BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23772_g6_i1 len=849 path=[3199:0-236 470:237-286 3485:287-581
681:582-605 3803:606-848]

Length=849
                                                                      Score     E

ref|XP_009629647.1|  PREDICTED: pollen-specific protein SF3-like ...    321   1e-106   
ref|XP_009629648.1|  PREDICTED: pollen-specific protein SF3-like ...    320   1e-106   
ref|XP_009779198.1|  PREDICTED: pollen-specific protein SF3-like        320   2e-106   
ref|NP_001288583.1|  uncharacterized protein LOC101266456               319   7e-106   
ref|XP_006339787.1|  PREDICTED: pollen-specific protein SF3-like        315   2e-104   
emb|CDP08845.1|  unnamed protein product                                314   5e-104   
ref|XP_009762983.1|  PREDICTED: pollen-specific protein SF3-like        314   5e-104   
ref|XP_009601147.1|  PREDICTED: pollen-specific protein SF3-like        311   5e-103   
ref|XP_011093154.1|  PREDICTED: LIM domain-containing protein PLI...    311   8e-103   
ref|XP_011091917.1|  PREDICTED: LIM domain-containing protein PLI...    309   5e-102   
ref|XP_009762122.1|  PREDICTED: pollen-specific protein SF3-like        308   2e-101   
gb|EYU35073.1|  hypothetical protein MIMGU_mgv1a013171mg                308   3e-101   
ref|XP_006341718.1|  PREDICTED: pollen-specific protein SF3-like        306   4e-101   
ref|XP_004248581.1|  PREDICTED: LIM domain-containing protein PLI...    306   4e-101   
ref|XP_009624528.1|  PREDICTED: pollen-specific protein SF3-like ...    304   3e-100   
gb|EPS71497.1|  hypothetical protein M569_03263                         304   3e-100   
ref|XP_009624529.1|  PREDICTED: pollen-specific protein SF3-like ...    304   4e-100   
gb|EPS59684.1|  hypothetical protein M569_15118                         302   8e-100   
ref|XP_004240106.1|  PREDICTED: LIM domain-containing protein WLI...    303   8e-100   
ref|XP_002269537.1|  PREDICTED: LIM domain-containing protein PLIM2c    302   4e-99    Vitis vinifera
ref|XP_010671960.1|  PREDICTED: LIM domain-containing protein PLI...    293   7e-96    
gb|EYU32092.1|  hypothetical protein MIMGU_mgv1a013269mg                291   9e-95    
emb|CDY56926.1|  BnaAnng14450D                                          286   4e-93    
ref|XP_007051870.1|  GATA type zinc finger transcription factor f...    288   7e-93    
ref|XP_002511828.1|  Pollen-specific protein SF3, putative              284   2e-92    Ricinus communis
ref|XP_010255661.1|  PREDICTED: LIM domain-containing protein PLI...    283   3e-92    
ref|XP_010523025.1|  PREDICTED: LIM domain-containing protein PLIM2b    283   3e-92    
ref|XP_006491462.1|  PREDICTED: pollen-specific protein SF3-like        283   6e-92    
ref|XP_004306805.1|  PREDICTED: pollen-specific protein SF3-like        283   6e-92    
ref|XP_008438078.1|  PREDICTED: pollen-specific protein SF3-like ...    283   6e-92    
ref|XP_009116783.1|  PREDICTED: pollen-specific protein SF3             283   7e-92    
ref|XP_008232792.1|  PREDICTED: pollen-specific protein SF3             283   1e-91    
ref|XP_006304383.1|  hypothetical protein CARUB_v10010886mg             282   1e-91    
gb|KGN56538.1|  hypothetical protein Csa_3G122620                       282   1e-91    
ref|XP_010469046.1|  PREDICTED: LIM domain-containing protein PLI...    281   3e-91    
ref|XP_010413441.1|  PREDICTED: LIM domain-containing protein PLI...    281   3e-91    
ref|XP_010469047.1|  PREDICTED: LIM domain-containing protein PLI...    281   4e-91    
gb|KEH18910.1|  GATA type zinc finger transcription factor family...    281   4e-91    
ref|XP_004133874.1|  PREDICTED: pollen-specific protein SF3-like        280   4e-91    
ref|XP_008438068.1|  PREDICTED: pollen-specific protein SF3-like        280   4e-91    
emb|CDX71757.1|  BnaC08g31170D                                          281   6e-91    
ref|XP_010479778.1|  PREDICTED: LIM domain-containing protein PLIM2b    280   6e-91    
ref|XP_006418457.1|  hypothetical protein EUTSA_v10008789mg             280   6e-91    
ref|XP_010413443.1|  PREDICTED: LIM domain-containing protein PLI...    280   6e-91    
ref|XP_009138785.1|  PREDICTED: pollen-specific protein SF3-like ...    280   1e-90    
ref|XP_010474800.1|  PREDICTED: LIM domain-containing protein PLI...    280   1e-90    
ref|XP_010512456.1|  PREDICTED: LIM domain-containing protein PLI...    280   1e-90    
ref|XP_004134333.1|  PREDICTED: pollen-specific protein SF3-like        280   1e-90    
ref|XP_009138786.1|  PREDICTED: pollen-specific protein SF3-like ...    280   1e-90    
ref|XP_010512457.1|  PREDICTED: LIM domain-containing protein PLI...    280   2e-90    
gb|KDP28657.1|  hypothetical protein JCGZ_14428                         280   2e-90    
ref|XP_008376025.1|  PREDICTED: pollen-specific protein SF3-like        279   3e-90    
ref|XP_006402504.1|  hypothetical protein EUTSA_v10006235mg             279   3e-90    
ref|XP_008438077.1|  PREDICTED: pollen-specific protein SF3-like ...    278   4e-90    
ref|XP_002320783.2|  LIM domain-containing family protein               278   4e-90    Populus trichocarpa [western balsam poplar]
ref|XP_010054850.1|  PREDICTED: pollen-specific protein SF3-like        278   4e-90    
ref|XP_010523732.1|  PREDICTED: LIM domain-containing protein PLI...    279   4e-90    
ref|XP_002892043.1|  LIM domain-containing protein                      278   7e-90    
gb|KHG24611.1|  Pollen-specific SF3                                     277   9e-90    
ref|XP_006292212.1|  hypothetical protein CARUB_v10018418mg             278   9e-90    
ref|XP_002878372.1|  LIM domain-containing protein                      277   2e-89    
ref|XP_008337059.1|  PREDICTED: pollen-specific protein SF3-like        277   2e-89    
ref|XP_011035878.1|  PREDICTED: LIM domain-containing protein PLI...    276   2e-89    
ref|XP_007218397.1|  hypothetical protein PRUPE_ppa011395mg             276   2e-89    
gb|KFK35321.1|  hypothetical protein AALP_AA5G269200                    276   3e-89    
ref|XP_011023373.1|  PREDICTED: LIM domain-containing protein PLIM2b    276   4e-89    
ref|NP_171683.1|  LIM family protein                                    276   4e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273176.1|  PREDICTED: LIM domain-containing protein PLIM2c    275   4e-89    
ref|XP_007139894.1|  hypothetical protein PHAVU_008G067500g             276   4e-89    
ref|NP_191682.2|  GATA type zinc finger transcription factor fami...    276   4e-89    Arabidopsis thaliana [mouse-ear cress]
gb|KFK35322.1|  hypothetical protein AALP_AA5G269200                    275   6e-89    
ref|XP_010107618.1|  Pollen-specific protein SF3                        275   6e-89    
gb|ABK58466.1|  LIM domain protein PLIM2a                               275   6e-89    Populus tremula x Populus alba [gray poplar]
gb|AGJ83944.1|  lim protein 4                                           275   7e-89    
emb|CAB71053.1|  LIM domain protein                                     275   8e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521910.2|  PREDICTED: pollen-specific protein SF3-like        275   1e-88    
ref|XP_010055180.1|  PREDICTED: pollen-specific protein SF3-like        275   1e-88    
ref|NP_001237551.1|  uncharacterized protein LOC100305845               275   1e-88    
gb|AAF78411.1|AC009273_17  Contains similarity to mRNA for transc...    276   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302574.1|  LIM domain-containing family protein               274   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_006827708.1|  hypothetical protein AMTR_s00009p00259550          272   7e-88    
ref|XP_010544716.1|  PREDICTED: LIM domain-containing protein PLI...    273   9e-88    
emb|CDY15152.1|  BnaC05g00310D                                          272   1e-87    
ref|XP_009119735.1|  PREDICTED: pollen-specific protein SF3-like        272   1e-87    
ref|XP_003551659.1|  PREDICTED: pollen-specific protein SF3-like        272   1e-87    
emb|CDY38028.1|  BnaCnng08890D                                          271   1e-87    
gb|KFK37370.1|  hypothetical protein AALP_AA4G247900                    273   2e-87    
ref|XP_010544715.1|  PREDICTED: LIM domain-containing protein PLI...    273   2e-87    
ref|XP_007135027.1|  hypothetical protein PHAVU_010G095700g             272   2e-87    
ref|XP_009118834.1|  PREDICTED: pollen-specific protein SF3             271   2e-87    
ref|XP_004510816.1|  PREDICTED: pollen-specific protein SF3-like        271   4e-87    
emb|CDY01571.1|  BnaC07g35610D                                          270   4e-87    
ref|XP_003623892.1|  LIM domain protein 2b                              270   7e-87    
gb|KHG00940.1|  Pollen-specific SF3                                     270   9e-87    
ref|XP_003533616.1|  PREDICTED: pollen-specific protein SF3-like        270   2e-86    
gb|KHN29376.1|  Pollen-specific protein SF3                             269   2e-86    
ref|XP_002882034.1|  LIM domain-containing protein                      269   3e-86    
ref|XP_006397773.1|  hypothetical protein EUTSA_v10001618mg             268   5e-86    
gb|ACN26203.1|  unknown                                                 268   6e-86    Zea mays [maize]
ref|XP_010518219.1|  PREDICTED: LIM domain-containing protein PLI...    268   7e-86    
ref|XP_006647592.1|  PREDICTED: pollen-specific protein SF3-like        267   8e-86    
ref|XP_009340168.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    268   8e-86    
ref|XP_010506557.1|  PREDICTED: LIM domain-containing protein PLIM2a    268   8e-86    
ref|XP_010508108.1|  PREDICTED: LIM domain-containing protein PLI...    268   9e-86    
ref|XP_007135026.1|  hypothetical protein PHAVU_010G095700g             267   1e-85    
ref|XP_010089139.1|  Pollen-specific protein SF3                        274   1e-85    
gb|EMT25782.1|  Pollen-specific protein SF3                             266   2e-85    
ref|NP_001047550.1|  Os02g0641000                                       266   2e-85    Oryza sativa Japonica Group [Japonica rice]
gb|AFK33321.1|  unknown                                                 266   2e-85    
ref|XP_004492709.1|  PREDICTED: pollen-specific protein SF3-like        266   3e-85    
ref|XP_003569963.1|  PREDICTED: LIM domain-containing protein WLI...    266   3e-85    
ref|XP_004150238.1|  PREDICTED: pollen-specific protein SF3-like ...    265   5e-85    
ref|NP_182104.1|  protein PLIM2A                                        266   5e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008677533.1|  PREDICTED: uncharacterized LOC100381874 isof...    265   5e-85    
ref|XP_009397610.1|  PREDICTED: pollen-specific protein SF3-like        265   6e-85    
emb|CDY18899.1|  BnaC04g04510D                                          266   6e-85    
ref|XP_010907367.1|  PREDICTED: LIM domain-containing protein WLI...    265   6e-85    
gb|KHG27160.1|  Pollen-specific SF3                                     264   8e-85    
ref|XP_008777895.1|  PREDICTED: pollen-specific protein SF3-like        265   9e-85    
ref|XP_006296425.1|  hypothetical protein CARUB_v10025604mg             265   1e-84    
ref|XP_009143175.1|  PREDICTED: pollen-specific protein SF3-like        265   2e-84    
ref|XP_007009106.1|  GATA type zinc finger transcription factor f...    263   2e-84    
ref|XP_004953255.1|  PREDICTED: pollen-specific protein SF3-like        263   2e-84    
ref|XP_010093495.1|  Pollen-specific protein SF3                        263   2e-84    
ref|XP_002452860.1|  hypothetical protein SORBIDRAFT_04g033700          263   2e-84    Sorghum bicolor [broomcorn]
ref|NP_001132843.1|  uncharacterized LOC100194335                       263   3e-84    Zea mays [maize]
ref|XP_009421306.1|  PREDICTED: pollen-specific protein SF3-like        263   3e-84    
ref|XP_008463203.1|  PREDICTED: pollen-specific protein SF3-like        263   4e-84    
ref|XP_009404566.1|  PREDICTED: pollen-specific protein SF3-like        262   5e-84    
emb|CDY27358.1|  BnaC04g50470D                                          263   8e-84    
ref|NP_001140551.1|  uncharacterized LOC100272616                       262   8e-84    Zea mays [maize]
ref|XP_011022732.1|  PREDICTED: LIM domain-containing protein WLI...    262   1e-83    
ref|XP_004167859.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    261   1e-83    
gb|ABK22125.1|  unknown                                                 261   1e-83    Picea sitchensis
emb|CDY37066.1|  BnaA04g26440D                                          263   1e-83    
gb|AGJ83945.1|  lim protein 5                                           261   1e-83    
gb|KDP25467.1|  hypothetical protein JCGZ_20623                         261   2e-83    
gb|ABL74496.1|  LIM domain protein PLIM2b                               260   2e-83    Populus tremula x Populus alba [gray poplar]
ref|XP_009402055.1|  PREDICTED: pollen-specific protein SF3-like        261   2e-83    
ref|XP_009142366.1|  PREDICTED: pollen-specific protein SF3-like        262   2e-83    
ref|XP_010554627.1|  PREDICTED: LIM domain-containing protein WLIM2b    260   3e-83    
ref|XP_009387955.1|  PREDICTED: pollen-specific protein SF3-like        260   3e-83    
ref|XP_010905119.1|  PREDICTED: LIM domain-containing protein WLI...    261   3e-83    
dbj|BAK06966.1|  predicted protein                                      260   3e-83    
ref|XP_007009108.1|  GATA type zinc finger transcription factor f...    260   4e-83    
ref|XP_004138434.1|  PREDICTED: pollen-specific protein SF3-like        259   5e-83    
ref|XP_002315180.1|  LIM domain-containing family protein               259   5e-83    Populus trichocarpa [western balsam poplar]
ref|XP_008796793.1|  PREDICTED: pollen-specific protein SF3-like        260   5e-83    
ref|XP_006445094.1|  hypothetical protein CICLE_v10022448mg             259   6e-83    
gb|KHN17859.1|  Pollen-specific protein SF3                             259   1e-82    
ref|XP_003538442.1|  PREDICTED: pollen-specific protein SF3-like ...    259   1e-82    
gb|KDP44835.1|  hypothetical protein JCGZ_01335                         258   1e-82    
ref|XP_006435557.1|  hypothetical protein CICLE_v10032838mg             258   1e-82    
gb|KHG07853.1|  Pollen-specific SF3                                     258   1e-82    
gb|ABK58469.1|  LIM domain protein WLIM2a                               258   2e-82    Populus tremula x Populus alba [gray poplar]
gb|AII80545.1|  LIM-domain protein 11                                   259   2e-82    
ref|NP_001241110.1|  uncharacterized protein LOC100809121               258   2e-82    
gb|AAF75284.1|AF116850_1  LIM domain protein PLIM-2                     259   2e-82    Helianthus annuus
ref|XP_009587504.1|  PREDICTED: pollen-specific protein SF3-like        258   3e-82    
ref|XP_003544136.1|  PREDICTED: pollen-specific protein SF3 isofo...    258   3e-82    
gb|KHG24101.1|  Pollen-specific SF3                                     259   3e-82    
gb|ACX47456.1|  LIM1                                                    257   4e-82    Hevea brasiliensis [jebe]
ref|XP_006652565.1|  PREDICTED: pollen-specific protein SF3-like        258   4e-82    
ref|XP_002530411.1|  Pollen-specific protein SF3, putative              257   5e-82    Ricinus communis
ref|XP_011076748.1|  PREDICTED: LIM domain-containing protein WLIM2b    257   5e-82    
ref|XP_008392902.1|  PREDICTED: pollen-specific protein SF3-like ...    257   6e-82    
ref|XP_007163504.1|  hypothetical protein PHAVU_001G239700g             257   7e-82    
ref|XP_009389159.1|  PREDICTED: pollen-specific protein SF3-like        257   8e-82    
ref|XP_007218461.1|  hypothetical protein PRUPE_ppa011869mg             256   1e-81    
gb|EYU19976.1|  hypothetical protein MIMGU_mgv1a014151mg                256   1e-81    
ref|XP_010067487.1|  PREDICTED: pollen-specific protein SF3             256   1e-81    
ref|XP_003580212.1|  PREDICTED: LIM domain-containing protein PLI...    256   1e-81    
ref|XP_004239928.1|  PREDICTED: LIM domain-containing protein WLI...    256   1e-81    
ref|XP_003574155.1|  PREDICTED: LIM domain-containing protein PLI...    256   1e-81    
ref|XP_009391810.1|  PREDICTED: pollen-specific protein SF3-like        255   2e-81    
ref|XP_004976341.1|  PREDICTED: pollen-specific protein SF3-like ...    256   2e-81    
ref|XP_002448228.1|  hypothetical protein SORBIDRAFT_06g023600          256   2e-81    Sorghum bicolor [broomcorn]
ref|XP_006848064.1|  hypothetical protein AMTR_s00029p00199510          255   2e-81    
ref|XP_009369042.1|  PREDICTED: pollen-specific protein SF3-like        256   2e-81    
ref|XP_008392904.1|  PREDICTED: pollen-specific protein SF3-like ...    256   2e-81    
ref|XP_009602682.1|  PREDICTED: pollen-specific protein SF3-like        255   2e-81    
ref|XP_010256708.1|  PREDICTED: LIM domain-containing protein WLI...    255   2e-81    
ref|XP_009344420.1|  PREDICTED: pollen-specific protein SF3-like        255   3e-81    
ref|XP_008381875.1|  PREDICTED: pollen-specific protein SF3-like        255   3e-81    
ref|XP_011040324.1|  PREDICTED: LIM domain-containing protein WLI...    254   4e-81    
ref|XP_008374043.1|  PREDICTED: pollen-specific protein SF3-like        255   4e-81    
ref|NP_001053405.1|  Os04g0532500                                       254   5e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002312139.1|  LIM domain-containing family protein               254   6e-81    Populus trichocarpa [western balsam poplar]
gb|AGJ83942.1|  lim protein 2                                           254   6e-81    
ref|XP_002279922.1|  PREDICTED: LIM domain-containing protein WLIM2b    254   6e-81    Vitis vinifera
ref|XP_008798954.1|  PREDICTED: pollen-specific protein SF3-like        254   8e-81    
ref|XP_004307607.1|  PREDICTED: pollen-specific protein SF3-like        254   1e-80    
ref|XP_007009107.1|  GATA type zinc finger transcription factor f...    253   1e-80    
dbj|BAK04207.1|  predicted protein                                      254   1e-80    
ref|XP_006661927.1|  PREDICTED: pollen-specific protein SF3-like        254   1e-80    
ref|XP_006403418.1|  hypothetical protein EUTSA_v10010740mg             253   2e-80    
gb|AFK39062.1|  unknown                                                 253   2e-80    
ref|XP_007009110.1|  GATA type zinc finger transcription factor f...    252   2e-80    
ref|XP_007040178.1|  GATA type zinc finger transcription factor f...    253   3e-80    
ref|XP_010516165.1|  PREDICTED: LIM domain-containing protein WLI...    253   3e-80    
emb|CBL95262.1|  lim domain protein                                     253   3e-80    
ref|XP_010923152.1|  PREDICTED: LIM domain-containing protein WLI...    252   3e-80    
ref|XP_010427370.1|  PREDICTED: LIM domain-containing protein WLIM2b    253   3e-80    
ref|XP_010504446.1|  PREDICTED: LIM domain-containing protein WLI...    253   4e-80    
ref|XP_010534537.1|  PREDICTED: LIM domain-containing protein WLI...    252   4e-80    
ref|XP_010928941.1|  PREDICTED: LIM domain-containing protein WLI...    252   4e-80    
ref|XP_002876333.1|  LIM domain-containing protein                      252   5e-80    
gb|ABK94608.1|  unknown                                                 252   5e-80    Populus trichocarpa [western balsam poplar]
ref|XP_008785448.1|  PREDICTED: pollen-specific protein SF3-like        252   5e-80    
emb|CDX76073.1|  BnaA04g03370D                                          254   6e-80    
ref|XP_009133391.1|  PREDICTED: pollen-specific protein SF3-like        251   1e-79    
emb|CDY02959.1|  BnaC04g25270D                                          254   1e-79    
dbj|BAJ86406.1|  predicted protein                                      251   1e-79    
ref|XP_002879831.1|  LIM domain-containing protein                      251   1e-79    
ref|XP_004503222.1|  PREDICTED: pollen-specific protein SF3-like ...    251   1e-79    
emb|CDY24943.1|  BnaC03g22290D                                          251   1e-79    
ref|XP_006295906.1|  hypothetical protein CARUB_v10025036mg             251   1e-79    
ref|XP_010517368.1|  PREDICTED: LIM domain-containing protein WLIM2a    251   1e-79    
ref|XP_002283482.1|  PREDICTED: LIM domain-containing protein WLIM2a    251   1e-79    Vitis vinifera
emb|CDY60999.1|  BnaA03g56620D                                          251   1e-79    
gb|AAL38006.1|AF443117_1  LIM domain protein                            250   2e-79    Gossypium hirsutum [American cotton]
ref|XP_006477522.1|  PREDICTED: pollen-specific protein SF3-like        251   2e-79    
ref|XP_010505685.1|  PREDICTED: LIM domain-containing protein WLI...    251   2e-79    
emb|CDX72203.1|  BnaC08g26710D                                          250   2e-79    
emb|CDY27267.1|  BnaA09g35350D                                          250   2e-79    
ref|XP_009139138.1|  PREDICTED: pollen-specific protein SF3-like        250   2e-79    
ref|XP_004982687.1|  PREDICTED: pollen-specific protein SF3-like        251   3e-79    
emb|CDY20498.1|  BnaC04g05460D                                          250   3e-79    
ref|XP_009116276.1|  PREDICTED: pollen-specific protein SF3             250   3e-79    
ref|XP_009143273.1|  PREDICTED: pollen-specific protein SF3             250   4e-79    
ref|NP_191136.1|  actin bundler LIM family protein WLIM2b               250   4e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002509768.1|  Pollen-specific protein SF3, putative              250   4e-79    Ricinus communis
ref|XP_003600847.1|  LIM domain-containing protein                      249   5e-79    
emb|CBI40313.3|  unnamed protein product                                249   5e-79    
ref|XP_011029226.1|  PREDICTED: LIM domain-containing protein WLI...    250   6e-79    
ref|XP_010508950.1|  PREDICTED: LIM domain-containing protein WLI...    249   6e-79    
ref|XP_008392559.1|  PREDICTED: pollen-specific protein SF3-like        249   1e-78    
dbj|BAH20111.1|  AT3G55770                                              248   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010053293.1|  PREDICTED: pollen-specific protein SF3-like        249   2e-78    
ref|XP_006411232.1|  hypothetical protein EUTSA_v10017249mg             248   2e-78    
gb|KDO76132.1|  hypothetical protein CISIN_1g041875mg                   248   2e-78    
ref|XP_002304483.2|  hypothetical protein POPTR_0003s12440g             248   4e-78    Populus trichocarpa [western balsam poplar]
ref|NP_181519.1|  protein WLIM2A                                        247   4e-78    Arabidopsis thaliana [mouse-ear cress]
gb|AFK34184.1|  unknown                                                 247   4e-78    
gb|KHG08337.1|  Pollen-specific SF3                                     248   5e-78    
gb|EMS55690.1|  Pollen-specific protein SF3                             254   1e-77    
ref|XP_007210077.1|  hypothetical protein PRUPE_ppa019584mg             245   4e-77    
ref|XP_008238877.1|  PREDICTED: pollen-specific protein SF3-like        245   6e-77    
ref|XP_009133751.1|  PREDICTED: pollen-specific protein SF3-like        245   1e-76    
ref|XP_009375790.1|  PREDICTED: pollen-specific protein SF3-like        243   2e-76    
gb|AGJ83943.1|  lim protein 3                                           243   2e-76    
gb|EAY79118.1|  hypothetical protein OsI_34224                          243   3e-76    Oryza sativa Indica Group [Indian rice]
ref|NP_001064995.1|  Os10g0503100                                       243   3e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003524464.1|  PREDICTED: pollen-specific protein SF3             243   3e-76    
ref|XP_004976340.1|  PREDICTED: pollen-specific protein SF3-like ...    243   5e-76    
ref|XP_010690195.1|  PREDICTED: LIM domain-containing protein WLIM2b    242   5e-76    
emb|CDX95666.1|  BnaC03g25470D                                          243   5e-76    
emb|CDY68273.1|  BnaAnng26690D                                          243   6e-76    
ref|XP_002969252.1|  hypothetical protein SELMODRAFT_146291             241   1e-75    
ref|XP_011072367.1|  PREDICTED: LIM domain-containing protein WLI...    241   1e-75    
gb|EPS58831.1|  hypothetical protein M569_15983                         239   3e-75    
gb|KCW77560.1|  hypothetical protein EUGRSUZ_D01873                     240   4e-75    
ref|XP_002960609.1|  hypothetical protein SELMODRAFT_229974             237   2e-74    
ref|XP_003532407.1|  PREDICTED: pollen-specific protein SF3             238   3e-74    
ref|XP_006649807.1|  PREDICTED: pollen-specific protein SF3-like        236   7e-74    
ref|NP_001049655.1|  Os03g0266100                                       236   8e-74    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147673.1|  pollen-specific protein SF3                        236   1e-73    Zea mays [maize]
dbj|BAM13335.1|  LIM domain-containing protein                          236   1e-73    
ref|XP_006439594.1|  hypothetical protein CICLE_v10023761mg             236   1e-73    
gb|EPS67160.1|  hypothetical protein M569_07616                         235   2e-73    
ref|XP_004503760.1|  PREDICTED: pollen-specific protein SF3-like        236   2e-73    
ref|XP_006291888.1|  hypothetical protein CARUB_v10018065mg             235   2e-73    
dbj|BAM13338.1|  LIM domain-containing protein                          235   2e-73    
emb|CAA62744.1|  transcription factor L2                                234   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|ACU13968.1|  unknown                                                 234   3e-73    Glycine max [soybeans]
dbj|BAM13341.1|  LIM domain-containing protein                          234   4e-73    
dbj|BAM13339.1|  LIM domain-containing protein                          234   4e-73    
ref|XP_011080992.1|  PREDICTED: LIM domain-containing protein WLI...    234   6e-73    
ref|XP_011029229.1|  PREDICTED: LIM domain-containing protein WLI...    234   7e-73    
ref|XP_009400630.1|  PREDICTED: pollen-specific protein SF3-like        233   8e-73    
dbj|BAM13340.1|  LIM domain-containing protein                          233   1e-72    
gb|EYU38365.1|  hypothetical protein MIMGU_mgv1a014348mg                233   1e-72    
ref|XP_002468127.1|  hypothetical protein SORBIDRAFT_01g040050          233   1e-72    
ref|XP_001765937.1|  predicted protein                                  233   1e-72    
ref|XP_009785548.1|  PREDICTED: pollen-specific protein SF3-like        233   2e-72    
emb|CDY45697.1|  BnaCnng13620D                                          232   2e-72    
ref|XP_004984674.1|  PREDICTED: pollen-specific protein SF3-like        232   4e-72    
ref|XP_009628860.1|  PREDICTED: pollen-specific protein SF3-like        231   8e-72    
ref|NP_001190099.1|  actin bundler LIM family protein WLIM2b            232   1e-71    
emb|CDP14069.1|  unnamed protein product                                229   1e-70    
gb|EYU29736.1|  hypothetical protein MIMGU_mgv1a014022mg                228   2e-70    
ref|XP_010676493.1|  PREDICTED: LIM domain-containing protein WLI...    227   4e-70    
emb|CDP09772.1|  unnamed protein product                                226   6e-70    
ref|XP_004245622.1|  PREDICTED: LIM domain-containing protein WLI...    225   2e-69    
gb|KHG14411.1|  Pollen-specific SF3                                     225   2e-69    
ref|XP_009766754.1|  PREDICTED: pollen-specific protein SF3-like        224   5e-69    
ref|XP_001771340.1|  predicted protein                                  223   1e-68    
gb|KEH21040.1|  GATA type zinc finger transcription factor family...    223   2e-68    
ref|XP_006352311.1|  PREDICTED: pollen-specific protein SF3-like        223   3e-68    
gb|ABK23670.1|  unknown                                                 220   2e-67    
gb|ABK22236.1|  unknown                                                 219   4e-67    
gb|ACA33841.1|  LIM2 transcription factor                               216   2e-66    
ref|XP_008793824.1|  PREDICTED: pollen-specific protein SF3-like ...    217   3e-66    
ref|XP_002965335.1|  hypothetical protein SELMODRAFT_143123             216   3e-66    
gb|EMT19855.1|  Pollen-specific protein SF3                             216   8e-66    
ref|XP_010928557.1|  PREDICTED: LIM domain-containing protein WLI...    216   3e-65    
ref|XP_006345025.1|  PREDICTED: pollen-specific protein SF3-like        213   4e-65    
ref|XP_010272870.1|  PREDICTED: LIM domain-containing protein WLI...    213   5e-65    
ref|XP_003558280.1|  PREDICTED: LIM domain-containing protein WLI...    213   6e-65    
ref|XP_006836719.1|  hypothetical protein AMTR_s00088p00121090          213   7e-65    
ref|XP_010272036.1|  PREDICTED: LIM domain-containing protein WLI...    213   7e-65    
ref|XP_004299580.1|  PREDICTED: pollen-specific protein SF3-like        213   9e-65    
ref|XP_004236135.1|  PREDICTED: LIM domain-containing protein WLIM1     213   9e-65    
ref|XP_002283525.1|  PREDICTED: LIM domain-containing protein WLIM1     211   2e-64    
ref|XP_010544006.1|  PREDICTED: LIM domain-containing protein WLIM1     211   2e-64    
ref|XP_010548517.1|  PREDICTED: LIM domain-containing protein WLI...    211   3e-64    
ref|XP_010322559.1|  PREDICTED: LIM domain-containing protein WLIM1     211   4e-64    
ref|XP_007209651.1|  hypothetical protein PRUPE_ppa012024mg             211   4e-64    
ref|XP_009408124.1|  PREDICTED: pollen-specific protein SF3-like        210   7e-64    
ref|XP_010254782.1|  PREDICTED: LIM domain-containing protein WLI...    210   1e-63    
ref|XP_011028613.1|  PREDICTED: LIM domain-containing protein WLI...    210   1e-63    
ref|XP_011030325.1|  PREDICTED: LIM domain-containing protein WLI...    210   2e-63    
ref|XP_004250748.1|  PREDICTED: LIM domain-containing protein WLI...    209   3e-63    
ref|XP_009610584.1|  PREDICTED: pollen-specific protein SF3-like ...    209   3e-63    
ref|XP_009786244.1|  PREDICTED: pollen-specific protein SF3-like        209   3e-63    
gb|KHN19331.1|  Pollen-specific protein SF3                             209   4e-63    
ref|XP_007036121.1|  GATA type zinc finger transcription factor f...    208   4e-63    
ref|XP_002266499.1|  PREDICTED: LIM domain-containing protein WLIM1     208   4e-63    
ref|XP_011074349.1|  PREDICTED: LIM domain-containing protein WLIM1     208   4e-63    
ref|XP_011044348.1|  PREDICTED: LIM domain-containing protein WLI...    208   5e-63    
ref|NP_001238580.1|  uncharacterized protein LOC100499957               208   5e-63    
ref|XP_010027995.1|  PREDICTED: pollen-specific protein SF3-like        208   5e-63    
ref|NP_001237652.1|  uncharacterized protein LOC100527547               208   5e-63    
ref|NP_001238190.1|  uncharacterized protein LOC100500444               208   5e-63    
ref|XP_002298780.2|  hypothetical protein POPTR_0001s30020g             208   5e-63    
ref|XP_002318024.1|  hypothetical protein POPTR_0012s07870g             208   6e-63    
ref|NP_001235271.1|  uncharacterized protein LOC100500501               208   6e-63    
gb|KHN16307.1|  Pollen-specific protein SF3                             208   6e-63    
ref|NP_001235758.1|  uncharacterized protein LOC100305720               208   6e-63    
ref|XP_009610583.1|  PREDICTED: pollen-specific protein SF3-like ...    208   6e-63    
gb|ABK94586.1|  unknown                                                 208   7e-63    
ref|XP_010923153.1|  PREDICTED: LIM domain-containing protein WLI...    207   7e-63    
ref|XP_002321571.1|  hypothetical protein POPTR_0015s08360g             207   8e-63    
ref|XP_002285355.1|  PREDICTED: LIM domain-containing protein WLIM1     208   9e-63    
ref|XP_009414770.1|  PREDICTED: pollen-specific protein SF3-like        207   1e-62    
ref|XP_009590601.1|  PREDICTED: pollen-specific protein SF3-like        207   1e-62    
ref|XP_002511450.1|  Pollen-specific protein SF3, putative              207   1e-62    
gb|ABK58465.1|  LIM domain protein GLIM1b                               207   1e-62    
ref|XP_004138126.1|  PREDICTED: pollen-specific protein SF3-like        207   1e-62    
emb|CDP17006.1|  unnamed protein product                                207   1e-62    
ref|XP_006595535.1|  PREDICTED: uncharacterized protein LOC100527...    207   1e-62    
gb|KHN04435.1|  Pollen-specific protein SF3                             207   1e-62    
gb|KDP31140.1|  hypothetical protein JCGZ_11516                         207   2e-62    
gb|KHG14633.1|  Pollen-specific SF3                                     207   2e-62    
ref|XP_007138113.1|  hypothetical protein PHAVU_009G181200g             206   2e-62    
ref|XP_010938994.1|  PREDICTED: LIM domain-containing protein WLI...    206   2e-62    
ref|XP_008453121.1|  PREDICTED: pollen-specific protein SF3-like        206   3e-62    
ref|XP_009803543.1|  PREDICTED: pollen-specific protein SF3-like        206   3e-62    
ref|XP_011087164.1|  PREDICTED: LIM domain-containing protein WLI...    206   3e-62    
ref|XP_007136766.1|  hypothetical protein PHAVU_009G072200g             206   3e-62    
ref|XP_006352087.1|  PREDICTED: pollen-specific protein SF3-like        206   3e-62    
gb|AII80542.1|  LIM-domain protein 8                                    206   3e-62    
gb|KHN36972.1|  Pollen-specific protein SF3                             206   3e-62    
ref|XP_008811666.1|  PREDICTED: pollen-specific protein SF3             206   3e-62    
ref|NP_001238429.1|  uncharacterized protein LOC100499947               206   3e-62    
ref|XP_008393059.1|  PREDICTED: pollen-specific protein SF3-like        206   4e-62    
ref|XP_004136935.1|  PREDICTED: pollen-specific protein SF3-like        206   4e-62    
ref|XP_010913501.1|  PREDICTED: LIM domain-containing protein WLI...    206   4e-62    
ref|XP_001764074.1|  predicted protein                                  206   5e-62    
ref|XP_003550749.1|  PREDICTED: pollen-specific protein SF3-like        206   5e-62    
ref|XP_006439752.1|  hypothetical protein CICLE_v10022413mg             206   5e-62    
ref|XP_010274389.1|  PREDICTED: LIM domain-containing protein WLI...    205   6e-62    
gb|AAX95760.2|  Pollen-specific protein SF3, putative                   205   6e-62    
ref|XP_006857164.1|  hypothetical protein AMTR_s00065p00168710          205   7e-62    
emb|CDP01275.1|  unnamed protein product                                205   7e-62    
ref|XP_007160919.1|  hypothetical protein PHAVU_001G028200g             205   9e-62    
ref|XP_011002116.1|  PREDICTED: LIM domain-containing protein WLI...    205   9e-62    
ref|XP_008374471.1|  PREDICTED: pollen-specific protein SF3-like        205   9e-62    
ref|XP_007155394.1|  hypothetical protein PHAVU_003G197600g             205   9e-62    
gb|ABK58464.1|  LIM domain protein GLIM1a                               205   1e-61    
gb|AFK42495.1|  unknown                                                 205   1e-61    
gb|EYU29934.1|  hypothetical protein MIMGU_mgv1a014656mg                204   1e-61    
gb|AFK47041.1|  unknown                                                 204   1e-61    
ref|XP_010037591.1|  PREDICTED: pollen-specific protein SF3-like ...    204   1e-61    
ref|XP_009415386.1|  PREDICTED: pollen-specific protein SF3-like        205   2e-61    
ref|XP_002313186.2|  hypothetical protein POPTR_0009s09040g             204   2e-61    
gb|AAD02543.1|  PGPS/D1                                                 204   2e-61    
ref|XP_008220373.1|  PREDICTED: pollen-specific protein SF3-like        204   3e-61    
ref|XP_004498991.1|  PREDICTED: pollen-specific protein SF3-like        204   3e-61    
gb|AAF13231.1|  pollen specific LIM domain protein 1a                   204   3e-61    
ref|XP_009766668.1|  PREDICTED: pollen-specific protein SF3-like        204   3e-61    
gb|EYU25518.1|  hypothetical protein MIMGU_mgv1a014425mg                204   3e-61    
ref|XP_007225874.1|  hypothetical protein PRUPE_ppa011761mg             204   3e-61    
gb|AGJ83946.1|  lim protein 6                                           204   3e-61    
ref|XP_002892554.1|  hypothetical protein ARALYDRAFT_471134             203   4e-61    
ref|XP_004501954.1|  PREDICTED: pollen-specific protein SF3-like        203   4e-61    
ref|XP_010028358.1|  PREDICTED: pollen-specific protein SF3-like        203   5e-61    
ref|NP_172491.1|  transcription factor lim1                             203   5e-61    
ref|XP_011071800.1|  PREDICTED: LIM domain-containing protein WLI...    202   6e-61    
ref|XP_010942770.1|  PREDICTED: LIM domain-containing protein WLI...    203   6e-61    
dbj|BAO02514.1|  predicted LIM domain-containing protein ortholog       203   6e-61    
ref|XP_011092491.1|  PREDICTED: LIM domain-containing protein WLI...    203   6e-61    
ref|XP_009598300.1|  PREDICTED: pollen-specific protein SF3-like        202   7e-61    
ref|XP_009769329.1|  PREDICTED: pollen-specific protein SF3-like        202   7e-61    
ref|XP_004501516.1|  PREDICTED: pollen-specific protein SF3-like        202   8e-61    
ref|XP_004290976.1|  PREDICTED: pollen-specific protein SF3-like        202   8e-61    
ref|XP_009148339.1|  PREDICTED: pollen-specific protein SF3             202   8e-61    
ref|XP_010111544.1|  Pollen-specific protein SF3                        203   8e-61    
ref|XP_007018479.1|  GATA type zinc finger transcription factor f...    202   9e-61    
ref|XP_009606069.1|  PREDICTED: pollen-specific protein SF3-like        202   9e-61    
ref|XP_010678700.1|  PREDICTED: LIM domain-containing protein WLI...    204   9e-61    
ref|XP_006304225.1|  hypothetical protein CARUB_v10010373mg             202   9e-61    
gb|ABK95336.1|  unknown                                                 202   9e-61    
dbj|BAM05591.1|  LIM transcription factor                               202   1e-60    
gb|ABL74498.1|  LIM domain protein BLIM2b                               200   1e-60    
ref|XP_004141291.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-60    
dbj|BAM05589.1|  LIM transcription factor                               202   1e-60    
ref|XP_003525489.1|  PREDICTED: pollen-specific protein SF3-like        203   1e-60    
ref|XP_008452649.1|  PREDICTED: pollen-specific protein SF3-like ...    202   1e-60    
ref|XP_007201308.1|  hypothetical protein PRUPE_ppa011881mg             202   1e-60    
ref|XP_009765343.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-60    
ref|XP_010490782.1|  PREDICTED: LIM domain-containing protein WLIM1     202   1e-60    
ref|XP_009418011.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-60    
ref|XP_009623970.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-60    
gb|ACU17588.1|  unknown                                                 200   2e-60    
ref|XP_009360821.1|  PREDICTED: pollen-specific protein SF3-like        202   2e-60    
ref|XP_010061652.1|  PREDICTED: pollen-specific protein SF3-like        202   2e-60    
ref|XP_008393720.1|  PREDICTED: pollen-specific protein SF3-like        202   2e-60    
ref|XP_007042657.1|  GATA type zinc finger transcription factor f...    202   2e-60    
ref|XP_010458355.1|  PREDICTED: LIM domain-containing protein WLI...    202   2e-60    
ref|XP_010475882.1|  PREDICTED: LIM domain-containing protein WLI...    202   2e-60    
ref|XP_004962903.1|  PREDICTED: pollen-specific protein SF3-like        202   2e-60    
ref|XP_009144466.1|  PREDICTED: pollen-specific protein SF3-like        201   2e-60    
gb|ABY21316.1|  LIM1                                                    201   2e-60    
ref|XP_008236308.1|  PREDICTED: pollen-specific protein SF3-like        202   2e-60    
ref|XP_007036120.1|  GATA type zinc finger transcription factor f...    202   2e-60    
emb|CDY20647.1|  BnaC08g14110D                                          201   3e-60    
gb|AGE09578.1|  LIM-like protein                                        201   3e-60    
ref|XP_006342667.1|  PREDICTED: pollen-specific protein SF3-like        201   3e-60    
ref|XP_002510088.1|  Pollen-specific protein SF3, putative              201   3e-60    
gb|AAD56959.1|AF187105_1  LIM domain protein WLIM1                      201   3e-60    
emb|CDX94916.1|  BnaC05g07550D                                          201   4e-60    
ref|XP_004252738.1|  PREDICTED: LIM domain-containing protein WLI...    201   4e-60    
gb|KDP41612.1|  hypothetical protein JCGZ_16019                         201   4e-60    
ref|XP_008444540.1|  PREDICTED: pollen-specific protein SF3             201   5e-60    
gb|AAD39103.1|AF116849_1  LIM domain protein WLIM-1                     200   5e-60    
ref|XP_010094354.1|  Pollen-specific protein SF3                        201   6e-60    
gb|KFK43312.1|  hypothetical protein AALP_AA1G108000                    200   6e-60    
ref|XP_006422808.1|  hypothetical protein CICLE_v10029316mg             200   7e-60    
dbj|BAB84584.1|  transcription factor LIM                               200   7e-60    
ref|XP_002442217.1|  hypothetical protein SORBIDRAFT_08g016450          200   8e-60    
gb|ABW69660.1|  transcription factor LIM                                200   9e-60    
gb|AAD56948.1|AF184109_1  LIM domain protein WLIM1                      200   9e-60    
gb|ABB51614.1|  LIM-domain protein                                      200   9e-60    
ref|XP_008347599.1|  PREDICTED: pollen-specific protein SF3-like        200   9e-60    
ref|XP_010059807.1|  PREDICTED: pollen-specific protein SF3-like        200   9e-60    
ref|XP_006417487.1|  hypothetical protein EUTSA_v10008856mg             200   1e-59    
ref|XP_009375152.1|  PREDICTED: pollen-specific protein SF3-like        200   1e-59    
gb|EYU39077.1|  hypothetical protein MIMGU_mgv1a014557mg                199   1e-59    
ref|XP_008648273.1|  PREDICTED: LOC541782 isoform X1                    200   1e-59    
ref|XP_002320687.1|  transcription factor LIM family protein            200   1e-59    
dbj|BAB84581.1|  transcription factor LIM                               200   1e-59    
ref|XP_003589058.1|  Transcription factor lim1                          200   1e-59    
ref|XP_003576026.1|  PREDICTED: LIM domain-containing protein WLIM1     200   1e-59    
gb|KCW55096.1|  hypothetical protein EUGRSUZ_I01055                     199   2e-59    
gb|ABK93551.1|  unknown                                                 199   2e-59    
ref|XP_004289780.1|  PREDICTED: pollen-specific protein SF3-like        199   2e-59    
ref|XP_004508840.1|  PREDICTED: pollen-specific protein SF3-like        199   2e-59    
dbj|BAJ94823.1|  predicted protein                                      199   2e-59    
dbj|BAA82827.1|  transcription factor Ntlim1                            199   2e-59    
ref|XP_004142897.1|  PREDICTED: pollen-specific protein SF3-like        199   3e-59    
ref|XP_004238086.1|  PREDICTED: LIM domain-containing protein WLIM1     199   3e-59    
gb|AGE09584.1|  LIM1-like protein                                       198   3e-59    
gb|AII80541.1|  LIM-domain protein 7                                    199   4e-59    
ref|XP_003608956.1|  LIM domain protein                                 198   4e-59    
ref|XP_010091018.1|  Pollen-specific protein SF3                        198   4e-59    
ref|XP_002302405.2|  hypothetical protein POPTR_0002s11880g             198   5e-59    
ref|XP_006664058.1|  PREDICTED: pollen-specific protein SF3-like        198   5e-59    
gb|ABK58467.1|  LIM domain protein WLIM1a                               198   6e-59    
ref|NP_001148027.1|  pollen-specific protein SF3                        198   6e-59    
gb|ABA99040.1|  Pollen-specific protein SF3, putative, expressed        198   6e-59    
ref|XP_002532425.1|  Cysteine and glycine-rich protein, putative        198   6e-59    
ref|XP_006433641.1|  hypothetical protein CICLE_v10002540mg             198   6e-59    
gb|EYU42534.1|  hypothetical protein MIMGU_mgv1a021971mg                197   6e-59    
gb|AFV60741.1|  LIM domain protein LIM-2                                197   7e-59    
emb|CDO97286.1|  unnamed protein product                                197   1e-58    
gb|ACG34183.1|  pollen-specific protein SF3                             197   1e-58    
gb|EEE65408.1|  hypothetical protein OsJ_20745                          199   2e-58    
ref|XP_010999890.1|  PREDICTED: LIM domain-containing protein WLI...    196   2e-58    
ref|XP_010687903.1|  PREDICTED: LIM domain-containing protein WLIM1     196   3e-58    
ref|XP_008364385.1|  PREDICTED: pollen-specific protein SF3-like        196   3e-58    
gb|AFK42303.1|  unknown                                                 195   4e-58    
ref|NP_001104937.2|  LOC541782                                          196   5e-58    
ref|XP_006431569.1|  hypothetical protein CICLE_v10003359mg             194   8e-58    
gb|KDP44510.1|  hypothetical protein JCGZ_16343                         194   2e-57    
ref|XP_006431570.1|  hypothetical protein CICLE_v10003747mg             193   2e-57    
gb|EYU36386.1|  hypothetical protein MIMGU_mgv1a009946mg                197   3e-57    
gb|AII80544.1|  LIM-domain protein 10                                   193   4e-57    
gb|AAD32870.1|AC005489_8  F14N23.8                                      192   2e-56    
ref|XP_007143127.1|  hypothetical protein PHAVU_007G046100g             191   3e-56    



