaps = 8/128 (6%)
 Frame = -1

Query  1482  MVGSSQVEADL-I*FSSMGASM-LLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSL  1309
             M  S QVEAD  +    +GAS+      FLS NDE PK+KHDS GLLSMAIADRD RGS+
Sbjct  1     MGESFQVEADFDLILCCLGASIHWYWTLFLSDNDESPKIKHDSQGLLSMAIADRDARGSI  60

Query  1308  FMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHEGRHK-  1132
             F +TF A HHLDRK VVFGKLV G EVLKKIE+VGNE GKPDVTVKI+NSGEL + + K 
Sbjct  61    FSITFQADHHLDRKCVVFGKLVDGLEVLKKIESVGNEEGKPDVTVKIINSGELPDDKRKL  120

Query  1131  -----GKH  1123
                  GKH
Sbjct  121   NKLKNGKH  128


 Score = 66.2 bits (160),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -1

Query  768  GKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHK-NNDLMQN  592
            GKH ++ K  +GN S  +EE EAV +H  K EA    E EE EFPKENG  + NN  M+ 
Sbjct  246  GKHKSMEKKTEGNHSPSLEEGEAVSLHHKK-EATDIFEGEEVEFPKENGERQSNNTKMEI  304

Query  591  KSDKSPVRQPDVVDNSPSKSRFTSI  517
            +SDK   RQPDVVD+ P KSR  SI
Sbjct  305  RSDKPVDRQPDVVDDHPGKSRSRSI  329


 Score = 26.9 bits (58),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSM  401
            SRSRS+SPKRT+++SM
Sbjct  324  SRSRSISPKRTMSRSM  339



>ref|XP_006364270.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Solanum tuberosum]
Length=751

 Score =   146 bits (369),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 93/133 (70%), Gaps = 8/133 (6%)
 Frame = -1

Query  1497  LEKVYMVGSSQVEADL-I*FSSMGASM-LLDICFLSYNDELPKLKHDSPGLLSMAIADRD  1324
             + K  M  S QV AD  +    +GAS+      FLS NDE PK+KHDS GLLSMAIADRD
Sbjct  1     MGKASMGESFQVGADFDLILRCLGASIHWYWTLFLSDNDESPKIKHDSQGLLSMAIADRD  60

Query  1323  IRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHE  1144
              RGS+F +TF A HHLDRK VVFGKL+ G EVLKKIE+VGNE GKPDVTVKI+N GEL +
Sbjct  61    ARGSIFSITFQADHHLDRKCVVFGKLIDGLEVLKKIESVGNEEGKPDVTVKIINCGELPD  120

Query  1143  GRHK------GKH  1123
              + K      GKH
Sbjct  121   DKRKLNKLKNGKH  133


 Score = 66.6 bits (161),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = -1

Query  771  DGKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHK-NNDLMQ  595
            +GKH ++ K  +GN S  +EE EAV +H  K EA    E EE EFPKENG  + NN  M+
Sbjct  250  EGKHKSMEKKTEGNHSPSLEEGEAVSLHHKK-EATDIFEGEEVEFPKENGERQSNNTKME  308

Query  594  NKSDKSPVRQPDVVDNSPSKSRFTSI  517
             +SDK   RQPDVVD+ P KSR  SI
Sbjct  309  IRSDKPVDRQPDVVDDHPGKSRSRSI  334


 Score = 26.9 bits (58),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSM  401
            SRSRS+SPKRT+++SM
Sbjct  329  SRSRSISPKRTMSRSM  344



>ref|XP_004245196.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Solanum lycopersicum]
Length=807

 Score =   136 bits (343),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PK+KHDS GLLSMAIADRD RGS+F +TF A HHLDRK VVFGKLV G EVLKKI
Sbjct  93    FPDESPKIKHDSQGLLSMAIADRDARGSIFSITFQADHHLDRKCVVFGKLVDGLEVLKKI  152

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VGNE GKPDVTVKI+NSGEL + + K
Sbjct  153   ESVGNEEGKPDVTVKIINSGELPDDKRK  180


 Score = 33.1 bits (74),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             GN+GESIYGGKFP
Sbjct  82    GNYGESIYGGKFP  94


 Score = 65.5 bits (158),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -1

Query  768  GKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHK-NNDLMQN  592
            GKH ++ K  +GN S  +EE EAV +H  K EA    E EE EFPKENG  + NN  M+ 
Sbjct  307  GKHKSMEKKTEGNHSPSLEEGEAVSLHHKK-EATDIFEGEEVEFPKENGERQSNNTKMEI  365

Query  591  KSDKSPVRQPDVVDNSPSKSRFTSI  517
            +SDK   RQPDVVD+ P KSR  SI
Sbjct  366  RSDKPVDRQPDVVDDHPGKSRSRSI  390


 Score = 26.9 bits (58),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSM  401
            SRSRS+SPKRT+++SM
Sbjct  385  SRSRSISPKRTMSRSM  400



>ref|XP_011084184.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084337.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
Length=784

 Score =   135 bits (341),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD  GLLSMAIADRD RGSLF +TF A HHLDRK++VFGKLV GHEVLKKI
Sbjct  96    FPDESPKLKHDGAGLLSMAIADRDERGSLFNITFKADHHLDRKNIVFGKLVDGHEVLKKI  155

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             EN G++ GKP VTVKIVNSGE H+ + KG
Sbjct  156   ENAGDDEGKPAVTVKIVNSGEAHDDKKKG  184


 Score = 33.5 bits (75),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             GN+GESIYGGKFP
Sbjct  85    GNYGESIYGGKFP  97


 Score = 51.2 bits (121),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = -1

Query  753  LGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQ--NKSDK  580
            L K  + N S  ++++E   ++  KG+     EREE EFP+ENG H+ ++ ++   +SD+
Sbjct  325  LKKTSEANHSPLLDKQENTQLNHKKGDVADVSEREEGEFPRENGNHRKSNGIEAGTESDR  384

Query  579  SPVRQPDVVDNSPSKSRFTSI  517
            S  R PDVVD  PSKSR  S+
Sbjct  385  SADRDPDVVD-VPSKSRSRSL  404


 Score = 38.1 bits (87),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPRSFSR  374
            SRSRSLSPKRT++KSMSISPR  +R
Sbjct  399  SRSRSLSPKRTISKSMSISPRGANR  423



>ref|XP_006364269.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Solanum tuberosum]
Length=807

 Score =   134 bits (338),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PK+KHDS GLLSMAIADRD RGS+F +TF A HHLDRK VVFGKL+ G EVLKKI
Sbjct  93    FPDESPKIKHDSQGLLSMAIADRDARGSIFSITFQADHHLDRKCVVFGKLIDGLEVLKKI  152

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VGNE GKPDVTVKI+N GEL + + K
Sbjct  153   ESVGNEEGKPDVTVKIINCGELPDDKRK  180


 Score = 32.7 bits (73),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             GN+GESIYGGKFP
Sbjct  82    GNYGESIYGGKFP  94


 Score = 65.9 bits (159),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = -1

Query  771  DGKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHK-NNDLMQ  595
            +GKH ++ K  +GN S  +EE EAV +H  K EA    E EE EFPKENG  + NN  M+
Sbjct  306  EGKHKSMEKKTEGNHSPSLEEGEAVSLHHKK-EATDIFEGEEVEFPKENGERQSNNTKME  364

Query  594  NKSDKSPVRQPDVVDNSPSKSRFTSI  517
             +SDK   RQPDVVD+ P KSR  SI
Sbjct  365  IRSDKPVDRQPDVVDDHPGKSRSRSI  390


 Score = 26.9 bits (58),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSM  401
            SRSRS+SPKRT+++SM
Sbjct  385  SRSRSISPKRTMSRSM  400



>ref|XP_011081940.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP95-like [Sesamum indicum]
Length=754

 Score =   135 bits (341),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSMAIADRD RGSLF VTF A   LDRK VVFG+LV GHEVLKKI
Sbjct  96    FPDESPKLKHDGPGLLSMAIADRDERGSLFSVTFKADRRLDRKCVVFGELVDGHEVLKKI  155

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             EN G+E GKP VTVKI+NSG+LH+ R K
Sbjct  156   ENAGDEEGKPSVTVKIINSGQLHDDRKK  183


 Score = 30.4 bits (67),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             GN+GESIY GKFP
Sbjct  85    GNYGESIYDGKFP  97


 Score = 47.8 bits (112),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  678  GEAMGSREREEDEFPKENGGHKNNDL-MQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            GEA+   EREE EFP ENG H++N + ++  SD+   RQPD+V++  SKSR  S+
Sbjct  327  GEAVDVSEREEGEFPAENGDHQSNGVGLEIGSDQRADRQPDLVEDRRSKSRSQSL  381


 Score = 28.1 bits (61),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRS+SLSP+R ++KS S SPR
Sbjct  376  SRSQSLSPRRAMSKSTSTSPR  396



>emb|CDP04788.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   135 bits (341),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSMAIADRD RGS F++TF A HHLDRK +VFGKLVHG+EVLKKI
Sbjct  93    FPDEPPKLKHDGPGLLSMAIADRDERGSQFILTFKADHHLDRKCIVFGKLVHGNEVLKKI  152

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             EN G+E G+P VTVKIVN GELH  + K
Sbjct  153   ENTGDEDGRPSVTVKIVNCGELHWDKRK  180


 Score = 30.4 bits (67),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             GN+GESIYG KFP
Sbjct  82    GNYGESIYGDKFP  94



>ref|XP_009783532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana sylvestris]
Length=799

 Score =   132 bits (331),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE+PKLKHD+ GLLSMAIADRD RGS+F +TF A HHLDRK +VFG L+ G EVLKKI
Sbjct  93    FPDEVPKLKHDAQGLLSMAIADRDARGSIFSITFQADHHLDRKCIVFGILIDGLEVLKKI  152

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VGNE GKPDVTVKI+N GEL + + K
Sbjct  153   ESVGNEEGKPDVTVKIINCGELPDYKRK  180


 Score = 33.1 bits (74),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             GN+GESIYGGKFP
Sbjct  82    GNYGESIYGGKFP  94


 Score = 60.1 bits (144),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = -1

Query  771  DGKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDL-MQ  595
            +GKH ++ K   GN S  +EE EAV +H  K EA    E EE + PKENG  ++N   ++
Sbjct  304  EGKHKSMEKKTVGNCSPSLEEGEAVSLHDKK-EATDIFEGEEADLPKENGERQSNHTKVE  362

Query  594  NKSDKSPVRQPDVVDNSPSKSRFTSI  517
            ++SDK   RQPDVVD+ P KSR  SI
Sbjct  363  DRSDKYVDRQPDVVDDHPCKSRSRSI  388


 Score = 26.9 bits (58),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSM  401
            SRSRS+SPKRT+++SM
Sbjct  383  SRSRSISPKRTMSRSM  398



>ref|XP_009783537.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana sylvestris]
Length=797

 Score =   132 bits (331),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE+PKLKHD+ GLLSMAIADRD RGS+F +TF A HHLDRK +VFG L+ G EVLKKI
Sbjct  93    FPDEVPKLKHDAQGLLSMAIADRDARGSIFSITFQADHHLDRKCIVFGILIDGLEVLKKI  152

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VGNE GKPDVTVKI+N GEL + + K
Sbjct  153   ESVGNEEGKPDVTVKIINCGELPDYKRK  180


 Score = 33.1 bits (74),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             GN+GESIYGGKFP
Sbjct  82    GNYGESIYGGKFP  94


 Score = 58.2 bits (139),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = -1

Query  771  DGKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDL-MQ  595
            +GKH ++ K   GN S  +EE EAV +H  K EA    E EE + PKENG  ++N   ++
Sbjct  304  EGKHKSMEKKTVGNCSPSLEEGEAVSLHDKK-EATDIFEGEEADLPKENGERQSNHTKVE  362

Query  594  NKSDKSPVRQPDVVDNSPSKSRFTS  520
            ++SDK   RQPDVVD+ P KSR  S
Sbjct  363  DRSDKYVDRQPDVVDDHPCKSRSIS  387


 Score = 24.6 bits (52),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSM  401
             +SRS+SPKRT+++SM
Sbjct  381  CKSRSISPKRTMSRSM  396



>ref|XP_009618666.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana tomentosiformis]
Length=799

 Score =   129 bits (324),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE+PKLKHD+ GLLSMAIADRD RGS+F +TF A HHLDRK +VFG L+ G EVLKKI
Sbjct  93    FPDEVPKLKHDAQGLLSMAIADRDARGSIFSITFQADHHLDRKCIVFGILIDGLEVLKKI  152

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VGNE GKP+VTVKI+N GEL + + K
Sbjct  153   ESVGNEEGKPNVTVKIINCGELPDYKRK  180


 Score = 33.5 bits (75),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             GN+GESIYGGKFP
Sbjct  82    GNYGESIYGGKFP  94


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -1

Query  771  DGKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDL-MQ  595
            +GKH ++ K  +GN+S  +EE EAV +H  K EA    E EE + PKENG  ++N   ++
Sbjct  307  EGKHKSMEKKTEGNRSPSLEEGEAVSLHDKK-EATDIFEGEEADLPKENGERQSNHTKVE  365

Query  594  NKSDKSPVRQPDVVDNSPSKSRFTSI  517
            ++SDK   RQPDVVD+ P KSR  SI
Sbjct  366  DRSDKYVDRQPDVVDDHPGKSRSRSI  391



>ref|XP_009618667.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana tomentosiformis]
Length=797

 Score =   129 bits (324),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE+PKLKHD+ GLLSMAIADRD RGS+F +TF A HHLDRK +VFG L+ G EVLKKI
Sbjct  93    FPDEVPKLKHDAQGLLSMAIADRDARGSIFSITFQADHHLDRKCIVFGILIDGLEVLKKI  152

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VGNE GKP+VTVKI+N GEL + + K
Sbjct  153   ESVGNEEGKPNVTVKIINCGELPDYKRK  180


 Score = 33.5 bits (75),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             GN+GESIYGGKFP
Sbjct  82    GNYGESIYGGKFP  94


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = -1

Query  771  DGKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDL-MQ  595
            +GKH ++ K  +GN+S  +EE EAV +H  K EA    E EE + PKENG  ++N   ++
Sbjct  307  EGKHKSMEKKTEGNRSPSLEEGEAVSLHDKK-EATDIFEGEEADLPKENGERQSNHTKVE  365

Query  594  NKSDKSPVRQPDVVDNSPSKSRFTS  520
            ++SDK   RQPDVVD+ P KSR  S
Sbjct  366  DRSDKYVDRQPDVVDDHPGKSRSIS  390



>ref|XP_011026473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
 ref|XP_011026474.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=795

 Score =   129 bits (323),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM+IADRD  GS F+VTF A HHLDRK VVFGKLV G +VLKKI
Sbjct  98    FPDESPKLKHDGPGLLSMSIADRDTLGSQFIVTFRANHHLDRKYVVFGKLVQGDKVLKKI  157

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G+P VTVKIVN GE  E + K
Sbjct  158   EDVGDEEGRPTVTVKIVNCGEFIEDKKK  185


 Score = 30.0 bits (66),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G FGESIYG KFP
Sbjct  87    GTFGESIYGDKFP  99



>ref|XP_011026475.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=794

 Score =   129 bits (323),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM+IADRD  GS F+VTF A HHLDRK VVFGKLV G +VLKKI
Sbjct  98    FPDESPKLKHDGPGLLSMSIADRDTLGSQFIVTFRANHHLDRKYVVFGKLVQGDKVLKKI  157

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G+P VTVKIVN GE  E + K
Sbjct  158   EDVGDEEGRPTVTVKIVNCGEFIEDKKK  185


 Score = 30.0 bits (66),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G FGESIYG KFP
Sbjct  87    GTFGESIYGDKFP  99



>ref|XP_011019775.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=816

 Score =   124 bits (312),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM+IADRD  GS F++TF A HHLDRK VVFGKLV G +VLK I
Sbjct  97    FPDESPKLKHDEPGLLSMSIADRDALGSQFIITFRANHHLDRKYVVFGKLVQGDKVLKNI  156

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G+P VTVKI+N GE  E + K
Sbjct  157   EDVGDEEGRPTVTVKIINCGEFIEDKKK  184


 Score = 32.7 bits (73),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G FGESIYGGKFP
Sbjct  86    GTFGESIYGGKFP  98


 Score = 38.5 bits (88),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  457  KLMSRSRSLSPKRTLNKSMSISPR  386
            KLMSRS+S+SPKRT +KSMSISPR
Sbjct  394  KLMSRSQSMSPKRTSSKSMSISPR  417


 Score = 38.1 bits (87),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 1/68 (1%)
 Frame = -1

Query  729  QSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVV  553
            QS  V E E   +   + E     E+E+ EFPKENG  ++N +  + KS  S  R+PD+ 
Sbjct  326  QSPVVLEEEVASLPCKRREEPDILEKEDGEFPKENGSRRSNGMEADAKSYGSEDREPDIR  385

Query  552  DNSPSKSR  529
            D+ P KSR
Sbjct  386  DDHPGKSR  393



>ref|XP_011019776.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=815

 Score =   124 bits (312),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM+IADRD  GS F++TF A HHLDRK VVFGKLV G +VLK I
Sbjct  97    FPDESPKLKHDEPGLLSMSIADRDALGSQFIITFRANHHLDRKYVVFGKLVQGDKVLKNI  156

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G+P VTVKI+N GE  E + K
Sbjct  157   EDVGDEEGRPTVTVKIINCGEFIEDKKK  184


 Score = 32.7 bits (73),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G FGESIYGGKFP
Sbjct  86    GTFGESIYGGKFP  98


 Score = 38.5 bits (88),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  457  KLMSRSRSLSPKRTLNKSMSISPR  386
            KLMSRS+S+SPKRT +KSMSISPR
Sbjct  394  KLMSRSQSMSPKRTSSKSMSISPR  417


 Score = 38.1 bits (87),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 1/68 (1%)
 Frame = -1

Query  729  QSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVV  553
            QS  V E E   +   + E     E+E+ EFPKENG  ++N +  + KS  S  R+PD+ 
Sbjct  326  QSPVVLEEEVASLPCKRREEPDILEKEDGEFPKENGSRRSNGMEADAKSYGSEDREPDIR  385

Query  552  DNSPSKSR  529
            D+ P KSR
Sbjct  386  DDHPGKSR  393



>ref|XP_011019778.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Populus euphratica]
Length=805

 Score =   124 bits (312),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM+IADRD  GS F++TF A HHLDRK VVFGKLV G +VLK I
Sbjct  97    FPDESPKLKHDEPGLLSMSIADRDALGSQFIITFRANHHLDRKYVVFGKLVQGDKVLKNI  156

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G+P VTVKI+N GE  E + K
Sbjct  157   EDVGDEEGRPTVTVKIINCGEFIEDKKK  184


 Score = 32.7 bits (73),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G FGESIYGGKFP
Sbjct  86    GTFGESIYGGKFP  98


 Score = 38.5 bits (88),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  457  KLMSRSRSLSPKRTLNKSMSISPR  386
            KLMSRS+S+SPKRT +KSMSISPR
Sbjct  394  KLMSRSQSMSPKRTSSKSMSISPR  417


 Score = 38.1 bits (87),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 1/68 (1%)
 Frame = -1

Query  729  QSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVV  553
            QS  V E E   +   + E     E+E+ EFPKENG  ++N +  + KS  S  R+PD+ 
Sbjct  326  QSPVVLEEEVASLPCKRREEPDILEKEDGEFPKENGSRRSNGMEADAKSYGSEDREPDIR  385

Query  552  DNSPSKSR  529
            D+ P KSR
Sbjct  386  DDHPGKSR  393



>ref|XP_011019777.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Populus euphratica]
Length=811

 Score =   124 bits (312),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM+IADRD  GS F++TF A HHLDRK VVFGKLV G +VLK I
Sbjct  97    FPDESPKLKHDEPGLLSMSIADRDALGSQFIITFRANHHLDRKYVVFGKLVQGDKVLKNI  156

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G+P VTVKI+N GE  E + K
Sbjct  157   EDVGDEEGRPTVTVKIINCGEFIEDKKK  184


 Score = 32.7 bits (73),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G FGESIYGGKFP
Sbjct  86    GTFGESIYGGKFP  98



>ref|XP_011019781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X6 [Populus euphratica]
Length=810

 Score =   124 bits (312),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM+IADRD  GS F++TF A HHLDRK VVFGKLV G +VLK I
Sbjct  97    FPDESPKLKHDEPGLLSMSIADRDALGSQFIITFRANHHLDRKYVVFGKLVQGDKVLKNI  156

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G+P VTVKI+N GE  E + K
Sbjct  157   EDVGDEEGRPTVTVKIINCGEFIEDKKK  184


 Score = 32.7 bits (73),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G FGESIYGGKFP
Sbjct  86    GTFGESIYGGKFP  98



>ref|XP_006382072.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
 gb|ERP59869.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
Length=842

 Score =   123 bits (309),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM+IADRD  GS F++TF A HHLDRK V FGKLV G +VLK I
Sbjct  114   FPDESPKLKHDEPGLLSMSIADRDALGSQFIITFRANHHLDRKYVAFGKLVQGDKVLKNI  173

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G+P VTVKI+N GE  E + K
Sbjct  174   EDVGDEEGRPTVTVKIINCGEFIEDKKK  201


 Score = 32.7 bits (73),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G FGESIYGGKFP
Sbjct  103   GTFGESIYGGKFP  115


 Score = 39.3 bits (90),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = -1

Query  729  QSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDL-MQNKSDKSPVRQPDVV  553
            QS  V E E   +   K E     E+E+ EFPKENG  ++N +    KS  S  R+PD+ 
Sbjct  343  QSPVVLEEEVASLPCKKREEPDILEKEDGEFPKENGSRRSNGMGADAKSYGSEDREPDIR  402

Query  552  DNSPSKSRFTSI  517
            D+ P KSR  S+
Sbjct  403  DDHPVKSRSQSM  414


 Score = 33.1 bits (74),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -3

Query  454  LMSRSRSLSPKRTLNKSMSISPR  386
            + SRS+S+SPKRT +KSMSISPR
Sbjct  407  VKSRSQSMSPKRTTSKSMSISPR  429



>ref|XP_002324283.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
 gb|EEF02848.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
Length=819

 Score =   125 bits (315),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM+IADRD  GS F+VTF A HHLDRK VVFGKLV G +VLK I
Sbjct  98    FPDESPKLKHDGPGLLSMSIADRDALGSQFIVTFRANHHLDRKYVVFGKLVQGDKVLKNI  157