>ref|XP_009629647.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=218

 Score =   321 bits (822),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 3/179 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVDLLSADGAT+HKSCFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSS---RENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            HFEQLFKESGNFSKNF ++S+   RENSLT+A +K S++FSGTQ+KC AC+KTVYPLEKV
Sbjct  61   HFEQLFKESGNFSKNFQTASAKPERENSLTRAPSKLSALFSGTQDKCAACNKTVYPLEKV  120

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            TMEGE++HKSCFKC+HGGC LTHATYAALDGVLYCKHHF QLFMEKGNYQHVL+A   K
Sbjct  121  TMEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNYQHVLEAANNK  179


 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 67/101 (66%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC+KTVY ++ ++ +G  +HKSCFKC+H    L  + Y++++GVLYCK HF
Sbjct  100  FSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHF  159

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEK  447
             QLF E GN+     ++++++NS  KA ++  +      E+
Sbjct  160  AQLFMEKGNYQHVLEAANNKKNSAEKADDEQETTEKAEDEQ  200



>ref|XP_009629648.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=217

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVDLLSADGAT+HKSCFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSS--SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++S   RENSLT+A +K S++FSGTQ+KC AC+KTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQTASKPERENSLTRAPSKLSALFSGTQDKCAACNKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGE++HKSCFKC+HGGC LTHATYAALDGVLYCKHHF QLFMEKGNYQHVL+A   K
Sbjct  121  MEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNYQHVLEAANNK  178


 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 67/101 (66%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC+KTVY ++ ++ +G  +HKSCFKC+H    L  + Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEK  447
             QLF E GN+     ++++++NS  KA ++  +      E+
Sbjct  159  AQLFMEKGNYQHVLEAANNKKNSAEKADDEQETTEKAEDEQ  199



>ref|XP_009779198.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=217

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVDLLSADGAT+HKSCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS--SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++S   RENSLT+A +K S++FSGTQ+KC AC+KTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQTASKPERENSLTRAPSKLSALFSGTQDKCAACNKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGE++HKSCFKC+HGGC LTHATYAALDGVLYCKHHF QLFMEKGNYQHVLKA   K
Sbjct  121  MEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNYQHVLKAANNK  178


 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 65/101 (64%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC+KTVY ++ ++ +G  +HKSCFKC+H    L  + Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEK  447
             QLF E GN+     ++++++NS  KA  +         E+
Sbjct  159  AQLFMEKGNYQHVLKAANNKKNSAEKADEEQEPTEKAEDEQ  199



>ref|NP_001288583.1| uncharacterized protein LOC101266456 [Solanum lycopersicum]
 gb|AGV29549.1| PLIM2a [Solanum lycopersicum]
Length=223

 Score =   319 bits (817),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKC ACDKTVYFVDLLSADG TYHKSCFKCSHCKGTLVMSNYSSM+G+LYCKT
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCKGTLVMSNYSSMDGILYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +S  S R+NSLT+A +K S++FSGTQ+KC AC KTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQNSAKSERQNSLTRAPSKLSALFSGTQDKCAACDKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGES+HKSCFKC+HGGCALTHATYA+LDG LYCKHHF QLFMEKGNYQHVLKA   K
Sbjct  121  MEGESFHKSCFKCAHGGCALTHATYASLDGNLYCKHHFAQLFMEKGNYQHVLKAANNK  178


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC ACDKTVY ++ ++ +G ++HKSCFKC+H    L  + Y+S++G LYCK HF
Sbjct  99   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCALTHATYASLDGNLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN+     ++++++NS
Sbjct  159  AQLFMEKGNYQHVLKAANNKKNS  181



>ref|XP_006339787.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=221

 Score =   315 bits (807),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 162/178 (91%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKC ACDKTVYFVDLLSADG TYHKSCFKCSHC+GTLVMSNYSSM+G+LYCKT
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCRGTLVMSNYSSMDGILYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +   S R+NSLT+A +K S+MFSGTQ+KC AC KTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQNPAKSERQNSLTRAPSKLSAMFSGTQDKCAACDKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGES+HKSCFKC+HGGCALTHATYA+LDG LYCKHHF QLFMEKGNYQHVLKA   K
Sbjct  121  MEGESFHKSCFKCAHGGCALTHATYASLDGNLYCKHHFAQLFMEKGNYQHVLKAANNK  178


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC ACDKTVY ++ ++ +G ++HKSCFKC+H    L  + Y+S++G LYCK HF
Sbjct  99   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCALTHATYASLDGNLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN+     ++++++NS
Sbjct  159  AQLFMEKGNYQHVLKAANNKKNS  181



>emb|CDP08845.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   314 bits (804),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVDLLSADGAT+H+SCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHRSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS-SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF++    RENSLT+A +K S++FSGTQ+KC ACSKTVYPLEKVTM
Sbjct  61   HFEQLFKESGNFSKNFNTGKHERENSLTRAPSKLSALFSGTQDKCAACSKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGESYHKSCFKC+HGGC LTH++YAALDG+LYCKHHF QLFMEKGNYQHVLKA   K
Sbjct  121  EGESYHKSCFKCAHGGCPLTHSSYAALDGILYCKHHFAQLFMEKGNYQHVLKAATHK  177


 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHKSCFKC+H    L  S+Y++++G+LYCK HF
Sbjct  98   FSGTQDKCAACSKTVYPLEKVTMEGESYHKSCFKCAHGGCPLTHSSYAALDGILYCKHHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKA  405
             QLF E GN+     +++ +++++   
Sbjct  158  AQLFMEKGNYQHVLKAATHKKSAVAPV  184


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ ++ +G ++H+SCFKCSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYFVDLLSADGATFHRSCFKCSHCKGTLVMSNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E GN+      G+ + +
Sbjct  63   EQLFKESGNFSKNFNTGKHERE  84



>ref|XP_009762983.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=212

 Score =   314 bits (804),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKC ACDKTVYFVDLLSADG TYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNF+KNF +S + R+NSLT+A +K S+MFSGTQ+KC AC KTVYPLEKVTM
Sbjct  61   HFEQLFKESGNFTKNFQNSKAERQNSLTRAPSKLSAMFSGTQDKCAACDKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGES+HKSCFKC+HGGC LTHATYA+LDG LYCKHHF QLFMEKGNYQHVLKA   K
Sbjct  121  EGESFHKSCFKCAHGGCPLTHATYASLDGNLYCKHHFAQLFMEKGNYQHVLKAVNNK  177


 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC ACDKTVY ++ ++ +G ++HKSCFKC+H    L  + Y+S++G LYCK HF
Sbjct  98   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGNLYCKHHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN+     + +++++S
Sbjct  158  AQLFMEKGNYQHVLKAVNNKKSS  180



>ref|XP_009601147.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AAF75828.1|AF116851_1 LIM domain protein PLIM-2 [Nicotiana tabacum]
Length=212

 Score =   311 bits (797),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKC ACDKTVYFVDLLSADG TYHKSCFKCSHCKGTLVMSNYSSMEGVLYCK 
Sbjct  1    MAFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKH  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNF+KNF +S + R+NSLT+A +K S+MFSGTQ+KC AC KTVYPLEKVTM
Sbjct  61   HFEQLFKESGNFTKNFQNSKAERQNSLTRAPSKLSAMFSGTQDKCAACDKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGES+HKSCFKC+HGGC LTHATYA+LDG LYCKHHF QLFMEKGNYQHVLKA   K
Sbjct  121  EGESFHKSCFKCAHGGCPLTHATYASLDGNLYCKHHFAQLFMEKGNYQHVLKAANNK  177


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC ACDKTVY ++ ++ +G ++HKSCFKC+H    L  + Y+S++G LYCK HF
Sbjct  98   FSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGNLYCKHHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN+     +++++++S
Sbjct  158  AQLFMEKGNYQHVLKAANNKKSS  180



>ref|XP_011093154.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Sesamum 
indicum]
Length=218

 Score =   311 bits (797),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            +FTGTLDKCKACDKTVYFVDLLSADGA +H+SCFKCSHCKGTLVMSNYSSM+GVLYCK H
Sbjct  3    SFTGTLDKCKACDKTVYFVDLLSADGAIFHRSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  62

Query  322  FEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            FEQLFKESGNFSKNF +   S RENSLT+  +K S++FSGTQ+KCPAC+KTVYPLEKVTM
Sbjct  63   FEQLFKESGNFSKNFQTGAKSERENSLTRTPSKLSALFSGTQDKCPACNKTVYPLEKVTM  122

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGES+H+SCFKC+HGGC LTH++YAALDG+LYCKHHF QLFMEKGNYQHVLKA   K
Sbjct  123  EGESFHRSCFKCAHGGCPLTHSSYAALDGILYCKHHFQQLFMEKGNYQHVLKAANNK  179


 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC+KTVY ++ ++ +G ++H+SCFKC+H    L  S+Y++++G+LYCK HF
Sbjct  100  FSGTQDKCPACNKTVYPLEKVTMEGESFHRSCFKCAHGGCPLTHSSYAALDGILYCKHHF  159

Query  325  EQLFKESGNFSKNFHSSSSRENSL  396
            +QLF E GN+     ++++++N++
Sbjct  160  QQLFMEKGNYQHVLKAANNKKNAV  183



>ref|XP_011091917.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Sesamum 
indicum]
Length=223

 Score =   309 bits (792),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSM+GVLYCK H
Sbjct  3    AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  62

Query  322  FEQLFKESGNFSKNFHSSS-SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            FEQLFKESGNFSKNF ++   +ENS  KA NK S+MFSGTQ+KCPAC KTVYPLEKV ME
Sbjct  63   FEQLFKESGNFSKNFQTTKHDKENSSNKAPNKLSAMFSGTQDKCPACHKTVYPLEKVIME  122

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GES+HKSCFKC+HGGC LTH++YAALDG+LYCK HF QLFMEKGNYQHVL+A   +
Sbjct  123  GESFHKSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQHVLEAATNR  178


 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ +  +G ++HKSCFKC+H    L  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCPACHKTVYPLEKVIMEGESFHKSCFKCAHGGCPLTHSSYAALDGILYCKVHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENSL  396
            +QLF E GN+     ++++R++++
Sbjct  159  QQLFMEKGNYQHVLEAATNRKSAV  182



>ref|XP_009762122.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|ACB05475.1| LIM domain protein 2b [Nicotiana tabacum]
Length=216

 Score =   308 bits (788),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 161/178 (90%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVDLL+ADG TYHKSCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLTADGITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS--SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE GNFSKNF +S+   RE++LT+  +K S+MFSGTQ+KC AC+KTVYPLEKVT
Sbjct  61   HFEQLFKECGNFSKNFQTSAKPEREHALTRTPSKLSAMFSGTQDKCAACNKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGES+HKSCFKC+HGGC LTHATYA+LDGVLYCKHHF QLFMEKG YQHVL+A   K
Sbjct  121  MEGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTYQHVLEAANNK  178


 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC+KTVY ++ ++ +G ++HKSCFKC+H    L  + Y+S++GVLYCK HF
Sbjct  99   FSGTQDKCAACNKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRE-NSLTKASNK  414
             QLF E G +     ++++++ N+ T  +N+
Sbjct  159  AQLFMEKGTYQHVLEAANNKKINAETPTNNE  189



>gb|EYU35073.1| hypothetical protein MIMGU_mgv1a013171mg [Erythranthe guttata]
Length=229

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AFTGTLDKCKACDKTVYFVDLLSADGAT+HKSCFKCSHCKGTLVMSNYSSM+GVLYCKTH
Sbjct  3    AFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  62

Query  322  FEQLFKESGNFSKNFHSSS--SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            FEQLFK+S +F+KNF +S+   RENSLT+A NK S+MFSGTQ+KCPAC K VYPLEKVTM
Sbjct  63   FEQLFKDSAHFTKNFQTSAKPERENSLTRAPNKLSAMFSGTQDKCPACDKIVYPLEKVTM  122

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGES+HKSCFKC+HGGC LTH++YAALDG+LYCK HF QLFMEKGNYQHVL +   K
Sbjct  123  EGESFHKSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQHVLNSTNHK  179



>ref|XP_006341718.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=212

 Score =   306 bits (785),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVYFVDLLSADG TYHKSCFKC+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYFVDLLSADGITYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSS--SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE GNFSKNF +S    +EN+L +  +K S+MFSGTQ+KC AC+KTVYPLEKVT
Sbjct  61   HFEQLFKECGNFSKNFQTSPKPDKENALARTPSKLSAMFSGTQDKCAACTKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGES+HKSCFKC+HGGC LTHATYA+LDG+LYCKHHF QLFMEKG YQHVL+A   K
Sbjct  121  MEGESFHKSCFKCAHGGCPLTHATYASLDGILYCKHHFAQLFMEKGTYQHVLEAANNK  178


 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 68/103 (66%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G ++HKSCFKC+H    L  + Y+S++G+LYCK HF
Sbjct  99   FSGTQDKCAACTKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGILYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCP  453
             QLF E G +     ++++++N+   A+N+     + T E+ P
Sbjct  159  AQLFMEKGTYQHVLEAANNKKNADQAAANEVVENEATTTEEQP  201



>ref|XP_004248581.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Solanum 
lycopersicum]
Length=212

 Score =   306 bits (785),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVYFVDLLSADG TYHKSCFKC+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYFVDLLSADGITYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSS--SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE GNFSKNF +S    +EN+L +  +K S+MFSGTQ+KC AC+KTVYPLEKVT
Sbjct  61   HFEQLFKECGNFSKNFQTSPKPDKENALARTPSKLSAMFSGTQDKCAACTKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGES+HKSCFKC+HGGC LTHATYA+LDG+LYCKHHF QLFMEKG YQHVL+A   K
Sbjct  121  MEGESFHKSCFKCAHGGCPLTHATYASLDGILYCKHHFAQLFMEKGTYQHVLEAANNK  178


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 67/103 (65%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G ++HKSCFKC+H    L  + Y+S++G+LYCK HF
Sbjct  99   FSGTQDKCAACTKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGILYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCP  453
             QLF E G +     ++++++N+   A+ +     + T ++ P
Sbjct  159  AQLFMEKGTYQHVLEAANNKKNADQAAAIEVVEDEATTTDEQP  201



>ref|XP_009624528.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=207

 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVDLL+ADG TYHKSCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLTADGITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS--SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE GNFSKNF +++   RE++LT+  +K S+MFSGTQ+KC AC KTVYPLEKVT
Sbjct  61   HFEQLFKECGNFSKNFQTTAKPEREHALTRTPSKLSAMFSGTQDKCAACKKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGES+HKSCFKC+HGGC LTHATYA+LDGVLYCKHHF QLFMEKG YQHVL+A   K
Sbjct  121  MEGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTYQHVLEAANHK  178


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G ++HKSCFKC+H    L  + Y+S++GVLYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNK  414
             QLF E G +     +++ ++ +  +A+NK
Sbjct  159  AQLFMEKGTYQHVLEAANHKKIN-NEATNK  187



>gb|EPS71497.1| hypothetical protein M569_03263, partial [Genlisea aurea]
Length=215

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 159/178 (89%), Gaps = 3/178 (2%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSM+GVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  322  FEQLFKESGNFSKNFHSSS---SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            FEQLFKESGNFSKNF +S     +EN  +KA NK S+MFSGTQ+KC ACSKTVYPLEK+T
Sbjct  62   FEQLFKESGNFSKNFQTSKHVVDKENYGSKAPNKVSAMFSGTQDKCAACSKTVYPLEKMT  121

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGESYHKSCFKC+HGGC LTH++YAALDG+LYCK HF QLFMEKGNYQHVL A   +
Sbjct  122  MEGESYHKSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQHVLNAATHR  179


 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHKSCFKC+H    L  S+Y++++G+LYCK HF
Sbjct  100  FSGTQDKCAACSKTVYPLEKMTMEGESYHKSCFKCAHGGCPLTHSSYAALDGILYCKVHF  159

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
            +QLF E GN+    ++++ R ++
Sbjct  160  QQLFMEKGNYQHVLNAATHRRSA  182


 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  SMFSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKH  600
            S F+GT +KC AC KTVY ++ ++ +G +YHKSCFKCSH    L  + Y+++DGVLYCK 
Sbjct  1    SAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  601  HFTQLFMEKGNY  636
            HF QLF E GN+
Sbjct  61   HFEQLFKESGNF  72



>ref|XP_009624529.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=206

 Score =   304 bits (778),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVDLL+ADG TYHKSCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLTADGITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE GNFSKNF ++   RE++LT+  +K S+MFSGTQ+KC AC KTVYPLEKVTM
Sbjct  61   HFEQLFKECGNFSKNFQTTKPEREHALTRTPSKLSAMFSGTQDKCAACKKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGES+HKSCFKC+HGGC LTHATYA+LDGVLYCKHHF QLFMEKG YQHVL+A   K
Sbjct  121  EGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTYQHVLEAANHK  177


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G ++HKSCFKC+H    L  + Y+S++GVLYCK HF
Sbjct  98   FSGTQDKCAACKKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNK  414
             QLF E G +     +++ ++ +  +A+NK
Sbjct  158  AQLFMEKGTYQHVLEAANHKKIN-NEATNK  186



>gb|EPS59684.1| hypothetical protein M569_15118, partial [Genlisea aurea]
Length=180

 Score =   302 bits (773),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVYFVDLL+ADGAT+HKSCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYFVDLLTADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFH-SSSSRENSLTKAS-NKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF  S++++ENS +KA+ N+ S+MFSGTQ+KCPAC+K VYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQPSAANKENSASKAAPNRMSAMFSGTQDKCPACNKIVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGES H+SCFKC+HGGC LTH++YAALDG+LYCK HF QLFMEKGNYQHVL+A   K
Sbjct  121  MEGESVHRSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQHVLQAATHK  178


 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +1

Query  118  NKV*KERMA--FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSS  291
            +K    RM+  F+GT DKC AC+K VY ++ ++ +G + H+SCFKC+H    L  S+Y++
Sbjct  88   SKAAPNRMSAMFSGTQDKCPACNKIVYPLEKVTMEGESVHRSCFKCAHGGCPLTHSSYAA  147

Query  292  MEGVLYCKTHFEQLFKESGNFSKNFHSSSSREN  390
            ++G+LYCK HF+QLF E GN+     +++ + +
Sbjct  148  LDGILYCKVHFQQLFMEKGNYQHVLQAATHKRS  180



>ref|XP_004240106.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Solanum 
lycopersicum]
Length=228

 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 161/178 (90%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVDLLSADGAT+HKSCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENS--LTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +SS  E    L KA +K S+MFSGTQ+KC ACSKTVYPLEKV 
Sbjct  61   HFEQLFKESGNFSKNFQTSSKSEKESSLAKAPSKVSAMFSGTQDKCAACSKTVYPLEKVI  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +EGE++HKSCFKC+HGGCALTHATYAALDGVLYCKHHF QLFMEKG+YQHVLKA   K
Sbjct  121  LEGEAFHKSCFKCAHGGCALTHATYAALDGVLYCKHHFAQLFMEKGSYQHVLKATTNK  178


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ +  +G  +HKSCFKC+H    L  + Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACSKTVYPLEKVILEGEAFHKSCFKCAHGGCALTHATYAALDGVLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLF E G++     +++++++++T
Sbjct  159  AQLFMEKGSYQHVLKATTNKKSTVT  183



>ref|XP_002269537.1| PREDICTED: LIM domain-containing protein PLIM2c [Vitis vinifera]
 emb|CAN74803.1| hypothetical protein VITISV_006290 [Vitis vinifera]
Length=220

 Score =   302 bits (773),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 162/181 (90%), Gaps = 3/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VDLLSADGA+YHK+CFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS---SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            HFEQLFKESGNFSKNF +S+    + N L++A +K SSMFSGTQ+KC AC KTVYPLEKV
Sbjct  61   HFEQLFKESGNFSKNFQTSAKPADKLNELSRAPSKLSSMFSGTQDKCSACRKTVYPLEKV  120

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            T+EGESYHKSCFKC+HGGC LTH++YAAL+GVLYCKHHF+QLFMEKGNY HVL+A   K 
Sbjct  121  TLEGESYHKSCFKCAHGGCPLTHSSYAALNGVLYCKHHFSQLFMEKGNYSHVLEAATHKK  180

Query  670  Q  672
            Q
Sbjct  181  Q  181



>ref|XP_010671960.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score =   293 bits (750),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVDLLSADGA +HKSCF+CSHC GTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYFVDLLSADGAIFHKSCFRCSHCNGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNF KNF S   + R     +A NK SS FSGTQEKCP C KTVYPLEK+T
Sbjct  61   HFEQLFKESGNFRKNFQSGQKTDRPYEQNRAPNKLSSFFSGTQEKCPGCHKTVYPLEKIT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            MEGESYHKSCFKC+ GGC LTH++YAALDG+LYCKHHF QLFMEKG+Y HV  A ++
Sbjct  121  MEGESYHKSCFKCAVGGCPLTHSSYAALDGILYCKHHFQQLFMEKGSYNHVKNAAKK  177


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ ++ +G  +HKSCF+CSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYFVDLLSADGAIFHKSCFRCSHCNGTLVMSNYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E GN++   ++GQ+ ++
Sbjct  63   EQLFKESGNFRKNFQSGQKTDR  84



>gb|EYU32092.1| hypothetical protein MIMGU_mgv1a013269mg [Erythranthe guttata]
Length=225

 Score =   291 bits (744),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 156/179 (87%), Gaps = 4/179 (2%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            +FTGTLDKCKACDKTVYFVDLLSADG+T+HKSCFKCSHCKGTLVMS+YSSM+GVLYCK H
Sbjct  3    SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSSYSSMDGVLYCKPH  62

Query  322  FEQLFKESGNFSKNFHSSSSRE----NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            FEQLFKESGNFSKNF +S        N   +  +K+S+MF GTQ+KCPAC+KTVYPLEKV
Sbjct  63   FEQLFKESGNFSKNFQASKQERDHNNNLQARGPSKHSAMFCGTQDKCPACNKTVYPLEKV  122

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            TMEGES+HKSCFKC+HGGC LTH++YAALDG+LYCK HF QLFMEKGNYQHVL +   K
Sbjct  123  TMEGESFHKSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQHVLDSANHK  181


 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = +1

Query  130  KERMAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLY  309
            K    F GT DKC AC+KTVY ++ ++ +G ++HKSCFKC+H    L  S+Y++++G+LY
Sbjct  97   KHSAMFCGTQDKCPACNKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHSSYAALDGILY  156

Query  310  CKTHFEQLFKESGNFSKNFHSSSSRENS  393
            CK HF+QLF E GN+     S++ ++ +
Sbjct  157  CKVHFQQLFMEKGNYQHVLDSANHKKGA  184



>emb|CDY56926.1| BnaAnng14450D [Brassica napus]
Length=212

 Score =   286 bits (732),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMRYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF S+   E  N +T+A +K SS FSGTQ+KCPAC KTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQSAGKTEKTNDVTRAPSKLSSFFSGTQDKCPACKKTVYPLEKIT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGESYHK+CF+C+HGGC LTH++YAAL+GVLYCK HF+QLF+EKGNY HVL+A   +
Sbjct  121  MEGESYHKTCFRCAHGGCPLTHSSYAALNGVLYCKVHFSQLFLEKGNYNHVLQAANNR  178



>ref|XP_007051870.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOX96027.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=276

 Score =   288 bits (736),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  130  KERMAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLY  309
            K+ MAFTGTLDKCKACD+TV+ VD+LS +G  YHK+CFKCSHCKG LVMS YSSM+GVLY
Sbjct  66   KKEMAFTGTLDKCKACDRTVHVVDMLSLEGVPYHKTCFKCSHCKGNLVMSTYSSMDGVLY  125

Query  310  CKTHFEQLFKESGNFSKNFHS-SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            CK HFEQLFKESGNFSKNFH+  S R+N L++  +K SS+F GTQ+KC AC KTVYPLEK
Sbjct  126  CKPHFEQLFKESGNFSKNFHTVKSERQNELSRTPSKVSSLFCGTQDKCAACQKTVYPLEK  185

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VTMEGE YHK+CF+C+HGGC LTH++YAAL+GVLYCKHHF QLFMEKGNY HVL+A   K
Sbjct  186  VTMEGECYHKNCFRCAHGGCHLTHSSYAALNGVLYCKHHFAQLFMEKGNYNHVLQAASHK  245


 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 62/85 (73%), Gaps = 4/85 (5%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC +TV+ ++ +++EG  YHK+CFKCSH    L  +TY+++DGVLYCK HF
Sbjct  71   FTGTLDKCKACDRTVHVVDMLSLEGVPYHKTCFKCSHCKGNLVMSTYSSMDGVLYCKPHF  130

Query  607  TQLFMEKGNYQ---HVLKAGQRKNQ  672
             QLF E GN+    H +K+ +R+N+
Sbjct  131  EQLFKESGNFSKNFHTVKS-ERQNE  154


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y+++ GVLYCK HF
Sbjct  166  FCGTQDKCAACQKTVYPLEKVTMEGECYHKNCFRCAHGGCHLTHSSYAALNGVLYCKHHF  225

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASN  411
             QLF E GN++    ++S + N+ + ASN
Sbjct  226  AQLFMEKGNYNHVLQAASHKRNN-SSASN  253



>ref|XP_002511828.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF50497.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=210

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 155/179 (87%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VD+LS +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKA-SNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  + ++N  ++A  +K SS+F GTQ+KC AC KTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQAGKTEKQNDSSRAPPSKVSSLFCGTQDKCSACGKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            MEGE +HKSCF+C+HGGC LTH++YAALDGVLYCKHHF QLFMEKG+Y HVL+A   K 
Sbjct  121  MEGECFHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMEKGSYTHVLQAASHKR  179


 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +++EG  YHKSCFKCSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVVDMLSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E GN+    +AG+ + Q
Sbjct  63   EQLFKESGNFSKNFQAGKTEKQ  84


 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC KTVY ++ ++ +G  +HKSCF+C+H    L  S+Y++++GVLYCK HF
Sbjct  99   FCGTQDKCSACGKTVYPLEKVTMEGECFHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E G+++    ++S + ++
Sbjct  159  AQLFMEKGSYTHVLQAASHKRST  181



>ref|XP_010255661.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Nelumbo 
nucifera]
Length=199

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 153/180 (85%), Gaps = 3/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GTL KCKACDKTVY VDLLSADG  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MSFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS--SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+FSKNF +  S  + + L +A +K SSMFSGTQ+KC AC KT YPLEKVT
Sbjct  61   HFEQLFKETGSFSKNFQTGKSEKQNDQLARAPSKLSSMFSGTQDKCAACKKTAYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            +EGESYHKSCFKCSHGGC LT +TYAALDG+LYCKHHF QLF EKGNY H+ K A  RKN
Sbjct  121  LEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKHHFAQLFKEKGNYNHLAKGASLRKN  180


 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KT Y ++ ++ +G +YHKSCFKCSH    L  S Y++++G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTAYPLEKVTLEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE GN++     +S R+N+
Sbjct  159  AQLFKEKGNYNHLAKGASLRKNN  181