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G+P VTVKIVN GE  E + K
Sbjct  158   EDVGDEEGRPTVTVKIVNCGEFIEDKKK  185


 Score = 30.4 bits (67),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G FGESIYG KFP
Sbjct  87    GTFGESIYGDKFP  99



>gb|EYU29231.1| hypothetical protein MIMGU_mgv1a002140mg [Erythranthe guttata]
Length=709

 Score =   130 bits (328),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKL+H+ PGLLSMAIADRD RGSLF +TF+A HHLDRK++VFGKLV G EVLKKI
Sbjct  96    FPDEYPKLRHNGPGLLSMAIADRDQRGSLFSITFDAEHHLDRKNIVFGKLVEGDEVLKKI  155

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G+E G+P V VKIVNSGE+H+
Sbjct  156   ENAGDEEGRPAVIVKIVNSGEIHD  179



>gb|EYU29229.1| hypothetical protein MIMGU_mgv1a002072mg [Erythranthe guttata]
Length=635

 Score =   129 bits (324),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             +++E PKLKHDSPGLLSMAIADR  RGSLF +TF A H+LDRK++VFGKLV G EVLKKI
Sbjct  13    FSEESPKLKHDSPGLLSMAIADRGERGSLFSITFEADHNLDRKNIVFGKLVEGEEVLKKI  72

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             EN G++ G+P V VKIVNSGE+++  HKG
Sbjct  73    ENAGDKEGRPVVLVKIVNSGEINDDAHKG  101



>ref|XP_010648638.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Vitis vinifera]
Length=795

 Score =   125 bits (313),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM++ADRD  GS F+VTF+A HHLDRK VVFGKLV GHEVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMSVADRDTVGSQFIVTFSANHHLDRKYVVFGKLVQGHEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G P  TVKI+  GE+ E + K
Sbjct  154   ESVGDEEGIPTATVKIIYCGEIPEEKRK  181


 Score = 28.5 bits (62),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G+ GESIYGGKFP
Sbjct  83    GSGGESIYGGKFP  95


 Score = 65.5 bits (158),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = -1

Query  768  GKHTNLGKIPD--GNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQ  595
            G   N  K P   GN S  VE+REAV     KGE     E+EE E PKENG  ++N + +
Sbjct  323  GPDCNPKKPPQLIGNGSPVVEDREAVSTRHKKGEVADVLEKEEGESPKENGDRRSNGIEE  382

Query  594  NKSDKSPVRQPDVVDNSPSKSRFTSI  517
             KSD+S  RQPDVVD+ P KSR  S+
Sbjct  383  VKSDRSAERQPDVVDDHPGKSRSRSM  408


 Score = 36.2 bits (82),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRT++KSMSISPR
Sbjct  403  SRSRSMSPKRTMSKSMSISPR  423



>ref|XP_002285000.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
 ref|XP_010648637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
Length=796

 Score =   125 bits (313),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM++ADRD  GS F+VTF+A HHLDRK VVFGKLV GHEVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMSVADRDTVGSQFIVTFSANHHLDRKYVVFGKLVQGHEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G P  TVKI+  GE+ E + K
Sbjct  154   ESVGDEEGIPTATVKIIYCGEIPEEKRK  181


 Score = 28.5 bits (62),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G+ GESIYGGKFP
Sbjct  83    GSGGESIYGGKFP  95


 Score = 65.1 bits (157),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  735  GNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQNKSDKSPVRQPDV  556
            GN S  VE+REAV     KGE     E+EE E PKENG  ++N + + KSD+S  RQPDV
Sbjct  337  GNGSPVVEDREAVSTRHKKGEVADVLEKEEGESPKENGDRRSNGIEEVKSDRSAERQPDV  396

Query  555  VDNSPSKSRFTSI  517
            VD+ P KSR  S+
Sbjct  397  VDDHPGKSRSRSM  409


 Score = 36.2 bits (82),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRT++KSMSISPR
Sbjct  404  SRSRSMSPKRTMSKSMSISPR  424



>gb|EYU29230.1| hypothetical protein MIMGU_mgv1a002072mg [Erythranthe guttata]
Length=719

 Score =   126 bits (317),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + +E PKLKHDSPGLLSMAIADR  RGSLF +TF A H+LDRK++VFGKLV G EVLKKI
Sbjct  97    FPEESPKLKHDSPGLLSMAIADRGERGSLFSITFEADHNLDRKNIVFGKLVEGEEVLKKI  156

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             EN G++ G+P V VKIVNSGE+++  HKG
Sbjct  157   ENAGDKEGRPVVLVKIVNSGEINDDAHKG  185


 Score = 26.6 bits (57),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  86    GKHGESIYGGKFP  98



>gb|KHG30308.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=196

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSMAIADRD  GS F++TF A H LDRK +VFG+L+ G+EVLKKI
Sbjct  91    FPDESPRLKHDGPGLLSMAIADRDTVGSQFVITFKANHDLDRKYIVFGQLIQGNEVLKKI  150

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKGK  1126
             ENVG+E G P VTVKI+N GE+ E + K K
Sbjct  151   ENVGDEEGIPTVTVKIINCGEVIEDKRKNK  180



>ref|XP_006450486.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63726.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=792

 Score =   126 bits (317),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM+IADRD  GS F++TF A H LDRK VVFG+LV GHE+LKKI
Sbjct  94    FPDESPRLKHDRPGLLSMSIADRDTLGSQFIITFKANHSLDRKYVVFGELVQGHEILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             ENVG+E G+  VTVKI+N GE+ E + KG
Sbjct  154   ENVGDEEGRLTVTVKIINCGEVSEDKKKG  182


 Score = 25.4 bits (54),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIY GKFP
Sbjct  83    GTSGESIYEGKFP  95


 Score = 37.0 bits (84),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRTL+KSMSISPR
Sbjct  397  SRSRSMSPKRTLSKSMSISPR  417


 Score = 36.6 bits (83),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (54%), Gaps = 8/56 (14%)
 Frame = -1

Query  660  REREEDEF--------PKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            R+RE+D F        P+ENG  ++N +          RQPDVVD+ P KSR  S+
Sbjct  347  RKREDDMFEKEEGEETPRENGEQRSNGIQAGAKSVRSDRQPDVVDDHPGKSRSRSM  402



>ref|XP_006483322.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Citrus sinensis]
Length=792

 Score =   126 bits (317),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM+IADRD  GS F++TF A H LDRK VVFG+LV GHE+LKKI
Sbjct  94    FPDESPRLKHDRPGLLSMSIADRDTLGSQFIITFKANHSLDRKYVVFGELVQGHEILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             ENVG+E G+  VTVKI+N GE+ E + KG
Sbjct  154   ENVGDEEGRLTVTVKIINCGEVSEDKKKG  182


 Score = 25.4 bits (54),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIY GKFP
Sbjct  83    GTSGESIYEGKFP  95


 Score = 37.4 bits (85),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (54%), Gaps = 8/56 (14%)
 Frame = -1

Query  660  REREEDEF--------PKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            R+RE+D F        PKENG  ++N +          RQPDVVD+ P KSR  S+
Sbjct  347  RKREDDMFEKEEGEETPKENGEQRSNGIQAGAKSVRSDRQPDVVDDHPGKSRSRSM  402


 Score = 37.0 bits (84),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRTL+KSMSISPR
Sbjct  397  SRSRSMSPKRTLSKSMSISPR  417



>ref|XP_006450487.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 ref|XP_006450488.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63727.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63728.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=801

 Score =   126 bits (316),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM+IADRD  GS F++TF A H LDRK VVFG+LV GHE+LKKI
Sbjct  94    FPDESPRLKHDRPGLLSMSIADRDTLGSQFIITFKANHSLDRKYVVFGELVQGHEILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             ENVG+E G+  VTVKI+N GE+ E + KG
Sbjct  154   ENVGDEEGRLTVTVKIINCGEVSEDKKKG  182


 Score = 25.4 bits (54),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIY GKFP
Sbjct  83    GTSGESIYEGKFP  95


 Score = 37.0 bits (84),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRTL+KSMSISPR
Sbjct  406  SRSRSMSPKRTLSKSMSISPR  426


 Score = 36.6 bits (83),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (54%), Gaps = 8/56 (14%)
 Frame = -1

Query  660  REREEDEF--------PKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            R+RE+D F        P+ENG  ++N +          RQPDVVD+ P KSR  S+
Sbjct  356  RKREDDMFEKEEGEETPRENGEQRSNGIQAGAKSVRSDRQPDVVDDHPGKSRSRSM  411



>emb|CAN80313.1| hypothetical protein VITISV_020758 [Vitis vinifera]
Length=728

 Score =   123 bits (309),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM++ADRD  GS F+VTF+A HHLDRK VVFGKLV GHEVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMSVADRDTVGSQFIVTFSANHHLDRKYVVFGKLVQGHEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G P  TVKI+  GE+ E + K
Sbjct  154   ESVGDEEGIPTATVKIIYCGEIPEEKRK  181


 Score = 28.1 bits (61),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G+ GESIYGGKFP
Sbjct  83    GSGGESIYGGKFP  95


 Score = 65.5 bits (158),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  735  GNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQNKSDKSPVRQPDV  556
            GN S  VE+REAV     KGE     E+EE E PKENG  ++N + + KSD+S  RQPDV
Sbjct  360  GNGSPVVEDREAVSTRHKKGEVADVLEKEEGESPKENGDRRSNGIEEVKSDRSAERQPDV  419

Query  555  VDNSPSKSRFTSI  517
            VD+ P KSR  S+
Sbjct  420  VDDHPGKSRSRSM  432


 Score = 36.2 bits (82),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRT++KSMSISPR
Sbjct  427  SRSRSMSPKRTMSKSMSISPR  447



>ref|XP_006483320.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483321.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO61676.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61677.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61678.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
Length=801

 Score =   126 bits (316),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM+IADRD  GS F++TF A H LDRK VVFG+LV GHE+LKKI
Sbjct  94    FPDESPRLKHDRPGLLSMSIADRDTLGSQFIITFKANHSLDRKYVVFGELVQGHEILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             ENVG+E G+  VTVKI+N GE+ E + KG
Sbjct  154   ENVGDEEGRLTVTVKIINCGEVSEDKKKG  182


 Score = 25.4 bits (54),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIY GKFP
Sbjct  83    GTSGESIYEGKFP  95


 Score = 37.4 bits (85),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (54%), Gaps = 8/56 (14%)
 Frame = -1

Query  660  REREEDEF--------PKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            R+RE+D F        PKENG  ++N +          RQPDVVD+ P KSR  S+
Sbjct  356  RKREDDMFEKEEGEETPKENGEQRSNGIQAGAKSVRSDRQPDVVDDHPGKSRSRSM  411


 Score = 37.0 bits (84),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRTL+KSMSISPR
Sbjct  406  SRSRSMSPKRTLSKSMSISPR  426



>gb|KDP33623.1| hypothetical protein JCGZ_07194 [Jatropha curcas]
Length=789

 Score =   125 bits (315),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +LKHDSPGLLSM IADR+  GS F++TF A HHLDRK VVFGKLV G EVLKKI
Sbjct  94    FPDETSRLKHDSPGLLSMPIADRETLGSQFIITFKANHHLDRKYVVFGKLVQGDEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKGK  1126
             E+ G+E G+P VTVKI+NSGE  EG  K K
Sbjct  154   ESAGDEEGRPMVTVKIINSGEFKEGADKKK  183


 Score = 25.8 bits (55),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTGGESIYGDKFP  95


 Score = 42.7 bits (99),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -1

Query  654  REEDEFPKENGGHKNNDLMQNK-SDKSPVRQPDVVDNSPSKSRFTSI  517
            +E+   PKENGG ++N +  +  SD+S  RQPDVVD+ P KSR  SI
Sbjct  367  KEDGRSPKENGGRRSNGIGADATSDRSEDRQPDVVDDHPGKSRSRSI  413


 Score = 36.6 bits (83),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 50/95 (53%), Gaps = 21/95 (22%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISP-------------RSFSRNQSDsprrsvsrsasvnasprr  308
            SRSRS+SPKRT++KSMSISP             RS SR+ S         S S     RR
Sbjct  408  SRSRSISPKRTMSKSMSISPRRAMSKSPSVGLKRSMSRSHS--------ASRSPPRVSRR  459

Query  307  vsdrssspvkRGNRNPTRSVSGSPATGKRGRSVSE  203
             S   S      +R+P RSVS SP  GK+ RS+S+
Sbjct  460  RSFSKSPARSGSSRSPARSVSRSPIRGKKARSISK  494



>gb|KHG19968.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=702

 Score =   125 bits (314),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSMAIADRD  GS F++TF A H LDRK +VFG+L+ G+EVLKKI
Sbjct  94    FPDESPRLKHDGPGLLSMAIADRDTVGSQFVITFKANHDLDRKYIVFGQLIQGNEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKGK  1126
             ENVG+E G P VTVKI+N GE+ E + K K
Sbjct  154   ENVGDEEGIPTVTVKIINCGEVIEDKRKNK  183


 Score = 25.4 bits (54),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIY GKFP
Sbjct  83    GTSGESIYDGKFP  95



>ref|XP_010048237.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Eucalyptus grandis]
 gb|KCW80434.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80435.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=796

 Score =   124 bits (312),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM +ADRD  GS F++TF A HHLDRKSVVFGKLV G EVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMLVADRDALGSHFLITFKADHHLDRKSVVFGKLVQGLEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G++ G+P VTVKI+N GE  E
Sbjct  154   ENAGDDEGRPTVTVKIINCGEFSE  177


 Score = 25.4 bits (54),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTSGESIYGEKFP  95



>ref|XP_010048238.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X4 [Eucalyptus grandis]
Length=794

 Score =   124 bits (312),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM +ADRD  GS F++TF A HHLDRKSVVFGKLV G EVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMLVADRDALGSHFLITFKADHHLDRKSVVFGKLVQGLEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G++ G+P VTVKI+N GE  E
Sbjct  154   ENAGDDEGRPTVTVKIINCGEFSE  177


 Score = 25.4 bits (54),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTSGESIYGEKFP  95



>ref|XP_007013817.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 ref|XP_007013819.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31438.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
Length=843

 Score =   124 bits (311),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSMAIADRD  GS F++TF A H+LDRK VVFGKLV GHEVLKKI
Sbjct  94    FPDESPRLKHDGPGLLSMAIADRDTVGSQFIITFKANHNLDRKYVVFGKLVQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             ENVG+E G   VTVKI+N GE+ E
Sbjct  154   ENVGDEEGILTVTVKIINCGEVGE  177


 Score = 25.8 bits (55),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIY GKFP
Sbjct  83    GTSGESIYDGKFP  95


 Score = 47.0 bits (110),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -1

Query  651  EEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVVDNSPSKSRFTSI  517
            +E E PKENGG ++N + ++ +SD+S  RQPDVVD+ PSKSR  S+
Sbjct  362  KEHEAPKENGGRRSNGIEEDAQSDRSADRQPDVVDDRPSKSRSRSM  407


 Score = 29.3 bits (64),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSI  395
            SRSRS+SPKR ++KSMSI
Sbjct  402  SRSRSMSPKRAMSKSMSI  419



>ref|XP_010048233.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048234.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048235.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 gb|KCW80436.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=799

 Score =   124 bits (312),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM +ADRD  GS F++TF A HHLDRKSVVFGKLV G EVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMLVADRDALGSHFLITFKADHHLDRKSVVFGKLVQGLEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G++ G+P VTVKI+N GE  E
Sbjct  154   ENAGDDEGRPTVTVKIINCGEFSE  177


 Score = 25.4 bits (54),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTSGESIYGEKFP  95



>ref|XP_010048236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Eucalyptus grandis]
Length=797

 Score =   124 bits (312),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM +ADRD  GS F++TF A HHLDRKSVVFGKLV G EVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMLVADRDALGSHFLITFKADHHLDRKSVVFGKLVQGLEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G++ G+P VTVKI+N GE  E
Sbjct  154   ENAGDDEGRPTVTVKIINCGEFSE  177


 Score = 25.4 bits (54),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTSGESIYGEKFP  95



>ref|XP_007013820.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
 gb|EOY31439.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
Length=858

 Score =   124 bits (311),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSMAIADRD  GS F++TF A H+LDRK VVFGKLV GHEVLKKI
Sbjct  109   FPDESPRLKHDGPGLLSMAIADRDTVGSQFIITFKANHNLDRKYVVFGKLVQGHEVLKKI  168

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             ENVG+E G   VTVKI+N GE+ E
Sbjct  169   ENVGDEEGILTVTVKIINCGEVGE  192


 Score = 25.8 bits (55),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIY GKFP
Sbjct  98    GTSGESIYDGKFP  110


 Score = 47.0 bits (110),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -1

Query  651  EEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVVDNSPSKSRFTSI  517
            +E E PKENGG ++N + ++ +SD+S  RQPDVVD+ PSKSR  S+
Sbjct  377  KEHEAPKENGGRRSNGIEEDAQSDRSADRQPDVVDDRPSKSRSRSM  422


 Score = 29.6 bits (65),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSI  395
            SRSRS+SPKR ++KSMSI
Sbjct  417  SRSRSMSPKRAMSKSMSI  434



>ref|XP_002515550.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
 gb|EEF46999.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
Length=729

 Score =   125 bits (315),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHDSPGLL+MA+ADRD  GS F++TF A HHLDRK V FGKLV G EVLKKI
Sbjct  98    FPDESPRLKHDSPGLLTMAVADRDTLGSQFIITFKANHHLDRKYVAFGKLVQGDEVLKKI  157

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+ G+E G+P VTVKI+N GE  +G  K
Sbjct  158   ESAGDEEGRPMVTVKIINCGEFKDGTDK  185



>gb|AES58972.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=772

 Score =   126 bits (316),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  1404  FLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVL  1225
             +  + DE P+LKHDSPGLLSMAIADRD  GS F++T  A HHLDRK VVFGKLV G+++L
Sbjct  90    YPKFPDESPRLKHDSPGLLSMAIADRDTLGSHFIITLKADHHLDRKHVVFGKLVQGYDIL  149

Query  1224  KKIENVGNEVGKPDVTVKIVNSGELHE  1144
             KKIE+VGNE G P VTVKI+NSGE +E
Sbjct  150   KKIEDVGNEEGLPTVTVKIINSGEHNE  176


 Score = 44.3 bits (103),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = -1

Query  729  QSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVV  553
            QS  V E+E  P++  K + +G    +E+E PKENG   +N +  N + D+S  RQ DV+
Sbjct  339  QSSSVLEKELPPLNHKKRDGVG--MLDEEELPKENGAQPSNGIRANYRPDRSEERQHDVM  396

Query  552  DNSPSKSRFTSI  517
            D++P KSR  S+
Sbjct  397  DDNPGKSRSRSM  408


 Score = 38.1 bits (87),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 2/100 (2%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPRSFSRNQSDsprrsvsrsasvnas--prrvsdrssspvkR  275
            SRSRS+SPK+T++KSMSISP+   ++ S SP+R  SRS S + S         S SPV+ 
Sbjct  403  SRSRSMSPKQTVSKSMSISPKCVCKSPSISPKRRFSRSPSGSKSPRAPSQRSLSRSPVRS  462

Query  274  GNRNPTRSVSGSPATGKRGRSVSESPSPITNFRKGRNRSP  155
             +R+  R+VS SP  G++GRS+S SP   T+  K  ++SP
Sbjct  463  ISRSLNRNVSRSPVRGRKGRSISRSPMRTTHIHKSVSKSP  502



>emb|CBI21007.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   121 bits (304),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM++ADRD  GS F+VTF+A HHLDRK VVFGKLV GHEVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMSVADRDTVGSQFIVTFSANHHLDRKYVVFGKLVQGHEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E+VG+E G P  TVKI+  GE+ E + K
Sbjct  154   ESVGDEEGIPTATVKIIYCGEIPEEKRK  181


 Score = 28.1 bits (61),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G+ GESIYGGKFP
Sbjct  83    GSGGESIYGGKFP  95


 Score = 66.6 bits (161),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  735  GNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQNKSDKSPVRQPDV  556
            GN S  VE+REAV     KGE     E+EE E PKENG  ++N + + KSD+S  RQPDV
Sbjct  337  GNGSPVVEDREAVSTRHKKGEVADVLEKEEGESPKENGDRRSNGIEEVKSDRSAERQPDV  396

Query  555  VDNSPSKSRFTSI  517
            VD+ P KSR  S+
Sbjct  397  VDDHPGKSRSRSM  409


 Score = 37.0 bits (84),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRT++KSMSISPR
Sbjct  404  SRSRSMSPKRTMSKSMSISPR  424



>gb|KHN05982.1| E3 SUMO-protein ligase RanBP2 [Glycine soja]
Length=841

 Score =   120 bits (302),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSMA+ADRD+ GS F +TF A  HLDRK VVFGKLV GH+VLKKI
Sbjct  56    FPDESPRLKHDGPGLLSMAVADRDMLGSHFTLTFKADPHLDRKHVVFGKLVQGHDVLKKI  115

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG+E G P VTVKI+N GE +E
Sbjct  116   EEVGDEEGLPSVTVKIINCGEHNE  139


 Score = 28.9 bits (63),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 2/19 (11%)
 Frame = -3

Query  1522  VICCFTGNFGESIYGGKFP  1466
              +C  TG  GESIYG KFP
Sbjct  41    ALC--TGTGGESIYGSKFP  57



>ref|XP_004138866.1| PREDICTED: uncharacterized protein LOC101210345 [Cucumis sativus]
Length=774

 Score =   120 bits (300),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DELP+LKHD PGLLSMAIADRD  GS F++TF A +HLDRK +VFGKLV G +VLKK+
Sbjct  94    FPDELPRLKHDGPGLLSMAIADRDTLGSHFLITFKANNHLDRKHLVFGKLVQGFDVLKKM  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRH  1135
             E V  E G P VTVKIVN GE +EG++
Sbjct  154   ERVDVEDGIPTVTVKIVNCGEFNEGKN  180


 Score = 29.6 bits (65),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTVGESIYGGKFP  95



>gb|KCW80440.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80441.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=695

 Score =   124 bits (311),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM +ADRD  GS F++TF A HHLDRKSVVFGKLV G EVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMLVADRDALGSHFLITFKADHHLDRKSVVFGKLVQGLEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G++ G+P VTVKI+N GE  E
Sbjct  154   ENAGDDEGRPTVTVKIINCGEFSE  177


 Score = 25.4 bits (54),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTSGESIYGEKFP  95



>ref|XP_006581366.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X4 [Glycine max]
 ref|XP_006581367.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X5 [Glycine max]
Length=785