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            FSGT +KC AC KTVY ++ ++ +G +YHKSCFKCSH    L  + Y+++DGVLYCK HF
Sbjct  3    FSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E G++    + G+ + Q
Sbjct  63   EQLFKETGSFSKNFQTGKSEKQ  84



>ref|XP_010523025.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
 ref|XP_010523026.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
 ref|XP_010523027.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
Length=208

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC ACDKTVY VD+L+ +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLTLEGMPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF +  S +  L +  +K SS+FSGT +KC AC KTVYPLEKVTME
Sbjct  61   HFEQLFKESGNFSKNFQTGKSEKPELNRTPSKLSSLFSGTLDKCAACEKTVYPLEKVTME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            GE YHK+CF+C+HGGC LTH++YAALDGVLYC+HHF QLF+EKGNY HVL++ 
Sbjct  121  GECYHKTCFRCAHGGCPLTHSSYAALDGVLYCRHHFNQLFLEKGNYSHVLQSA  173


 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG  YHKSCFKCSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCNACDKTVYVVDMLTLEGMPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GN+    + G+
Sbjct  63   EQLFKESGNFSKNFQTGK  80



>ref|XP_006491462.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|KDO86087.1| hypothetical protein CISIN_1g040947mg [Citrus sinensis]
Length=210

 Score =   283 bits (724),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 153/181 (85%), Gaps = 8/181 (4%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VD+LS +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGMPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFH-----SSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESGNFSKNF      SS S +N   +  +K SS+FSGTQ+KC AC KTVYPLE
Sbjct  61   HFEQLFKESGNFSKNFQTGKNPSSCSNQN---RTPSKLSSLFSGTQDKCAACEKTVYPLE  117

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVTMEG+ +HK+CF+C+HGGC LTH++YAALDGVLYCKHHF QLFMEKGNY HVLKA   
Sbjct  118  KVTMEGDCFHKTCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMEKGNYSHVLKAANH  177

Query  664  K  666
            K
Sbjct  178  K  178



>ref|XP_004306805.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=216

 Score =   283 bits (724),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKAC+KTVY VD+LS +G  YHKSCFKCSHCKG L MS YSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACEKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENS-LTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF  S+ ++N  L +A +K SSMFSGTQ+KC  CSKTVYPLEKVT+
Sbjct  61   HFEQLFKESGNFSKNFAKSAEKQNEVLNRAPSKLSSMFSGTQDKCATCSKTVYPLEKVTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            EGESYHKSCF+C+HGGC LTH++YAALDG+LYCK HF QLFMEKGNY HVL+A ++
Sbjct  121  EGESYHKSCFRCAHGGCPLTHSSYAALDGILYCKVHFAQLFMEKGNYSHVLQAAKK  176



>ref|XP_008438078.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cucumis 
melo]
Length=208

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY V+LLS +G  YHKSCFKCSHCKGTL MS+YS M+GVLYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++  S ++N L++A +K SSMFSGTQ+KC AC+KTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQNAKPSEKQNDLSRAPSKLSSMFSGTQDKCAACTKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +EGE YHK+CF+C+HGGC LTH++YAALDGVLYCKHHF QLFM KGNY HVL+A   K
Sbjct  121  LEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYNHVLEAAANK  178


 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACTKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRE  387
             QLF   GN++    ++++++
Sbjct  159  AQLFMIKGNYNHVLEAAANKK  179



>ref|XP_009116783.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
 emb|CDY48936.1| BnaA09g39010D [Brassica napus]
Length=218

 Score =   283 bits (724),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 153/178 (86%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNFH++   E  N +T+A +K SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFHTAGKTEKSNDVTRAPSKLSSFFSGTQDKCAACKKTVYPLEKIT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGESYHK+CF+C+HGGC LTH++YAAL+G+LYCK HF QLF+EKGNY HVL A   K
Sbjct  121  MEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHFNQLFLEKGNYNHVLAAANHK  178


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y+++ G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKITMEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHF  158

Query  325  EQLFKESGNFSKNF----HSSSSREN  390
             QLF E GN++       H  SS E+
Sbjct  159  NQLFLEKGNYNHVLAAANHKRSSEED  184



>ref|XP_008232792.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
Length=217

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 154/180 (86%), Gaps = 3/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VD+LS +G  YHKSCFKCSHCKG L MS YSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENS--LTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF   S+ + +  L +A +K SSMFSGT +KC  CSKTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQPKSAEKQNEQLNRAPSKLSSMFSGTLDKCATCSKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            +EGESYHKSCF+C+HGGC LTH++YAALDGVLYCKHHF+QLF+EKGNY HVL+ A  RKN
Sbjct  121  LEGESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAANRKN  180



>ref|XP_006304383.1| hypothetical protein CARUB_v10010886mg [Capsella rubella]
 gb|EOA37281.1| hypothetical protein CARUB_v10010886mg [Capsella rubella]
Length=205

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC ACDKTVY VD+LS +G  YHKSCF+C+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF      +  LTK  +K SS+F GTQ+KC AC KTVYPLEKV ME
Sbjct  61   HFEQLFKESGNFSKNFQPGKIEKPELTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CF+C+HGGC LTH++YA+LDGVLYC+HHF QLFMEKGNY HVL+A   +
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFMEKGNYAHVLQAANHR  176


 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC+KTVY ++ +  +G  +HK+CF+C+H   TL  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  +
Sbjct  157  NQLFMEKGNYAHVLQAANHRRTA  179



>gb|KGN56538.1| hypothetical protein Csa_3G122620 [Cucumis sativus]
Length=209

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY V+LLS +G  YHKSC KCSHCKGTL MS+YS M+GVLYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCLKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++  S ++N L++A +K SSMFSGTQ+KC ACSKTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQNAKPSEKQNDLSRAPSKLSSMFSGTQDKCAACSKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +EGE YHK+CF+C+HGGC LTH++YAALDGVLYCKHHF QLFM KGNY HVL+A   K
Sbjct  121  LEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYNHVLEAAANK  178


 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  99   FSGTQDKCAACSKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRE  387
             QLF   GN++    ++++++
Sbjct  159  AQLFMIKGNYNHVLEAAANKK  179



>ref|XP_010469046.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Camelina sativa]
Length=217

 Score =   281 bits (720),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++   E  N  ++A N+ SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGESYHK+CF+C+H GC LTH++YAALDG+LYCK HF+QLF+EKGNY HVL+A 
Sbjct  121  MEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAA  175



>ref|XP_010413441.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X1 [Camelina 
sativa]
 ref|XP_010413442.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X2 [Camelina 
sativa]
Length=217

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++   E  N  ++A N+ SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGESYHK+CF+C+H GC LTH++YAALDG+LYCK HF+QLF+EKGNY HVL+A 
Sbjct  121  MEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAA  175



>ref|XP_010469047.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Camelina sativa]
Length=216

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 152/174 (87%), Gaps = 1/174 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF +  + + N  ++A N+ SS FSGTQ+KC AC KTVYPLEK+TM
Sbjct  61   HFEQLFKESGNFSKNFQTGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            EGESYHK+CF+C+H GC LTH++YAALDG+LYCK HF+QLF+EKGNY HVL+A 
Sbjct  121  EGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAA  174


 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG  YHKSCF+CSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GN+    + G+
Sbjct  63   EQLFKESGNFSKNFQTGK  80



>gb|KEH18910.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=205

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY VDLL+ +   YHKSCFKCSHCKG L MS YSSM+G+LYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLENIPYHKSCFKCSHCKGNLTMSTYSSMDGILYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF  SS + N L +  ++ SSMFSGT +KC  CSKTVYPLEKVT+E
Sbjct  61   HFEQLFKESGNFSKNFAKSSDKANELNRTPSRLSSMFSGTLDKCATCSKTVYPLEKVTLE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            GE YHK+CF+C+H GC LTH+ YAALDGVLYC+ HF QLFMEKGNY HVLK+  ++N
Sbjct  121  GEIYHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGNYSHVLKSAHKRN  177



>ref|XP_004133874.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155817.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN56534.1| hypothetical protein Csa_3G122580 [Cucumis sativus]
Length=205

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 151/177 (85%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VDLL+ +G  YHK+CFKCSHCKGTL MS+YS M+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVVDLLTLEGNPYHKNCFKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHS-SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF + SS + N LT+  +K SSMFSGTQ+KC  C+KTVYPLEKV++
Sbjct  61   HFEQLFKESGNFSKNFQTKSSDKPNDLTRTPSKLSSMFSGTQDKCSVCTKTVYPLEKVSL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGE YHK CF+C+HGGC LTH +YAALDGVLYCKHHF QLFM KGNY HVL+A   K
Sbjct  121  EGECYHKKCFRCAHGGCHLTHCSYAALDGVLYCKHHFAQLFMVKGNYNHVLEAAANK  177


 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ +S +G  YHK CF+C+H    L   +Y++++GVLYCK HF
Sbjct  98   FSGTQDKCSVCTKTVYPLEKVSLEGECYHKKCFRCAHGGCHLTHCSYAALDGVLYCKHHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKAS  408
             QLF   GN++    ++++++ +   A 
Sbjct  158  AQLFMVKGNYNHVLEAAANKKTTTPPAD  185



>ref|XP_008438068.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008438069.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=205

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VDLL+ +G  YHK+CFKCSHCKGTL MS+YS M+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVVDLLTLEGNPYHKNCFKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHS-SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF +  S R+N LT+  +K SSMF GTQ+KC  C+KTVYPLEKVT+
Sbjct  61   HFEQLFKESGNFSKNFQTKPSERQNDLTRTPSKLSSMFCGTQDKCSVCTKTVYPLEKVTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGE YHK CF+C+HGGC LTH +YAALDGVLYCKHHF QLFM KGNY HVL+A   K
Sbjct  121  EGECYHKKCFRCAHGGCHLTHCSYAALDGVLYCKHHFAQLFMVKGNYNHVLEAAANK  177


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC  C KTVY ++ ++ +G  YHK CF+C+H    L   +Y++++GVLYCK HF
Sbjct  98   FCGTQDKCSVCTKTVYPLEKVTLEGECYHKKCFRCAHGGCHLTHCSYAALDGVLYCKHHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKA  405
             QLF   GN++    ++++++ +   A
Sbjct  158  AQLFMVKGNYNHVLEAAANKKTTTPPA  184



>emb|CDX71757.1| BnaC08g31170D [Brassica napus]
Length=216

 Score =   281 bits (718),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 153/178 (86%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++  + + N +T+A +K SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTAGKTDKSNEMTRAPSKLSSFFSGTQDKCAACKKTVYPLEKIT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGESYHK+CF+C+HGGC LTH++YAAL+G+LYCK HF QLF+EKGNY HVL A   K
Sbjct  121  MEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHFNQLFLEKGNYSHVLAAANHK  178


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 69/105 (66%), Gaps = 5/105 (5%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y+++ G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKITMEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHF  158

Query  325  EQLFKESGNFSKNF----HSSSSRENSLTKASNKYSSMFSGTQEK  447
             QLF E GN+S       H  +S E+  T+ + ++ S  + T+E+
Sbjct  159  NQLFLEKGNYSHVLAAANHKRTSEEDK-TETNEEHESEANPTEEE  202



>ref|XP_010479778.1| PREDICTED: LIM domain-containing protein PLIM2b [Camelina sativa]
 ref|XP_010457082.1| PREDICTED: LIM domain-containing protein PLIM2b [Camelina sativa]
Length=205

 Score =   280 bits (717),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC ACDKTVY VD+LS +G  YHKSCF+C+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF    + +  LT+  +K SS+F GTQ+KC AC KTVYPLEKV ME
Sbjct  61   HFEQLFKESGNFSKNFQPGKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CF+C+HGGC LTH++YA+LD VLYC+HHF QLFMEKGNY HVL+A   +
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQAANHR  176


 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC+KTVY ++ +  +G  +HK+CF+C+H   TL  S+Y+S++ VLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  +
Sbjct  157  NQLFMEKGNYAHVLQAANHRRTA  179



>ref|XP_006418457.1| hypothetical protein EUTSA_v10008789mg [Eutrema salsugineum]
 gb|ESQ36810.1| hypothetical protein EUTSA_v10008789mg [Eutrema salsugineum]
Length=205

 Score =   280 bits (717),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC ACDKTVY VD+LS +G  YHKSCF+C+HC GTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCNGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF    + +  LTK  +K SS+F GTQ+KC AC KTVYPLEKV ME
Sbjct  61   HFEQLFKESGNFSKNFQPGKTEKPELTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CF+C+HGGC LTH++YA+LDGVLYC+HHF QLF+EKGNY HVL+A   +
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQAANHR  176


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC+KTVY ++ +  +G  +HK+CF+C+H   TL  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  +
Sbjct  157  NQLFLEKGNYAHVLQAANHRRTA  179



>ref|XP_010413443.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X3 [Camelina 
sativa]
 ref|XP_010413445.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X4 [Camelina 
sativa]
Length=216

 Score =   280 bits (717),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 152/174 (87%), Gaps = 1/174 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF +  + + N  ++A N+ SS FSGTQ+KC AC KTVYPLEK+TM
Sbjct  61   HFEQLFKESGNFSKNFQTGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            EGESYHK+CF+C+H GC LTH++YAALDG+LYCK HF+QLF+EKGNY HVL+A 
Sbjct  121  EGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAA  174


 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG  YHKSCF+CSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GN+    + G+
Sbjct  63   EQLFKESGNFSKNFQTGK  80



>ref|XP_009138785.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Brassica 
rapa]
 emb|CDX89105.1| BnaA04g00810D [Brassica napus]
Length=211

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 153/178 (86%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF S+   E  N +T+A +K SS FSGTQ+KC AC KTVYPLEK+ 
Sbjct  61   HFEQLFKESGNFSKNFQSAGKTEKSNDVTRAPSKLSSFFSGTQDKCAACKKTVYPLEKMA  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            MEGESYHK+CF+C+HGGC LTH++YAAL+G+LYCK HF+QLF+EKGNY HVL+A   +
Sbjct  121  MEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYNHVLEAANHR  178


 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y+++ G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMAMEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  S
Sbjct  159  SQLFLEKGNYNHVLEAANHRRTS  181



>ref|XP_010474800.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Camelina 
sativa]
 ref|XP_010474801.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Camelina 
sativa]
Length=205

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC ACDKTVY VD+LS +G  YHKSCF+C+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF    + +  LT+  +K SS+F GTQ+KC AC KTVYPLEKV ME
Sbjct  61   HFEQLFKESGNFSKNFQPGKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CF+C+HGGC LTH++YA+LD VLYC+HHF QLFMEKGNY HVL+A   +
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQATNHR  176


 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC+KTVY ++ +  +G  +HK+CF+C+H   TL  S+Y+S++ VLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  +
Sbjct  157  NQLFMEKGNYAHVLQATNHRRTA  179



>ref|XP_010512456.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Camelina sativa]
Length=219

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++   E  N  ++A N+ SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGESYHK+CF+C+H GC LTH++YAALDG+LYCK HF+QLF+EKGNY HVL+A 
Sbjct  121  MEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAA  175


 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN+S    ++++   +
Sbjct  159  SQLFLEKGNYSHVLQAAANNRRT  181



>ref|XP_004134333.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155874.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
Length=210

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 156/179 (87%), Gaps = 3/179 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY V+LLS +G  YHKSCFKCSHCKGTL MS+YS M+GVLYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSL-TKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            HFEQLFKESGNFSKNF ++  S ++N L ++A +K SSMFSGTQ+KC ACSKTVYPLEKV
Sbjct  61   HFEQLFKESGNFSKNFQNAKPSEKQNDLQSRAPSKLSSMFSGTQDKCAACSKTVYPLEKV  120

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            T+EGE YHK+CF+C+HGGC LTH++YAALDGVLYCKHHF QLFM KGNY HVL+A   K
Sbjct  121  TLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYNHVLEAAANK  179


 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  100  FSGTQDKCAACSKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  159

Query  325  EQLFKESGNFSKNFHSSSSRE  387
             QLF   GN++    ++++++
Sbjct  160  AQLFMIKGNYNHVLEAAANKK  180



>ref|XP_009138786.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Brassica 
rapa]
Length=210

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF S  + + N +T+A +K SS FSGTQ+KC AC KTVYPLEK+ M
Sbjct  61   HFEQLFKESGNFSKNFQSGKTEKSNDVTRAPSKLSSFFSGTQDKCAACKKTVYPLEKMAM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGESYHK+CF+C+HGGC LTH++YAAL+G+LYCK HF+QLF+EKGNY HVL+A   +
Sbjct  121  EGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYNHVLEAANHR  177


 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y+++ G+LYCK HF
Sbjct  98   FSGTQDKCAACKKTVYPLEKMAMEGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  S
Sbjct  158  SQLFLEKGNYNHVLEAANHRRTS  180



>ref|XP_010512457.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Camelina sativa]
Length=218

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 152/174 (87%), Gaps = 1/174 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF +  + + N  ++A N+ SS FSGTQ+KC AC KTVYPLEK+TM
Sbjct  61   HFEQLFKESGNFSKNFQTGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            EGESYHK+CF+C+H GC LTH++YAALDG+LYCK HF+QLF+EKGNY HVL+A 
Sbjct  121  EGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAA  174


 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG  YHKSCF+CSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GN+    + G+
Sbjct  63   EQLFKESGNFSKNFQTGK  80


 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y++++G+LYCK HF
Sbjct  98   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN+S    ++++   +
Sbjct  158  SQLFLEKGNYSHVLQAAANNRRT  180



>gb|KDP28657.1| hypothetical protein JCGZ_14428 [Jatropha curcas]
Length=221

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 153/197 (78%), Gaps = 20/197 (10%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VD+LS +G  YHK CFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGVPYHKYCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHS--------------------SSSRENSLTKASNKYSSMFSGT  438
            HFEQLFKESGNFSKNF +                         + +T A +K SSMFSGT
Sbjct  61   HFEQLFKESGNFSKNFQAGKRFLQCSYINIMLFYGMFFQERLRSKMTLAPSKVSSMFSGT  120

Query  439  QEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLF  618
            Q+KC ACSKTVYPLEKVTMEGE +HKSCF+C+HGGC LTH++YAALDGVLYCKHHF QLF
Sbjct  121  QDKCSACSKTVYPLEKVTMEGECFHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLF  180

Query  619  MEKGNYQHVLKAGQRKN  669
            MEKG+Y HVL+A   K 
Sbjct  181  MEKGSYTHVLQAASHKR  197


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G  +HKSCF+C+H    L  S+Y++++GVLYCK HF
Sbjct  117  FSGTQDKCSACSKTVYPLEKVTMEGECFHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHF  176

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E G+++    ++S +  +
Sbjct  177  AQLFMEKGSYTHVLQAASHKRTA  199



>ref|XP_008376025.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=221

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 153/179 (85%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY  ++LS +G  YHKSCFKCSHCKG L MS YSSM+G+LYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVTEMLSLEGVPYHKSCFKCSHCKGFLSMSTYSSMDGILYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE-NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF  S+ ++   L +  +K S++FSGTQ+KC  CSKTVYPLEKVT+
Sbjct  61   HFEQLFKESGNFSKNFAKSAEKQGEQLNRVPSKLSALFSGTQDKCATCSKTVYPLEKVTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            EGESYHKSCF+C HGGCALTH++YAALDGVLYCKHHF+QLF+EKGNY HVL+ A  RKN
Sbjct  121  EGESYHKSCFRCXHGGCALTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAANRKN  179



>ref|XP_006402504.1| hypothetical protein EUTSA_v10006235mg [Eutrema salsugineum]
 gb|ESQ43957.1| hypothetical protein EUTSA_v10006235mg [Eutrema salsugineum]
Length=214

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 156/180 (87%), Gaps = 4/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++  + + N +T+A +K SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTAGKTEKPNEMTRAPSKLSSFFSGTQDKCAACKKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG--QRK  666
            MEGESYHK+CF+C+H GC LTH++YAAL+G+LYCK HF+QLF+EKGNY HVL+A   QR+
Sbjct  121  MEGESYHKTCFRCAHSGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYNHVLQAAANQRR  180


 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y+++ G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALNGILYCKVHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++++  +
Sbjct  159  SQLFLEKGNYNHVLQAAANQRRT  181



>ref|XP_008438077.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cucumis 
melo]
Length=209

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 156/179 (87%), Gaps = 3/179 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY V+LLS +G  YHKSCFKCSHCKGTL MS+YS M+GVLYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSL-TKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            HFEQLFKESGNFSKNF ++  S ++N L ++A +K SSMFSGTQ+KC AC+KTVYPLEKV
Sbjct  61   HFEQLFKESGNFSKNFQNAKPSEKQNDLQSRAPSKLSSMFSGTQDKCAACTKTVYPLEKV  120

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            T+EGE YHK+CF+C+HGGC LTH++YAALDGVLYCKHHF QLFM KGNY HVL+A   K
Sbjct  121  TLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYNHVLEAAANK  179


 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  100  FSGTQDKCAACTKTVYPLEKVTLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  159

Query  325  EQLFKESGNFSKNFHSSSSRE  387
             QLF   GN++    ++++++
Sbjct  160  AQLFMIKGNYNHVLEAAANKK  180



>ref|XP_002320783.2| LIM domain-containing family protein [Populus trichocarpa]
 gb|EEE99098.2| LIM domain-containing family protein [Populus trichocarpa]
Length=206

 Score =   278 bits (711),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 149/178 (84%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVD++S +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYFVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFH-SSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE G+FSKNF      R + L++  +K SS+F GTQ+KC AC KTVYPLEKVTM
Sbjct  61   HFEQLFKEGGDFSKNFQKGKPERTHDLSRIPSKLSSVFCGTQDKCSACGKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGE YHK+CF+C+HGGC LTH++YAALDGVLYCK HF QLFMEKG Y HVL +   K 
Sbjct  121  EGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLASAAHKR  178


 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
             F GT DKC AC KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK H
Sbjct  97   VFCGTQDKCSACGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVH  156

Query  322  FEQLFKESGNFSKNFHSSSSRENSLTKA  405
            F QLF E G +S    S++ + ++ T  
Sbjct  157  FAQLFMEKGTYSHVLASAAHKRSNSTPP  184



>ref|XP_010054850.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW78044.1| hypothetical protein EUGRSUZ_D02268 [Eucalyptus grandis]
Length=208

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGT+DKCK CDKTV+ VD+++ +G  YHK+CF+CSHC GTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTVDKCKVCDKTVHVVDMMTLEGIPYHKTCFRCSHCNGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESG+F KNFHS+ S + N +T+  +K SSMFSGT +KC +C+KTVYPLEKVTM
Sbjct  61   HFEQLFKESGDFRKNFHSAKSDKPNEMTRTPSKLSSMFSGTLDKCSSCNKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            EGE YHK+CF+C+HGGC LTH++YAALDGVLYC+HHF +LFMEKG+++HVL  A  R+N
Sbjct  121  EGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCRHHFARLFMEKGDFKHVLDSATHRRN  179


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC +C+KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYC+ HF
Sbjct  98   FSGTLDKCSSCNKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCRHHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             +LF E G+F     S++ R N+
Sbjct  158  ARLFMEKGDFKHVLDSATHRRNA  180



>ref|XP_010523732.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Tarenaya 
hassleriana]
Length=234

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 151/180 (84%), Gaps = 4/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DLL+ +G  YHKSCF+CSHC GTLV+SNYSSMEGVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLTLEGMPYHKSCFRCSHCNGTLVISNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENS----LTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESGNFSKNF ++   E S     T+A N+ SS FSGTQ+KC AC KTVYPLEK
Sbjct  61   HFEQLFKESGNFSKNFQTAGKTEKSSDAPQTRAPNRLSSFFSGTQDKCAACQKTVYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +TMEGESYHK+CF+C+H GC LTH++YAALDGVLYCK HF QLF+EKG+Y HVL++   +
Sbjct  121  MTMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHFNQLFLEKGSYNHVLQSANHR  180


 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  101  FSGTQDKCAACQKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E G+++    S++ R  +
Sbjct  161  NQLFLEKGSYNHVLQSANHRRTA  183



>ref|XP_002892043.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68302.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   278 bits (710),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC  CDKTVY VD+LS +G  YHKSCF+C+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF    + +  LTK  +K SS+F GTQ+KC AC KTVYPLEK+ ME
Sbjct  61   HFEQLFKESGNFSKNFQPGKTEKPELTKTPSKISSIFCGTQDKCAACEKTVYPLEKIQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CF+C+HGGC LTH++YA+LD VLYC+HHF QLF+EKGNY HVL+A   +
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFLEKGNYAHVLQAANHR  176


 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 60/89 (67%), Gaps = 4/89 (4%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC+KTVY ++ +  +G  +HK+CF+C+H   TL  S+Y+S++ VLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRE----NSLT  399
             QLF E GN++    +++ R     N+LT
Sbjct  157  NQLFLEKGNYAHVLQAANHRRTASGNTLT  185



>gb|KHG24611.1| Pollen-specific SF3 [Gossypium arboreum]
Length=209

 Score =   277 bits (709),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTV+ VD+++ +G  YHK+CFKCSHCKG LVM+ YSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVHVVDMMTLEGVPYHKTCFKCSHCKGNLVMNTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF ++ + ++N  ++  NK SS+FSGTQ+KC AC KTVYPLEK+TM
Sbjct  61   HFEQLFKESGNFSKNFQTAKTEKQNDTSRTPNKLSSLFSGTQDKCAACEKTVYPLEKITM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG-QRKN  669
            EGE +HK+CF+C+HGGC LTH++YAAL+G+LYCKHHF QLFM KGNY HVL+A   R+N
Sbjct  121  EGECFHKTCFRCAHGGCPLTHSSYAALNGILYCKHHFAQLFMVKGNYNHVLQAATHRRN  179


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTV+ ++ +T+EG  YHK+CFKCSH    L   TY+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVHVVDMMTLEGVPYHKTCFKCSHCKGNLVMNTYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E GN+    +  + + Q
Sbjct  63   EQLFKESGNFSKNFQTAKTEKQ  84


 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC+KTVY ++ ++ +G  +HK+CF+C+H    L  S+Y+++ G+LYCK HF
Sbjct  98   FSGTQDKCAACEKTVYPLEKITMEGECFHKTCFRCAHGGCPLTHSSYAALNGILYCKHHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYS  420
             QLF   GN++    +++ R N+ T +S  ++
Sbjct  158  AQLFMVKGNYNHVLQAATHRRNTSTASSTDFA  189



>ref|XP_006292212.1| hypothetical protein CARUB_v10018418mg [Capsella rubella]
 gb|EOA25110.1| hypothetical protein CARUB_v10018418mg [Capsella rubella]
Length=216

 Score =   278 bits (710),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+ NYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF ++   E  N  ++A N+ SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGESYHK+CF+C+H GC LTH++YAALDG+LYCK HF+QLF+EKGNY HVL+A 
Sbjct  121  MEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAA  175


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN+S    ++++   S
Sbjct  159  SQLFLEKGNYSHVLQAAANHRRS  181



>ref|XP_002878372.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54631.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+ NYSSM+GVLYCKTH
Sbjct  3    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKTH  62

Query  322  FEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            FEQLFKESGNFSKNF ++   E  N  T+A N+ SS FSGTQ+KC AC KTVYPLEK+TM
Sbjct  63   FEQLFKESGNFSKNFQTAGKTEKSNETTRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTM  122

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            EGESYHK+CF+C+H GC LTH++YAALDG+LYCK HF+QLF+EKGNY HVL+A 
Sbjct  123  EGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYNHVLQAA  176



>ref|XP_008337059.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008343387.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=219

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 151/179 (84%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKC ACDKTVY  ++LS +G  YHKSCFKCSHCKG L MS YSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCSACDKTVYVTEMLSLEGVPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE-NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNF KNF  S+ ++   L +A +K SSMF GTQ+KC  CSKTVYPLEKVT+
Sbjct  61   HFEQLFKESGNFGKNFAKSAEKQGEQLNRAPSKLSSMFCGTQDKCATCSKTVYPLEKVTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            EGESYHKSCF+C+HGGC LTH++YAALDGVLYCKHHF+QLF+EKGNY HVL+ A  RKN
Sbjct  121  EGESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAANRKN  179



>ref|XP_011035878.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Populus 
euphratica]
Length=206

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVD++S +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYFVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFH-SSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE G+FSKNF      R + L++  +K SS+F GTQ+KC  C KTVYPLEKVTM
Sbjct  61   HFEQLFKEGGDFSKNFQKGKPERTHDLSRIPSKLSSVFCGTQDKCSTCGKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGE YHK+CF+C+HGGC LTH++YAALDGVLYCK HF QLFMEKG Y HVL +   K 
Sbjct  121  EGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLASAAHKR  178


 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
             F GT DKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK H
Sbjct  97   VFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVH  156

Query  322  FEQLFKESGNFSKNFHSSSSRENSLTKA  405
            F QLF E G +S    S++ + ++ T  
Sbjct  157  FAQLFMEKGTYSHVLASAAHKRSNSTPP  184



>ref|XP_007218397.1| hypothetical protein PRUPE_ppa011395mg [Prunus persica]
 gb|EMJ19596.1| hypothetical protein PRUPE_ppa011395mg [Prunus persica]
Length=212

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 151/178 (85%), Gaps = 4/178 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VD+LS +G  YHKSCFKCSHCKG L MS YSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNF+K   S+  +   L +A +K SSMFSGT +KC  CSKTVYPLEKVT+E
Sbjct  61   HFEQLFKESGNFTK---SAEKQNEQLNRAPSKLSSMFSGTLDKCATCSKTVYPLEKVTLE  117

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            GESYHKSCF+C+HGGC LTH++YAALDGVLYCKHHF+QLF+EKGNY HVL+ A  RKN
Sbjct  118  GESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAANRKN  175


 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC  C KTVY ++ ++ +G +YHKSCF+C+H    L  S+Y++++GVLYCK HF
Sbjct  94   FSGTLDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHF  153

Query  325  EQLFKESGNFSKNFHSSSSRENSL  396
             QLF E GN+S    ++++R+N+L
Sbjct  154  SQLFLEKGNYSHVLQAAANRKNAL  177



>gb|KFK35321.1| hypothetical protein AALP_AA5G269200 [Arabis alpina]
Length=214

 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC  TLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNHTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGN+SKNFH++   E  N +TKA +K SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKESGNYSKNFHTAGKTEKSNEVTKAPSKLSSFFSGTQDKCAACKKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQ  660
            MEGESYHK+CF+C+HGGC LTH++YAAL+GVLYCK HF QLF+EKGNY HVL +  
Sbjct  121  MEGESYHKNCFRCAHGGCHLTHSSYAALNGVLYCKVHFNQLFLEKGNYSHVLASAN  176


 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y+++ GVLYCK HF
Sbjct  99   FSGTQDKCAACKKTVYPLEKMTMEGESYHKNCFRCAHGGCHLTHSSYAALNGVLYCKVHF  158

Query  325  EQLFKESGNF-----SKNFHSSSSRENSLTKASNKYSSMFSGTQEKCP  453
             QLF E GN+     S N H  ++ E       N+       T +  P
Sbjct  159  NQLFLEKGNYSHVLASANNHRRTTEEEKTEANENEAKPTEEETSDAVP  206



>ref|XP_011023373.1| PREDICTED: LIM domain-containing protein PLIM2b [Populus euphratica]
Length=203

 Score =   276 bits (705),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VD++S +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFH-SSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE G+FSKNF      R + LT+  +K SS+F GTQ+KC  C KTVYPLEKVTM
Sbjct  61   HFEQLFKEGGDFSKNFQKGKPERTHELTRTPSKLSSVFCGTQDKCSTCGKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGE YHK+CF+C+HGGC LTH++YAALDGVLYCK HF QLFMEKG Y HVL     K 
Sbjct  121  EGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLAGATHKR  178


 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
             F GT DKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK H
Sbjct  97   VFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVH  156

Query  322  FEQLFKESGNFSKNFHSSSSRENSLTKASN  411
            F QLF E G +S     ++ + ++ T    
Sbjct  157  FAQLFMEKGTYSHVLAGATHKRSTSTPPPE  186



>ref|NP_171683.1| LIM family protein [Arabidopsis thaliana]
 sp|Q1ECF5.1|PLI2B_ARATH RecName: Full=LIM domain-containing protein PLIM2b; AltName: 
Full=Pollen-expressed LIM protein 2B [Arabidopsis thaliana]
 gb|ABF83669.1| At1g01780 [Arabidopsis thaliana]
 dbj|BAH20039.1| AT1G01780 [Arabidopsis thaliana]
 gb|AEE27334.1| LIM domain-containing protein [Arabidopsis thaliana]
Length=205

 Score =   276 bits (705),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC  CDKTVY VD+LS +G  YHKSCF+C+HCKGTL MSNYSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF    + +  LT+  +K SS+F GTQ+KC AC KTVYPLEK+ ME
Sbjct  61   HFEQLFKESGNFSKNFQPGKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEKIQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CF+C+HGGC LTH++YA+LD VLYC+HHF QLFMEKGNY HVL+A   +
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQAANHR  176


 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC+KTVY ++ +  +G  +HK+CF+C+H   TL  S+Y+S++ VLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  +
Sbjct  157  NQLFMEKGNYAHVLQAANHRRTA  179



>ref|XP_010273176.1| PREDICTED: LIM domain-containing protein PLIM2c [Nelumbo nucifera]
Length=200

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GTL KCKACDKTVY VDLLSADG  YHKSCFKCSHCKGTLVMSNYSS++GVLYCK 
Sbjct  1    MAFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSLDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSL-TKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF +  S + S  +KA +K SSMF GTQ+KC  C KT YPLEKVT+
Sbjct  61   HFEQLFKESGNFSKNFQTGKSEKPSDGSKAPSKLSSMFCGTQDKCATCHKTAYPLEKVTV  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            EGESYHKSCFKCSHGGC+LT + YAALDG+LYCKHHF QLF EKG+Y HV+ A ++
Sbjct  121  EGESYHKSCFKCSHGGCSLTPSNYAALDGILYCKHHFAQLFKEKGSYNHVITAVKK  176



>ref|XP_007139894.1| hypothetical protein PHAVU_008G067500g [Phaseolus vulgaris]
 gb|ESW11888.1| hypothetical protein PHAVU_008G067500g [Phaseolus vulgaris]
Length=208

 Score =   276 bits (705),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY VDLL+ +G  YHK+CF+CSHCKG L MS YSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGTPYHKNCFRCSHCKGCLTMSTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS--SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  SS ++N + K  N+ SSMFSGT +KC  CSKTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTARSSDKQNEVNKTPNRLSSMFSGTLDKCSVCSKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            +EGE YHK+CF+C+H GC LTH++YAALDGVLYC+HHF QLFMEKGNY HVL+ A  RKN
Sbjct  121  LEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQAAANRKN  180


 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYC+ HF
Sbjct  99   FSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
            +QLF E GN+     ++++R+N+
Sbjct  159  QQLFMEKGNYHHVLQAAANRKNA  181



>ref|NP_191682.2| GATA type zinc finger transcription factor family protein [Arabidopsis 
thaliana]
 sp|Q500W4.1|PLI2C_ARATH RecName: Full=LIM domain-containing protein PLIM2c; AltName: 
Full=Pollen-expressed LIM protein 2C [Arabidopsis thaliana]
 gb|AAY34164.1| At3g61230 [Arabidopsis thaliana]
 dbj|BAH30497.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80176.1| GATA type zinc finger transcription factor family protein [Arabidopsis 
thaliana]
Length=213

 Score =   276 bits (705),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 149/174 (86%), Gaps = 2/174 (1%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AFTGT DKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+ NYSSM+GVLYCKTH
Sbjct  3    AFTGTTDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKTH  62

Query  322  FEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            FEQLFKESGNFSKNF ++   E  N  TKA N+ SS FSGTQ+KC AC KTVYPLEK+TM
Sbjct  63   FEQLFKESGNFSKNFQTAGKTEKSNDATKAPNRLSSFFSGTQDKCAACKKTVYPLEKMTM  122

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            EGESYHK+CF+C+H GC LTH++YAALDGVLYCK HF+QLF+EKGNY HVL+A 
Sbjct  123  EGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHFSQLFLEKGNYNHVLQAA  176


 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  100  FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHF  159

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    ++++   S
Sbjct  160  SQLFLEKGNYNHVLQAAANHRRS  182



>gb|KFK35322.1| hypothetical protein AALP_AA5G269200 [Arabis alpina]
Length=213

 Score =   275 bits (704),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DL++ +G  YHKSCF+CSHC  TLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNHTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGN+SKNFH+  + + N +TKA +K SS FSGTQ+KC AC KTVYPLEK+TM
Sbjct  61   HFEQLFKESGNYSKNFHTGKTEKSNEVTKAPSKLSSFFSGTQDKCAACKKTVYPLEKMTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQ  660
            EGESYHK+CF+C+HGGC LTH++YAAL+GVLYCK HF QLF+EKGNY HVL +  
Sbjct  121  EGESYHKNCFRCAHGGCHLTHSSYAALNGVLYCKVHFNQLFLEKGNYSHVLASAN  175


 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y+++ GVLYCK HF
Sbjct  98   FSGTQDKCAACKKTVYPLEKMTMEGESYHKNCFRCAHGGCHLTHSSYAALNGVLYCKVHF  157

Query  325  EQLFKESGNF-----SKNFHSSSSRENSLTKASNKYSSMFSGTQEKCP  453
             QLF E GN+     S N H  ++ E       N+       T +  P
Sbjct  158  NQLFLEKGNYSHVLASANNHRRTTEEEKTEANENEAKPTEEETSDAVP  205



>ref|XP_010107618.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXC16357.1| Pollen-specific protein SF3 [Morus notabilis]
Length=213

 Score =   275 bits (704),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 154/199 (77%), Gaps = 23/199 (12%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKAC+KTVY VD++S +G  YHKSCFKCSHCKGTL MS+YS M+GVLYCK 
Sbjct  1    MAFTGTLDKCKACNKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS----------------------SSSRENS-LTKASNKYSSMF  429
            HFEQLFKESGNFSKNF +                      SS R+N  L +A +K SS+F
Sbjct  61   HFEQLFKESGNFSKNFQTVFLLGLFANNNKRVGEKFVTAKSSERQNDQLARAPSKLSSLF  120

Query  430  SGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFT  609
            SGTQ+KC  CSKTVYPLEKV++EGE YHKSCF+C+HGGC LTH++YAALDGVLYCKHHF 
Sbjct  121  SGTQDKCATCSKTVYPLEKVSLEGECYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFQ  180

Query  610  QLFMEKGNYQHVLKAGQRK  666
            QLFMEKGNY HVLKA   K
Sbjct  181  QLFMEKGNYSHVLKAAANK  199


 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ +S +G  YHKSCF+C+H    L  S+Y++++GVLYCK HF
Sbjct  120  FSGTQDKCATCSKTVYPLEKVSLEGECYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHF  179

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
            +QLF E GN+S    ++++++N+
Sbjct  180  QQLFMEKGNYSHVLKAAANKKNA  202



>gb|ABK58466.1| LIM domain protein PLIM2a [Populus tremula x Populus alba]
Length=206

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVYFVD++S +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYFVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFH-SSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE G+FS+NF      R + L++  +K SS+F GTQ+KC  C KTVYPLEKVTM
Sbjct  61   HFEQLFKEGGDFSRNFQKGKPERTHDLSRIPSKLSSVFCGTQDKCSTCGKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGE YHK+CF+C+HGGC LTH++YAALDGVLYCK HF QLFMEKG Y HVL +   K 
Sbjct  121  EGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLASAAHKR  178


 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
             F GT DKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK H
Sbjct  97   VFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVH  156

Query  322  FEQLFKESGNFSKNFHSSS-SRENSLT  399
            F QLF E G +S    S++  R NS T
Sbjct  157  FAQLFMEKGTYSHVLASAAHKRSNSTT  183



>gb|AGJ83944.1| lim protein 4 [Gossypium hirsutum]
Length=209

 Score =   275 bits (703),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTV+ VD+++ +G  YHK+CFKCSHCKG LVM+ YSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVHVVDMMTLEGVPYHKTCFKCSHCKGNLVMNTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF ++ + ++N  ++  NK SS+FSGTQ+KC AC KTVYPLEK+TM
Sbjct  61   HFEQLFKESGNFSKNFQTAKTEKQNDTSRTPNKLSSLFSGTQDKCAACEKTVYPLEKITM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            EGE +HK+CF+C+HGGC LTH++YAAL+G+LYCKHH+ QLFM KGNY HVL+ A  R+N
Sbjct  121  EGECFHKTCFRCAHGGCPLTHSSYAALNGILYCKHHYAQLFMVKGNYNHVLQSATHRRN  179


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTV+ ++ +T+EG  YHK+CFKCSH    L   TY+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVHVVDMMTLEGVPYHKTCFKCSHCKGNLVMNTYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E GN+    +  + + Q
Sbjct  63   EQLFKESGNFSKNFQTAKTEKQ  84


 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC+KTVY ++ ++ +G  +HK+CF+C+H    L  S+Y+++ G+LYCK H+
Sbjct  98   FSGTQDKCAACEKTVYPLEKITMEGECFHKTCFRCAHGGCPLTHSSYAALNGILYCKHHY  157

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYS  420
             QLF   GN++    S++ R N+ T +S  ++
Sbjct  158  AQLFMVKGNYNHVLQSATHRRNTSTASSTDFA  189



>emb|CAB71053.1| LIM domain protein [Arabidopsis thaliana]
Length=211

 Score =   275 bits (703),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AFTGT DKCKACDKTVY +DL++ +G  YHKSCF+CSHC GTLV+ NYSSM+GVLYCKTH
Sbjct  3    AFTGTTDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKTH  62

Query  322  FEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTMEG  501
            FEQLFKESGNFSKNF ++   E S   A N+ SS FSGTQ+KC AC KTVYPLEK+TMEG
Sbjct  63   FEQLFKESGNFSKNFQTAGKTEKSNDAAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEG  122

Query  502  ESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            ESYHK+CF+C+H GC LTH++YAALDGVLYCK HF+QLF+EKGNY HVL+A 
Sbjct  123  ESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHFSQLFLEKGNYNHVLQAA  174


 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  98   FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    ++++   S
Sbjct  158  SQLFLEKGNYNHVLQAAANHRRS  180



>ref|XP_003521910.2| PREDICTED: pollen-specific protein SF3-like [Glycine max]
Length=206

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC ACDKTVY VDLL+ +G TYHK+CFKCSHCKG L MS YSSM+G+LYCKT
Sbjct  1    MSFTGTLDKCTACDKTVYVVDLLTLEGITYHKNCFKCSHCKGCLTMSTYSSMDGILYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF  SS ++N L +  +K SSMFSGT +KC  C+KTVYPLEK+T+E
Sbjct  61   HFEQLFKESGNFSKNFAKSSEKQNDLNRTPSKLSSMFSGTLDKCSVCTKTVYPLEKMTLE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            GE +HK+CF+C+H GC LTH+ YAALDGVLYC+ HF QLFMEKGNY HVL+A   + 
Sbjct  121  GECFHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGNYSHVLQAAAHRR  177



>ref|XP_010055180.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW71657.1| hypothetical protein EUGRSUZ_E00179 [Eucalyptus grandis]
Length=218

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 3/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VD+LS +G  YHK+CF+CSHC G LVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGMPYHKNCFRCSHCNGHLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHS--SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQL+KESGNFSKNF +  SS R++ L +  ++ SS+FSGT +KC  C KTVYPLEKVT
Sbjct  61   HFEQLYKESGNFSKNFQTAKSSERQHDLNRTPSRLSSLFSGTLDKCTTCGKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            +EGE +HK+CF+C+HGGCALTH++YAALDGV YCKHHF +LFMEKGNY HVL+ A  R+N
Sbjct  121  LEGECFHKNCFRCAHGGCALTHSSYAALDGVFYCKHHFARLFMEKGNYSHVLEGAVHRRN  180



>ref|NP_001237551.1| uncharacterized protein LOC100305845 [Glycine max]
 gb|ACU13723.1| unknown [Glycine max]
 gb|KHN04651.1| Pollen-specific protein SF3 [Glycine soja]
Length=210

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC ACDKTVY VDLL+ +G  YHK+CFKCSHCKG L M  YSSM+G+LYCKT
Sbjct  1    MSFTGTLDKCTACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGCLTMCTYSSMDGILYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF  SS ++N L +  +K SSMFSGTQ+KC  C+KTVYPLEK+T+E
Sbjct  61   HFEQLFKESGNFSKNFAKSSEKQNELNRTPSKLSSMFSGTQDKCSVCTKTVYPLEKMTLE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            GE +HK+CF+C+H GC LTH+ YAALDGVLYC+ HF QLFMEKGNY HVL+A   + 
Sbjct  121  GECFHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGNYNHVLQAAAHRR  177



>gb|AAF78411.1|AC009273_17 Contains similarity to mRNA for transcription factor L2 from 
Arabidopsis thaliana gb|X91398. It contains LIM domain containing 
proteins PF|00412. ESTs gb|T13084 and gb|T42925 come from 
this gene [Arabidopsis thaliana]
Length=261

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC  CDKTVY VD+LS +G  YHKSCF+C+HCKGTL MSNYSSM+GVLYCKT
Sbjct  57   MSFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKT  116

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF    + +  LT+  +K SS+F GTQ+KC AC KTVYPLEK+ ME
Sbjct  117  HFEQLFKESGNFSKNFQPGKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEKIQME  176

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CF+C+HGGC LTH++YA+LD VLYC+HHF QLFMEKGNY HVL+A   +
Sbjct  177  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQAANHR  232


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC+KTVY ++ +  +G  +HK+CF+C+H   TL  S+Y+S++ VLYC+ HF
Sbjct  153  FCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHF  212

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  +
Sbjct  213  NQLFMEKGNYAHVLQAANHRRTA  235



>ref|XP_002302574.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|EEE81847.1| LIM domain-containing family protein [Populus trichocarpa]
Length=206

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VD++S +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFH-SSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE G+FSKNF      R + L +  +K SS+F GTQ+KC  C KTVYPLEKVTM
Sbjct  61   HFEQLFKEGGDFSKNFQKGKPERTHELIRTPSKLSSVFCGTQDKCSTCGKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGE YHK+CF+C+HGGC LTH++YAALDGVLYCK HF QLFMEKG Y HVL     K 
Sbjct  121  EGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLAGATHKR  178


 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
             F GT DKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK H
Sbjct  97   VFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVH  156

Query  322  FEQLFKESGNFSKNFHSSSSRENSLTKASN  411
            F QLF E G +S     ++ + ++ T    
Sbjct  157  FAQLFMEKGTYSHVLAGATHKRSTSTPPPE  186



>ref|XP_006827708.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
 gb|ERM95124.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
Length=195

 Score =   272 bits (695),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 3/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GTL KCK CDKTVY VDLLSADG  YHKSCFKCSHCKGTL +SNYSS+EGVLYCK 
Sbjct  1    MAFSGTLQKCKMCDKTVYVVDLLSADGVNYHKSCFKCSHCKGTLSISNYSSLEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFH---SSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            HFEQLFKE+G+F+K+F     S+ +++ L +A +K SS+FSGTQ+KC  C KT YPLEKV
Sbjct  61   HFEQLFKETGSFNKSFQLPPKSADKQHDLARAPSKLSSLFSGTQDKCATCYKTAYPLEKV  120

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            T+EGESYHKSCFKCSHGGC LT +TYAALDG+LYCKHHF QLF EKGNY H++K    K 
Sbjct  121  TVEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKHHFAQLFKEKGNYNHLIKTASMKR  180


 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KT Y ++ ++ +G +YHKSCFKCSH    L  S Y++++G+LYCK HF
Sbjct  100  FSGTQDKCATCYKTAYPLEKVTVEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKHHF  159

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE GN++    ++S + N+
Sbjct  160  AQLFKEKGNYNHLIKTASMKRNA  182



>ref|XP_010544716.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Tarenaya hassleriana]
Length=234

 Score =   273 bits (698),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%), Gaps = 4/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +D+L+ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS----SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESGNFSKNF +S       +   T+A N+ SS FSGTQ+KC AC KTVYPLEK
Sbjct  61   HFEQLFKESGNFSKNFQASGKTDKPNDAPPTRAPNRLSSFFSGTQDKCAACQKTVYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +T+EGESYHK+CF+C+H GC+LTH++YAAL+GVLYCK HF+QLF+EKG+Y HVL++   +
Sbjct  121  MTLEGESYHKTCFRCAHSGCSLTHSSYAALNGVLYCKAHFSQLFLEKGSYNHVLQSANHR  180


 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG  YHKSCF+CSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E GN+    +A  + ++
Sbjct  63   EQLFKESGNFSKNFQASGKTDK  84


 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H   +L  S+Y+++ GVLYCK HF
Sbjct  101  FSGTQDKCAACQKTVYPLEKMTLEGESYHKTCFRCAHSGCSLTHSSYAALNGVLYCKAHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E G+++    S++ R  +
Sbjct  161  SQLFLEKGSYNHVLQSANHRRTA  183



>emb|CDY15152.1| BnaC05g00310D [Brassica napus]
Length=205

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC  CDKTVY +D+LS +G  YHKSCFKC+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTTDKCDVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HF+QLFKESGNFSKNF    + +   TK  +K SS+F GTQ+KC AC KTVYPLEKV ME
Sbjct  61   HFDQLFKESGNFSKNFQPGKTEKPEHTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CF+C+HGGC LTH++YA+LDGVLYC+HHF QLF+EKGNY HVL+A   +
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQAANHR  176