 Score =   118 bits (295),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD+ GLLSMAIADRD  GS F++T  A HHLDRK VVFGKLV GH VLKKI
Sbjct  29    FPDESPRLKHDATGLLSMAIADRDTLGSHFIITLKADHHLDRKHVVFGKLVQGHNVLKKI  88

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E  G+E G P VTVKI+N GE  E
Sbjct  89    EEFGDEEGHPTVTVKIINCGEYSE  112


 Score = 31.6 bits (70),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKFP  1466
             + C  G  GESIYG KFP
Sbjct  13    VSCDNGTAGESIYGSKFP  30



>gb|KCW80439.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=614

 Score =   123 bits (309),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSM +ADRD  GS F++TF A HHLDRKSVVFGKLV G EVLK+I
Sbjct  94    FPDESPRLKHDGPGLLSMLVADRDALGSHFLITFKADHHLDRKSVVFGKLVQGLEVLKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             EN G++ G+P VTVKI+N GE  E + + 
Sbjct  154   ENAGDDEGRPTVTVKIINCGEFSEDKKRA  182


 Score = 25.4 bits (54),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTSGESIYGEKFP  95



>ref|XP_010670674.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=697

 Score =   125 bits (313),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 75/99 (76%), Gaps = 5/99 (5%)
 Frame = -1

Query  1437  SMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVV  1258
             S G S+  D     + DE PKLKHD  GLLSM+IADRDIRGSLF + F A  +LDRK++V
Sbjct  13    SAGESIFGD----RFPDESPKLKHDERGLLSMSIADRDIRGSLFNLMFKANQNLDRKNIV  68

Query  1257  FGKLVHGHEVLKKIENVGNEVG-KPDVTVKIVNSGELHE  1144
             FGKLVHGHEVLKKIE+VG+E G KP VTVKI NSGE  E
Sbjct  69    FGKLVHGHEVLKKIEDVGDEDGFKPAVTVKICNSGEFSE  107



>ref|XP_003603433.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=943

 Score =   120 bits (302),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSMAIADRD  GS F++T  A HHLDRK VVFG+LV G +VLKKI
Sbjct  137   FPDESPRLKHDGPGLLSMAIADRDKLGSHFIITLKADHHLDRKYVVFGRLVEGLKVLKKI  196

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKGK  1126
             E+VG++ G P VTVKI+N GE +EG   GK
Sbjct  197   EDVGDDEGHPTVTVKIINCGEYNEGTDYGK  226


 Score = 28.1 bits (61),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 11/18 (61%), Gaps = 0/18 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKFP  1466
             + C  G  GESIYG  FP
Sbjct  121   VSCDDGTGGESIYGSNFP  138



>ref|XP_006578154.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Glycine max]
Length=778

 Score =   117 bits (293),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD+ GLLSMAIADRD  GS F++T  A HHLDRK VVFGKLV G  VLKKI
Sbjct  29    FPDESPKLKHDATGLLSMAIADRDTLGSHFIITLKADHHLDRKHVVFGKLVQGPNVLKKI  88

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG+E G P VTVKI+N GE  E
Sbjct  89    EEVGDEEGHPTVTVKIINCGEYSE  112


 Score = 31.6 bits (70),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKFP  1466
             + C  G  GESIYG KFP
Sbjct  13    VSCDNGTAGESIYGSKFP  30



>gb|EPS68763.1| hypothetical protein M569_06004, partial [Genlisea aurea]
Length=756

 Score =   123 bits (308),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  1389  DELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIEN  1210
             +E  KLKHD PGLLSMAIADRD RGS+F +T  A HHLDRK++VFGKL+ G +VLKKIE+
Sbjct  105   NESAKLKHDGPGLLSMAIADRDERGSIFSITLKADHHLDRKNIVFGKLIDGQDVLKKIED  164

Query  1209  VGNEVGKPDVTVKIVNSGELHEGR  1138
              G+  G+P VTVKI+N GELHEGR
Sbjct  165   SGDGDGRPTVTVKIINCGELHEGR  188


 Score = 25.4 bits (54),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFPG  1463
             G +GESIY G FPG
Sbjct  85    GKYGESIYAGNFPG  98



>ref|XP_008445168.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
 ref|XP_008445170.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
Length=779

 Score =   119 bits (297),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DELP+LKHD PGLLSMAIADRD  GS F++TF A +HLDRK +VFGKLV G +VLKK+
Sbjct  94    FPDELPRLKHDGPGLLSMAIADRDTLGSHFLITFKANNHLDRKHIVFGKLVQGFDVLKKM  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E V  E G P VTVKIVN GE +E + K
Sbjct  154   ERVDVEDGIPTVTVKIVNCGEFNEEKRK  181


 Score = 29.3 bits (64),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTVGESIYGGKFP  95



>gb|KGN62922.1| hypothetical protein Csa_2G380020 [Cucumis sativus]
Length=784

 Score =   118 bits (295),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DELP+LKHD PGLLSMAIADRD  GS F++TF A +HLDRK +VFGKLV G +VLKK+
Sbjct  94    FPDELPRLKHDGPGLLSMAIADRDTLGSHFLITFKANNHLDRKHLVFGKLVQGFDVLKKM  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E V  E G P VTVKIVN GE +E + K
Sbjct  154   ERVDVEDGIPTVTVKIVNCGEFNEEKRK  181


 Score = 29.6 bits (65),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTVGESIYGGKFP  95



>ref|XP_010670673.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=765

 Score =   124 bits (310),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 75/99 (76%), Gaps = 5/99 (5%)
 Frame = -1

Query  1437  SMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVV  1258
             S G S+  D     + DE PKLKHD  GLLSM+IADRDIRGSLF + F A  +LDRK++V
Sbjct  84    SAGESIFGD----RFPDESPKLKHDERGLLSMSIADRDIRGSLFNLMFKANQNLDRKNIV  139

Query  1257  FGKLVHGHEVLKKIENVGNEVG-KPDVTVKIVNSGELHE  1144
             FGKLVHGHEVLKKIE+VG+E G KP VTVKI NSGE  E
Sbjct  140   FGKLVHGHEVLKKIEDVGDEDGFKPAVTVKICNSGEFSE  178



>ref|XP_010670670.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670671.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670672.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   124 bits (310),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 75/99 (76%), Gaps = 5/99 (5%)
 Frame = -1

Query  1437  SMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVV  1258
             S G S+  D     + DE PKLKHD  GLLSM+IADRDIRGSLF + F A  +LDRK++V
Sbjct  84    SAGESIFGD----RFPDESPKLKHDERGLLSMSIADRDIRGSLFNLMFKANQNLDRKNIV  139

Query  1257  FGKLVHGHEVLKKIENVGNEVG-KPDVTVKIVNSGELHE  1144
             FGKLVHGHEVLKKIE+VG+E G KP VTVKI NSGE  E
Sbjct  140   FGKLVHGHEVLKKIEDVGDEDGFKPAVTVKICNSGEFSE  178



>ref|XP_008445172.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X5 [Cucumis melo]
Length=721

 Score =   122 bits (307),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 2/122 (2%)
 Frame = -1

Query  1497  LEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIR  1318
             LE+ +MV S QV    + FS M     +D  F  + +ELP+LKHD PGLLSMAIADRD  
Sbjct  4     LERAFMVESFQVTEPHLLFS-MRFFPYID-RFPFHPNELPRLKHDGPGLLSMAIADRDTL  61

Query  1317  GSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHEGR  1138
             GS F++TF A +HLDRK +VFGKLV G +VLKK+E V  E G P VTVKIVN GE +E +
Sbjct  62    GSHFLITFKANNHLDRKHIVFGKLVQGFDVLKKMERVDVEDGIPTVTVKIVNCGEFNEEK  121

Query  1137  HK  1132
              K
Sbjct  122   RK  123



>ref|XP_004501307.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Cicer arietinum]
Length=770

 Score =   115 bits (288),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSMAIADRD+ GS F++T  A HHLDRK VVFGKLV G  VLKKI
Sbjct  29    FPDESPKLKHDGPGLLSMAIADRDMLGSHFIITLKADHHLDRKHVVFGKLVQGLHVLKKI  88

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E+VG++ G P VTVKI+  GE ++
Sbjct  89    EDVGDDEGHPTVTVKIIYCGEYND  112


 Score = 30.8 bits (68),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKFP  1466
             + C  G  GESIYG KFP
Sbjct  13    VSCDDGTDGESIYGSKFP  30



>ref|XP_008445167.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X2 [Cucumis melo]
Length=791

 Score =   122 bits (306),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 81/129 (63%), Gaps = 16/129 (12%)
 Frame = -1

Query  1497  LEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYND-------ELPKLKHDSPGLLSMA  1339
             LE+ +MV S QV             +L  + F  Y D       ELP+LKHD PGLLSMA
Sbjct  74    LERAFMVESFQVTE---------PHLLFSMRFFPYIDRFPFHPNELPRLKHDGPGLLSMA  124

Query  1338  IADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNS  1159
             IADRD  GS F++TF A +HLDRK +VFGKLV G +VLKK+E V  E G P VTVKIVN 
Sbjct  125   IADRDTLGSHFLITFKANNHLDRKHIVFGKLVQGFDVLKKMERVDVEDGIPTVTVKIVNC  184

Query  1158  GELHEGRHK  1132
             GE +E + K
Sbjct  185   GEFNEEKRK  193



>ref|XP_004501306.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Cicer arietinum]
Length=788

 Score =   115 bits (288),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSMAIADRD+ GS F++T  A HHLDRK VVFGKLV G  VLKKI
Sbjct  47    FPDESPKLKHDGPGLLSMAIADRDMLGSHFIITLKADHHLDRKHVVFGKLVQGLHVLKKI  106

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E+VG++ G P VTVKI+  GE ++
Sbjct  107   EDVGDDEGHPTVTVKIIYCGEYND  130


 Score = 29.6 bits (65),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKFP  1466
             + C  G  GESIYG KFP
Sbjct  31    VSCDDGTDGESIYGSKFP  48



>ref|XP_008445171.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X4 [Cucumis melo]
Length=724

 Score =   121 bits (303),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 82/132 (62%), Gaps = 19/132 (14%)
 Frame = -1

Query  1497  LEKVYMVGSSQVEADLI*FSSMGAS---MLLDICFLSYND-------ELPKLKHDSPGLL  1348
             LE+ +MV S         F  M  +   +L  + F  Y D       ELP+LKHD PGLL
Sbjct  4     LERAFMVES---------FQKMQVTEPHLLFSMRFFPYIDRFPFHPNELPRLKHDGPGLL  54

Query  1347  SMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKI  1168
             SMAIADRD  GS F++TF A +HLDRK +VFGKLV G +VLKK+E V  E G P VTVKI
Sbjct  55    SMAIADRDTLGSHFLITFKANNHLDRKHIVFGKLVQGFDVLKKMERVDVEDGIPTVTVKI  114

Query  1167  VNSGELHEGRHK  1132
             VN GE +E + K
Sbjct  115   VNCGEFNEEKRK  126



>ref|XP_010546569.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010546570.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Tarenaya hassleriana]
Length=845

 Score =   119 bits (299),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 71/96 (74%), Gaps = 5/96 (5%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DELPKL+HD PGLLSM++ +RD  GS F++TF   H LDR++VVFGKLV G EVLKKI
Sbjct  94    FPDELPKLRHDEPGLLSMSVDERDKLGSQFIITFKPNHQLDRRNVVFGKLVQGKEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR-----HKGKH  1123
             E VG+E GKP VTVKI+  GE +E R      KGKH
Sbjct  154   ERVGDEEGKPTVTVKIIRCGEYNEDRKRNGLKKGKH  189


 Score = 24.6 bits (52),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESI+ GKFP
Sbjct  83    GTAGESIFAGKFP  95



>ref|XP_008445166.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X1 [Cucumis melo]
Length=794

 Score =   120 bits (301),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 82/132 (62%), Gaps = 19/132 (14%)
 Frame = -1

Query  1497  LEKVYMVGSSQVEADLI*FSSMGAS---MLLDICFLSYND-------ELPKLKHDSPGLL  1348
             LE+ +MV S         F  M  +   +L  + F  Y D       ELP+LKHD PGLL
Sbjct  74    LERAFMVES---------FQKMQVTEPHLLFSMRFFPYIDRFPFHPNELPRLKHDGPGLL  124

Query  1347  SMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKI  1168
             SMAIADRD  GS F++TF A +HLDRK +VFGKLV G +VLKK+E V  E G P VTVKI
Sbjct  125   SMAIADRDTLGSHFLITFKANNHLDRKHIVFGKLVQGFDVLKKMERVDVEDGIPTVTVKI  184

Query  1167  VNSGELHEGRHK  1132
             VN GE +E + K
Sbjct  185   VNCGEFNEEKRK  196



>ref|XP_003526420.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006581364.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=850

 Score =   117 bits (294),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD+ GLLSMAIADRD  GS F++T  A HHLDRK VVFGKLV GH VLKKI
Sbjct  94    FPDESPRLKHDATGLLSMAIADRDTLGSHFIITLKADHHLDRKHVVFGKLVQGHNVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E  G+E G P VTVKI+N GE  E
Sbjct  154   EEFGDEEGHPTVTVKIINCGEYSE  177


 Score = 25.8 bits (55),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGSKFP  95



>gb|KHN07093.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=824

 Score =   117 bits (294),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD+ GLLSMAIADRD  GS F++T  A HHLDRK VVFGKLV GH VLKKI
Sbjct  94    FPDESPRLKHDATGLLSMAIADRDTLGSHFIITLKADHHLDRKHVVFGKLVQGHNVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E  G+E G P VTVKI+N GE  E
Sbjct  154   EEFGDEEGHPTVTVKIINCGEYSE  177


 Score = 25.8 bits (55),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGSKFP  95



>ref|XP_006581365.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Glycine max]
Length=837

 Score =   117 bits (294),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD+ GLLSMAIADRD  GS F++T  A HHLDRK VVFGKLV GH VLKKI
Sbjct  94    FPDESPRLKHDATGLLSMAIADRDTLGSHFIITLKADHHLDRKHVVFGKLVQGHNVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E  G+E G P VTVKI+N GE  E
Sbjct  154   EEFGDEEGHPTVTVKIINCGEYSE  177


 Score = 25.8 bits (55),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGSKFP  95



>ref|XP_004498656.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Cicer arietinum]
 ref|XP_004498657.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Cicer arietinum]
Length=773

 Score =   120 bits (300),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 74/114 (65%), Gaps = 19/114 (17%)
 Frame = -1

Query  1407  CFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEV  1228
              +  + DE P+LKHDSPGLL MA+ADRD  GS F +T  A HHLDRK+VVFGKLV G+++
Sbjct  89    IYPKFPDESPRLKHDSPGLLFMAVADRDTLGSHFKITLKADHHLDRKNVVFGKLVQGYDI  148

Query  1227  LKKIENVGNEVGKPDVTVKIVNSGE-------------------LHEGRHKGKH  1123
             LKK+E+VG+E G P VTVKI+N GE                    HE R KGKH
Sbjct  149   LKKMEDVGDEEGLPTVTVKIINCGEHNEDGKKTHKSIIGSSEANSHEARRKGKH  202


 Score = 45.1 bits (105),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -1

Query  729  QSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVV  553
            QS    ++E  P++  K E +G    EE+ FPK NG    N +  N +SD+S  RQPD+V
Sbjct  336  QSSSFLDKELPPMNHKKREGVG--MLEEEGFPKPNGAQHTNGVGANYRSDRSEERQPDMV  393

Query  552  DNSPSKSRFTSI  517
            D+ P KSR  S+
Sbjct  394  DDHPGKSRSRSM  405


 Score = 37.0 bits (84),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPRSFSRNQS  365
            SRSRS+SPKR+++KSMSISP+S S+ QS
Sbjct  400  SRSRSMSPKRSVSKSMSISPKSGSKIQS  427



>ref|XP_003523694.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006578153.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=843

 Score =   117 bits (292),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD+ GLLSMAIADRD  GS F++T  A HHLDRK VVFGKLV G  VLKKI
Sbjct  94    FPDESPKLKHDATGLLSMAIADRDTLGSHFIITLKADHHLDRKHVVFGKLVQGPNVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG+E G P VTVKI+N GE  E
Sbjct  154   EEVGDEEGHPTVTVKIINCGEYSE  177


 Score = 26.2 bits (56),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGSKFP  95



>ref|XP_007161232.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
 gb|ESW33226.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
Length=895

 Score =   117 bits (292),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD+PGLLSM +ADRD  GS F++TF +  HLDRK V+FGKLV GH +LKKI
Sbjct  94    FPDESPRLKHDAPGLLSMPVADRDSLGSHFIITFKSDPHLDRKHVIFGKLVQGHNILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E+VG+E G P VTVKI+N GE +E
Sbjct  154   EDVGDEEGLPSVTVKIINCGEHNE  177


 Score = 26.2 bits (56),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTGGESIYGSKFP  95



>ref|XP_004498655.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=812

 Score =   119 bits (299),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -1

Query  1407  CFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEV  1228
              +  + DE P+LKHDSPGLL MA+ADRD  GS F +T  A HHLDRK+VVFGKLV G+++
Sbjct  122   IYPKFPDESPRLKHDSPGLLFMAVADRDTLGSHFKITLKADHHLDRKNVVFGKLVQGYDI  181

Query  1227  LKKIENVGNEVGKPDVTVKIVNSGELHEG  1141
             LKK+E+VG+E G P VTVKI+N GE +EG
Sbjct  182   LKKMEDVGDEEGLPTVTVKIINCGEHNEG  210


 Score = 45.4 bits (106),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -1

Query  729  QSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVV  553
            QS    ++E  P++  K E +G    EE+ FPK NG    N +  N +SD+S  RQPD+V
Sbjct  375  QSSSFLDKELPPMNHKKREGVG--MLEEEGFPKPNGAQHTNGVGANYRSDRSEERQPDMV  432

Query  552  DNSPSKSRFTSI  517
            D+ P KSR  S+
Sbjct  433  DDHPGKSRSRSM  444


 Score = 37.0 bits (84),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPRSFSRNQS  365
            SRSRS+SPKR+++KSMSISP+S S+ QS
Sbjct  439  SRSRSMSPKRSVSKSMSISPKSGSKIQS  466



>ref|XP_004164532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp5-like, partial 
[Cucumis sativus]
Length=296

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DELP+LKHD PGLLSMAIADRD  GS F++TF A +HLDRK +VFGKLV G +VLKK+
Sbjct  94    FPDELPRLKHDGPGLLSMAIADRDTLGSHFLITFKANNHLDRKHLVFGKLVQGFDVLKKM  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E V  E G P VTVKIVN GE +E + K
Sbjct  154   ERVDVEDGIPTVTVKIVNCGEFNEEKRK  181



>gb|KHN08115.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=805

 Score =   116 bits (291),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD+ GLLSMAIADRD  GS F++T  A HHLDRK VVFGKLV G  VLKKI
Sbjct  94    FPDESPKLKHDATGLLSMAIADRDTLGSHFIITLKADHHLDRKHVVFGKLVQGPNVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG+E G P VTVKI+N GE  E
Sbjct  154   EEVGDEEGHPTVTVKIINCGEYSE  177


 Score = 25.8 bits (55),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGSKFP  95



>ref|XP_007161230.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
 gb|ESW33224.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
Length=933

 Score =   118 bits (296),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD+PGLLSM +ADRD  GS FM+TF A  HLDRK VVFGKLV GH++LKKI
Sbjct  94    FPDESPRLKHDAPGLLSMPVADRDTLGSHFMITFKADPHLDRKHVVFGKLVLGHDILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E+VG++ G P VTVKI+N GE +E
Sbjct  154   EDVGDKEGLPSVTVKIINCGEHNE  177


 Score = 23.5 bits (49),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTGGESIYGSKFP  95


 Score = 49.7 bits (117),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = -1

Query  729  QSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVV  553
            QS  V  +E  P+H  K E +  +E  E+E PKENG  ++N    N +S++S  RQPDV+
Sbjct  339  QSSSVVGKELPPMHPNKREKLDIQE--EEELPKENGERRSNGTGANYRSERSEGRQPDVM  396

Query  552  DNSPSKSRFTSILLAP  505
            D+ P KSR  S  ++P
Sbjct  397  DDQPDKSRSQSTSISP  412


 Score = 22.7 bits (47),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = -3

Query  457  KLMSRSRSLSPKRTLNKSMS  398
            +  S+S S+SPKR LN+S S
Sbjct  413  RRKSKSLSISPKRRLNRSPS  432



>gb|ACJ83900.1| unknown [Medicago truncatula]
Length=154

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE P+LKHD PGLLSMAI DRD  GS F++T  A HHLDRK VVFG+LV G +VLKK
Sbjct  28    NFPDESPRLKHDGPGLLSMAIVDRDKLGSHFIITLKADHHLDRKYVVFGRLVEGLKVLKK  87

Query  1218  IENVGNEVGKPDVTVKIVNSGELHE  1144
             IE+VG++ G P VTVKI+N GE +E
Sbjct  88    IEDVGDDEGHPTVTVKIINCGEYNE  112



>ref|XP_010110347.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
 gb|EXC26034.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
Length=860

 Score =   113 bits (282),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 70/113 (62%), Gaps = 23/113 (20%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +LKHD PGLLSM +ADRD  GS F+VTF A H LDRK VVFGKLVHGHEVL+KI
Sbjct  103   FPDESSRLKHDEPGLLSMPLADRDSLGSHFIVTFAANHSLDRKHVVFGKLVHGHEVLRKI  162

Query  1215  ENVGNEVGKPDVTVKIVNSGEL----------------------HEGRHKGKH  1123
             E+VG E   P VTVKI+N GE                       HE R KGKH
Sbjct  163   EDVG-EHASPPVTVKIINCGEYDGDKKRVNKLRSGKDASSDANSHEARRKGKH  214


 Score = 28.5 bits (62),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  92    GTGGESIYGGKFP  104



>gb|AES73684.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=895

 Score =   117 bits (294),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD PGLLSMAIADRD  GS F++T  A HHLDRK VVFG+LV G +VLKKI
Sbjct  97    FPDESPRLKHDGPGLLSMAIADRDKLGSHFIITLKADHHLDRKYVVFGRLVEGLKVLKKI  156

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E+VG++ G P VTVKI+N GE +E
Sbjct  157   EDVGDDEGHPTVTVKIINCGEYNE  180


 Score = 23.9 bits (50),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 9/13 (69%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG  FP
Sbjct  86    GTGGESIYGSNFP  98