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC+KTVY ++ +  +G  +HK+CF+C+H   TL  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  +
Sbjct  157  NQLFLEKGNYAHVLQAANHRRTA  179



>ref|XP_009119735.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 ref|XP_009119736.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDX90059.1| BnaA10g00230D [Brassica napus]
Length=205

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC  CDKTVY +D+LS +G  YHKSCFKC+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HF+QLFKESGNFSKNF    + +   TK  +K SS+F GTQ+KC AC KTVYPLEKV ME
Sbjct  61   HFDQLFKESGNFSKNFQPGKTEKPEHTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CF+C+HGGC LTH++YA+LDGVLYC+HHF QLF+EKGNY HVL+A   +
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQAANHR  176


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC+KTVY ++ +  +G  +HK+CF+C+H   TL  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    +++ R  +
Sbjct  157  NQLFLEKGNYAHVLQAANHRRTA  179



>ref|XP_003551659.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHM99398.1| Pollen-specific protein SF3 [Glycine soja]
Length=216

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCKACDKTVY VD+L+ +G  YHK+CF+CSHCKG L M+ YSSM+GVLYCK 
Sbjct  1    MSFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCFRCSHCKGYLTMNTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS--SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  SS ++N   KA N+ SSMFSGT +KC  CSKTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTAKSSDKQNETNKAPNRLSSMFSGTLDKCSVCSKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +EGE YHK+CF+C+H GC LTH++YAALDGVLYC+HHF QLFMEKGNY HVL++   K
Sbjct  121  LEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQSANHK  178


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYC+ HF
Sbjct  99   FSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHF  158

Query  325  EQLFKESGNFSKNFHSSSSREN  390
            +QLF E GN+     S++ ++N
Sbjct  159  QQLFMEKGNYHHVLQSANHKKN  180



>emb|CDY38028.1| BnaCnng08890D [Brassica napus]
Length=205

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC  CDKTVY +D+LS +G  YHKSCFKC+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF    + +   +K  +K SS+F GTQ+KC AC KTVYPLEKV ME
Sbjct  61   HFEQLFKESGNFSKNFQPGKTEKPEQSKTPSKISSIFCGTQDKCAACDKTVYPLEKVQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CFKC+HGGC LTH++YA+LDGVLYC+HHF QLF+EKGNY HVL++   +
Sbjct  121  GECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQSANHR  176


 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC ACDKTVY ++ +  +G  +HK+CFKC+H    L  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACDKTVYPLEKVQMEGECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    S++ R  +
Sbjct  157  NQLFLEKGNYAHVLQSANHRRTA  179



>gb|KFK37370.1| hypothetical protein AALP_AA4G247900 [Arabis alpina]
Length=232

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DLL+ +G TYHKSCFKCSHCKGTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLNLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  + +  + LT+A +K SS FSGTQ+KC  C KTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQNGKTEKTNDQLTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGESYHK+CF+C+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  MEGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  175


 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ + +EG +YHKSCFKCSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLNLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GN+    + G+
Sbjct  63   EQLFKESGNFSKNFQNGK  80



>ref|XP_010544715.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Tarenaya hassleriana]
Length=235

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 152/181 (84%), Gaps = 5/181 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +D+L+ +G  YHKSCF+CSHC GTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE-----NSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESGNFSKNF +S   +        T+A N+ SS FSGTQ+KC AC KTVYPLE
Sbjct  61   HFEQLFKESGNFSKNFQASGKTDKPNDAQPPTRAPNRLSSFFSGTQDKCAACQKTVYPLE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            K+T+EGESYHK+CF+C+H GC+LTH++YAAL+GVLYCK HF+QLF+EKG+Y HVL++   
Sbjct  121  KMTLEGESYHKTCFRCAHSGCSLTHSSYAALNGVLYCKAHFSQLFLEKGSYNHVLQSANH  180

Query  664  K  666
            +
Sbjct  181  R  181


 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG  YHKSCF+CSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E GN+    +A  + ++
Sbjct  63   EQLFKESGNFSKNFQASGKTDK  84


 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G +YHK+CF+C+H   +L  S+Y+++ GVLYCK HF
Sbjct  102  FSGTQDKCAACQKTVYPLEKMTLEGESYHKTCFRCAHSGCSLTHSSYAALNGVLYCKAHF  161

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E G+++    S++ R  +
Sbjct  162  SQLFLEKGSYNHVLQSANHRRTA  184



>ref|XP_007135027.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
 gb|ESW07021.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
Length=225

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY VDLL+ +G  YHK+CFKCSHCKG L M  YSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMCTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF  S+ ++N + +  +K SSMFSGT +KC  CSKTVYPLEKV++E
Sbjct  61   HFEQLFKESGNFSKNFAKSTEKQNDINRTPSKLSSMFSGTLDKCAVCSKTVYPLEKVSLE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            GE YHK+CF+C+H GC LTH+ YAALDGV+YC+ HF QLFMEKGNY HVL+A   K 
Sbjct  121  GECYHKTCFRCAHAGCPLTHSNYAALDGVVYCRVHFAQLFMEKGNYSHVLQAAAHKR  177



>ref|XP_009118834.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=205

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC  CDKTVY +D+LS +G  YHKSCFKC+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF    + +    K  +K SS+F GTQ+KC AC KTVYPLEKV ME
Sbjct  61   HFEQLFKESGNFSKNFQPGKTEKPEQNKTPSKISSIFCGTQDKCAACDKTVYPLEKVQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CFKC+HGGC LTH++YA+LDGVLYC+HHF QLF+EKGNY HVL++   +
Sbjct  121  GECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQSANHR  176


 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC ACDKTVY ++ +  +G  +HK+CFKC+H    L  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACDKTVYPLEKVQMEGECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    S++ R  +
Sbjct  157  NQLFLEKGNYAHVLQSANHRRTA  179



>ref|XP_004510816.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=210

 Score =   271 bits (692),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY VDLL+ +   YHK+CFKCSHCKG L MS YSSM+G+LYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLENIPYHKNCFKCSHCKGCLTMSTYSSMDGILYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF  SS ++N L +  ++ SSMFSGT +KC  C+KTVYPLEKVT+E
Sbjct  61   HFEQLFKESGNFSKNFAKSSDKQNELNRTPSRLSSMFSGTLDKCAVCTKTVYPLEKVTLE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKNQ  672
            GE YHK+CF+C+H GC LTH+ YAALDGVLYC+ HF QLFMEKG Y HVL +   K  
Sbjct  121  GECYHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGTYSHVLNSTAHKRN  178


 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  SNY++++GVLYC+ HF
Sbjct  97   FSGTLDKCAVCTKTVYPLEKVTLEGECYHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKAS  408
             QLF E G +S   +S++ + N  +  S
Sbjct  157  AQLFMEKGTYSHVLNSTAHKRNGSSPPS  184



>emb|CDY01571.1| BnaC07g35610D [Brassica napus]
Length=205

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC  CDKTVY +D+LS +G  YHKSCFKC+HCKGTLVMSNYSSM+GVLYCKT
Sbjct  1    MSFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HF+QLFKESGNFSKNF    + +   +K  +K SS+F GTQ+KC AC KTVYPLEKV ME
Sbjct  61   HFDQLFKESGNFSKNFQPGKTEKPEQSKTPSKISSIFCGTQDKCAACDKTVYPLEKVQME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HK+CFKC+HGGC LTH++YA+LDGVLYC+HHF QLF+EKGNY HVL++   +
Sbjct  121  GECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQSANHR  176


 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC ACDKTVY ++ +  +G  +HK+CFKC+H    L  S+Y+S++GVLYC+ HF
Sbjct  97   FCGTQDKCAACDKTVYPLEKVQMEGECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E GN++    S++ R  +
Sbjct  157  NQLFLEKGNYAHVLQSANHRRTA  179



>ref|XP_003623892.1| LIM domain protein 2b [Medicago truncatula]
 gb|AES80110.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=212

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY VDLL+ +G  YHKSC KC+HCKG L MS YSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKSCLKCTHCKGNLTMSTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENS--LTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF + SS + +  + +  ++ SSMFSGT +KC  C+KTVYPLEK++
Sbjct  61   HFEQLFKESGNFSKNFQAKSSEKINELMNRTPSRLSSMFSGTLDKCAVCTKTVYPLEKMS  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +EGE YHK+CF+C+HGGC LTH++YAALDGVLYCKHHF QLFMEKGNY HVL+A   K
Sbjct  121  LEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFQQLFMEKGNYNHVLQAAANK  178


 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC  C KTVY ++ +S +G  YHK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  99   FSGTLDKCAVCTKTVYPLEKMSLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
            +QLF E GN++    ++++++NS
Sbjct  159  QQLFMEKGNYNHVLQAAANKKNS  181



>gb|KHG00940.1| Pollen-specific SF3 [Gossypium arboreum]
Length=208

 Score =   270 bits (689),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTV+ VD+++ +G  YHK+CFKCSHCKG L M+ YS M+G+LYCK 
Sbjct  1    MAFTGTLDKCKACDKTVHVVDMMTLEGVPYHKTCFKCSHCKGNLQMTTYSWMDGILYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF + + R   L +  +K SS+FSGT +KC AC KTVYPLEKVTME
Sbjct  61   HFEQLFKESGNFSKNFQTGT-RPTELNRTPSKLSSLFSGTLDKCAACEKTVYPLEKVTME  119

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG-QRKNQ  672
            GE +HK+CF+C+HGGC LTH++YAALDGVLYCKHHF QLFM KGNY HVL+A   R+N 
Sbjct  120  GECFHKTCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMVKGNYNHVLQAATHRRNN  178


 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC AC+KTVY ++ ++ +G  +HK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  96   FSGTLDKCAACEKTVYPLEKVTMEGECFHKTCFRCAHGGCPLTHSSYAALDGVLYCKHHF  155

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNK  414
             QLF   GN++    +++ R N+ T +S++
Sbjct  156  AQLFMVKGNYNHVLQAATHRRNNSTASSSE  185



>ref|XP_003533616.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
Length=219

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCKACDKTVY VD+L+ +G  YHK+CF+CSHCKG L MS YSSM+GVLYCK 
Sbjct  1    MSFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCFRCSHCKGCLTMSTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS--SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  SS ++N   K  N+ SSMFSGT +KC  CSKTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTAKSSDKQNETHKTPNRLSSMFSGTLDKCSVCSKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +EGE YHK+CF+C+H GC LTH++YAALDGVLYC+HHF QLFMEKGNY HVL++   K
Sbjct  121  LEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQSANHK  178


 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYC+ HF
Sbjct  99   FSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
            +QLF E GN+     S++ ++N+
Sbjct  159  QQLFMEKGNYHHVLQSANHKKNA  181



>gb|KHN29376.1| Pollen-specific protein SF3 [Glycine soja]
Length=219

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCKACDKTVY VD+L+ +G  YHK+CF+CSHCKG L MS YSSM+GVLYCK 
Sbjct  1    MSFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCFRCSHCKGCLTMSTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS--SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  SS ++N   K  N+ SSMFSGT +KC  CSKTVYPLEK+T
Sbjct  61   HFEQLFKESGNFSKNFQTAKSSDKQNETHKTPNRLSSMFSGTLDKCSVCSKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +EGE YHK+CF+C+H GC LTH++YAALDGVLYC+HHF QLFMEKGNY HVL++   K
Sbjct  121  LEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQSANHK  178


 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYC+ HF
Sbjct  99   FSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
            +QLF E GN+     S++ ++N+
Sbjct  159  QQLFMEKGNYHHVLQSANHKKNA  181



>ref|XP_002882034.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58293.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY +DLL+ +G TYHKSCF+CSHCKGTLV+SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCKGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGN+SKNF +  + +  + LT+  +K SS FSGTQ+KC  C KTVYPLEKVT
Sbjct  61   HFEQLFKESGNYSKNFQTGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGESYHK+CF+CSH GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  MEGESYHKTCFRCSHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  175


 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCF+CSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCKGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GNY    + G+
Sbjct  63   EQLFKESGNYSKNFQTGK  80



>ref|XP_006397773.1| hypothetical protein EUTSA_v10001618mg [Eutrema salsugineum]
 gb|ESQ39226.1| hypothetical protein EUTSA_v10001618mg [Eutrema salsugineum]
Length=228

 Score =   268 bits (686),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DLL+ +G TYHKSCF+CSHC GTLV+SNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  + +  + LT+A +K SS FSGTQ+KC  C KTVYPLEKVT
Sbjct  61   HFEQLFKESGNFSKNFQTGKTEKPNDHLTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGESYHK+CF+C+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  MEGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  175


 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCF+CSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GN+    + G+
Sbjct  63   EQLFKESGNFSKNFQTGK  80



>gb|ACN26203.1| unknown [Zea mays]
 gb|ADX60140.1| LIM transcription factor [Zea mays]
 gb|AFW72521.1| putative LIM-type zinc finger domain family protein [Zea mays]
Length=204

 Score =   268 bits (684),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 151/177 (85%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCKACDKTV+ +DLL+ADG +YHK+CFKCSHCKG L +S+YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCKACDKTVHIIDLLTADGVSYHKTCFKCSHCKGVLSISSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHS-SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G FSKNF   +SS +N   KA +K SS FSGTQ+KC AC KTVYPLEK+T+
Sbjct  61   HFEQLFKETGTFSKNFQGGASSNKNDQAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGESYHKSCFKCSHGGC LT ++YAAL+GVLYCK HF+QLF EKG+Y H+++  Q K
Sbjct  121  EGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFSQLFKEKGSYNHLIETAQTK  177


 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ ++ +G +YHKSCFKCSH    L  S+Y+++ GVLYCK H
Sbjct  97   AFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIH  156

Query  322  FEQLFKESGNFSKNFHSSSSRENSLTKA  405
            F QLFKE G+++    ++ +++N   +A
Sbjct  157  FSQLFKEKGSYNHLIETAQTKKNEAAEA  184


 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GTQ+KC AC KTV+ ++ +T +G SYHK+CFKCSH    L+ ++Y+++DGVLYCK HF
Sbjct  3    FTGTQDKCKACDKTVHIIDLLTADGVSYHKTCFKCSHCKGVLSISSYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E G +    + G   N+
Sbjct  63   EQLFKETGTFSKNFQGGASSNK  84



>ref|XP_010518219.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Camelina 
sativa]
Length=229

 Score =   268 bits (685),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY +DLL+ +G TYHKSCFKCSHCKGTLV+SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGN+SKNF +  + + N LT+  +K SS FSGTQ+KC  C KTVYPLEKVTM
Sbjct  61   HFEQLFKESGNYSKNFQNGKTDKPNDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            EGE YHK+CF+C+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  EGECYHKNCFRCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  174


 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCFKCSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GNY    + G+
Sbjct  63   EQLFKESGNYSKNFQNGK  80



>ref|XP_006647592.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=206

 Score =   267 bits (683),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCKACDKTV+F+DLL+ADG +YHK+CFKCSHCKGTL M NYSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+FSK F     SS +N   KA +K SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKETGSFSKKFSQGGKSSDKNDQGKAPSKLSSAFSGTQDKCAACQKTVYPLEKLT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKNQ  672
            +EGESYHKSCFKCSHGGC LT ++YAAL+G+LYCK HF+QLF EKG+Y H+++  Q K +
Sbjct  121  LEGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTAQSKQK  180



>ref|XP_009340168.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3 [Pyrus 
x bretschneideri]
Length=243

 Score =   268 bits (686),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 154/201 (77%), Gaps = 24/201 (12%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY  ++LS +G  YHKSCFKCSHCKG L MS YSSM+G+LYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVTEMLSLEGVPYHKSCFKCSHCKGFLSMSTYSSMDGILYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE-NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEK---  486
            HFEQLFKESGNFSKNF  S+ ++   L +  +K S++FSGTQ+KC  CSKTVYPLEK   
Sbjct  61   HFEQLFKESGNFSKNFAKSAEKQGEQLNRVPSKLSALFSGTQDKCATCSKTVYPLEKVSN  120

Query  487  -------------------VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFT  609
                               VT+EGESYHKSCF+C+HGGCALTH++YAALDGVLYCKHHF+
Sbjct  121  IIKGINLISMSPCFSXQTIVTLEGESYHKSCFRCAHGGCALTHSSYAALDGVLYCKHHFS  180

Query  610  QLFMEKGNYQHVLK-AGQRKN  669
            QLF+EKGNY HVL+ A  RKN
Sbjct  181  QLFLEKGNYSHVLQAAANRKN  201



>ref|XP_010506557.1| PREDICTED: LIM domain-containing protein PLIM2a [Camelina sativa]
Length=228

 Score =   268 bits (685),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY +DLL+ +G TYHKSCFKCSHCKGTLV+SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGN+SKNF +  + + N LT+  +K SS FSGTQ+KC  C KTVYPLEKVTM
Sbjct  61   HFEQLFKESGNYSKNFQTGKTDKPNDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            EGE YHK+CF+C+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  EGECYHKNCFRCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  174


 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCFKCSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GNY    + G+
Sbjct  63   EQLFKESGNYSKNFQTGK  80



>ref|XP_010508108.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Camelina 
sativa]
Length=230

 Score =   268 bits (685),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY +DLL+ +G TYHKSCFKCSHCKGTLV+SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGN+SKNF +  + + N LT+  +K SS FSGTQ+KC  C KTVYPLEKVTM
Sbjct  61   HFEQLFKESGNYSKNFQTGKTDKPNDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            EGE YHK+CF+C+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  EGECYHKNCFRCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  174


 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCFKCSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GNY    + G+
Sbjct  63   EQLFKESGNYSKNFQTGK  80



>ref|XP_007135026.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
 gb|ESW07020.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
Length=226

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY VDLL+ +G  YHK+CFKCSHCKG L M  YSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMCTYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSL-TKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKESGNFSKNF  S+ ++N +  +  +K SSMFSGT +KC  CSKTVYPLEKV++
Sbjct  61   HFEQLFKESGNFSKNFAKSTEKQNDIQNRTPSKLSSMFSGTLDKCAVCSKTVYPLEKVSL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGE YHK+CF+C+H GC LTH+ YAALDGV+YC+ HF QLFMEKGNY HVL+A   K 
Sbjct  121  EGECYHKTCFRCAHAGCPLTHSNYAALDGVVYCRVHFAQLFMEKGNYSHVLQAAAHKR  178



>ref|XP_010089139.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB37386.1| Pollen-specific protein SF3 [Morus notabilis]
Length=421

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  RMAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCK  315
            +M+F+GT  KCKACDKTV+F+D LSADG  YHK+CFKCSHC G LV+S+YSSM+GVLYCK
Sbjct  217  KMSFSGTQQKCKACDKTVHFIDALSADGVVYHKTCFKCSHCNGLLVISSYSSMDGVLYCK  276

Query  316  THFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
             HFEQLFKE+G+F+K F S   + + LT+A +K SS+FSGTQ+KC  C+KTVYPLEKVT+
Sbjct  277  PHFEQLFKETGSFTKKFQSGKPQNDQLTRAPSKLSSLFSGTQDKCAVCTKTVYPLEKVTV  336

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            EGE YHKSCF+CSHGGC LT ++YAAL+G+LYCKHHF QLFMEKG+Y H++K A  +KN
Sbjct  337  EGEFYHKSCFRCSHGGCFLTPSSYAALEGILYCKHHFAQLFMEKGSYNHLIKTASIKKN  395


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ ++ +G  YHKSCF+CSH    L  S+Y+++EG+LYCK HF
Sbjct  314  FSGTQDKCAVCTKTVYPLEKVTVEGEFYHKSCFRCSHGGCFLTPSSYAALEGILYCKHHF  373

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQ  441
             QLF E G+++    ++S ++N       K  +   GTQ
Sbjct  374  AQLFMEKGSYNHLIKTASIKKNGQPPIGQKPETTQRGTQ  412



>gb|EMT25782.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=213

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCK CDKTV+F+DLL+ADG +YHK+CFKCSHCKGTL M NYSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNF-HSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+GNFSKNF     S E    KA +K SS FSGTQ+KC AC KTVYPLEK+T+
Sbjct  61   HFEQLFKETGNFSKNFTPGGKSAEKGEAKAPSKMSSAFSGTQDKCAACQKTVYPLEKLTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKNQ  672
            EGE YHKSCFKCSHGGC LT ++YAAL+G+LYCK HF+QLF EKG+Y H++K  Q K +
Sbjct  121  EGECYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIKTAQTKKE  179


 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ L+ +G  YHKSCFKCSH    L  S+Y+++ G+LYCK H
Sbjct  97   AFSGTQDKCAACQKTVYPLEKLTLEGECYHKSCFKCSHGGCILTTSSYAALNGILYCKIH  156

Query  322  FEQLFKESGNFSKNFHSSSSRENSL  396
            F QLFKE G+++    ++ +++ S+
Sbjct  157  FSQLFKEKGSYNHLIKTAQTKKESV  181



>ref|NP_001047550.1| Os02g0641000 [Oryza sativa Japonica Group]
 dbj|BAD25223.1| putative LIM domain protein PLIM-2 [Oryza sativa Japonica Group]
 dbj|BAD25371.1| putative LIM domain protein PLIM-2 [Oryza sativa Japonica Group]
 dbj|BAF09464.1| Os02g0641000 [Oryza sativa Japonica Group]
 gb|EAY86851.1| hypothetical protein OsI_08235 [Oryza sativa Indica Group]
 gb|EAZ23959.1| hypothetical protein OsJ_07685 [Oryza sativa Japonica Group]
 gb|AEJ08684.1| PLIM [Oryza sativa]
Length=206

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCKACDKTV+F+DLL+ADG +YHK+CFKCSHCKGTL M NYSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+FSK F     SS ++   +A +K SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKETGSFSKKFSQGGKSSEKSDQGRAPSKLSSAFSGTQDKCAACQKTVYPLEKLT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKNQ  672
            +EGESYHKSCFKCSHGGC LT ++YAAL+G+LYCK HF+QLF EKG+Y H+++  Q K +
Sbjct  121  LEGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTAQSKQK  180


 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 70/105 (67%), Gaps = 0/105 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ L+ +G +YHKSCFKCSH    L  S+Y+++ G+LYCK H
Sbjct  98   AFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIH  157

Query  322  FEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPA  456
            F QLFKE G+++    ++ S++    +A+   ++  S  +++ P 
Sbjct  158  FSQLFKEKGSYNHLIQTAQSKQKESEEAAPVAATEASEKEQEVPP  202



>gb|AFK33321.1| unknown [Lotus japonicus]
Length=208

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKC ACDKTVY VDLL+ +G  YHKSCFKCSHCKG L MS YSSM+GVLYC+T
Sbjct  1    MSFTGTLDKCAACDKTVYVVDLLTLEGIPYHKSCFKCSHCKGNLTMSTYSSMDGVLYCRT  60

Query  319  HFEQLFKESGNFSKNFHS--SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  SS ++  L +  ++ SSMFSGT +KC  C+KTVY LEKVT
Sbjct  61   HFEQLFKESGNFSKNFQNAKSSEKQGELNRTPSRLSSMFSGTLDKCAVCTKTVYSLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +EGE YHK+CF+C+H GC LTH+ YAALDG LYC+ HF QLFMEKG+Y HVLKA  R+
Sbjct  121  LEGECYHKTCFRCAHAGCPLTHSNYAALDGNLYCRVHFAQLFMEKGSYSHVLKAAHRR  178


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  SNY++++G LYC+ HF
Sbjct  99   FSGTLDKCAVCTKTVYSLEKVTLEGECYHKTCFRCAHAGCPLTHSNYAALDGNLYCRVHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKA  405
             QLF E G++S    ++  R  S T  
Sbjct  159  AQLFMEKGSYSHVLKAAHRRTGSSTPP  185



>ref|XP_004492709.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=230

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY VDLL+ +G  YHK+CFKCSHCKG L MS   SM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMSTCCSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS--SSSRENSLT-KASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            HFEQLFKESGNFSKNF +  SS R+N L  K  ++ SSMFSGT +KC  CSKTVYPLEK+
Sbjct  61   HFEQLFKESGNFSKNFQTAKSSDRQNELVNKTPSRLSSMFSGTLDKCSVCSKTVYPLEKM  120

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRK  666
            ++EGE YHK+CF+C+H GC LTH++YAALDGVLYCKHHF QLFMEKGNY HVL+ A  RK
Sbjct  121  SLEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCKHHFQQLFMEKGNYNHVLQAAANRK  180

Query  667  N  669
            N
Sbjct  181  N  181


 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTLDKC  C KTVY ++ +S +G  YHK+CF+C+H    L  S+Y++++GVLYCK HF
Sbjct  100  FSGTLDKCSVCSKTVYPLEKMSLEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCKHHF  159

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
            +QLF E GN++    ++++R+N+
Sbjct  160  QQLFMEKGNYNHVLQAAANRKNA  182



>ref|XP_003569963.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Brachypodium 
distachyon]
Length=210

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCK CDKTV+F+DLLSADG +YHK+CFKCSHCKGTL M NYSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLSADGISYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+FSK F     SS +N   KA NK SS+FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKETGSFSKKFTPGGKSSDKNDQAKAPNKLSSVFSGTQDKCAACQKTVYPLEKLT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQ  660
            +EGE YHKSCFKCSHGGC LT ++YAAL+G+LYCK HF+QLF EKG+Y H++K  Q
Sbjct  121  LEGECYHKSCFKCSHGGCTLTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIKTAQ  176



>ref|XP_004150238.1| PREDICTED: pollen-specific protein SF3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004150239.1| PREDICTED: pollen-specific protein SF3-like isoform 2 [Cucumis 
sativus]
 gb|KGN50627.1| hypothetical protein Csa_5G198170 [Cucumis sativus]
Length=195

 Score =   265 bits (677),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 148/182 (81%), Gaps = 4/182 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKACDKTVY VD LSADG ++HKSCFKCSHCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNF----HSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNFSKNF     SS      LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFSKNFLSPAKSSEKPTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC+L+ + YAALDG+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCSLSPSNYAALDGILYCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  NQ  672
             Q
Sbjct  181  RQ  182


 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +   YHKSCFKCSH   +L  SNY++++G+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALDGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLFKE G+++    S+S +  + T
Sbjct  161  SQLFKEKGSYNHLIKSASMKRQAAT  185



>ref|NP_182104.1| protein PLIM2A [Arabidopsis thaliana]
 sp|O80839.1|PLI2A_ARATH RecName: Full=LIM domain-containing protein PLIM2a; AltName: 
Full=Pollen-expressed LIM protein 2; Short=AtPLIM2 [Arabidopsis 
thaliana]
 gb|AAC28544.1| putative LIM-domain protein [Arabidopsis thaliana]
 dbj|BAC42675.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AAO64006.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AEC10602.1| protein PLIM2A [Arabidopsis thaliana]
Length=226

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY +DLL+ +G TYHKSCF+C+HCKGTLV+SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGN+SKNF +  + +  + LT+  +K SS FSGTQ+KC  C KTVYPLEKVT
Sbjct  61   HFEQLFKESGNYSKNFQAGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGESYHK+CF+C+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  MEGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  175


 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCF+C+H    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GNY    +AG+
Sbjct  63   EQLFKESGNYSKNFQAGK  80



>ref|XP_008677533.1| PREDICTED: uncharacterized LOC100381874 isoform X1 [Zea mays]
 gb|AFW63175.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB04943.1| LIM transcription factor, partial [Zea mays]
Length=207

 Score =   265 bits (678),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 151/179 (84%), Gaps = 3/179 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCKACDKTV+F+DLL+ADG +YHK+CFKCSHCKG L +S+YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSHCKGVLSISSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHS---SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            HFEQLFKE+GNFSK F     +SS +N   KA +K SS FSGTQ+KC AC KTVYPLEK+
Sbjct  61   HFEQLFKETGNFSKKFQGGGGASSNKNDPAKAPSKLSSAFSGTQDKCAACQKTVYPLEKM  120

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            T+EGESYHK CFKCSHGGC LT ++YAAL+G+LYCK HF+QLF EKG+Y H+++  Q K
Sbjct  121  TLEGESYHKGCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIETAQTK  179


 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ ++ +G +YHK CFKCSH    L  S+Y+++ G+LYCK H
Sbjct  99   AFSGTQDKCAACQKTVYPLEKMTLEGESYHKGCFKCSHGGCILTTSSYAALNGILYCKIH  158

Query  322  FEQLFKESGNFSKNFHSSSSREN  390
            F QLFKE G+++    ++ +++N
Sbjct  159  FSQLFKEKGSYNHLIETAQTKKN  181



>ref|XP_009397610.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=201

 Score =   265 bits (676),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (84%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT DKCKACDKTV+F+DLL+ADG  YHK+CFKCSHCKGTL M NYSSM+G+LYCK 
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGTLSMCNYSSMDGILYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS-SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G+FSK F +SS S E  L++  +K SSMFSGTQ+KC +C KT YPLEK+T+
Sbjct  61   HFEQLFKETGSFSKKFPTSSKSGEKELSRTPSKVSSMFSGTQDKCASCKKTAYPLEKLTV  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGESYHK+CFKCSHGGC LT ++YAALDG+LYCKHHF QLF EKG+Y H+ K    K 
Sbjct  121  EGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSYNHLNKVASMKR  178



>emb|CDY18899.1| BnaC04g04510D [Brassica napus]
Length=227

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 150/177 (85%), Gaps = 2/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DLL+ +G TYHKSCF+CSHC GTLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  + +  + +T+A +K SS FSGTQ+KC  C KTVYPLEKV 
Sbjct  61   HFEQLFKESGNFSKNFQTGKTEKSNDQMTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVN  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            MEGE YHK+CFKC+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y +V +A  +
Sbjct  121  MEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQAAAK  177



>ref|XP_010907367.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=200

 Score =   265 bits (676),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT DKCKACDKTV+F+DLL+ADG  YHK+CFKCSHCKG L M NYSSM+GVLYCK 
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+G+F+K F + +  +N L +  +K S MF GTQ+KC +C+KT YPLEK+T+E
Sbjct  61   HFEQLFKETGSFTKKFPTGAKDKNELNRTPSKVSYMFCGTQDKCASCNKTAYPLEKITVE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            GESYHK+CFKCSHGGC LT ++YAALDG+LYCKHHF QLF EKG+Y H++KA   K 
Sbjct  121  GESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSYNHLIKAASTKR  177


 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC +C+KT Y ++ ++ +G +YHK+CFKCSH   TL  S+Y++++G+LYCK HF
Sbjct  97   FCGTQDKCASCNKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE G+++    ++S++ ++
Sbjct  157  AQLFKEKGSYNHLIKAASTKRSA  179



>gb|KHG27160.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   264 bits (674),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG  YHKSCFKCSHCKGTL + NYSSMEGV+YCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGIPYHKSCFKCSHCKGTLKLGNYSSMEGVVYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESGNF+KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG+SYHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVEGQSYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_008777895.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=204

 Score =   265 bits (676),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT DKCKACDKTV+F+DLL+ADG  YHK+CFKCSHCKG L M NYSSM+GVLYCK 
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+G+F+K F + +  +N L +  +K S MFSGTQ+KC +C KT YPLEK+T+E
Sbjct  61   HFEQLFKETGSFTKKFPTGAKDKNELNRTPSKVSYMFSGTQDKCASCKKTAYPLEKITVE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            GESYHK+CFKCSHGGC LT ++YAALDG+LYCKHHF QLF EKG+Y H++ A   K 
Sbjct  121  GESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSYNHLINAASMKR  177


 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC +C KT Y ++ ++ +G +YHK+CFKCSH   TL  S+Y++++G+LYCK HF
Sbjct  97   FSGTQDKCASCKKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE G+++   +++S + ++
Sbjct  157  AQLFKEKGSYNHLINAASMKRSA  179



>ref|XP_006296425.1| hypothetical protein CARUB_v10025604mg [Capsella rubella]
 gb|EOA29323.1| hypothetical protein CARUB_v10025604mg [Capsella rubella]
Length=225

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY +DLL+ +G TYHKSCFKC+HCKGTLV+SNYSSM+GVLYCK 
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCTHCKGTLVISNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGN+SKNF +  + +  + LT+  +K SS FSGTQ+KC  C KTVYPLEKVT
Sbjct  61   HFEQLFKESGNYSKNFQNGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGE YHK+CF+C+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  MEGECYHKNCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  175


 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCFKC+H    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCTHCKGTLVISNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GNY    + G+
Sbjct  63   EQLFKESGNYSKNFQNGK  80



>ref|XP_009143175.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDX74767.1| BnaA05g05130D [Brassica napus]
Length=229

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 151/177 (85%), Gaps = 2/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY +DLL+ +G TYHKSCF+CSHC GTLV+SNYSSM+GVLYCKT
Sbjct  1    MAFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENS--LTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  + +++  +T+A +K SS FSGTQ+KC  C KTVYPLEKV 
Sbjct  61   HFEQLFKESGNFSKNFQTGKTEKSNDHMTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVN  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            MEGE YHK+CFKC+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y +V +A  +
Sbjct  121  MEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQAAAK  177



>ref|XP_007009106.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009109.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17916.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17919.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
Length=189

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG  YHKSCFKCSHCKGTL + NYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG+SYHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_004953255.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=197

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCK CDKTV+F+DLL+ADG +YHK+CFKCSHCKGTL +S+YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSISSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G FSK F    SS ++   KA +K SS FSGTQ+KC AC KTVYPLEK+T+
Sbjct  61   HFEQLFKETGTFSKKFQGGGSSNKSDQAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGESYHKSCFKCSHGGC LT ++YAAL+G+LYCK HF+QLF EKG+Y H+++  Q K
Sbjct  121  EGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTAQTK  177


 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ ++ +G +YHKSCFKCSH    L  S+Y+++ G+LYCK H
Sbjct  97   AFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIH  156

Query  322  FEQLFKESGNFSKNFHSSSSREN  390
            F QLFKE G+++    ++ +++N
Sbjct  157  FSQLFKEKGSYNHLIQTAQTKKN  179


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GTQ+KC  C KTV+ ++ +T +G SYHK+CFKCSH    L+ ++Y+++DGVLYCK HF
Sbjct  3    FTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSISSYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E G +    + G   N+
Sbjct  63   EQLFKETGTFSKKFQGGGSSNK  84



>ref|XP_010093495.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB54148.1| Pollen-specific protein SF3 [Morus notabilis]
Length=192

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKACDKTVY V+ LSADG +YHKSCFKCSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACDKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS---SSSRENS-LTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+G+F+KNF S   S+ + N  LT++ +K +SMFSGTQ+KC  C KT YPLEK
Sbjct  61   HFEQLFKETGSFNKNFQSPAKSAEKLNPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E  +YHKSCFKCSHGGCA+T + YAAL+GVLYCKHHF QLF EKGNY HVL++   K
Sbjct  121  VTVESLTYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFAQLFKEKGNYNHVLRSASSK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KT Y ++ ++ +  TYHKSCFKCSH    +  SNY+++EGVLYCK HF
Sbjct  101  FSGTQDKCATCGKTAYPLEKVTVESLTYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKAS  408
             QLFKE GN++    S+SS+  +    S
Sbjct  161  AQLFKEKGNYNHVLRSASSKRTAAAPPS  188



>ref|XP_002452860.1| hypothetical protein SORBIDRAFT_04g033700 [Sorghum bicolor]
 gb|EES05836.1| hypothetical protein SORBIDRAFT_04g033700 [Sorghum bicolor]
Length=200

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCK CDKTV+F+DLL+ADG +YHK+CFKCSHCKGTL +S+YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSISSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHS-SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G FSK F   +SS +    KA +K SS FSGTQ+KC AC KTVYPLEK+T+
Sbjct  61   HFEQLFKETGTFSKKFQGGASSTKTDQAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGESYHKSCFKCSHGGC LT ++YAAL+G+LYCK HF+QLF EKG+Y H+++  Q K
Sbjct  121  EGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTAQTK  177


 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ ++ +G +YHKSCFKCSH    L  S+Y+++ G+LYCK H
Sbjct  97   AFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIH  156

Query  322  FEQLFKESGNFSKNFHSSSSREN  390
            F QLFKE G+++    ++ +++N
Sbjct  157  FSQLFKEKGSYNHLIQTAQTKKN  179



>ref|NP_001132843.1| uncharacterized LOC100194335 [Zea mays]
 gb|ACF81859.1| unknown [Zea mays]
 tpg|DAA36695.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
 gb|AIB04292.1| LIM transcription factor, partial [Zea mays]
Length=204

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 2/173 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC ACDKTV+F+DLL+ADGA YHK+CFKCSHCKG L M +YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGAIYHKTCFKCSHCKGVLSMCSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+FSKNF     SS +  LT+A +K SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKETGSFSKNFTPGGKSSDKGELTRAPSKLSSAFSGTQDKCAACQKTVYPLEKLT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK  651
            +EGESYHKSCFKCSHGGC LT ++YAAL+GVLYCK HF QLFMEKG+Y H+ K
Sbjct  121  LEGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFAQLFMEKGSYNHMNK  173


 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ L+ +G +YHKSCFKCSH    L  S+Y+++ GVLYCK H
Sbjct  98   AFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIH  157

Query  322  FEQLFKESGNFSKNFHSSSSRE  387
            F QLF E G+++     S S+E
Sbjct  158  FAQLFMEKGSYNHMNKKSPSQE  179


 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GTQ+KC AC KTV+ ++ +T +G  YHK+CFKCSH    L+  +Y+++DGVLYCK HF
Sbjct  3    FTGTQDKCTACDKTVHFIDLLTADGAIYHKTCFKCSHCKGVLSMCSYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQR  663
             QLF E G++      G +
Sbjct  63   EQLFKETGSFSKNFTPGGK  81



>ref|XP_009421306.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 149/178 (84%), Gaps = 3/178 (2%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            FTGT  KCKACDKTVY +D L+ADG  +HKSCFKC+HCKGTL +S YSSMEGVLYCK HF
Sbjct  5    FTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPHF  64

Query  325  EQLFKESGNFSKNFHS---SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            EQLFKESGNF+KNF S   S+ +   LT++++K +SMFSGTQEKC  C+KT YPLEKVT+
Sbjct  65   EQLFKESGNFNKNFQSPAKSAEKAPELTRSTSKAASMFSGTQEKCATCTKTAYPLEKVTV  124

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EG++YHKSCFKCSHGGC++T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K 
Sbjct  125  EGQAYHKSCFKCSHGGCSITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKR  182


 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +G  YHKSCFKCSH   ++  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCTKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALEGILYCKHHF  161

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLFKE G+++    S+S +  + T
Sbjct  162  SQLFKEKGSYNHLIKSASIKRAAAT  186



>ref|XP_008463203.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463204.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463205.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=195

 Score =   263 bits (671),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 148/182 (81%), Gaps = 4/182 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKACDKTVY VD LSADG ++HKSCFKCSHCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNF----HSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNFSKNF     SS      LT++ ++ +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFSKNFLSPAKSSEKPTPELTRSPSRAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC+L+ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  NQ  672
             Q
Sbjct  181  RQ  182


 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +   YHKSCFKCSH   +L  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASN  411
             QLFKE G+++    S+S +  + T  S+
Sbjct  161  SQLFKEKGSYNHLIKSASMKRQAATSDSD  189



>ref|XP_009404566.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   262 bits (669),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 148/178 (83%), Gaps = 3/178 (2%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            FTGT  KCKACDKTVY +D L+ADG  +HKSCFKC+HCKGTL +S YSSMEGVLYCK HF
Sbjct  5    FTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPHF  64

Query  325  EQLFKESGNFSKNFHS---SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            EQLFKESGNF+KNF S   S+ +   LT++ +K +SMFSGTQEKC  C+KT YPLEKVT+
Sbjct  65   EQLFKESGNFNKNFQSPAKSAEKAPELTRSPSKAASMFSGTQEKCATCAKTAYPLEKVTV  124

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EG++YHKSCFKCSHGGC++T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K 
Sbjct  125  EGQAYHKSCFKCSHGGCSITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKR  182


 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +G  YHKSCFKCSH   ++  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCAKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALEGILYCKHHF  161

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLFKE G+++    S+S + ++ T
Sbjct  162  SQLFKEKGSYNHLIKSASIKRSAAT  186



>emb|CDY27358.1| BnaC04g50470D [Brassica napus]
Length=230

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY +DLL+ +G TYHKSCF+CSHC GTL MS YSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMSTYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  + +  + +T+A +K SS FSGTQ+KC +C KTVYPLEKV 
Sbjct  61   HFEQLFKESGNFSKNFQTGKTEKSNDQMTRAPSKLSSFFSGTQDKCASCHKTVYPLEKVN  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGE YHK+CFKC+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  MEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  175


 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCF+CSH    L  +TY+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMSTYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GN+    + G+
Sbjct  63   EQLFKESGNFSKNFQTGK  80



>ref|NP_001140551.1| uncharacterized LOC100272616 [Zea mays]
 gb|ACF84061.1| unknown [Zea mays]
 gb|AFW58965.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB05143.1| LIM transcription factor, partial [Zea mays]
Length=205

 Score =   262 bits (669),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            +FTGT DKC  CDKTV+F+DLL+ADG TYHK+CFKCSHCKG L M +YSSM+GVLYCKTH
Sbjct  3    SFTGTQDKCAECDKTVHFIDLLTADGVTYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTH  62

Query  322  FEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            FEQLFKE+G+FSKNF     SS +  LT+A +K SS FSGTQ+KC AC KTVYPLEK+T+
Sbjct  63   FEQLFKETGSFSKNFTPGGKSSDKGELTRAPSKLSSAFSGTQDKCAACQKTVYPLEKLTL  122

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGESYHKSCFKCSHGGC LT ++YAAL+GVLYCK HF QLFMEKG+Y H++K    ++
Sbjct  123  EGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFAQLFMEKGSYSHMMKKSPSQD  180


 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  SMFSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKH  600
            S F+GTQ+KC  C KTV+ ++ +T +G +YHK+CFKCSH    L+  +Y+++DGVLYCK 
Sbjct  2    SSFTGTQDKCAECDKTVHFIDLLTADGVTYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  61

Query  601  HFTQLFMEKGNYQHVLKAGQRKNQ  672
            HF QLF E G++      G + + 
Sbjct  62   HFEQLFKETGSFSKNFTPGGKSSD  85



>ref|XP_011022732.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
Length=212

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M FTGTL+KCKACDKTVYF++L+SADG  YHK CFKCSHC G LVMS+YSS++GVLYCK 
Sbjct  1    MGFTGTLEKCKACDKTVYFIELVSADGVPYHKKCFKCSHCNGLLVMSSYSSIDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            H++QLFKE+GNF+K   SS  ++N LTKA +K SSMFSGTQ+KC +C KTVYPLEKVT+E
Sbjct  61   HYDQLFKETGNFTKKLQSSGEKKNGLTKAPSKLSSMFSGTQDKCASCKKTVYPLEKVTVE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HKSCF+CSHGGC +T ++YAALDG+LYCK HF+QLF +KG+Y ++ K    K
Sbjct  121  GEFFHKSCFRCSHGGCFITPSSYAALDGILYCKAHFSQLFKQKGSYSYLTKTSTMK  176


 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC +C KTVY ++ ++ +G  +HKSCF+CSH    +  S+Y++++G+LYCK HF
Sbjct  97   FSGTQDKCASCKKTVYPLEKVTVEGEFFHKSCFRCSHGGCFITPSSYAALDGILYCKAHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNK  414
             QLFK+ G++S    +S+ ++N++     K
Sbjct  157  SQLFKQKGSYSYLTKTSTMKKNAVNLPEEK  186



>ref|XP_004167859.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3-like 
[Cucumis sativus]
Length=195

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 147/182 (81%), Gaps = 4/182 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKACDKTVY VD LSADG ++HKSCFKCSHCKGTL +SNYSSM+GVLYCK 
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNF----HSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNFSKNF     SS      LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFSKNFLSPAKSSEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC+L+ + YAALDG+L CKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCSLSPSNYAALDGILXCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  NQ  672
             Q
Sbjct  181  RQ  182


 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +   YHKSCFKCSH   +L  SNY++++G+L CK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALDGILXCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLFKE G+++    S+S +  + T
Sbjct  161  SQLFKEKGSYNHLIKSASMKRQAAT  185



>gb|ABK22125.1| unknown [Picea sitchensis]
Length=197

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 147/183 (80%), Gaps = 6/183 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGT  KCKACDKTVYFVD LSADG +YHKSCF+C+HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MAFTGTQQKCKACDKTVYFVDQLSADGVSYHKSCFRCNHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE------NSLTKASNKYSSMFSGTQEKCPACSKTVYPL  480
            HF+QLF+ESGNF+KNF S  S +        LT++ +K S MFSGTQ+KC  C KT YPL
Sbjct  61   HFDQLFRESGNFNKNFQSQRSSKVIDGLSPELTRSPSKVSMMFSGTQDKCATCGKTAYPL  120

Query  481  EKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQ  660
            EKVT+E  SYHKSCFKCSHGGC+++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K   
Sbjct  121  EKVTVESLSYHKSCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKTAT  180

Query  661  RKN  669
             K 
Sbjct  181  MKR  183


 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  130  KERMAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLY  309
            K  M F+GT DKC  C KT Y ++ ++ +  +YHKSCFKCSH   ++  SNY+++EG+LY
Sbjct  98   KVSMMFSGTQDKCATCGKTAYPLEKVTVESLSYHKSCFKCSHGGCSISPSNYAALEGILY  157

Query  310  CKTHFEQLFKESGNFS  357
            CK HF QLFKE G+++
Sbjct  158  CKHHFSQLFKEKGSYN  173



>emb|CDY37066.1| BnaA04g26440D [Brassica napus]
Length=229

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY +DLL+ +G TYHKSCF+CSHC GTL M+ YSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMTTYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  + +  + +T+A +K SS FSGTQ+KC +C KTVYPLEKV 
Sbjct  61   HFEQLFKESGNFSKNFQTGKTEKSNDQMTRAPSKLSSFFSGTQDKCASCHKTVYPLEKVN  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGE YHK+CFKC+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  MEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  175


 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCF+CSH    L   TY+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMTTYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GN+    + G+
Sbjct  63   EQLFKESGNFSKNFQTGK  80



>gb|AGJ83945.1| lim protein 5 [Gossypium hirsutum]
Length=189

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 148/181 (82%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+LLSADG  YHKSCFKCSHCKGTL ++NYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLANYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLT----KASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF SS+     LT    ++ +K +SMFSGT EKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSSAKAAEKLTPEMTRSPSKAASMFSGTVEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG+SYHKSCFKCSHGGC+L+ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVEGQSYHKSCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>gb|KDP25467.1| hypothetical protein JCGZ_20623 [Jatropha curcas]
Length=212

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M F+GTL+KCKACDKTV+F+++++ADG  YHK+CFKCSHC G LVM +YSSMEGVLYCK 
Sbjct  1    MGFSGTLEKCKACDKTVHFIEMVTADGINYHKTCFKCSHCNGLLVMGSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLF+E+G+++K F SS  ++N+LT+  +K+SSMFSGTQ+KC  C+KT YPLEKV++E
Sbjct  61   HFEQLFRETGSYAKKFPSSGEKKNALTRTPSKFSSMFSGTQDKCARCNKTAYPLEKVSVE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            GESYHKSCF+CSHGGC ++ ++YAALDGVLYCK HF QLF EKG+Y H+ K+  +
Sbjct  121  GESYHKSCFRCSHGGCYISPSSYAALDGVLYCKPHFAQLFKEKGSYNHIRKSNSQ  175



>gb|ABL74496.1| LIM domain protein PLIM2b [Populus tremula x Populus alba]
Length=173

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = +1

Query  157  LDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHFEQLF  336
            LDKCKACDKTVY VD++S +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCKTHFEQLF
Sbjct  1    LDKCKACDKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLF  60

Query  337  KESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTMEGESYH  513
            KE G+FSKNF      R + L +  +K SS+F GTQ+KC  C KTVYPLEKVTMEGE YH
Sbjct  61   KEGGDFSKNFQKGKPERTHELIRTPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYH  120

Query  514  KSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            K+CF+C+HGGC LTH++YAALDGVLYCK HF QLFMEKG Y HVL     K 
Sbjct  121  KTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLAGATHKR  172


 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
             F GT DKC  C KTVY ++ ++ +G  YHK+CF+C+H    L  S+Y++++GVLYCK H
Sbjct  91   VFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVH  150

Query  322  FEQLFKESGNFS  357
            F QLF E G +S
Sbjct  151  FAQLFMEKGTYS  162



>ref|XP_009402055.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=201

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT DKCKAC+KTV+F+DLL+ADG TYHK+CFKCSHCKGTL M NYSSM+GVLYCK 
Sbjct  1    MSFSGTQDKCKACEKTVHFIDLLTADGVTYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G F++ F +   S   N  +KA  K SSMF GTQ+KC  C KT YPLE +T
Sbjct  61   HFEQLFKETGTFTRKFPTGTKSGERNEQSKAPTKISSMFCGTQDKCATCKKTAYPLETMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            MEGESYHK+CFKCS GGC LT ++YAALDG+LYCKHHF QLFMEKG+Y HV++A   K 
Sbjct  121  MEGESYHKTCFKCSVGGCMLTPSSYAALDGILYCKHHFAQLFMEKGSYNHVIQAALEKQ  179