>ref|XP_004501305.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=838

 Score =   115 bits (287),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSMAIADRD+ GS F++T  A HHLDRK VVFGKLV G  VLKKI
Sbjct  97    FPDESPKLKHDGPGLLSMAIADRDMLGSHFIITLKADHHLDRKHVVFGKLVQGLHVLKKI  156

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E+VG++ G P VTVKI+  GE ++
Sbjct  157   EDVGDDEGHPTVTVKIIYCGEYND  180


 Score = 25.8 bits (55),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  86    GTDGESIYGSKFP  98



>ref|XP_007161231.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
 gb|ESW33225.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
Length=915

 Score =   115 bits (287),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P+LKHD+PGLLSM +A RD  GS F++TF A  HLDRK V+FGKLV GH +LKKI
Sbjct  94    FPDESPRLKHDAPGLLSMPVAVRDTLGSHFIITFKADPHLDRKHVIFGKLVQGHNILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E+VG+E G P VTVKI+N GE +E
Sbjct  154   EDVGDEEGLPSVTVKIINCGEHNE  177


 Score = 23.5 bits (49),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTGGESIYGSKFP  95



>ref|XP_006412476.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
 gb|ESQ53929.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
Length=810

 Score =   111 bits (277),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 8/99 (8%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKL+H+ PGLLSMA+++RD  GS F +TF   H LDR +VVFGKL+ G EVLKKI
Sbjct  94    FPDESPKLRHEEPGLLSMAVSERDKLGSHFHITFRPNHQLDRNNVVFGKLIQGKEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELH--------EGRHKGKH  1123
             E VG+E GKP V+VKI+  GE          +GR +GKH
Sbjct  154   ERVGDEEGKPTVSVKIIRCGEYTGDKKSNTIDGRKRGKH  192


 Score = 27.7 bits (60),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 7/36 (19%)
 Frame = -3

Query  1573  LMKYHAQRTTDCFCN*DVICCFTGNFGESIYGGKFP  1466
             ++K ++ +  D F N D      G  GESIY GKFP
Sbjct  67    IVKGYSAQAGD-FVNRD------GTAGESIYAGKFP  95



>ref|XP_006283087.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
 gb|EOA15985.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
Length=879

 Score =   111 bits (278),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 7/98 (7%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKL+HD PGLLSM++ADRD  GS F +TF     LDR +VVFGKL+ G E+LKKI
Sbjct  84    FPDESPKLRHDEPGLLSMSVADRDKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILKKI  143

Query  1215  ENVGNEVGKPDVTVKIVNSGEL-------HEGRHKGKH  1123
             E VG+E GKP V+VKI+  GE         +GR KGKH
Sbjct  144   ERVGDEGGKPSVSVKIIRCGENSGDKKKDSDGRKKGKH  181


 Score = 26.9 bits (58),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 6/24 (25%)
 Frame = -3

Query  1537  FCN*DVICCFTGNFGESIYGGKFP  1466
             F N D      G  GESIY GKFP
Sbjct  68    FVNRD------GTAGESIYAGKFP  85



>ref|XP_009345297.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Pyrus 
x bretschneideri]
Length=1043

 Score =   111 bits (278),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P LKH  PGLLSM++ADRD  GS F +TF A   LDRK +VFGKLV GHEVLKKI
Sbjct  94    FPDESPVLKHSGPGLLSMSVADRDSLGSHFNITFAANRSLDRKHIVFGKLVQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G+E GKP V VK++N G+ +E
Sbjct  154   ENAGDEDGKPTVLVKVINCGDYNE  177


 Score = 25.4 bits (54),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTGGESIYGEKFP  95


 Score = 43.9 bits (102),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  639  FPKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            +PKENG  ++N L   K DKS  RQPD+VD+ P KSR  S 
Sbjct  372  YPKENGEQRSNGLAGAKYDKSADRQPDIVDDHPGKSRSRSF  412


 Score = 33.9 bits (76),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS SPKR ++KSMSISPR
Sbjct  407  SRSRSFSPKRAMSKSMSISPR  427



>ref|XP_010325121.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Solanum lycopersicum]
Length=698

 Score =   113 bits (283),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             MAIADRD RGS+F +TF A HHLDRK VVFGKLV G EVLKKIE+VGNE GKPDVTVKI+
Sbjct  1     MAIADRDARGSIFSITFQADHHLDRKCVVFGKLVDGLEVLKKIESVGNEEGKPDVTVKII  60

Query  1164  NSGELHEGRHK  1132
             NSGEL + + K
Sbjct  61    NSGELPDDKRK  71


 Score = 65.1 bits (157),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -1

Query  768  GKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHK-NNDLMQN  592
            GKH ++ K  +GN S  +EE EAV +H  K EA    E EE EFPKENG  + NN  M+ 
Sbjct  198  GKHKSMEKKTEGNHSPSLEEGEAVSLHHKK-EATDIFEGEEVEFPKENGERQSNNTKMEI  256

Query  591  KSDKSPVRQPDVVDNSPSKSRFTSI  517
            +SDK   RQPDVVD+ P KSR  SI
Sbjct  257  RSDKPVDRQPDVVDDHPGKSRSRSI  281


 Score = 26.9 bits (58),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSM  401
            SRSRS+SPKRT+++SM
Sbjct  276  SRSRSISPKRTMSRSM  291



>ref|XP_010447391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=824

 Score =   110 bits (274),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 67/98 (68%), Gaps = 7/98 (7%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKHD PGLLSM++ADRD  GS F +TF     LDR +VVFGKL+ G EVLKKI
Sbjct  94    FPDESPKLKHDEPGLLSMSVADRDKFGSHFHLTFRPNQQLDRNNVVFGKLIQGKEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGEL-------HEGRHKGKH  1123
             E  G+E GKP V+VKI+  GE         +GR KGKH
Sbjct  154   ERAGDEEGKPTVSVKIIRCGENSGDKKNDSDGRKKGKH  191


 Score = 25.0 bits (53),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIY GKFP
Sbjct  83    GTAGESIYAGKFP  95



>ref|XP_008219899.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
 ref|XP_008219900.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=843

 Score =   108 bits (271),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P LKH  PG+LSM +A RD  GS F++TF A H+LDRK +VFGKLV GHEVLKKI
Sbjct  94    FPDESPVLKHSGPGILSMPVAVRDSLGSHFIITFAANHNLDRKHIVFGKLVQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             EN G+E G P V VK++N GE +E + K
Sbjct  154   ENAGDEDGNPTVLVKVINCGEHNEDKKK  181


 Score = 26.2 bits (56),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGEKFP  95



>ref|XP_007225294.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
 gb|EMJ26493.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
Length=854

 Score =   108 bits (270),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P LKH  PG+LSM +A RD  GS F++TF A H+LDRK +VFGKLV GHEVLKKI
Sbjct  94    FPDESPVLKHSGPGVLSMPVAVRDSLGSHFIITFAANHNLDRKHIVFGKLVQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             EN G+E G P V VK++N GE +E + K
Sbjct  154   ENAGDEDGNPTVLVKVINCGEHNEDKKK  181


 Score = 26.2 bits (56),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGEKFP  95



>ref|XP_010249988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nelumbo nucifera]
Length=806

 Score =   108 bits (269),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PGLLSMA A  +  GS F +TF A  HLD K VVFGK++ G E LKKI
Sbjct  94    FADESFKLNHDGPGLLSMANAGSNTNGSQFFITFKATPHLDGKHVVFGKILQGKETLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             E VG E GKP   VKI+N GELHEG++ G
Sbjct  154   ERVGTEKGKPAAPVKIINCGELHEGKNHG  182


 Score = 26.2 bits (56),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94


 Score = 50.4 bits (119),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -1

Query  765  KHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-K  589
            K  +  ++P  NQS   +E  AV   Q K EA    E  EDE P+ENG  ++N + +  +
Sbjct  340  KSKSTSQMPATNQSPLTKEEGAV-ARQKKFEATDMVE-HEDESPRENGELQSNGIQETAR  397

Query  588  SDKSPVRQPDVVDNSPSKSRFTSI  517
            +D+S  RQPDVVD+ PSKSR  S+
Sbjct  398  TDRSADRQPDVVDDRPSKSRSRSM  421


 Score = 36.2 bits (82),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRT++KSMSISPR
Sbjct  416  SRSRSMSPKRTMSKSMSISPR  436



>ref|XP_010249986.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010249987.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
Length=807

 Score =   108 bits (270),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PGLLSMA A  +  GS F +TF A  HLD K VVFGK++ G E LKKI
Sbjct  94    FADESFKLNHDGPGLLSMANAGSNTNGSQFFITFKATPHLDGKHVVFGKILQGKETLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             E VG E GKP   VKI+N GELHEG++ G
Sbjct  154   ERVGTEKGKPAAPVKIINCGELHEGKNHG  182


 Score = 26.2 bits (56),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94


 Score = 50.4 bits (119),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -1

Query  765  KHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-K  589
            K  +  ++P  NQS   +E  AV   Q K EA    E  EDE P+ENG  ++N + +  +
Sbjct  341  KSKSTSQMPATNQSPLTKEEGAV-ARQKKFEATDMVE-HEDESPRENGELQSNGIQETAR  398

Query  588  SDKSPVRQPDVVDNSPSKSRFTSI  517
            +D+S  RQPDVVD+ PSKSR  S+
Sbjct  399  TDRSADRQPDVVDDRPSKSRSRSM  422


 Score = 36.2 bits (82),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRT++KSMSISPR
Sbjct  417  SRSRSMSPKRTMSKSMSISPR  437



>ref|XP_010432719.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=846

 Score =   104 bits (259),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 65/96 (68%), Gaps = 7/96 (7%)
 Frame = -1

Query  1389  DELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIEN  1210
             DE PKL+HD  GLLSM++ADRD  GS F +TF     LDR +VVFGKL+ G E+L+KIE 
Sbjct  117   DESPKLRHDEAGLLSMSVADRDKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILRKIER  176

Query  1209  VGNEVGKPDVTVKIVNSGEL-------HEGRHKGKH  1123
              G+E GKP V+VKI+  GE         +GR KGKH
Sbjct  177   AGDEEGKPTVSVKIIRCGENSGDKKNDSDGRKKGKH  212


 Score = 29.6 bits (65),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 18/35 (51%), Gaps = 6/35 (17%)
 Frame = -3

Query  1504  GNFGESIYGGKFPG*G*FDLILKHGSFNAIGHLFP  1400
             G  GESIY GKFPG       L   S +AI   FP
Sbjct  83    GTAGESIYAGKFPG------WLPLRSLSAISFQFP  111



>ref|XP_010447392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=822

 Score =   110 bits (275),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 79/135 (59%), Gaps = 10/135 (7%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     + GSS    D +   +   +    I    + DE PKLKHD PGLLSM++ADR
Sbjct  60    KGSFFHRILKGSSAQAGDFV---NRDGTAGESIYAGKFPDESPKLKHDEPGLLSMSVADR  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL-  1150
             D  GS F +TF     LDR +VVFGKL+ G EVLKKIE  G+E GKP V+VKI+  GE  
Sbjct  117   DKFGSHFHLTFRPNQQLDRNNVVFGKLIQGKEVLKKIERAGDEEGKPTVSVKIIRCGENS  176

Query  1149  ------HEGRHKGKH  1123
                    +GR KGKH
Sbjct  177   GDKKNDSDGRKKGKH  191



>emb|CDX75243.1| BnaA01g04590D [Brassica napus]
Length=765

 Score =   109 bits (273),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 79/136 (58%), Gaps = 11/136 (8%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     + GSS    D +   S   +    I    + DE PKL+HD  GLLSM +A+R
Sbjct  60    KGSFFHRILKGSSAQAGDFV---SRDGTAGESIYAGKFPDESPKLRHDERGLLSMDVAER  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELH  1147
             D  GS F +TF   H LDRK+VVFGKL+ G EVLKKIE VG+E GKP VTVKI+  GE  
Sbjct  117   DKFGSHFHITFRPNHQLDRKNVVFGKLIQGKEVLKKIERVGDEEGKPTVTVKIIRCGEYS  176

Query  1146  --------EGRHKGKH  1123
                     +GR + KH
Sbjct  177   GDKKKNVIDGRKRSKH  192



>ref|XP_004291478.1| PREDICTED: uncharacterized protein LOC101292865 [Fragaria vesca 
subsp. vesca]
Length=761

 Score =   109 bits (273),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKLKH+ PGLLSM +A RD  GS F++TF A H LDRK V+FGKL HG +VLK+I
Sbjct  95    FPDESPKLKHNEPGLLSMPVALRDSLGSQFIITFEANHSLDRKHVIFGKLKHGWDVLKRI  154

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKGK  1126
             EN G+  G P VTVK++N GE  E + K K
Sbjct  155   ENAGDVDGNPTVTVKVINCGEYSEDKKKVK  184


 Score = 43.1 bits (100),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = -1

Query  651  EEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVVDNSPSKSRFTSI  517
            +E  FPKENG  ++N L  + K DK+  RQPD+VD+ P KSR  S+
Sbjct  357  KESAFPKENGEQRSNGLRTDLKYDKTADRQPDIVDDHPGKSRSRSL  402


 Score = 36.6 bits (83),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRSLSPKR L+KSMSISPR
Sbjct  397  SRSRSLSPKRILSKSMSISPR  417



>ref|XP_008378304.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8-like isoform 
X2 [Malus domestica]
Length=826

 Score =   106 bits (264),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P LKH  PGLLSM +A RD  GS F +TF A  +LDRK++VFGKL  GHEVLKKI
Sbjct  94    FPDESPVLKHSGPGLLSMPVAVRDSLGSHFNITFAANRNLDRKNIVFGKLAQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G+E G P V VK++N GE +E
Sbjct  154   ENAGDEDGNPTVLVKVINCGEYNE  177


 Score = 25.8 bits (55),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGEKFP  95


 Score = 44.3 bits (103),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 43/84 (51%), Gaps = 10/84 (12%)
 Frame = -1

Query  738  DGNQSHHVEEREAVPVHQMKGEAMGS---REREEDE-------FPKENGGHKNNDLMQNK  589
            DG  +   +++    + +  GE   S    +REE E       +PKENG  ++N L   K
Sbjct  321  DGLDAKRKDQKSKKDISEKSGEGDASIYLXKREEAEVLVKDGAYPKENGDQQSNGLAGGK  380

Query  588  SDKSPVRQPDVVDNSPSKSRFTSI  517
             DKS  RQPD+VD+ P KSR  S 
Sbjct  381  YDKSADRQPDIVDDHPGKSRSRSF  404


 Score = 33.9 bits (76),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS SPKR ++KSMSISPR
Sbjct  399  SRSRSFSPKRAMSKSMSISPR  419



>ref|XP_008394051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X1 [Malus 
domestica]
Length=856

 Score =   105 bits (263),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P LKH  PGLLSM +A RD  GS F +TF A    DRK +VFGKLV GHEVLKKI
Sbjct  94    FPDESPVLKHSGPGLLSMPVAVRDSLGSHFNITFAANRSFDRKHIVFGKLVQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G+E GKP V VK++N G+ +E
Sbjct  154   ENAGDEDGKPTVLVKVINCGDYNE  177


 Score = 25.8 bits (55),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGEKFP  95


 Score = 43.9 bits (102),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  639  FPKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            +PKENG  ++N L   K DKS  RQPD+VD+ P KSR  S 
Sbjct  372  YPKENGEQRSNGLAGAKYDKSADRQPDIVDDHPGKSRSRSF  412


 Score = 33.9 bits (76),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS SPKR ++KSMSISPR
Sbjct  407  SRSRSFSPKRAMSKSMSISPR  427



>ref|XP_008394052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X2 [Malus 
domestica]
Length=835

 Score =   105 bits (263),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P LKH  PGLLSM +A RD  GS F +TF A    DRK +VFGKLV GHEVLKKI
Sbjct  94    FPDESPVLKHSGPGLLSMPVAVRDSLGSHFNITFAANRSFDRKHIVFGKLVQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G+E GKP V VK++N G+ +E
Sbjct  154   ENAGDEDGKPTVLVKVINCGDYNE  177


 Score = 25.8 bits (55),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGEKFP  95


 Score = 43.9 bits (102),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  639  FPKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            +PKENG  ++N L   K DKS  RQPD+VD+ P KSR  S 
Sbjct  372  YPKENGEQRSNGLAGAKYDKSADRQPDIVDDHPGKSRSRSF  412


 Score = 33.9 bits (76),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS SPKR ++KSMSISPR
Sbjct  407  SRSRSFSPKRAMSKSMSISPR  427



>emb|CDX68845.1| BnaC01g06080D [Brassica napus]
Length=765

 Score =   109 bits (272),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 73/119 (61%), Gaps = 3/119 (3%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     + GSS    D +     G      I    + DE PKL+HD  GLLSM +A+R
Sbjct  60    KGSFFHRILKGSSAQAGDFVNRDGTGGE---SIYAGKFPDESPKLRHDERGLLSMDVAER  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             D  GS F +TF   H LDRK+VVFGKL+ G EVLKKIE VG+E GKP VTVKI++ GE 
Sbjct  117   DKLGSHFHITFRPNHQLDRKNVVFGKLIQGKEVLKKIERVGDEEGKPTVTVKIISCGEY  175



>ref|XP_002867244.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43503.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
Length=845

 Score =   104 bits (259),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE PKL+H+ PGLLSM++ADRD  GS F +TF     LDR +VVFGKL+ G E+LKKI
Sbjct  94    FPDESPKLRHEEPGLLSMSVADRDKFGSHFHITFRPNQQLDRNNVVFGKLIQGKELLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E VG+E GKP V VKI+  GE 
Sbjct  154   ERVGDEEGKPTVIVKIIRCGEY  175


 Score = 26.9 bits (58),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 6/24 (25%)
 Frame = -3

Query  1537  FCN*DVICCFTGNFGESIYGGKFP  1466
             F N D      G  GESIY GKFP
Sbjct  78    FVNRD------GTAGESIYAGKFP  95



>ref|XP_009126010.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
 ref|XP_009126018.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
Length=760

 Score =   108 bits (271),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 74/119 (62%), Gaps = 3/119 (3%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     + GSS    D +   S   +    I    + DE PKL+HD  GLLSM +A+R
Sbjct  60    KGSFFHRILKGSSAQAGDFV---SRDGTAGESIYAGKFPDESPKLRHDERGLLSMDVAER  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             D  GS F +TF   H LDRK+VVFGKL+ G EVLKKIE+VG+E GKP VTVKI+  GE 
Sbjct  117   DKFGSHFHITFRPNHQLDRKNVVFGKLIQGKEVLKKIEHVGDEEGKPTVTVKIIRCGEY  175



>ref|XP_009783542.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009783547.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009783556.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009783562.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Nicotiana sylvestris]
Length=690

 Score =   108 bits (269),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             MAIADRD RGS+F +TF A HHLDRK +VFG L+ G EVLKKIE+VGNE GKPDVTVKI+
Sbjct  1     MAIADRDARGSIFSITFQADHHLDRKCIVFGILIDGLEVLKKIESVGNEEGKPDVTVKII  60

Query  1164  NSGELHEGRHK  1132
             N GEL + + K
Sbjct  61    NCGELPDYKRK  71


 Score = 59.3 bits (142),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = -1

Query  771  DGKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNN-DLMQ  595
            +GKH ++ K   GN S  +EE EAV +H  K EA    E EE + PKENG  ++N   ++
Sbjct  195  EGKHKSMEKKTVGNCSPSLEEGEAVSLHDKK-EATDIFEGEEADLPKENGERQSNHTKVE  253

Query  594  NKSDKSPVRQPDVVDNSPSKSRFTSI  517
            ++SDK   RQPDVVD+ P KSR  SI
Sbjct  254  DRSDKYVDRQPDVVDDHPCKSRSRSI  279


 Score = 26.9 bits (58),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSM  401
            SRSRS+SPKRT+++SM
Sbjct  274  SRSRSISPKRTMSRSM  289



>ref|XP_008378303.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=517

 Score =   105 bits (262),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P LKH  PGLLSM +A RD  GS F +TF A  +LDRK++VFGKL  GHEVLKKI
Sbjct  94    FPDESPVLKHSGPGLLSMPVAVRDSLGSHFNITFAANRNLDRKNIVFGKLAQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G+E G P V VK++N GE +E
Sbjct  154   ENAGDEDGNPTVLVKVINCGEYNE  177


 Score = 25.4 bits (54),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  83    GTAGESIYGEKFP  95


 Score = 45.4 bits (106),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 43/84 (51%), Gaps = 10/84 (12%)
 Frame = -1

Query  738  DGNQSHHVEEREAVPVHQMKGEAMGS---REREEDE-------FPKENGGHKNNDLMQNK  589
            DG  +   +++    + +  GE   S    +REE E       +PKENG  ++N L   K
Sbjct  321  DGLDAKRKDQKSKKDISEKSGEGDASIYLXKREEAEVLVKDGAYPKENGDQQSNGLAGGK  380

Query  588  SDKSPVRQPDVVDNSPSKSRFTSI  517
             DKS  RQPD+VD+ P KSR  S 
Sbjct  381  YDKSADRQPDIVDDHPGKSRSRSF  404


 Score = 34.7 bits (78),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS SPKR ++KSMSISPR
Sbjct  399  SRSRSFSPKRAMSKSMSISPR  419



>ref|XP_010249989.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Nelumbo nucifera]
Length=733

 Score =   108 bits (269),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -1

Query  1389  DELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIEN  1210
             DE  KL HD PGLLSMA A  +  GS F +TF A  HLD K VVFGK++ G E LKKIE 
Sbjct  22    DESFKLNHDGPGLLSMANAGSNTNGSQFFITFKATPHLDGKHVVFGKILQGKETLKKIER  81

Query  1209  VGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             VG E GKP   VKI+N GELHEG++ G
Sbjct  82    VGTEKGKPAAPVKIINCGELHEGKNHG  108


 Score = 50.4 bits (119),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -1

Query  765  KHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-K  589
            K  +  ++P  NQS   +E  AV   Q K EA    E  EDE P+ENG  ++N + +  +
Sbjct  267  KSKSTSQMPATNQSPLTKEEGAV-ARQKKFEATDMVE-HEDESPRENGELQSNGIQETAR  324

Query  588  SDKSPVRQPDVVDNSPSKSRFTSI  517
            +D+S  RQPDVVD+ PSKSR  S+
Sbjct  325  TDRSADRQPDVVDDRPSKSRSRSM  348


 Score = 36.2 bits (82),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRT++KSMSISPR
Sbjct  343  SRSRSMSPKRTMSKSMSISPR  363



>ref|XP_009334770.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Pyrus x bretschneideri]
Length=846

 Score =   107 bits (267),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P LKH  PGLLSM +A RD  GS F +TF A   LDRK +VFGKLV GHEVLKKI
Sbjct  94    FPDESPVLKHSGPGLLSMPVAVRDSLGSHFNITFAANRSLDRKHIVFGKLVQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G+E GKP V VK++N G+ +E
Sbjct  154   ENAGDEDGKPTVLVKVINCGDYNE  177


 Score = 43.9 bits (102),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  639  FPKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            +PKENG  ++N L   K DKS  RQPD+VD+ P KSR  S 
Sbjct  364  YPKENGEQRSNGLAGAKYDKSADRQPDIVDDHPGKSRSRSF  404


 Score = 33.9 bits (76),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS SPKR ++KSMSISPR
Sbjct  399  SRSRSFSPKRAMSKSMSISPR  419



>ref|XP_009334769.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Pyrus x bretschneideri]
Length=854

 Score =   107 bits (267),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE P LKH  PGLLSM +A RD  GS F +TF A   LDRK +VFGKLV GHEVLKKI
Sbjct  94    FPDESPVLKHSGPGLLSMPVAVRDSLGSHFNITFAANRSLDRKHIVFGKLVQGHEVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             EN G+E GKP V VK++N G+ +E
Sbjct  154   ENAGDEDGKPTVLVKVINCGDYNE  177


 Score = 43.9 bits (102),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  639  FPKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            +PKENG  ++N L   K DKS  RQPD+VD+ P KSR  S 
Sbjct  372  YPKENGEQRSNGLAGAKYDKSADRQPDIVDDHPGKSRSRSF  412


 Score = 33.9 bits (76),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS SPKR ++KSMSISPR
Sbjct  407  SRSRSFSPKRAMSKSMSISPR  427



>ref|XP_009618668.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Nicotiana tomentosiformis]
 ref|XP_009618669.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Nicotiana tomentosiformis]
 ref|XP_009618670.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Nicotiana tomentosiformis]
Length=690

 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             MAIADRD RGS+F +TF A HHLDRK +VFG L+ G EVLKKIE+VGNE GKP+VTVKI+
Sbjct  1     MAIADRDARGSIFSITFQADHHLDRKCIVFGILIDGLEVLKKIESVGNEEGKPNVTVKII  60

Query  1164  NSGELHEGRHK  1132
             N GEL + + K
Sbjct  61    NCGELPDYKRK  71


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -1

Query  771  DGKHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDL-MQ  595
            +GKH ++ K  +GN+S  +EE EAV +H  K EA    E EE + PKENG  ++N   ++
Sbjct  198  EGKHKSMEKKTEGNRSPSLEEGEAVSLHDKK-EATDIFEGEEADLPKENGERQSNHTKVE  256

Query  594  NKSDKSPVRQPDVVDNSPSKSRFTSI  517
            ++SDK   RQPDVVD+ P KSR  SI
Sbjct  257  DRSDKYVDRQPDVVDDHPGKSRSRSI  282



>ref|XP_010432722.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Camelina sativa]
Length=825

 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 78/135 (58%), Gaps = 10/135 (7%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     + GSS    D +   +   +    I    + DE PKL+HD  GLLSM++ADR
Sbjct  60    KGSFFHRILKGSSAQAGDFV---NRDGTAGESIYAGKFPDESPKLRHDEAGLLSMSVADR  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL-  1150
             D  GS F +TF     LDR +VVFGKL+ G E+L+KIE  G+E GKP V+VKI+  GE  
Sbjct  117   DKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILRKIERAGDEEGKPTVSVKIIRCGENS  176

Query  1149  ------HEGRHKGKH  1123
                    +GR KGKH
Sbjct  177   GDKKNDSDGRKKGKH  191



>gb|AAM13845.1| unknown protein [Arabidopsis thaliana]
 gb|AAS75312.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=837

 Score =   105 bits (262),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 72/119 (61%), Gaps = 3/119 (3%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     M GSS    D +   +   +    I    + DE PKL+H+  GLLSM+IADR
Sbjct  60    KGSFFHRIMKGSSAQAGDFV---NRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADR  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             D  GS F +TF     LDR +VVFGKL+ G E+LKKIE VG+E GKP V+VKI+  GE 
Sbjct  117   DKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILKKIERVGDEEGKPTVSVKIIRCGEY  175



>ref|XP_010437912.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=806

 Score =   105 bits (262),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 78/135 (58%), Gaps = 10/135 (7%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     + GSS    D +   +   +    I    + DE PKL+H+  GLLSM++ADR
Sbjct  60    KGSFFHRILKGSSAQAGDFV---NRDGTAGESIYAGKFPDESPKLRHEEAGLLSMSVADR  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL-  1150
             D  GS F +TF     LDR +VVFGKL+ G EVLKKIE  G+E GKP V+VKI+  GE  
Sbjct  117   DKFGSHFHLTFRPNQQLDRSNVVFGKLIQGKEVLKKIERAGDEEGKPTVSVKIIRCGENS  176

Query  1149  ------HEGRHKGKH  1123
                    +GR KGKH
Sbjct  177   GDKKIDSDGRKKGKH  191



>ref|NP_194968.2| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190889.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q8RWY7.2|CYP95_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP95; Short=AtCYP95; 
Short=PPIase CYP95; AltName: Full=Cyclophilin-like 
protein CypRS92 [Arabidopsis thaliana]
 gb|AEE86054.1| peptidylprolyl isomerase [Arabidopsis thaliana]
 gb|AEE86057.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=837

 Score =   105 bits (262),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 72/119 (61%), Gaps = 3/119 (3%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     M GSS    D +   +   +    I    + DE PKL+H+  GLLSM+IADR
Sbjct  60    KGSFFHRIMKGSSAQAGDFV---NRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADR  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             D  GS F +TF     LDR +VVFGKL+ G E+LKKIE VG+E GKP V+VKI+  GE 
Sbjct  117   DKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILKKIERVGDEEGKPTVSVKIIRCGEY  175



>ref|XP_006483323.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X4 [Citrus sinensis]
 ref|XP_006483324.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X5 [Citrus sinensis]
 ref|XP_006483325.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X6 [Citrus sinensis]
Length=691

 Score =   101 bits (252),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M+IADRD  GS F++TF A H LDRK VVFG+LV GHE+LKKIENVG+E G+  VTVKI+
Sbjct  1     MSIADRDTLGSQFIITFKANHSLDRKYVVFGELVQGHEILKKIENVGDEEGRLTVTVKII  60

Query  1164  NSGELHEGRHKG  1129
             N GE+ E + KG
Sbjct  61    NCGEVSEDKKKG  72


 Score = 37.4 bits (85),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = -1

Query  657  EREE-DEFPKENGGHKNNDLMQNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            E+EE +E PKENG  ++N +          RQPDVVD+ P KSR  S+
Sbjct  254  EKEEGEETPKENGEQRSNGIQAGAKSVRSDRQPDVVDDHPGKSRSRSM  301


 Score = 36.6 bits (83),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRTL+KSMSISPR
Sbjct  296  SRSRSMSPKRTLSKSMSISPR  316



>ref|XP_010648639.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Vitis vinifera]
Length=686

 Score =   100 bits (250),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M++ADRD  GS F+VTF+A HHLDRK VVFGKLV GHEVLK+IE+VG+E G P  TVKI+
Sbjct  1     MSVADRDTVGSQFIVTFSANHHLDRKYVVFGKLVQGHEVLKRIESVGDEEGIPTATVKII  60

Query  1164  NSGELHEGRHK  1132
               GE+ E + K
Sbjct  61    YCGEIPEEKRK  71


 Score = 64.7 bits (156),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = -1

Query  768  GKHTNLGKIPD---GNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLM  598
            G   N  K P    GN S  VE+REAV     KGE     E+EE E PKENG  ++N + 
Sbjct  213  GPDCNPKKPPQLIAGNGSPVVEDREAVSTRHKKGEVADVLEKEEGESPKENGDRRSNGIE  272

Query  597  QNKSDKSPVRQPDVVDNSPSKSRFTSI  517
            + KSD+S  RQPDVVD+ P KSR  S+
Sbjct  273  EVKSDRSAERQPDVVDDHPGKSRSRSM  299


 Score = 36.2 bits (82),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRT++KSMSISPR
Sbjct  294  SRSRSMSPKRTMSKSMSISPR  314



>ref|XP_010048239.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X5 [Eucalyptus grandis]
Length=689

 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M +ADRD  GS F++TF A HHLDRKSVVFGKLV G EVLK+IEN G++ G+P VTVKI+
Sbjct  1     MLVADRDALGSHFLITFKADHHLDRKSVVFGKLVQGLEVLKRIENAGDDEGRPTVTVKII  60

Query  1164  NSGELHE  1144
             N GE  E
Sbjct  61    NCGEFSE  67



>gb|KCW80437.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80438.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=686

 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M +ADRD  GS F++TF A HHLDRKSVVFGKLV G EVLK+IEN G++ G+P VTVKI+
Sbjct  1     MLVADRDALGSHFLITFKADHHLDRKSVVFGKLVQGLEVLKRIENAGDDEGRPTVTVKII  60

Query  1164  NSGELHE  1144
             N GE  E
Sbjct  61    NCGEFSE  67



>ref|XP_007013818.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 2 [Theobroma 
cacao]
 gb|EOY31437.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 2 [Theobroma 
cacao]
Length=733

 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             MAIADRD  GS F++TF A H+LDRK VVFGKLV GHEVLKKIENVG+E G   VTVKI+
Sbjct  1     MAIADRDTVGSQFIITFKANHNLDRKYVVFGKLVQGHEVLKKIENVGDEEGILTVTVKII  60

Query  1164  NSGELHE  1144
             N GE+ E
Sbjct  61    NCGEVGE  67


 Score = 47.4 bits (111),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -1

Query  651  EEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVVDNSPSKSRFTSI  517
            +E E PKENGG ++N + ++ +SD+S  RQPDVVD+ PSKSR  S+
Sbjct  252  KEHEAPKENGGRRSNGIEEDAQSDRSADRQPDVVDDRPSKSRSRSM  297


 Score = 29.6 bits (65),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSI  395
            SRSRS+SPKR ++KSMSI
Sbjct  292  SRSRSMSPKRAMSKSMSI  309



>ref|XP_011019779.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X5 [Populus euphratica]
 ref|XP_011019780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X5 [Populus euphratica]
Length=703

 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M+IADRD  GS F++TF A HHLDRK VVFGKLV G +VLK IE+VG+E G+P VTVKI+
Sbjct  1     MSIADRDALGSQFIITFRANHHLDRKYVVFGKLVQGDKVLKNIEDVGDEEGRPTVTVKII  60

Query  1164  NSGELHEGRHK  1132
             N GE  E + K
Sbjct  61    NCGEFIEDKKK  71


 Score = 38.5 bits (88),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  457  KLMSRSRSLSPKRTLNKSMSISPR  386
            KLMSRS+S+SPKRT +KSMSISPR
Sbjct  281  KLMSRSQSMSPKRTSSKSMSISPR  304


 Score = 37.4 bits (85),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = -1

Query  657  EREEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVVDNSPSKSR  529
            E+E+ EFPKENG  ++N +  + KS  S  R+PD+ D+ P KSR
Sbjct  237  EKEDGEFPKENGSRRSNGMEADAKSYGSEDREPDIRDDHPGKSR  280



>ref|XP_010437913.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=805

 Score = 99.0 bits (245),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     + GSS    D +   +   +    I    + DE PKL+H+  GLLSM++ADR
Sbjct  60    KGSFFHRILKGSSAQAGDFV---NRDGTAGESIYAGKFPDESPKLRHEEAGLLSMSVADR  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL-  1150
             D  GS F +TF     LD  +VVFGKL+ G EVLKKIE  G+E GKP V+VKI+  GE  
Sbjct  117   DKFGSHFHLTFRPNQQLD-SNVVFGKLIQGKEVLKKIERAGDEEGKPTVSVKIIRCGENS  175

Query  1149  ------HEGRHKGKH  1123
                    +GR KGKH
Sbjct  176   GDKKIDSDGRKKGKH  190



>ref|XP_004498658.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X4 [Cicer arietinum]
 ref|XP_004498659.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X5 [Cicer arietinum]
Length=664

 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 59/93 (63%), Gaps = 19/93 (20%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             MA+ADRD  GS F +T  A HHLDRK+VVFGKLV G+++LKK+E+VG+E G P VTVKI+
Sbjct  1     MAVADRDTLGSHFKITLKADHHLDRKNVVFGKLVQGYDILKKMEDVGDEEGLPTVTVKII  60

Query  1164  NSGE-------------------LHEGRHKGKH  1123
             N GE                    HE R KGKH
Sbjct  61    NCGEHNEDGKKTHKSIIGSSEANSHEARRKGKH  93


 Score = 44.3 bits (103),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -1

Query  729  QSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-KSDKSPVRQPDVV  553
            QS    ++E  P++  K E +G    EE+ FPK NG    N +  N +SD+S  RQPD+V
Sbjct  227  QSSSFLDKELPPMNHKKREGVG--MLEEEGFPKPNGAQHTNGVGANYRSDRSEERQPDMV  284

Query  552  DNSPSKSRFTSI  517
            D+ P KSR  S+
Sbjct  285  DDHPGKSRSRSM  296


 Score = 37.0 bits (84),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPRSFSRNQS  365
            SRSRS+SPKR+++KSMSISP+S S+ QS
Sbjct  291  SRSRSMSPKRSVSKSMSISPKSGSKIQS  318



>ref|XP_006581368.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X6 [Glycine max]
Length=740

 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             MAIADRD  GS F++T  A HHLDRK VVFGKLV GH VLKKIE  G+E G P VTVKI+
Sbjct  1     MAIADRDTLGSHFIITLKADHHLDRKHVVFGKLVQGHNVLKKIEEFGDEEGHPTVTVKII  60

Query  1164  NSGELHE  1144
             N GE  E
Sbjct  61    NCGEYSE  67



>gb|AAP44536.1| cyclophilin-like protein [Triticum aestivum]
Length=636

 Score = 90.9 bits (224),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PG+LSMA +  +  GS F +TF A+ HLD K VVFGK+++G  +LKK+
Sbjct  97    FPDENFKLKHDQPGILSMANSGENTNGSQFFITFKAVPHLDGKHVVFGKVLNGKALLKKL  156

Query  1215  ENVGNEVGKPDVTVKIVNSGE  1153
             E +G+E GKP   VKIV+ GE
Sbjct  157   EALGSESGKPTCPVKIVDCGE  177


 Score = 25.0 bits (53),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  86    GRGGESIYGGKFP  98



>gb|EMS62524.1| Peptidyl-prolyl cis-trans isomerase D [Triticum urartu]
Length=534

 Score = 90.5 bits (223),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PG+LSMA +  +  GS F +TF A+ HLD K VVFGK+++G  +LKK+
Sbjct  84    FPDENFKLKHDQPGILSMANSGENTNGSQFFITFKAVPHLDGKHVVFGKVLNGKALLKKL  143

Query  1215  ENVGNEVGKPDVTVKIVNSGE  1153
             E +G+E GKP   VKIV+ GE
Sbjct  144   EALGSESGKPTCPVKIVDCGE  164


 Score = 25.0 bits (53),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  73    GRGGESIYGGKFP  85



>ref|XP_008802283.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802284.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score = 91.3 bits (225),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKHD PG+LSMA    D  GS F ++F A   LD K+VVFGK+V G  +LKKI
Sbjct  94    FSDENFKLKHDGPGVLSMASPAPDSNGSQFFISFRAAPRLDGKNVVFGKVVSGMSLLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E  G++ GKP  TV+IVN GE  +
Sbjct  154   EQAGSDKGKPICTVRIVNCGEASD  177


 Score = 24.3 bits (51),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKF  1469
             I    G+ GES+YGGKF
Sbjct  78    IAKLDGSGGESVYGGKF  94



>ref|XP_008802286.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Phoenix dactylifera]
Length=682

 Score = 91.3 bits (225),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKHD PG+LSMA    D  GS F ++F A   LD K+VVFGK+V G  +LKKI
Sbjct  94    FSDENFKLKHDGPGVLSMASPAPDSNGSQFFISFRAAPRLDGKNVVFGKVVSGMSLLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E  G++ GKP  TV+IVN GE  +
Sbjct  154   EQAGSDKGKPICTVRIVNCGEASD  177


 Score = 24.3 bits (51),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKF  1469
             I    G+ GES+YGGKF
Sbjct  78    IAKLDGSGGESVYGGKF  94



>ref|XP_006838913.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
 gb|ERN01482.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
Length=795

 Score = 92.8 bits (229),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PG+LSMA A  D  GS F +TF +  HLD K VVFGKLV G +VLKKI
Sbjct  94    FVDENFKLHHDGPGVLSMANAGPDTNGSQFFITFKSTGHLDGKHVVFGKLVEGMDVLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             E VG + G+P   VKIV+ GE  E +  G
Sbjct  154   EQVGTDQGRPTHNVKIVDCGEFIEAKAHG  182


 Score = 22.7 bits (47),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_008802285.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Phoenix dactylifera]
Length=684

 Score = 91.3 bits (225),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKHD PG+LSMA    D  GS F ++F A   LD K+VVFGK+V G  +LKKI
Sbjct  94    FSDENFKLKHDGPGVLSMASPAPDSNGSQFFISFRAAPRLDGKNVVFGKVVSGMSLLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E  G++ GKP  TV+IVN GE  +
Sbjct  154   EQAGSDKGKPICTVRIVNCGEASD  177


 Score = 24.3 bits (51),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKF  1469
             I    G+ GES+YGGKF
Sbjct  78    IAKLDGSGGESVYGGKF  94



>ref|XP_008802287.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Phoenix dactylifera]
Length=681

 Score = 91.3 bits (225),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKHD PG+LSMA    D  GS F ++F A   LD K+VVFGK+V G  +LKKI
Sbjct  94    FSDENFKLKHDGPGVLSMASPAPDSNGSQFFISFRAAPRLDGKNVVFGKVVSGMSLLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E  G++ GKP  TV+IVN GE  +
Sbjct  154   EQAGSDKGKPICTVRIVNCGEASD  177


 Score = 24.3 bits (51),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKF  1469
             I    G+ GES+YGGKF
Sbjct  78    IAKLDGSGGESVYGGKF  94



>ref|XP_008802288.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X5 [Phoenix dactylifera]
Length=668

 Score = 91.3 bits (225),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKHD PG+LSMA    D  GS F ++F A   LD K+VVFGK+V G  +LKKI
Sbjct  77    FSDENFKLKHDGPGVLSMASPAPDSNGSQFFISFRAAPRLDGKNVVFGKVVSGMSLLKKI  136

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E  G++ GKP  TV+IVN GE  +
Sbjct  137   EQAGSDKGKPICTVRIVNCGEASD  160


 Score = 24.3 bits (51),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKF  1469
             I    G+ GES+YGGKF
Sbjct  61    IAKLDGSGGESVYGGKF  77



>ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=819

 Score = 92.0 bits (227),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   L HD PGLLSMA A RD  GS F +TF    HLD K VVFGKL+ GHE LK I
Sbjct  93    FADENFVLNHDGPGLLSMANAGRDTNGSQFFITFKPAPHLDGKHVVFGKLILGHETLKNI  152

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E+V  +  +P V VKIVN GEL+E
Sbjct  153   ESVDVDGDRPVVPVKIVNCGELNE  176


 Score = 22.7 bits (47),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  82    GTGGESIYGGKF  93



>ref|XP_009399354.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FS    S    I    + DE  KLKHD PGLLSMA +  +  GS F +TF A   LD K+
Sbjct  78    FSRRDGSGGESIYGRKFPDENFKLKHDGPGLLSMASSAPNSNGSQFFITFKATPQLDGKN  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHEGR  1138
             VVFGK+V G  +LKKIE  G+E GKP   VK+V+ GE  +G+
Sbjct  138   VVFGKVVSGSNLLKKIEQAGSEKGKPLCLVKVVDCGEASDGK  179



>ref|XP_009399355.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=691

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FS    S    I    + DE  KLKHD PGLLSMA +  +  GS F +TF A   LD K+
Sbjct  78    FSRRDGSGGESIYGRKFPDENFKLKHDGPGLLSMASSAPNSNGSQFFITFKATPQLDGKN  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHEGR  1138
             VVFGK+V G  +LKKIE  G+E GKP   VK+V+ GE  +G+
Sbjct  138   VVFGKVVSGSNLLKKIEQAGSEKGKPLCLVKVVDCGEASDGK  179



>dbj|BAJ87064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=620

 Score = 92.4 bits (228),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PG+LSMA +  D  GS F +TF A+ HLD K VVFGK+++G  +LKK+
Sbjct  97    FQDENFKLKHDQPGILSMANSGEDSNGSQFFITFKAVPHLDGKHVVFGKILNGKALLKKL  156

Query  1215  ENVGNEVGKPDVTVKIVNSGE  1153
             E +G+E GKP   VKIV+ GE
Sbjct  157   EALGSESGKPTSLVKIVDCGE  177


 Score = 22.3 bits (46),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  86    GRGGESIYGGKF  97



>ref|XP_010546571.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Tarenaya hassleriana]
Length=735

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 5/79 (6%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M++ +RD  GS F++TF   H LDR++VVFGKLV G EVLKKIE VG+E GKP VTVKI+
Sbjct  1     MSVDERDKLGSQFIITFKPNHQLDRRNVVFGKLVQGKEVLKKIERVGDEEGKPTVTVKII  60

Query  1164  NSGELHEGR-----HKGKH  1123
               GE +E R      KGKH
Sbjct  61    RCGEYNEDRKRNGLKKGKH  79



>ref|XP_010432721.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=829

 Score = 84.7 bits (208),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 57/89 (64%), Gaps = 10/89 (11%)
 Frame = -1

Query  1389  DELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIEN  1210
             DE PKL+HD  GLLSM++ADRD  GS F +TF     LDR +VVFGKL+ G E+L+KIE 
Sbjct  117   DESPKLRHDEAGLLSMSVADRDKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILRKIER  176

Query  1209  VGNEVGKPDVTVKIVNSGELHEGRHKGKH  1123
              G+E  K + +          +GR KGKH
Sbjct  177   AGDEEDKKNDS----------DGRKKGKH  195


 Score = 29.6 bits (65),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 18/35 (51%), Gaps = 6/35 (17%)
 Frame = -3

Query  1504  GNFGESIYGGKFPG*G*FDLILKHGSFNAIGHLFP  1400
             G  GESIY GKFPG       L   S +AI   FP
Sbjct  83    GTAGESIYAGKFPG------WLPLRSLSAISFQFP  111



>gb|EEE66674.1| hypothetical protein OsJ_23316 [Oryza sativa Japonica Group]
Length=632

 Score = 91.7 bits (226),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  1410  ICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHE  1231
             I    + DE  KLKHD PG+LSMA A  D  GS F +TF    HLD K VVFGK+V G  
Sbjct  90    IYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQFFITFMPTPHLDGKHVVFGKVVTGMP  149

Query  1230  VLKKIENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             +LKK+E VG++ GKP   VKIV+ GE+ + +++
Sbjct  150   LLKKLEAVGSDTGKPTCEVKIVDCGEVSDSQNQ  182



>gb|EEC81610.1| hypothetical protein OsI_25113 [Oryza sativa Indica Group]
Length=632

 Score = 91.7 bits (226),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  1410  ICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHE  1231
             I    + DE  KLKHD PG+LSMA A  D  GS F +TF    HLD K VVFGK+V G  
Sbjct  90    IYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQFFITFVPTPHLDGKHVVFGKVVTGMP  149

Query  1230  VLKKIENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             +LKK+E VG++ GKP   VKIV+ GE+ + +++
Sbjct  150   LLKKLEAVGSDTGKPTCEVKIVDCGEVSDSQNQ  182



>ref|XP_002459423.1| hypothetical protein SORBIDRAFT_02g004430 [Sorghum bicolor]
 gb|EER95944.1| hypothetical protein SORBIDRAFT_02g004430 [Sorghum bicolor]
Length=648

 Score = 88.2 bits (217),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +L HD PG+LSMA +  D  GS F +TF AL HLD K VVFGK+V G ++LKK+
Sbjct  94    FPDENFRLLHDQPGVLSMANSGPDSNGSQFFITFKALPHLDGKHVVFGKVVSGLDLLKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E VG E G P   VKIV+ GE+
Sbjct  154   EAVGGESGNPSRQVKIVDCGEV  175


 Score = 25.0 bits (53),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GRGGESIYGGKFP  95



>ref|XP_010935780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Elaeis 
guineensis]
Length=703

 Score = 88.2 bits (217),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKHD PG+LSMA    D  GS F ++F A   LD K+VVFGK+V G  +LKK+
Sbjct  100   FSDENFKLKHDGPGVLSMASPAPDSNGSQFFMSFRAAPRLDGKNVVFGKVVSGMSLLKKM  159

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E  G++ GKP  TVKIV+ GE  + + K
Sbjct  160   EQAGSDKGKPICTVKIVDCGEASDNKTK  187


 Score = 25.0 bits (53),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  1519  ICCFTGNFGESIYGGKF  1469
             I    G+ GESIYGGKF
Sbjct  84    IAKLDGSGGESIYGGKF  100



>ref|XP_008445173.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X6 [Cucumis melo]
 ref|XP_008445174.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X6 [Cucumis melo]
 ref|XP_008445175.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X6 [Cucumis melo]
Length=669

 Score = 91.3 bits (225),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             MAIADRD  GS F++TF A +HLDRK +VFGKLV G +VLKK+E V  E G P VTVKIV
Sbjct  1     MAIADRDTLGSHFLITFKANNHLDRKHIVFGKLVQGFDVLKKMERVDVEDGIPTVTVKIV  60

Query  1164  NSGELHEGRHK  1132
             N GE +E + K
Sbjct  61    NCGEFNEEKRK  71



>ref|XP_003557489.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Brachypodium distachyon]
Length=637

 Score = 89.4 bits (220),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -1

Query  1410  ICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHE  1231
             I    + DE  KLKHD PG+LSMA +  +  GS F +TF A  HLD K VVFGK+++G +
Sbjct  93    IYGAKFPDENFKLKHDQPGVLSMANSGANSNGSQFFITFKATPHLDGKHVVFGKVLNGKD  152

Query  1230  VLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             +LKK+E +G+E GKP   VKIV+ GE+
Sbjct  153   LLKKLEALGSESGKPTSPVKIVDCGEV  179


 Score = 23.9 bits (50),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYG KFP
Sbjct  87    GRGGESIYGAKFP  99



>ref|XP_004341067.1| peptidylprolyl cis-trans isomerase, cyclophilin-type, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR19003.1| peptidylprolyl cis-trans isomerase, cyclophilin-type, putative 
[Acanthamoeba castellanii str. Neff]
Length=202

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKH +PGLLSMA A +D  GS F +T  A   LD K VVFGK++ G++++KK+
Sbjct  117   FADENFKLKHTTPGLLSMANAGKDTNGSQFFITTVATPWLDGKHVVFGKVLEGYDIIKKL  176

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E++G++ GKP  T+ I +SGEL
Sbjct  177   ESLGSQSGKPSATLTIADSGEL  198



>ref|NP_001170592.1| uncharacterized protein LOC100384625 [Zea mays]
 gb|ACR34149.1| unknown [Zea mays]
 tpg|DAA42556.1| TPA: hypothetical protein ZEAMMB73_596682 [Zea mays]
Length=644

 Score = 88.2 bits (217),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +L H+ PG+LSMA +  D  GS F +TF AL HLD K VVFGK+V G  +LKK+
Sbjct  94    FPDENFRLLHNQPGVLSMANSGPDTNGSQFFITFKALPHLDGKHVVFGKVVSGIALLKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E VG+E G P   VKIV+ GE+
Sbjct  154   EAVGSETGNPSYQVKIVDCGEV  175


 Score = 25.0 bits (53),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GKGGESIYGGKFP  95



>ref|XP_008668501.1| PREDICTED: uncharacterized protein LOC100384625 isoform X1 [Zea 
mays]
Length=645

 Score = 88.2 bits (217),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +L H+ PG+LSMA +  D  GS F +TF AL HLD K VVFGK+V G  +LKK+
Sbjct  94    FPDENFRLLHNQPGVLSMANSGPDTNGSQFFITFKALPHLDGKHVVFGKVVSGIALLKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E VG+E G P   VKIV+ GE+
Sbjct  154   EAVGSETGNPSYQVKIVDCGEV  175


 Score = 25.0 bits (53),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GKGGESIYGGKFP  95



>tpg|DAA42558.1| TPA: hypothetical protein ZEAMMB73_596682 [Zea mays]
Length=670

 Score = 87.8 bits (216),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +L H+ PG+LSMA +  D  GS F +TF AL HLD K VVFGK+V G  +LKK+
Sbjct  120   FPDENFRLLHNQPGVLSMANSGPDTNGSQFFITFKALPHLDGKHVVFGKVVSGIALLKKL  179

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E VG+E G P   VKIV+ GE+
Sbjct  180   EAVGSETGNPSYQVKIVDCGEV  201


 Score = 25.0 bits (53),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  109   GKGGESIYGGKFP  121



>ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=832

 Score = 90.1 bits (222),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE   L HD  GLLSMA A RD  GS F +TFN+  HL+ K V+FGKL+ GHE LK I
Sbjct  94    FSDENFVLNHDGRGLLSMANAGRDANGSQFFITFNSAPHLNGKHVIFGKLILGHETLKNI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             ENV  +  +P   VKIVN GEL E
Sbjct  154   ENVDVDGDRPVALVKIVNCGELCE  177


 Score = 22.7 bits (47),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_008792090.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008792091.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=845

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   L+HD PGLLSMA A RD  GS F +TF A  HLD K VVFGKL+ G E L+ I
Sbjct  94    FPDENFLLRHDGPGLLSMANAGRDTNGSQFFITFKAAPHLDGKHVVFGKLISGEETLRNI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             E V  +  KP V VKI N GE +  + +G
Sbjct  154   ERVEVDGSKPIVPVKIANCGEFNASKDQG  182



>gb|ACJ54182.1| PPIase domain-containing protein [Nicotiana benthamiana]
Length=195

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -1

Query  1314  SLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHEGRH  1135
             S+F +TF A HHLDRK +VFG L+ G EVLKKIE+VGNE GKPDVTVKI+N GEL + + 
Sbjct  1     SIFSITFQADHHLDRKCIVFGILIDGLEVLKKIESVGNEEGKPDVTVKIINCGELPDYKR  60

Query  1134  K  1132
             K
Sbjct  61    K  61



>ref|XP_009388658.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388659.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388660.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=814

 Score = 89.4 bits (220),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   L HD PGLL+MA A RD  GS F +TF A  HLD K VVFGKL+ G E L+ +
Sbjct  96    FADENFMLNHDGPGLLAMANAGRDTNGSQFFITFKAAPHLDGKHVVFGKLILGQETLRDM  155

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             ENV  +  +P V VKIV+ GEL+E
Sbjct  156   ENVDVDGDRPVVPVKIVSCGELNE  179


 Score = 22.7 bits (47),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  85    GTGGESIYGGKF  96



>ref|XP_006657499.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=627

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = -1

Query  1410  ICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHE  1231
             I    + DE  KLKHD PG+LSMA A  D  GS F +TF  + HLD K VVFGK+V G  
Sbjct  90    IYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQFFITFLPVPHLDGKHVVFGKVVTGIT  149

Query  1230  VLKKIENVGNEVGKPDVTVKIVNSGELHE  1144
             +LKK+E VG++ GKP   VKIV+ GE+ +
Sbjct  150   LLKKLEAVGSDTGKPTSEVKIVDCGEVSD  178



>ref|XP_006657500.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=626

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = -1

Query  1410  ICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHE  1231
             I    + DE  KLKHD PG+LSMA A  D  GS F +TF  + HLD K VVFGK+V G  
Sbjct  90    IYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQFFITFLPVPHLDGKHVVFGKVVTGIT  149

Query  1230  VLKKIENVGNEVGKPDVTVKIVNSGELHE  1144
             +LKK+E VG++ GKP   VKIV+ GE+ +
Sbjct  150   LLKKLEAVGSDTGKPTSEVKIVDCGEVSD  178



>ref|XP_004955636.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Setaria italica]
 ref|XP_004955637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Setaria italica]
 ref|XP_004955638.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Setaria italica]
Length=644

 Score = 86.7 bits (213),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +L HD PG+LSMA A  D  GS F +TF  L HLD K VVFGK+  G  +LKK+
Sbjct  94    FPDENFRLTHDQPGMLSMANAGPDTNGSQFFITFKPLPHLDGKHVVFGKVASGIALLKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E VG E G P   VKIV+ GE+
Sbjct  154   EAVGGENGNPSRQVKIVDCGEV  175


 Score = 25.0 bits (53),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GRGGESIYGGKFP  95



>ref|XP_004955639.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X4 [Setaria italica]
Length=643

 Score = 86.7 bits (213),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +L HD PG+LSMA A  D  GS F +TF  L HLD K VVFGK+  G  +LKK+
Sbjct  94    FPDENFRLTHDQPGMLSMANAGPDTNGSQFFITFKPLPHLDGKHVVFGKVASGIALLKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E VG E G P   VKIV+ GE+
Sbjct  154   EAVGGENGNPSRQVKIVDCGEV  175


 Score = 25.0 bits (53),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GRGGESIYGGKFP  95



>ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Elaeis guineensis]
Length=836

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   L+HD PGLLSMA A RD  GS F +TF A  HLD K VVFGKL+ G E L+ I
Sbjct  94    FPDENFVLRHDGPGLLSMANAGRDTNGSQFFITFKAAPHLDGKHVVFGKLISGEETLRNI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             E V  +  +P V VKI N GEL+  +  G
Sbjct  154   ERVEVDGSRPVVPVKITNCGELNASKDHG  182



>ref|XP_010228289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Brachypodium distachyon]
Length=651

 Score = 89.7 bits (221),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -1

Query  1410  ICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHE  1231
             I    + DE  KLKHD PG+LSMA +  +  GS F +TF A  HLD K VVFGK+++G +
Sbjct  93    IYGAKFPDENFKLKHDQPGVLSMANSGANSNGSQFFITFKATPHLDGKHVVFGKVLNGKD  152

Query  1230  VLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             +LKK+E +G+E GKP   VKIV+ GE+
Sbjct  153   LLKKLEALGSESGKPTSPVKIVDCGEV  179



>ref|XP_007162476.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 ref|XP_007162477.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34470.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34471.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
Length=663

 Score = 89.0 bits (219),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL+HD PG LSMA +  +  GS F +TF    HLD K VVFGK+V+G + LKKI
Sbjct  94    FADENFKLRHDGPGFLSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVVNGMDALKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP  TVKI++ GE+ E
Sbjct  154   ELVGTSDGKPTQTVKIIDCGEVFE  177


 Score = 22.3 bits (46),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=818

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   L+HD PGLLSMA A RD  GS F +TF A  HLD K VVFGKL+ G E L+ I
Sbjct  94    FPDENFVLRHDGPGLLSMANAGRDTNGSQFFITFKAAPHLDGKHVVFGKLISGEETLRNI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELH  1147
             E+V  +  KP V VKI N GE +
Sbjct  154   EHVEVDGSKPVVPVKITNCGEFN  176



>ref|XP_008235347.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Prunus 
mume]
Length=665

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FS+   +    I    + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K 
Sbjct  78    FSNGNGTGGESIYGGKFADENFKLKHDGPGLLSMANAGPNTNGSQFFIIFRRQPHLDGKH  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHE  1144
             VVFGK+V G +V++KIE VG+  GKP  TVKIV+ GE+ E
Sbjct  138   VVFGKVVKGMDVVEKIERVGSADGKPFQTVKIVDCGEVSE  177



>ref|XP_010249990.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X4 [Nelumbo nucifera]
Length=697

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             MA A  +  GS F +TF A  HLD K VVFGK++ G E LKKIE VG E GKP   VKI+
Sbjct  1     MANAGSNTNGSQFFITFKATPHLDGKHVVFGKILQGKETLKKIERVGTEKGKPAAPVKII  60

Query  1164  NSGELHEGRHKG  1129
             N GELHEG++ G
Sbjct  61    NCGELHEGKNHG  72


 Score = 50.4 bits (119),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -1

Query  765  KHTNLGKIPDGNQSHHVEEREAVPVHQMKGEAMGSREREEDEFPKENGGHKNNDLMQN-K  589
            K  +  ++P  NQS   +E  AV   Q K EA    E  EDE P+ENG  ++N + +  +
Sbjct  231  KSKSTSQMPATNQSPLTKEEGAV-ARQKKFEATDMVE-HEDESPRENGELQSNGIQETAR  288

Query  588  SDKSPVRQPDVVDNSPSKSRFTSI  517
            +D+S  RQPDVVD+ PSKSR  S+
Sbjct  289  TDRSADRQPDVVDDRPSKSRSRSM  312


 Score = 36.2 bits (82),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -3

Query  448  SRSRSLSPKRTLNKSMSISPR  386
            SRSRS+SPKRT++KSMSISPR
Sbjct  307  SRSRSMSPKRTMSKSMSISPR  327



>ref|XP_004162194.1| PREDICTED: uncharacterized LOC101219904 [Cucumis sativus]
Length=655

 Score = 89.0 bits (219),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKHD PG+LSMA +  +  GS F +TF    HLD K VVFGK+V G +V+KKI
Sbjct  94    FSDENFKLKHDGPGILSMANSGPNTNGSQFFITFKPQPHLDGKHVVFGKVVMGMDVVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G   GKP   VKIVN GE  E
Sbjct  154   EQIGTADGKPGEPVKIVNCGEPSE  177


 Score = 21.6 bits (44),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GES+YGGKF
Sbjct  83    GTGGESVYGGKF  94



>ref|XP_008235346.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X2 [Prunus 
mume]
Length=669

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FS+   +    I    + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K 
Sbjct  78    FSNGNGTGGESIYGGKFADENFKLKHDGPGLLSMANAGPNTNGSQFFIIFRRQPHLDGKH  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHE  1144
             VVFGK+V G +V++KIE VG+  GKP  TVKIV+ GE+ E
Sbjct  138   VVFGKVVKGMDVVEKIERVGSADGKPFQTVKIVDCGEVSE  177



>ref|XP_008235345.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=670

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FS+   +    I    + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K 
Sbjct  78    FSNGNGTGGESIYGGKFADENFKLKHDGPGLLSMANAGPNTNGSQFFIIFRRQPHLDGKH  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHE  1144
             VVFGK+V G +V++KIE VG+  GKP  TVKIV+ GE+ E
Sbjct  138   VVFGKVVKGMDVVEKIERVGSADGKPFQTVKIVDCGEVSE  177



>ref|XP_008219901.1| PREDICTED: putative uncharacterized protein ENSP00000383309 isoform 
X2 [Prunus mume]
 ref|XP_008219903.1| PREDICTED: putative uncharacterized protein ENSP00000383309 isoform 
X2 [Prunus mume]
Length=733

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M +A RD  GS F++TF A H+LDRK +VFGKLV GHEVLKKIEN G+E G P V VK++
Sbjct  1     MPVAVRDSLGSHFIITFAANHNLDRKHIVFGKLVQGHEVLKKIENAGDEDGNPTVLVKVI  60

Query  1164  NSGELHEGRHK  1132
             N GE +E + K
Sbjct  61    NCGEHNEDKKK  71



>ref|XP_004146961.1| PREDICTED: uncharacterized protein LOC101219904 [Cucumis sativus]
 gb|KGN44769.1| hypothetical protein Csa_7G378580 [Cucumis sativus]
Length=668

 Score = 89.0 bits (219),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKHD PG+LSMA +  +  GS F +TF    HLD K VVFGK+V G +V+KKI
Sbjct  94    FSDENFKLKHDGPGILSMANSGPNTNGSQFFITFKPQPHLDGKHVVFGKVVMGMDVVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G   GKP   VKIVN GE  E
Sbjct  154   EQIGTADGKPGEPVKIVNCGEPSE  177


 Score = 21.6 bits (44),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GES+YGGKF
Sbjct  83    GTGGESVYGGKF  94



>ref|XP_008345159.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like, partial 
[Malus domestica]
Length=606

 Score = 88.2 bits (217),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K VVFGK+V G +V++KI
Sbjct  27    FADENFKLKHDRPGLLSMANAGPNTNGSQFFIIFRRQPHLDGKHVVFGKVVKGMDVVEKI  86

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP  TVKIV+ GE  E
Sbjct  87    EKVGTADGKPLETVKIVDCGEFSE  110


 Score = 22.3 bits (46),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  1495  GESIYGGKF  1469
             GESIYGGKF
Sbjct  19    GESIYGGKF  27



>ref|XP_008368672.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Malus 
domestica]
Length=609

 Score = 87.8 bits (216),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K VVFGK+V G +V++KI
Sbjct  25    FADENFKLKHDRPGLLSMANAGPNTNGSQFFIIFRRQPHLDGKHVVFGKVVKGMDVVEKI  84

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP  TVKIV+ GE  E
Sbjct  85    EKVGTADGKPLETVKIVDCGEFSE  108


 Score = 22.3 bits (46),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  14    GTGGESIYGGKF  25



>tpg|DAA42555.1| TPA: hypothetical protein ZEAMMB73_596682, partial [Zea mays]
Length=313

 Score = 85.5 bits (210),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +L H+ PG+LSMA +  D  GS F +TF AL HLD K VVFGK+V G  +LKK+
Sbjct  94    FPDENFRLLHNQPGVLSMANSGPDTNGSQFFITFKALPHLDGKHVVFGKVVSGIALLKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E VG+E G P   VKIV+ GE+
Sbjct  154   EAVGSETGNPSYQVKIVDCGEV  175


 Score = 24.3 bits (51),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GKGGESIYGGKFP  95



>ref|XP_003521263.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Glycine 
max]
Length=668

 Score = 87.8 bits (216),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PG+LSMA +  +  GS F +TF    HLD K VVFGK+V+G ++LKKI
Sbjct  94    FADENFKLTHDGPGILSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVVNGIDILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKI++ GE+ E
Sbjct  154   EQVGTSDGKPTQPVKIIDCGEVSE  177


 Score = 22.3 bits (46),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_007199724.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
 gb|EMJ00923.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
Length=673

 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FS+   +    I    + DE  KLKHD PG+LSMA A  +  GS F + F    HLD K 
Sbjct  78    FSNGNGTGGESIYGGKFADENFKLKHDGPGVLSMANAGPNTNGSQFFIIFRRQPHLDGKH  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHE  1144
             VVFGK+V G +V++KIE VG+  GKP  TVKIV+ GE+ E
Sbjct  138   VVFGKVVKGMDVVEKIERVGSADGKPFQTVKIVDCGEVSE  177



>gb|KHN10697.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=727

 Score = 87.4 bits (215),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PG+LSMA +  +  GS F +TF    HLD K VVFGK+V+G ++LKKI
Sbjct  153   FADENFKLTHDGPGILSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVVNGIDILKKI  212

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKI++ GE+ E
Sbjct  213   EQVGTSDGKPTQPVKIIDCGEVSE  236


 Score = 22.3 bits (46),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  142   GTGGESIYGGKF  153



>ref|XP_008451290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 [Cucumis melo]
Length=669

 Score = 87.8 bits (216),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKHD PG+LSMA +  +  GS F +TF    HLD K VVFGK+V G +V+K+I
Sbjct  94    FSDENFKLKHDGPGILSMANSGPNTNGSQFFITFKPQPHLDGKHVVFGKVVMGMDVVKEI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G   GKP   VKIVN GE  E
Sbjct  154   EQIGTADGKPGQPVKIVNCGEPSE  177


 Score = 21.9 bits (45),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GES+YGGKF
Sbjct  83    GTGGESVYGGKF  94



>emb|CBJ33426.1| conserved unknown protein [Ectocarpus siliculosus]
Length=338

 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE  +LKHD PGLLSMA + RD   S F +TF  L  LD K VVFGK+V G EV++K
Sbjct  184   TFVDESFQLKHDQPGLLSMANSGRDSNNSQFFITFGPLPWLDSKHVVFGKVVEGMEVVRK  243

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             IE+ G   G+P   V+I   G++
Sbjct  244   IEDCGTTSGEPTKRVQIAECGQI  266



>ref|XP_010274266.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Nelumbo nucifera]
Length=695

 Score = 86.7 bits (213),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ HD PGLLSMA A +D  GS F +TF +  HLD K VVFGK+V G +V+KK+
Sbjct  94    FADENFKMLHDGPGLLSMANAGKDTNGSQFFITFKSARHLDGKHVVFGKVVQGMDVVKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGE  1153
             E VG   GK    VKIV+ GE
Sbjct  154   EQVGTSDGKSISLVKIVDCGE  174


 Score = 22.3 bits (46),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  1495  GESIYGGKF  1469
             GESIYGGKF
Sbjct  86    GESIYGGKF  94



>ref|XP_008355416.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
 ref|XP_008355417.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
Length=595

 Score = 86.7 bits (213),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K VVFGK+V G +V++KI
Sbjct  94    FADENFKLKHDRPGLLSMANAGPNTNGSQFFIIFRRQPHLDGKHVVFGKVVKGMDVVEKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP  TVKIV+ GE  E
Sbjct  154   EKVGTADGKPLETVKIVDCGEFSE  177


 Score = 22.3 bits (46),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>gb|KDO68610.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=603

 Score = 86.7 bits (213),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL H+ PG+LSMA +  +  GS F +TF   HHLD K VVFGK+V G  ++KKI
Sbjct  47    FTDENFKLDHNGPGILSMANSGANTNGSQFFITFRRQHHLDGKHVVFGKVVKGLNIVKKI  106

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKI++ GE  E
Sbjct  107   EQVGTGDGKPAQPVKIIDCGEFSE  130


 Score = 22.3 bits (46),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  36    GTGGESIYGGKF  47



>ref|XP_010274264.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010274265.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
Length=696

 Score = 86.7 bits (213),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ HD PGLLSMA A +D  GS F +TF +  HLD K VVFGK+V G +V+KK+
Sbjct  94    FADENFKMLHDGPGLLSMANAGKDTNGSQFFITFKSARHLDGKHVVFGKVVQGMDVVKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGE  1153
             E VG   GK    VKIV+ GE
Sbjct  154   EQVGTSDGKSISLVKIVDCGE  174


 Score = 22.3 bits (46),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  1495  GESIYGGKF  1469
             GESIYGGKF
Sbjct  86    GESIYGGKF  94



>ref|XP_010274267.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X3 [Nelumbo nucifera]
Length=693

 Score = 86.7 bits (213),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ HD PGLLSMA A +D  GS F +TF +  HLD K VVFGK+V G +V+KK+
Sbjct  94    FADENFKMLHDGPGLLSMANAGKDTNGSQFFITFKSARHLDGKHVVFGKVVQGMDVVKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGE  1153
             E VG   GK    VKIV+ GE
Sbjct  154   EQVGTSDGKSISLVKIVDCGE  174


 Score = 22.3 bits (46),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  1495  GESIYGGKF  1469
             GESIYGGKF
Sbjct  86    GESIYGGKF  94



>gb|KDO68609.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=588

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 58/100 (58%), Gaps = 0/100 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FS    +    I    + DE  KL H+ PG+LSMA +  +  GS F +TF   HHLD K 
Sbjct  16    FSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNGSQFFITFRRQHHLDGKH  75

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHE  1144
             VVFGK+V G  ++KKIE VG   GKP   VKI++ GE  E
Sbjct  76    VVFGKVVKGLNIVKKIEQVGTGDGKPAQPVKIIDCGEFSE  115



>ref|XP_010274268.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X4 [Nelumbo nucifera]
Length=691

 Score = 86.3 bits (212),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ HD PGLLSMA A +D  GS F +TF +  HLD K VVFGK+V G +V+KK+
Sbjct  94    FADENFKMLHDGPGLLSMANAGKDTNGSQFFITFKSARHLDGKHVVFGKVVQGMDVVKKL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGE  1153
             E VG   GK    VKIV+ GE
Sbjct  154   EQVGTSDGKSISLVKIVDCGE  174


 Score = 22.3 bits (46),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  1495  GESIYGGKF  1469
             GESIYGGKF
Sbjct  86    GESIYGGKF  94



>ref|XP_006443958.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|ESR57198.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
Length=581

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 58/100 (58%), Gaps = 0/100 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FS    +    I    + DE  KL H+ PG+LSMA +  +  GS F +TF   HHLD K 
Sbjct  16    FSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNGSQFFITFRRQHHLDGKH  75

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHE  1144
             VVFGK+V G  ++KKIE VG   GKP   VKI++ GE  E
Sbjct  76    VVFGKVVKGLNIVKKIEQVGTGDGKPAQPVKIIDCGEFSE  115



>ref|XP_006443960.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479627.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479628.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Citrus sinensis]
 gb|ESR57200.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68607.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=650

 Score = 86.7 bits (213),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL H+ PG+LSMA +  +  GS F +TF   HHLD K VVFGK+V G  ++KKI
Sbjct  94    FTDENFKLDHNGPGILSMANSGANTNGSQFFITFRRQHHLDGKHVVFGKVVKGLNIVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E VG   GKP   VKI++ GE  E +
Sbjct  154   EQVGTGDGKPAQPVKIIDCGEFSESK  179


 Score = 22.3 bits (46),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|NP_001190888.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE86056.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=820

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 61/103 (59%), Gaps = 3/103 (3%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     M GSS    D +   +   +    I    + DE PKL+H+  GLLSM+IADR
Sbjct  60    KGSFFHRIMKGSSAQAGDFV---NRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADR  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNE  1198
             D  GS F +TF     LDR +VVFGKL+ G E+LKKIE VG+E
Sbjct  117   DKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILKKIERVGDE  159



>gb|KDO68608.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=658

 Score = 86.7 bits (213),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL H+ PG+LSMA +  +  GS F +TF   HHLD K VVFGK+V G  ++KKI
Sbjct  94    FTDENFKLDHNGPGILSMANSGANTNGSQFFITFRRQHHLDGKHVVFGKVVKGLNIVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E VG   GKP   VKI++ GE  E +
Sbjct  154   EQVGTGDGKPAQPVKIIDCGEFSESK  179


 Score = 22.3 bits (46),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_006604472.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X4 [Glycine max]
Length=640

 Score = 86.3 bits (212),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PG+LSMA +  +  GS F +TF    HLD K VVFGK+V+G ++LKKI
Sbjct  94    FVDENFKLTHDGPGVLSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVVNGMDILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKI++ GE+ E
Sbjct  154   EPVGTSDGKPTQPVKIIDCGEVSE  177


 Score = 22.3 bits (46),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_006604469.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Glycine max]
 ref|XP_006604470.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Glycine max]
Length=664

 Score = 86.3 bits (212),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PG+LSMA +  +  GS F +TF    HLD K VVFGK+V+G ++LKKI
Sbjct  94    FVDENFKLTHDGPGVLSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVVNGMDILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKI++ GE+ E
Sbjct  154   EPVGTSDGKPTQPVKIIDCGEVSE  177


 Score = 22.3 bits (46),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_006604471.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Glycine max]
 gb|KHN02546.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=659

 Score = 86.3 bits (212),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PG+LSMA +  +  GS F +TF    HLD K VVFGK+V+G ++LKKI
Sbjct  94    FVDENFKLTHDGPGVLSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVVNGMDILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKI++ GE+ E
Sbjct  154   EPVGTSDGKPTQPVKIIDCGEVSE  177


 Score = 22.3 bits (46),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_006604473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X5 [Glycine max]
Length=635

 Score = 86.3 bits (212),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PG+LSMA +  +  GS F +TF    HLD K VVFGK+V+G ++LKKI
Sbjct  94    FVDENFKLTHDGPGVLSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVVNGMDILKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKI++ GE+ E
Sbjct  154   EPVGTSDGKPTQPVKIIDCGEVSE  177


 Score = 22.3 bits (46),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_006443959.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479629.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Citrus sinensis]
 gb|ESR57199.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68606.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=643

 Score = 86.3 bits (212),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL H+ PG+LSMA +  +  GS F +TF   HHLD K VVFGK+V G  ++KKI
Sbjct  94    FTDENFKLDHNGPGILSMANSGANTNGSQFFITFRRQHHLDGKHVVFGKVVKGLNIVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E VG   GKP   VKI++ GE  E +
Sbjct  154   EQVGTGDGKPAQPVKIIDCGEFSESK  179


 Score = 22.3 bits (46),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_008366532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
 ref|XP_008366533.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=534

 Score = 86.3 bits (212),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K VVFGK+V G +V++K 
Sbjct  94    FADEXFKLKHDGPGLLSMANAGPNTNGSQFFIIFRHQPHLDGKHVVFGKVVKGMDVVEKT  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP  TVKIV+ GE  E
Sbjct  154   EKVGTADGKPLETVKIVDCGEFSE  177


 Score = 22.3 bits (46),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_008366534.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X2 [Malus domestica]
Length=533

 Score = 86.3 bits (212),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K VVFGK+V G +V++K 
Sbjct  94    FADEXFKLKHDGPGLLSMANAGPNTNGSQFFIIFRHQPHLDGKHVVFGKVVKGMDVVEKT  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP  TVKIV+ GE  E
Sbjct  154   EKVGTADGKPLETVKIVDCGEFSE  177


 Score = 22.3 bits (46),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_008359381.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
B-like [Malus domestica]
Length=324

 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K VVFGK+V G +V++K 
Sbjct  113   FADEXFKLKHDGPGLLSMANAGPNTNGSQFFIIFRHQPHLDGKHVVFGKVVKGMDVVEKT  172

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP  TVKIV+ GE  E
Sbjct  173   EKVGTADGKPLETVKIVDCGEFSE  196



>ref|XP_008350049.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8-like [Malus 
domestica]
Length=621

 Score = 85.9 bits (211),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PGLLSMA A  +  GS F + F    HLD K VVFGK+V G +V++K 
Sbjct  181   FADEXFKLKHDGPGLLSMANAGPNTNGSQFFIIFRHQPHLDGKHVVFGKVVKGMDVVEKT  240

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP  TVKIV+ GE  E
Sbjct  241   EKVGTADGKPLETVKIVDCGEFSE  264


 Score = 21.9 bits (45),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  170   GTGGESIYGGKF  181



>ref|XP_009370747.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Pyrus x 
bretschneideri]
Length=535

 Score = 85.5 bits (210),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   LKHD PGLLSMA A  +  GS F + F    HLD K VVFGK+V G +V++KI
Sbjct  94    FADENFNLKHDRPGLLSMANAGPNTNGSQFFIIFRRQPHLDGKHVVFGKVVKGMDVVEKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP  TVKIV+ GE  E
Sbjct  154   EKVGTADGKPLETVKIVDCGEFSE  177


 Score = 22.3 bits (46),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  1495  GESIYGGKF  1469
             GESIYGGKF
Sbjct  86    GESIYGGKF  94



>ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
Length=842

 Score = 86.3 bits (212),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   L+HD PGLLSMA A RD  GS F +TF A  HLD K VVFGKL  G E L+ I
Sbjct  94    FPDENFILRHDGPGLLSMANAGRDTNGSQFFITFKAAPHLDGKHVVFGKLRSGEESLRNI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             E+V  +  KP V VKI N GE +  +  G
Sbjct  154   EHVEVDGSKPVVPVKITNCGEFNASKDHG  182



>ref|XP_010432723.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Camelina sativa]
Length=808

 Score = 86.3 bits (212),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 70/128 (55%), Gaps = 13/128 (10%)
 Frame = -1

Query  1506  QGTLEKVYMVGSSQVEADLI*FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADR  1327
             +G+     + GSS    D +   +   +    I    + DE PKL+HD  GLLSM++ADR
Sbjct  60    KGSFFHRILKGSSAQAGDFV---NRDGTAGESIYAGKFPDESPKLRHDEAGLLSMSVADR  116

Query  1326  DIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELH  1147
             D  GS F +TF     LDR +VVFGKL+ G E+L+KIE  G+E  K + +          
Sbjct  117   DKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILRKIERAGDEEDKKNDS----------  166

Query  1146  EGRHKGKH  1123
             +GR KGKH
Sbjct  167   DGRKKGKH  174



>ref|XP_009126026.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Brassica rapa]
 ref|XP_009126034.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Brassica rapa]
 ref|XP_009126041.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Brassica rapa]
Length=650

 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M +A+RD  GS F +TF   H LDRK+VVFGKL+ G EVLKKIE+VG+E GKP VTVKI+
Sbjct  1     MDVAERDKFGSHFHITFRPNHQLDRKNVVFGKLIQGKEVLKKIEHVGDEEGKPTVTVKII  60

Query  1164  NSGEL  1150
               GE 
Sbjct  61    RCGEY  65



>ref|XP_010326423.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Solanum lycopersicum]
Length=591

 Score = 79.3 bits (194),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ H   GLLSMA +  +  GS F + F    HLD K VVFGK+V G +++KKI
Sbjct  25    FPDENFKVAHAEAGLLSMANSGPNTNGSQFFIIFKRTPHLDGKHVVFGKVVKGMDLVKKI  84

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G + GKP   VKIV+ GEL E
Sbjct  85    EQLGTDSGKPSGLVKIVDCGELSE  108


 Score = 28.1 bits (61),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 2/23 (9%)
 Frame = -3

Query  1534  CN*DVICCFTGNFGESIYGGKFP  1466
             CN  V    TG  GESIYGGKFP
Sbjct  6     CNKRVYGTSTG--GESIYGGKFP  26



>tpg|DAA59762.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
Length=340

 Score = 82.0 bits (201),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL H+ PG+LSMA +     GS F +TF AL HLD K VVFGK+V G  +LK +
Sbjct  94    FPDENFKLLHNQPGVLSMANSGPGTNGSQFFITFKALPHLDGKHVVFGKVVSGIALLKNL  153

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E  G+E G P   VKIV+ GE+
Sbjct  154   EAAGSETGNPSCQVKIVDCGEV  175


 Score = 24.6 bits (52),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GKGGESIYGGKFP  95



>dbj|BAJ98045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score = 84.7 bits (208),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   L+HD  GLLSMA A R+  GS F +TF    HLDRK+ VFGKL+ G++VLK+I
Sbjct  99    FEDENFVLRHDDRGLLSMANAGRNTNGSQFFITFKPNSHLDRKNTVFGKLILGNDVLKRI  158

Query  1215  E--NVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             E  +V     KP V V+IV+ G+L +G+ +G
Sbjct  159   EHVDVDGSTNKPIVPVRIVDCGQLVDGKGRG  189



>emb|CDP03680.1| unnamed protein product [Coffea canephora]
Length=664

 Score = 81.3 bits (199),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL H   GLLSMA +  +  GS F +TF    HLD K VVFGK+V G EV++++
Sbjct  94    FPDENFKLDHSEAGLLSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVVEGMEVIRRV  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKIV+SGE  +
Sbjct  154   ERVGTADGKPSGVVKIVDSGETSQ  177


 Score = 25.0 bits (53),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTGGESIYGGKFP  95



>ref|XP_010437914.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Camelina sativa]
Length=696

 Score = 85.1 bits (209),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M++ADRD  GS F +TF     LDR +VVFGKL+ G EVLKKIE  G+E GKP V+VKI+
Sbjct  1     MSVADRDKFGSHFHLTFRPNQQLDRSNVVFGKLIQGKEVLKKIERAGDEEGKPTVSVKII  60

Query  1164  NSGEL-------HEGRHKGKH  1123
               GE         +GR KGKH
Sbjct  61    RCGENSGDKKIDSDGRKKGKH  81



>ref|XP_010038050.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Eucalyptus grandis]
 gb|KCW49849.1| hypothetical protein EUGRSUZ_K03321 [Eucalyptus grandis]
Length=664

 Score = 84.0 bits (206),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PGLLSMA    +  GS F + F    HLD K VVFGK++ G EV+KKI
Sbjct  94    FADENFKLAHDGPGLLSMANGGPNTNGSQFFIIFKRQPHLDGKHVVFGKVMRGMEVVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG+  GKP   VKIV+ GE  E
Sbjct  154   EQVGSANGKPLQPVKIVDCGETSE  177


 Score = 22.3 bits (46),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_010038051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Eucalyptus grandis]
Length=661

 Score = 84.0 bits (206),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL HD PGLLSMA    +  GS F + F    HLD K VVFGK++ G EV+KKI
Sbjct  94    FADENFKLAHDGPGLLSMANGGPNTNGSQFFIIFKRQPHLDGKHVVFGKVMRGMEVVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG+  GKP   VKIV+ GE  E
Sbjct  154   EQVGSANGKPLQPVKIVDCGETSE  177


 Score = 22.3 bits (46),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_004493728.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Cicer arietinum]
Length=642

 Score = 83.6 bits (205),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PG+LSMA +  +  GS F + F    HLD K VVFGK+  G E+LKK+
Sbjct  71    FADENVKLKHDGPGILSMANSGPNTNGSQFFIIFKRQPHLDGKHVVFGKVAKGLEILKKM  130

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E +G   GKP   +KIV+ GE+ + +
Sbjct  131   EQLGTSDGKPAQPIKIVDCGEISKAK  156


 Score = 22.3 bits (46),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  60    GTGGESIYGGKF  71



>ref|XP_004493727.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Cicer arietinum]
Length=665

 Score = 83.6 bits (205),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PG+LSMA +  +  GS F + F    HLD K VVFGK+  G E+LKK+
Sbjct  94    FADENVKLKHDGPGILSMANSGPNTNGSQFFIIFKRQPHLDGKHVVFGKVAKGLEILKKM  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E +G   GKP   +KIV+ GE+ + +
Sbjct  154   EQLGTSDGKPAQPIKIVDCGEISKAK  179


 Score = 22.3 bits (46),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|NP_001119097.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE86055.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=727

 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M+IADRD  GS F +TF     LDR +VVFGKL+ G E+LKKIE VG+E GKP V+VKI+
Sbjct  1     MSIADRDKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILKKIERVGDEEGKPTVSVKII  60

Query  1164  NSGEL  1150
               GE 
Sbjct  61    RCGEY  65



>ref|XP_010447393.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Camelina sativa]
Length=714

 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M++ADRD  GS F +TF     LDR +VVFGKL+ G EVLKKIE  G+E GKP V+VKI+
Sbjct  1     MSVADRDKFGSHFHLTFRPNQQLDRNNVVFGKLIQGKEVLKKIERAGDEEGKPTVSVKII  60

Query  1164  NSGEL-------HEGRHKGKH  1123
               GE         +GR KGKH
Sbjct  61    RCGENSGDKKNDSDGRKKGKH  81



>gb|KDP21391.1| hypothetical protein JCGZ_21862 [Jatropha curcas]
Length=716

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   LKHD PGLLSMA +  +  GS F VTF    HLD K VVFGK++ G +V+KKI
Sbjct  94    FADENFILKHDEPGLLSMANSGPNTNGSQFFVTFKRQPHLDGKHVVFGKVIKGLDVVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKIV+ GE  E
Sbjct  154   EQVGTGDGKPIRPVKIVDCGETFE  177



>gb|KEH23833.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=651

 Score = 82.8 bits (203),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKHD PG+LSMA +  +  GS F + F    HLD K VVFGK+  G E+LKK+
Sbjct  94    FADENFKLKHDGPGVLSMANSGPNTNGSQFFIIFKRQAHLDGKHVVFGKVTKGIEILKKM  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRHK  1132
             E +G   GKP   +KIV+ GE+ + + +
Sbjct  154   EQLGTADGKPTQPIKIVDCGEVSKAKSQ  181


 Score = 22.3 bits (46),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_008651149.1| PREDICTED: uncharacterized protein LOC100274576 isoform X1 [Zea 
mays]
Length=649

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FSS        I    + DE  KL H+ PG+LSMA +     GS F +TF AL HLD K 
Sbjct  78    FSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQFFITFKALPHLDGKH  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             VVFGK+V G  +LK +E  G+E G P   VKIV+ GE+
Sbjct  138   VVFGKVVSGIALLKNLEAAGSETGNPSCQVKIVDCGEV  175



>ref|XP_008651150.1| PREDICTED: uncharacterized protein LOC100274576 isoform X2 [Zea 
mays]
 tpg|DAA59759.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
Length=648

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FSS        I    + DE  KL H+ PG+LSMA +     GS F +TF AL HLD K 
Sbjct  78    FSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQFFITFKALPHLDGKH  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             VVFGK+V G  +LK +E  G+E G P   VKIV+ GE+
Sbjct  138   VVFGKVVSGIALLKNLEAAGSETGNPSCQVKIVDCGEV  175



>ref|XP_008651151.1| PREDICTED: uncharacterized protein LOC100274576 isoform X3 [Zea 
mays]
 tpg|DAA59760.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
 tpg|DAA59761.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
Length=621

 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FSS        I    + DE  KL H+ PG+LSMA +     GS F +TF AL HLD K 
Sbjct  78    FSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQFFITFKALPHLDGKH  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             VVFGK+V G  +LK +E  G+E G P   VKIV+ GE+
Sbjct  138   VVFGKVVSGIALLKNLEAAGSETGNPSCQVKIVDCGEV  175



>ref|XP_003739714.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
E-like [Metaseiulus occidentalis]
Length=324

 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             +NDE   LKH  PG+LSMA + R+  GS F +T      LD K VVFG++  G E+LKK+
Sbjct  242   FNDENFVLKHTGPGILSMANSGRNTNGSQFFMTTARTEWLDDKHVVFGQVTAGLEILKKM  301

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E  G   G+P  TV+IVN GEL
Sbjct  302   EACGTTSGQPKTTVQIVNCGEL  323



>ref|XP_010679137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=661

 Score = 82.4 bits (202),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL+H   G LSMA   RD  GS F +TF    HLD K VVFGK+V G +V+K I
Sbjct  94    FADENFKLEHTGTGFLSMANCGRDTNGSQFFITFKRTPHLDGKHVVFGKVVEGMDVVKNI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRH  1135
             E  G   G+P   VKI + GE+  G++
Sbjct  154   EQFGTSEGQPTKQVKIADCGEVSSGKN  180


 Score = 22.3 bits (46),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_010679138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=659

 Score = 82.4 bits (202),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL+H   G LSMA   RD  GS F +TF    HLD K VVFGK+V G +V+K I
Sbjct  94    FADENFKLEHTGTGFLSMANCGRDTNGSQFFITFKRTPHLDGKHVVFGKVVEGMDVVKNI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRH  1135
             E  G   G+P   VKI + GE+  G++
Sbjct  154   EQFGTSEGQPTKQVKIADCGEVSSGKN  180


 Score = 22.3 bits (46),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_010679140.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=658

 Score = 82.4 bits (202),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL+H   G LSMA   RD  GS F +TF    HLD K VVFGK+V G +V+K I
Sbjct  94    FADENFKLEHTGTGFLSMANCGRDTNGSQFFITFKRTPHLDGKHVVFGKVVEGMDVVKNI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGRH  1135
             E  G   G+P   VKI + GE+  G++
Sbjct  154   EQFGTSEGQPTKQVKIADCGEVSSGKN  180


 Score = 22.3 bits (46),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_010432724.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X5 [Camelina sativa]
Length=715

 Score = 83.6 bits (205),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = -1

Query  1344  MAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIV  1165
             M++ADRD  GS F +TF     LDR +VVFGKL+ G E+L+KIE  G+E GKP V+VKI+
Sbjct  1     MSVADRDKFGSHFHITFRPNQQLDRNNVVFGKLIQGKEILRKIERAGDEEGKPTVSVKII  60

Query  1164  NSGEL-------HEGRHKGKH  1123
               GE         +GR KGKH
Sbjct  61    RCGENSGDKKNDSDGRKKGKH  81



>ref|XP_007050461.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOX94618.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
Length=557

 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  1389  DELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIEN  1210
             DE  KL HD PG+LSMA +  +  GS F +TF    HLD K VVFGK++ G +VLKKIE 
Sbjct  96    DENFKLAHDGPGVLSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVIKGMDVLKKIEQ  155

Query  1209  VGNEVGKPDVTVKIVNSGELHE  1144
             VG   GKP   VKI + GE  E
Sbjct  156   VGTGDGKPAKPVKISDCGETSE  177



>ref|XP_009798525.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Nicotiana sylvestris]
Length=589

 Score = 78.6 bits (192),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ H   GLLSMA +  +  GS F +TF    HLD K VVFGK+V G + +KKI
Sbjct  23    FPDENFKVVHTGAGLLSMANSGPNTNGSQFFITFKRTPHLDGKHVVFGKVVKGMDFVKKI  82

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E VG   GKP   VKIV+ GE+ + R
Sbjct  83    EQVGTADGKPSGLVKIVDCGEMSDER  108


 Score = 25.4 bits (54),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  12    GTGGESIYGGKFP  24



>ref|XP_007050460.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX94617.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
Length=676

 Score = 82.8 bits (203),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  1389  DELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKIEN  1210
             DE  KL HD PG+LSMA +  +  GS F +TF    HLD K VVFGK++ G +VLKKIE 
Sbjct  96    DENFKLAHDGPGVLSMANSGPNTNGSQFFITFKRQPHLDGKHVVFGKVIKGMDVLKKIEQ  155

Query  1209  VGNEVGKPDVTVKIVNSGELHE  1144
             VG   GKP   VKI + GE  E
Sbjct  156   VGTGDGKPAKPVKISDCGETSE  177



>ref|XP_004247203.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Solanum lycopersicum]
Length=660

 Score = 79.0 bits (193),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ H   GLLSMA +  +  GS F + F    HLD K VVFGK+V G +++KKI
Sbjct  94    FPDENFKVAHAEAGLLSMANSGPNTNGSQFFIIFKRTPHLDGKHVVFGKVVKGMDLVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G + GKP   VKIV+ GEL E
Sbjct  154   EQLGTDSGKPSGLVKIVDCGELSE  177


 Score = 25.0 bits (53),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTGGESIYGGKFP  95



>ref|XP_006349731.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Solanum 
tuberosum]
Length=658

 Score = 78.6 bits (192),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ H   GLLSMA +  +  GS F + F    HLD K VVFGK+V G +++KKI
Sbjct  94    FPDENFKVAHTEAGLLSMANSGPNTNGSQFFIIFKRTPHLDGKHVVFGKVVKGMDLVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G + GKP   VKIV+ GE+ E
Sbjct  154   EQLGTDSGKPSGLVKIVDCGEMSE  177


 Score = 25.0 bits (53),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTGGESIYGGKFP  95



>ref|XP_009798520.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798521.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798522.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
Length=660

 Score = 78.2 bits (191),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ H   GLLSMA +  +  GS F +TF    HLD K VVFGK+V G + +KKI
Sbjct  94    FPDENFKVVHTGAGLLSMANSGPNTNGSQFFITFKRTPHLDGKHVVFGKVVKGMDFVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E VG   GKP   VKIV+ GE+ + R
Sbjct  154   EQVGTADGKPSGLVKIVDCGEMSDER  179


 Score = 25.0 bits (53),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTGGESIYGGKFP  95



>ref|XP_009798524.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Nicotiana sylvestris]
Length=660

 Score = 78.2 bits (191),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ H   GLLSMA +  +  GS F +TF    HLD K VVFGK+V G + +KKI
Sbjct  94    FPDENFKVVHTGAGLLSMANSGPNTNGSQFFITFKRTPHLDGKHVVFGKVVKGMDFVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E VG   GKP   VKIV+ GE+ + R
Sbjct  154   EQVGTADGKPSGLVKIVDCGEMSDER  179


 Score = 25.0 bits (53),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTGGESIYGGKFP  95



>ref|XP_006647052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=847

 Score = 82.0 bits (201),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE   L+HD  GLLSMA A  +  GS F +TF     LDRKS VFGKL+ G++VLK+
Sbjct  93    TFEDENFDLRHDDRGLLSMANAGPNANGSQFFITFKHNSRLDRKSTVFGKLILGNDVLKR  152

Query  1218  IE--NVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             IE  +V      P V V+IV+ GEL +GRH G
Sbjct  153   IEYVDVHGAGATPVVPVRIVDCGELVDGRHHG  184



>ref|XP_006647053.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=845

 Score = 82.0 bits (201),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE   L+HD  GLLSMA A  +  GS F +TF     LDRKS VFGKL+ G++VLK+
Sbjct  93    TFEDENFDLRHDDRGLLSMANAGPNANGSQFFITFKHNSRLDRKSTVFGKLILGNDVLKR  152

Query  1218  IE--NVGNEVGKPDVTVKIVNSGELHEGRHKG  1129
             IE  +V      P V V+IV+ GEL +GRH G
Sbjct  153   IEYVDVHGAGATPVVPVRIVDCGELVDGRHHG  184



>gb|AJA29688.1| peptidyl-prolyl cis-trans isomerase [Betula luminifera]
Length=695

 Score = 81.6 bits (200),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -1

Query  1443  FSSMGASMLLDICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKS  1264
             FSS   +    I    + DE  +LKHD  G+LSMA    +  GS F +TF    HLD K 
Sbjct  78    FSSGDGTGGESIYGGKFADENFRLKHDGAGVLSMANCGLNTNGSQFFITFKRQPHLDGKH  137

Query  1263  VVFGKLVHGHEVLKKIENVGNEVGKPDVTVKIVNSGELHEGR  1138
             VVFGK+V G E+LKKIE  G   GKP   VKIV+ G+  E +
Sbjct  138   VVFGKVVKGIEILKKIELAGTAEGKPARPVKIVDCGKTSESK  179



>ref|XP_009601158.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana tomentosiformis]
Length=662

 Score = 77.8 bits (190),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ H   G+LSMA +  +  GS F +TF    HLD K VVFGK+V G + +KKI
Sbjct  94    FPDENFKVDHTEAGILSMANSGPNTNGSQFFITFKRTPHLDGKHVVFGKVVKGMDFVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E +G   GKP   VKIV+ GE+ E R
Sbjct  154   EQLGTADGKPSGLVKIVDCGEMSEER  179


 Score = 25.0 bits (53),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTGGESIYGGKFP  95



>ref|XP_009601160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Nicotiana tomentosiformis]
Length=661

 Score = 77.8 bits (190),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+ H   G+LSMA +  +  GS F +TF    HLD K VVFGK+V G + +KKI
Sbjct  94    FPDENFKVDHTEAGILSMANSGPNTNGSQFFITFKRTPHLDGKHVVFGKVVKGMDFVKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E +G   GKP   VKIV+ GE+ E R
Sbjct  154   EQLGTADGKPSGLVKIVDCGEMSEER  179


 Score = 25.0 bits (53),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKFP  1466
             G  GESIYGGKFP
Sbjct  83    GTGGESIYGGKFP  95



>ref|XP_009014518.1| hypothetical protein HELRODRAFT_156722 [Helobdella robusta]
 gb|ESO07140.1| hypothetical protein HELRODRAFT_156722 [Helobdella robusta]
Length=164

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +LKH  PG+LSMA A ++  GS F +       LD K VVFGK+V G++V+KK+
Sbjct  83    FEDENFQLKHTEPGILSMANAGKNTNGSQFFICTAKTEWLDNKHVVFGKVVEGYDVIKKV  142

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E+ G++ GK    +KI N G+L
Sbjct  143   ESYGSQSGKTKEAIKIANCGQL  164



>gb|EMT10283.1| Peptidyl-prolyl cis-trans isomerase G [Aegilops tauschii]
Length=536

 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE   L+HD  GLLSMA A R+  GS F +TF    HLDRK+ VFGKL+ G++VLK+I
Sbjct  133   FEDENFVLRHDDRGLLSMANAGRNTNGSQFFITFKPNSHLDRKNTVFGKLILGNDVLKRI  192

Query  1215  E--NVGNEVGKPDVTVKIVNSGEL  1150
             E  +V     KP V V+IV+ GEL
Sbjct  193   EHVDVDGSTNKPIVPVRIVDCGEL  216



>gb|ACF87276.1| unknown [Zea mays]
Length=106

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -1

Query  1410  ICFLSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHE  1231
             I  L + DE  K+KH  PGLLSMA A RD  GS F +T      LD K VVFGK++ G +
Sbjct  18    IYGLKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWLDGKHVVFGKVLSGMD  77

Query  1230  VLKKIENVGNEVGKPDVTVKIVNSGEL  1150
             V+ K+E  G + G+P   V I +SGEL
Sbjct  78    VVYKVEAEGRQSGEPKSKVVIADSGEL  104



>ref|XP_005646868.1| hypothetical protein COCSUDRAFT_29609 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22324.1| hypothetical protein COCSUDRAFT_29609 [Coccomyxa subellipsoidea 
C-169]
Length=261

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  K+KH  PG LSMA A ++  GS F +T  A  HLD K VVFG+++ G +++ +I
Sbjct  177   FDDENFKMKHTEPGTLSMANAGKNTNGSQFFITTVATPHLDGKHVVFGRVIEGMDLVHEI  236

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E+VG+  GKP V V I +SGEL
Sbjct  237   ESVGDSSGKPRVPVTIADSGEL  258



>emb|CDY52123.1| BnaA10g29520D [Brassica napus]
 emb|CDX80340.1| BnaC09g34020D [Brassica napus]
Length=204

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE  KLKH  PG LSMA A +D  GS F +T      LD + VVFGK+V G +V+ K
Sbjct  120   TFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVSGMDVVYK  179

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             IE  GN+ G P   V IV+SGEL
Sbjct  180   IEAEGNQSGTPKSKVVIVDSGEL  202



>ref|XP_011079927.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Sesamum 
indicum]
Length=696

 Score = 79.7 bits (195),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KL H  PG LSMA    +  GS F +TF    HLD K VVFGK+V G +V+KK+
Sbjct  94    FADENFKLDHSGPGFLSMANGGPNTNGSQFFITFKRQPHLDGKHVVFGKVVKGMDVVKKM  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHEGR  1138
             E +G   G+P   VKIV+ GE+ + +
Sbjct  154   EQLGTADGRPAGVVKIVDCGEMSKAK  179


 Score = 22.3 bits (46),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_006401051.1| hypothetical protein EUTSA_v10014704mg [Eutrema salsugineum]
 gb|ESQ42504.1| hypothetical protein EUTSA_v10014704mg [Eutrema salsugineum]
Length=204

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE  KLKH  PG LSMA A +D  GS F +T      LD + VVFGK+V G +V+ K
Sbjct  120   TFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYK  179

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             IE  GN+ G P   V IV+SGEL
Sbjct  180   IEAEGNQSGTPKSKVVIVDSGEL  202



>ref|XP_009120386.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Brassica 
rapa]
Length=205

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE  KLKH  PG LSMA A +D  GS F +T      LD + VVFGK+V G +V+ K
Sbjct  121   TFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYK  180

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             IE  GN+ G P   V IV+SGEL
Sbjct  181   IEAEGNQSGTPKSKVVIVDSGEL  203



>ref|XP_002280876.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Vitis vinifera]
Length=702

 Score = 79.3 bits (194),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K  H+ PG LSMA +  +  GS F +TF    HLD K VVFGK+V G + LKKI
Sbjct  94    FADENFKRAHEGPGFLSMANSGPNTNGSQFFMTFKRQPHLDGKHVVFGKVVQGIDTLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G   GKP   VKIV+ GE  E
Sbjct  154   EQLGTGDGKPARLVKIVDCGETSE  177


 Score = 22.7 bits (47),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_002864586.1| hypothetical protein ARALYDRAFT_495994 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40845.1| hypothetical protein ARALYDRAFT_495994 [Arabidopsis lyrata subsp. 
lyrata]
Length=204

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE  KLKH  PG LSMA A +D  GS F +T      LD + VVFGK+V G +V+ K
Sbjct  120   TFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYK  179

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             IE  GN+ G P   V IV+SGEL
Sbjct  180   IEAEGNQSGTPKSKVVIVDSGEL  202



>ref|XP_010646137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Vitis vinifera]
 emb|CBI25055.3| unnamed protein product [Vitis vinifera]
Length=700

 Score = 79.3 bits (194),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K  H+ PG LSMA +  +  GS F +TF    HLD K VVFGK+V G + LKKI
Sbjct  94    FADENFKRAHEGPGFLSMANSGPNTNGSQFFMTFKRQPHLDGKHVVFGKVVQGIDTLKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G   GKP   VKIV+ GE  E
Sbjct  154   EQLGTGDGKPARLVKIVDCGETSE  177


 Score = 22.3 bits (46),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -3

Query  1504  GNFGESIYGGKF  1469
             G  GESIYGGKF
Sbjct  83    GTGGESIYGGKF  94



>ref|XP_004992532.1| peptidyl-prolyl cis-trans isomerase E [Salpingoeca rosetta]
 gb|EGD74887.1| peptidyl-prolyl cis-trans isomerase E [Salpingoeca rosetta]
Length=295

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE   LKH  PG LSMA +  +  GS F +TF     LD + VVFG +V G+ +LK+
Sbjct  213   TFRDENFDLKHQGPGTLSMANSGSNTNGSQFFLTFAKTDWLDGRHVVFGHVVEGNSLLKR  272

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             IE+VG E GKP   VKIV  GEL
Sbjct  273   IEDVGTESGKPTKKVKIVACGEL  295



>emb|CBK24925.2| unnamed protein product [Blastocystis hominis]
Length=202

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KLKH  PG+LSMA A  D  GS F +T      LD + VVFGK++ G E++K+I
Sbjct  121   FSDENFKLKHTGPGILSMANAGPDTNGSQFFITTVKTQWLDGRHVVFGKVIEGMEIVKQI  180

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E VG   G P   V IV+SGEL
Sbjct  181   EAVGTGSGTPTKKVVIVDSGEL  202



>ref|XP_006402278.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 ref|XP_006402279.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43731.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43732.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
Length=384

 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE  KL HD  G+LSMA    +  GS F + F    HLD K VVFGK+V G E +KKI
Sbjct  94    FSDENFKLDHDGAGVLSMANCGPNTNGSQFFILFKRQPHLDGKHVVFGKVVKGMEFIKKI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E VG   GKP   VKI++ GE+ +
Sbjct  154   ELVGTSDGKPTTHVKIIDCGEMSQ  177



>emb|CAD10797.1| putative cyclophilin [Pleurotus sp. 'Florida']
Length=164

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +LKH  PGLLSMA A ++  GS F +T      LD   VVFG++V G +++KKI
Sbjct  83    FADENFQLKHTKPGLLSMANAGKNTNGSQFFITTVVTSWLDGAHVVFGEVVEGFDIVKKI  142

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E  G++ GKP  T+KI  SG +
Sbjct  143   EGYGSQSGKPSATIKISASGTV  164



>gb|KDQ25375.1| hypothetical protein PLEOSDRAFT_186045 [Pleurotus ostreatus PC15]
Length=162

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +LKH  PGLLSMA A ++  GS F +T      LD   VVFG++V G +++KKI
Sbjct  81    FADENFQLKHTKPGLLSMANAGKNTNGSQFFITTVVTSWLDGAHVVFGEVVEGFDIVKKI  140

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E  G++ GKP  T+KI  SG +
Sbjct  141   EGYGSQSGKPSATIKISASGTV  162



>gb|KDD76228.1| hypothetical protein H632_c307p0 [Helicosporidium sp. ATCC 50920]
Length=168

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKH++PGLLSMA A  D  GS F +       LD K VVFG++V G  VLK +
Sbjct  23    FEDENFKLKHNAPGLLSMANAGPDTNGSQFFLCTEECPWLDGKHVVFGRVVEGMAVLKMM  82

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E+ G+  GKP   V I + GEL E
Sbjct  83    ESKGSRSGKPSARVLIADCGELLE  106



>ref|XP_010443618.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X1 [Camelina sativa]
 ref|XP_010443619.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Camelina sativa]
Length=204

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE  KLKH  PG LSMA A +D  GS F +T      LD + VVFGK+V G +V+ K
Sbjct  120   TFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYK  179

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             +E  GN+ G P   V IV+SGEL
Sbjct  180   VEAEGNQSGTPKSKVVIVDSGEL  202



>ref|XP_010483473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Camelina 
sativa]
Length=204

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE  KLKH  PG LSMA A +D  GS F +T      LD + VVFGK+V G +V+ K
Sbjct  120   TFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYK  179

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             +E  GN+ G P   V IV+SGEL
Sbjct  180   VEAEGNQSGTPKSKVVIVDSGEL  202



>ref|XP_006281118.1| hypothetical protein CARUB_v10027149mg [Capsella rubella]
 gb|EOA14016.1| hypothetical protein CARUB_v10027149mg [Capsella rubella]
Length=204

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE  KLKH  PG LSMA A +D  GS F +T      LD + VVFGK+V G +V+ K
Sbjct  120   TFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYK  179

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             +E  GN+ G P   V IV+SGEL
Sbjct  180   VEAEGNQSGTPKSKVVIVDSGEL  202



>ref|XP_002520955.1| cyclophilin, putative [Ricinus communis]
 gb|EEF41372.1| cyclophilin, putative [Ricinus communis]
Length=688

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             ++DE   LKHD  G LSMA +  +  GS F +TF     LDRK VVFGK++ G EV+K+I
Sbjct  94    FSDENFILKHDGAGFLSMANSGPNTNGSQFFITFKRQPQLDRKHVVFGKVIKGIEVVKRI  153

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G   GKP   VKIV+ GE  E
Sbjct  154   EQLGTADGKPVHPVKIVDCGETSE  177



>ref|XP_002437567.1| hypothetical protein SORBIDRAFT_10g029480 [Sorghum bicolor]
 gb|EER88934.1| hypothetical protein SORBIDRAFT_10g029480 [Sorghum bicolor]
Length=215

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -1

Query  1401  LSYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLK  1222
             L + DE  K+KH  PGLLSMA A RD  GS F +T      LD K VVFGK++ G +V+ 
Sbjct  130   LKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWLDGKHVVFGKVLSGMDVVY  189

Query  1221  KIENVGNEVGKPDVTVKIVNSGEL  1150
             K+E  G + G+P   V I +SGEL
Sbjct  190   KVEAEGRQSGQPKSKVVITDSGEL  213



>emb|CAN75764.1| hypothetical protein VITISV_034442 [Vitis vinifera]
Length=786

 Score = 78.2 bits (191),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K  H+ PG LSMA +  +  GS F +TF    HLD K VVFGK+V G + LKKI
Sbjct  121   FADENFKRAHEGPGFLSMANSGPNTNGSQFFMTFKRQPHLDGKHVVFGKVVQGIDTLKKI  180

Query  1215  ENVGNEVGKPDVTVKIVNSGELHE  1144
             E +G   GKP   VKIV+ GE  E
Sbjct  181   EQLGTGDGKPARLVKIVDCGETSE  204


 Score = 22.3 bits (46),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  1495  GESIYGGKF  1469
             GESIYGGKF
Sbjct  113   GESIYGGKF  121



>ref|XP_010535384.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Tarenaya 
hassleriana]
Length=204

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  1398  SYNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKK  1219
             ++ DE  K+KH  PGLLSMA A +D  GS F +T      LD + VVFGK+V G +V+ K
Sbjct  120   TFPDENFKIKHTGPGLLSMANAGKDTNGSQFFITTVTTSWLDGRHVVFGKVVSGMDVVYK  179

Query  1218  IENVGNEVGKPDVTVKIVNSGEL  1150
             IE  GN+ G P   V I +SGEL
Sbjct  180   IEAEGNQSGTPKSNVVITDSGEL  202



>ref|WP_030289924.1| MULTISPECIES: peptidylprolyl isomerase [Streptomyces]
Length=164

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  +LKHD PGLLSMA A R+  GS F +T      LD K VVFG++V G +++KKI
Sbjct  82    FADENFQLKHDRPGLLSMANAGRNTNGSQFFITTIVTDWLDGKHVVFGEVVEGMDIVKKI  141

Query  1215  ENVGNEVGKPDVTVKIVNSG  1156
             E +G++ G+    +KI  SG
Sbjct  142   EGLGSQSGRTSAAIKIAKSG  161



>ref|XP_006656475.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Oryza 
brachyantha]
Length=215

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  K+KH  PGLLSMA A RD  GS F +T      LD K VVFGK++ G +V+ KI
Sbjct  132   FADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWLDGKHVVFGKVLSGMDVVYKI  191

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E  G + G P   V I +SGEL
Sbjct  192   EAEGQQTGSPKSKVVIADSGEL  213



>ref|NP_200679.1| cyclophilin ROC7 [Arabidopsis thaliana]
 sp|Q9SP02.1|CP20A_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP20-1; Short=PPIase 
CYP20-1; AltName: Full=Cyclophilin of 20 kDa 1; AltName: 
Full=Rotamase CYP20-1; AltName: Full=Rotamase cyclophilin-7; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF05760.1|AF192490_1 cyclophilin [Arabidopsis thaliana]
 dbj|BAA97339.1| cyclophilin [Arabidopsis thaliana]
 gb|AAK82490.1| AT5g58710/mzn1_160 [Arabidopsis thaliana]
 gb|AAM16173.1| AT5g58710/mzn1_160 [Arabidopsis thaliana]
 gb|AAM63473.1| cyclophilin ROC7 [Arabidopsis thaliana]
 gb|AED97088.1| cyclophilin ROC7 [Arabidopsis thaliana]
Length=204

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -1

Query  1395  YNDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHLDRKSVVFGKLVHGHEVLKKI  1216
             + DE  KLKH  PG LSMA A +D  GS F +T      LD + VVFGK+V G +V+ K+
Sbjct  121   FADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYKV  180

Query  1215  ENVGNEVGKPDVTVKIVNSGEL  1150
             E  GN+ G P   V IV+SGEL
Sbjct  181   EAEGNQSGTPKSKVVIVDSGEL  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5599886480952