 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            FSGTQ+KC AC KTV+ ++ +T +G +YHK+CFKCSH    L+   Y+++DGVLYCK HF
Sbjct  3    FSGTQDKCKACEKTVHFIDLLTADGVTYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVL----KAGQRKNQ  672
             QLF E G +        K+G+R  Q
Sbjct  63   EQLFKETGTFTRKFPTGTKSGERNEQ  88


 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC  C KT Y ++ ++ +G +YHK+CFKCS     L  S+Y++++G+LYCK HF
Sbjct  99   FCGTQDKCATCKKTAYPLETMTMEGESYHKTCFKCSVGGCMLTPSSYAALDGILYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLF E G+++    ++  ++N+
Sbjct  159  AQLFMEKGSYNHVIQAALEKQNA  181



>ref|XP_009142366.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
Length=229

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGTLDKCKACDKTVY +DLL+ +G TYHKSCF+CSHC GTL M+ YSSM+GVLYCKT
Sbjct  1    MSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMTTYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE--NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESGNFSKNF +  + +  + +T+A +K SS FSGTQ+KC +C KTVYPLEKV 
Sbjct  61   HFEQLFKESGNFSKNFQTGKTEKSNDQMTRAPSKLSSFFSGTQDKCASCHKTVYPLEKVN  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            MEGE YHK+CFKC+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y HV +A 
Sbjct  121  MEGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAA  175


 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ +T+EG +YHKSCF+CSH    L   TY+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMTTYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQ  660
             QLF E GN+    + G+
Sbjct  63   EQLFKESGNFSKNFQTGK  80



>ref|XP_010554627.1| PREDICTED: LIM domain-containing protein WLIM2b [Tarenaya hassleriana]
 ref|XP_010554628.1| PREDICTED: LIM domain-containing protein WLIM2b [Tarenaya hassleriana]
Length=196

 Score =   260 bits (665),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCK CDKTVY V+LLSADG  YHKSCFKC+HCK  L +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKTCDKTVYPVELLSADGVGYHKSCFKCTHCKSRLQLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT+  +K++SMFSGTQ+KC  CSKTVYPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKPAEKPTPELTRTPSKFASMFSGTQDKCATCSKTVYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E +SYHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ ++ +  +YHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQDKCATCSKTVYPLEKVTVESQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE G+++    S+S +  +
Sbjct  161  SQLFKEKGSYNHLIKSASIKRTA  183



>ref|XP_009387955.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=186

 Score =   260 bits (664),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GTLDKCKAC+KTV+F+DLLSADG  YHKSCF+CSHC GTL M NYSSMEGVLYCK 
Sbjct  1    MSFSGTLDKCKACEKTVHFIDLLSADGVIYHKSCFRCSHCNGTLSMCNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G F+K F +   +   N L+K  +K+SSMFSGTQ+KC +C KT YPLE +T
Sbjct  61   HFEQLFKETGTFTKKFPTGIKAGERNELSKTPSKFSSMFSGTQDKCASCKKTAYPLETLT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKNQ  672
            MEGESYHK+CFKCS GGC LT ++ AAL+G+LYCKHHF +LFMEKG+Y HV++A   K  
Sbjct  121  MEGESYHKTCFKCSVGGCTLTPSSCAALNGILYCKHHFARLFMEKGSYSHVIQAALMKQN  180


 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC +C KT Y ++ L+ +G +YHK+CFKCS    TL  S+ +++ G+LYCK HF
Sbjct  99   FSGTQDKCASCKKTAYPLETLTMEGESYHKTCFKCSVGGCTLTPSSCAALNGILYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             +LF E G++S    ++  ++N+
Sbjct  159  ARLFMEKGSYSHVIQAALMKQNA  181



>ref|XP_010905119.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=208

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT DKCKACDKTV+F+DLL+ADG  YHK+CFKCSHCKG L M +YSSM+GVLYCK 
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCSYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+F+K F +   S  +N L +  +K S MFSGTQ+KC +C KT YPLEK+T
Sbjct  61   HFEQLFKETGSFTKKFPTGAKSGDKNELNRTPSKVSYMFSGTQDKCASCKKTAYPLEKIT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKNQ  672
            +EGESYHK+CFKCSHGGC LT ++YAA+DG+LYCKHHF QLF EKG+Y HV+KA   K  
Sbjct  121  VEGESYHKTCFKCSHGGCTLTPSSYAAIDGILYCKHHFAQLFKEKGSYNHVIKAASMKRN  180


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC +C KT Y ++ ++ +G +YHK+CFKCSH   TL  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCASCKKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPSSYAAIDGILYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE G+++    ++S + N+
Sbjct  159  AQLFKEKGSYNHVIKAASMKRNA  181



>dbj|BAK06966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   260 bits (665),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCK CDKTV+F+DLL+ADG +YHK+CFKCSHCKGTL M NYSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNF-HSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G+FSK F     S E S  KA +K SS FSGTQ+KC AC KTVYPLEK+++
Sbjct  61   HFEQLFKETGSFSKKFTPGGKSAEKSEAKAPSKMSSAFSGTQDKCAACQKTVYPLEKLSL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKNQ  672
            EGE YHK CFKCSHGGC LT ++YAAL+G+LYCK HF+QLF EKG+Y H++K  Q K +
Sbjct  121  EGECYHKGCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIKTAQTKKE  179


 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ LS +G  YHK CFKCSH    L  S+Y+++ G+LYCK H
Sbjct  97   AFSGTQDKCAACQKTVYPLEKLSLEGECYHKGCFKCSHGGCILTTSSYAALNGILYCKIH  156

Query  322  FEQLFKESGNFSKNFHSSSSRENS  393
            F QLFKE G+++    ++ +++ +
Sbjct  157  FSQLFKEKGSYNHLIKTAQTKKEN  180



>ref|XP_007009108.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOY17918.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
Length=197

 Score =   260 bits (664),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 149/189 (79%), Gaps = 12/189 (6%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG  YHKSCFKCSHCKGTL + NYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS---------SREN---SLTKASNKYSSMFSGTQEKCPACS  462
            HFEQLFKE+GNF+KNF S S         S E     LT++ +K +SMFSGTQEKC  C 
Sbjct  61   HFEQLFKETGNFNKNFQSLSLILLSAAAKSAEKLTPELTRSPSKAASMFSGTQEKCATCG  120

Query  463  KTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQH  642
            KT YPLEKVT+EG+SYHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H
Sbjct  121  KTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNH  180

Query  643  VLKAGQRKN  669
            ++K+   K 
Sbjct  181  LIKSASIKR  189



>ref|XP_004138434.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004165359.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_008441430.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441431.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441432.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 gb|KGN45769.1| hypothetical protein Csa_6G009480 [Cucumis sativus]
Length=189

 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+ LSADG +YHKSCFKCSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT++ +K + MFSGTQ+KC  C KTVYPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQDKCATCGKTVYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E +SYHKSCFKCSHGGCAL+ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQSYHKSCFKCSHGGCALSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ ++ +  +YHKSCFKCSH    L  SNY+++EG+LYCK HF
Sbjct  101  FSGTQDKCATCGKTVYPLEKVTVESQSYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE G+++    S+S + ++
Sbjct  161  SQLFKEKGSYNHLIKSASMKRSA  183



>ref|XP_002315180.1| LIM domain-containing family protein [Populus trichocarpa]
 ref|XP_011036022.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011036023.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 gb|ABK96192.1| unknown [Populus trichocarpa]
 gb|EEF01351.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY ++LLSADG  YHK+CFKC HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS---SSSRENS-LTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S   S+ + N  LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLNPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGCA+T + YAAL+GVLYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKSATMK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_008796793.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=205

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT DKCKACDKTV+F+DLL+ADG  YHK+CFKCSHCKG L M +YSSM+GVLYCK 
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCSYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+F+K F +   S  +N L +  +K S MFSGTQ+KC +C+KT YPLEK+T
Sbjct  61   HFEQLFKETGSFTKKFPTGAKSGDKNELNRTPSKVSYMFSGTQDKCASCNKTAYPLEKIT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            +EGESYHK+CFKCSHGGC LT ++YAALDG+LYCKHHF QLF EKG+Y H+ KA   K 
Sbjct  121  VEGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSYNHLNKAASMKR  179


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 74/115 (64%), Gaps = 14/115 (12%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC +C+KT Y ++ ++ +G +YHK+CFKCSH   TL  S+Y++++G+LYCK HF
Sbjct  99   FSGTQDKCASCNKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASN-KYSSMFSGTQEKCPACSKTVYPLEK  486
             QLFKE G++           N L KA++ K S+     QE+  A ++T   LE+
Sbjct  159  AQLFKEKGSY-----------NHLNKAASMKRSAAIEQEQEQ--ALAETAPELEQ  200



>ref|XP_006445094.1| hypothetical protein CICLE_v10022448mg [Citrus clementina]
 gb|ESR58334.1| hypothetical protein CICLE_v10022448mg [Citrus clementina]
Length=185

 Score =   259 bits (661),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 138/177 (78%), Gaps = 23/177 (13%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VD+LS +G  YHKSCFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDMLSLEGMPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKESGNFSKNF +                       +KC AC KTVYPLEKVTME
Sbjct  61   HFEQLFKESGNFSKNFQT-----------------------DKCAACEKTVYPLEKVTME  97

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            G+ +HK+CF+C+HGGC LTH++YAALDGVLYCKHHF QLFMEKGNY HVLKA   K 
Sbjct  98   GDCFHKTCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMEKGNYSHVLKAANHKR  154



>gb|KHN17859.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY VD LSADG  YHK+CF+CSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESG+FSKNF S +   +     LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKESGSFSKNFQSPAKLADKTTHELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H+ K+   K
Sbjct  121  VTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLTKSASVK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_003538442.1| PREDICTED: pollen-specific protein SF3-like isoformX1 [Glycine 
max]
 ref|XP_006591370.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Glycine 
max]
 ref|XP_006591371.1| PREDICTED: pollen-specific protein SF3-like isoform X3 [Glycine 
max]
Length=200

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY VD LSADG  YHK+CF+CSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESG+FSKNF S +   +     LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKESGSFSKNFQSPAKLADKTTHELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H+ K+   K
Sbjct  121  VTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLTKSASVK  180

Query  667  N  669
             
Sbjct  181  R  181



>gb|KDP44835.1| hypothetical protein JCGZ_01335 [Jatropha curcas]
Length=189

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 148/181 (82%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY ++LLSADG +YHKSCFKC HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGISYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC+L+ + YAAL+GVLYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_006435557.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006435558.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006486459.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR48797.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|ESR48798.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|KDO69271.1| hypothetical protein CISIN_1g029695mg [Citrus sinensis]
Length=189

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCK C+KTVY V+ LSADG  YHKSCFKCSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKVCEKTVYPVEQLSADGVVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESGNF+KNF S +         LT++ +K +SMFSGTQEKC +CSKTVYPLEK
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCASCSKTVYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            V +E ++YHK+CFKCSHGGC+++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VAVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>gb|KHG07853.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+LLSADG  YHKSCFKCSHCKGTL ++NYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLANYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF SS+         LT++ +K +SMFSGT EKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSSAKAAEKLTPELTRSPSKAASMFSGTVEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG+SYHKSCFKCSH GC+L+ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVEGQSYHKSCFKCSHSGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT++KC  C KT Y ++ ++ +G +YHKSCFKCSH   +L  SNY+++EG+LYCK HF
Sbjct  101  FSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHSGCSLSPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE G+++    S+S +  +
Sbjct  161  SQLFKEKGSYNHLIKSASIKRTA  183



>gb|ABK58469.1| LIM domain protein WLIM2a [Populus tremula x Populus alba]
Length=189

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY ++LLSADG  YHKSCFKC HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HF+QLFKE+GNF+KNF S +         LT++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HFDQLFKETGNFNKNFQSPAKTAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGCA+T ++YAAL+GVLYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCAITPSSYAALEGVLYCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>gb|AII80545.1| LIM-domain protein 11 [Gossypium hirsutum]
Length=225

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GT DKC  CDKTV+F+DLL+ADG  YHK+CFKC+HC G LVMSNY SMEGVLYCK 
Sbjct  1    MAFSGTTDKCTICDKTVHFIDLLTADGIPYHKTCFKCTHCNGLLVMSNYCSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G ++KNF S  S R N  TK  N+ ++ FSGTQ+KC  C+KT YPLEKVT+
Sbjct  61   HFEQLFKETGTYTKNFQSKKSDRPNGQTKTPNRLAAFFSGTQDKCGVCNKTAYPLEKVTV  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            EGE+YHKSCF+CS GGC LT +TYAA+DG+LYCKHHF QLFMEKG Y H+ K A  +KN
Sbjct  121  EGENYHKSCFRCSPGGCLLTPSTYAAMDGILYCKHHFAQLFMEKGCYSHLAKQACMKKN  179



>ref|NP_001241110.1| uncharacterized protein LOC100809121 [Glycine max]
 ref|XP_006601833.1| PREDICTED: uncharacterized protein LOC100809121 isoform X1 [Glycine 
max]
 ref|XP_006601834.1| PREDICTED: uncharacterized protein LOC100809121 isoform X2 [Glycine 
max]
 gb|ACU23614.1| unknown [Glycine max]
 gb|KHN07635.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY VD LSADG  YHK+CF+CSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            H+EQLFKESG+FSKNF S +   +     LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HYEQLFKESGSFSKNFQSPAKLADKTTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H+ K+   K
Sbjct  121  VTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLTKSASVK  180

Query  667  N  669
             
Sbjct  181  R  181



>gb|AAF75284.1|AF116850_1 LIM domain protein PLIM-2 [Helianthus annuus]
 gb|AAD15745.1| LIM domain protein PLIM-2 [Helianthus annuus]
Length=240

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF GT+DKC ACDKTV+FVDL++ D   YHK CFKC+HCKGTLVMSNYSSM+GVLYC  
Sbjct  1    MAFGGTIDKCNACDKTVHFVDLMTVDNVIYHKKCFKCTHCKGTLVMSNYSSMDGVLYCMP  60

Query  319  HFEQLFKESGNFSKNFHSSS-SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+GN+SKNF +S  +R+NS  +  NK+S  FSGT +KC  C KTVY ++K+TM
Sbjct  61   HFEQLFKETGNYSKNFRTSKLNRDNSTAQLPNKFSYFFSGTLDKCRICEKTVYFIDKMTM  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG--QRKN  669
            EGESYHK CF+C HGGC LTH++YAAL+G LYC+HHF QLF+EKG   HVLKA   ++KN
Sbjct  121  EGESYHKQCFRCVHGGCPLTHSSYAALNGNLYCRHHFAQLFLEKGTLSHVLKAAADRKKN  180



>ref|XP_009587504.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=189

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG +YHKSCFKC+HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQL+KESGNF+KNF S +         LT++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLYKESGNFNKNFQSPAKSAEKLTPELTRSPSKAARMFSGTQEKCATCDKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E +SYHKSCFKCSHGGC+L  + YAALDG+LYCK HF+QLF EKG+Y H++K    K
Sbjct  121  VTVENQSYHKSCFKCSHGGCSLNPSNYAALDGILYCKPHFSQLFKEKGSYNHLIKCASVK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +1

Query  136  RMAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCK  315
            RM F+GT +KC  CDKT Y ++ ++ +  +YHKSCFKCSH   +L  SNY++++G+LYCK
Sbjct  99   RM-FSGTQEKCATCDKTAYPLEKVTVENQSYHKSCFKCSHGGCSLNPSNYAALDGILYCK  157

Query  316  THFEQLFKESGNFSKNFHSSSSRENSLT  399
             HF QLFKE G+++     +S +  + T
Sbjct  158  PHFSQLFKEKGSYNHLIKCASVKRPAAT  185



>ref|XP_003544136.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Glycine max]
 ref|XP_006595876.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Glycine max]
 ref|XP_006595877.1| PREDICTED: pollen-specific protein SF3 isoform X3 [Glycine max]
 gb|KHN20876.1| Pollen-specific protein SF3 [Glycine soja]
Length=189

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KC+ACDKTVY VD LSADG  YHK+CFKCSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE----NSLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            H+EQLFKE+G+F KNF S + +       LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HYEQLFKETGSFKKNFQSPAKQAVKTTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG++YHKSCFKCSHG C +T + YAAL+GVLYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVEGQAYHKSCFKCSHGSCPITPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  NQ  672
             +
Sbjct  181  RE  182


 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +G  YHKSCFKCSH    +  SNY+++EGVLYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGSCPITPSNYAALEGVLYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRE--NSLTKA  405
             QLFKE G+++    S+S +   NS+ +A
Sbjct  161  SQLFKEKGSYNHLIKSASIKREANSVPQA  189



>gb|KHG24101.1| Pollen-specific SF3 [Gossypium arboreum]
Length=227

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GT DKC  CDKTV+F+DLL+ADG  YHK+CFKC+HC G LVMSNY SMEGVLYCK 
Sbjct  1    MAFSGTTDKCTICDKTVHFIDLLTADGIPYHKTCFKCTHCNGLLVMSNYCSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G ++KNF S  S R N  TK  N+ ++ FSGTQ+KC  C+KT YPLEKVT+
Sbjct  61   HFEQLFKETGTYTKNFQSKKSDRPNGQTKTPNRLAAFFSGTQDKCGVCNKTAYPLEKVTV  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            EGE+YHKSCF+CS GGC LT +TYAA+DG+LYCKHHF QLFMEKG Y H+ K A  +KN
Sbjct  121  EGENYHKSCFRCSPGGCLLTPSTYAAMDGILYCKHHFAQLFMEKGCYSHLAKQACMKKN  179



>gb|ACX47456.1| LIM1 [Hevea brasiliensis]
Length=189

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY ++LLSADG  YHKSCFKC HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC+L+ + YAAL+GVLYCKHHF+QLF EKG+Y H++K    K
Sbjct  121  VTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKCASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_006652565.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=200

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC ACDKTV+F+DLL+ADG  YHK+CFKCSHCKG L M +YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G+FSK F     S +  L +A +K SS FSGTQ+KC AC KTVYPLEK+T+
Sbjct  61   HFEQLFKETGSFSKKFTPGCRSSDKELARAPSKISSAFSGTQDKCAACQKTVYPLEKLTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGESYHKSCFKCSHGGC LT ++YAAL+GVLYCK HF QLFMEKG+Y H+ K  + + 
Sbjct  121  EGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYNHMKKKSESQE  178



>ref|XP_002530411.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF31981.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=189

 Score =   257 bits (656),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY ++LLSADG  YHKSCFKC HCKGTL +SNYSSMEGV+YCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVVYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC+++ + YAAL+GVLYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCSISPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_011076748.1| PREDICTED: LIM domain-containing protein WLIM2b [Sesamum indicum]
Length=189

 Score =   257 bits (656),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+LLSADG +YHKSCFKCSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            H+EQLFKE+G+FSKNF S +         LT++ +K + MFSGTQ+KC  C KT YPLEK
Sbjct  61   HYEQLFKETGSFSKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQDKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E +SYHKSCFKCSHGGC+LT + YAALDG+LYCK HF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQSYHKSCFKCSHGGCSLTPSNYAALDGILYCKPHFSQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_008392902.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_008392903.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_009351060.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Pyrus x bretschneideri]
Length=200

 Score =   257 bits (656),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 148/182 (81%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+ LSADG +YHKSCFKC+HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRE-----NSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKE+GNF+KNF S +++        LT++ +K +SMFSGTQ+KC  C KT YPLE
Sbjct  61   HFEQLFKETGNFNKNFQSPAAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   
Sbjct  121  KVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182



>ref|XP_007163504.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 ref|XP_007163505.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|AGV54419.1| pollen-specific protein SF3-like isoform 1 [Phaseolus vulgaris]
 gb|ESW35498.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|ESW35499.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
Length=194

 Score =   257 bits (656),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY VD LSADG  YHK+CF+CSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            H+EQLFKE+G FSKNF S +   +     LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HYEQLFKETGTFSKNFQSPAKLADKTTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H+ K+   K
Sbjct  121  VTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLTKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_009389159.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=200

 Score =   257 bits (656),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT DKCKACDKTV+F+DLL+ADG  +HK+CFKCS CKGTL M NYSS++G+LYCK 
Sbjct  1    MSFSGTQDKCKACDKTVHFIDLLTADGVPFHKTCFKCSRCKGTLSMCNYSSLDGILYCKP  60

Query  319  HFEQLFKESGNFSKNFH--SSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+F+K F   + S   N L + +++ SSMFSGTQ+KC  C KT YPLEK+T
Sbjct  61   HFEQLFKETGSFTKKFPIGAKSGERNELARPASRVSSMFSGTQDKCATCHKTAYPLEKLT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            +EGESYHK+CFKCSHGGC LT ++YAAL+G++YCKHHF QLF EKG+Y H+LK    K 
Sbjct  121  VEGESYHKTCFKCSHGGCKLTPSSYAALEGIIYCKHHFAQLFKEKGSYNHLLKVAAMKQ  179


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KT Y ++ L+ +G +YHK+CFKCSH    L  S+Y+++EG++YCK HF
Sbjct  99   FSGTQDKCATCHKTAYPLEKLTVEGESYHKTCFKCSHGGCKLTPSSYAALEGIIYCKHHF  158

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE G+++     ++ +++S
Sbjct  159  AQLFKEKGSYNHLLKVAAMKQSS  181


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            FSGTQ+KC AC KTV+ ++ +T +G  +HK+CFKCS     L+   Y++LDG+LYCK HF
Sbjct  3    FSGTQDKCKACDKTVHFIDLLTADGVPFHKTCFKCSRCKGTLSMCNYSSLDGILYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E G++      G +  +
Sbjct  63   EQLFKETGSFTKKFPIGAKSGE  84



>ref|XP_007218461.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_007218462.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_008233707.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 ref|XP_008233708.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 gb|EMJ19660.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 gb|EMJ19661.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
Length=192

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+ LSADG +YHK+CFKC+HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGVSYHKACFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>gb|EYU19976.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
 gb|EYU19977.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
Length=199

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 148/182 (81%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+LLSADG ++HKSCF+CSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFLGTTQKCKACEKTVYHVELLSADGISFHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS-----SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            H+EQLFKE+G+F+KNF S +     S    +T++ +K + MFSGTQ+KC  C+KT YPLE
Sbjct  61   HYEQLFKETGSFTKNFTSPAKSAEKSSTPEMTRSPSKAAGMFSGTQDKCATCAKTAYPLE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E +SYHKSCFKCSHGGC+LT + YAALDG+LYCK HF+QLF EKG+Y HVLK+   
Sbjct  121  KVTVENQSYHKSCFKCSHGGCSLTPSNYAALDGILYCKPHFSQLFKEKGSYNHVLKSASM  180

Query  664  KN  669
            K 
Sbjct  181  KR  182



>ref|XP_010067487.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067488.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067489.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 gb|KCW65631.1| hypothetical protein EUGRSUZ_G03023 [Eucalyptus grandis]
Length=189

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+ LSADG  YHKSCFKCSHCKGTL +S+YSSMEGVLYCK 
Sbjct  1    MSFTGTQVKCKACEKTVYPVEQLSADGVAYHKSCFKCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLT----KASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +   + LT    ++ +K + MFSGTQ+KC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSADKLTPELARSPSKAAGMFSGTQDKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E +SYHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQSYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_003580212.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Brachypodium 
distachyon]
Length=205

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC ACDKTV+F+DLL+ADG  YHK+CFKCSHCKG L M +YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCFACDKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSS-SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G+FSK F   + S    L++A +K SS+FSGTQ+KC AC+KTVYPLEK+T+
Sbjct  61   HFEQLFKETGSFSKKFTPGTKSDRGELSRAPSKLSSIFSGTQDKCTACTKTVYPLEKMTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK  651
            EGE+YHKSCFKCSHGGC LT ++YAAL+GVLYCK HF QLFMEKG+Y H+ K
Sbjct  121  EGEAYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYSHMKK  172


 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KTVY ++ ++ +G  YHKSCFKCSH    L  S+Y+++ GVLYCK HF
Sbjct  98   FSGTQDKCTACTKTVYPLEKMTLEGEAYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHF  157

Query  325  EQLFKESGNFSKNFHSSSSRE  387
             QLF E G++S     S S+E
Sbjct  158  GQLFMEKGSYSHMKKKSDSQE  178


 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GTQ+KC AC KTV+ ++ +T +G  YHK+CFKCSH    L+  +Y+++DGVLYCK HF
Sbjct  3    FTGTQDKCFACDKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E G++      G + ++
Sbjct  63   EQLFKETGSFSKKFTPGTKSDR  84



>ref|XP_004239928.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Solanum 
lycopersicum]
 ref|XP_006355670.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=189

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG +YHKSCFKC+HCKGTL +S+YSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTHCKGTLKLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLT----KASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQL+KESGNF+KNF S       LT    K+ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLYKESGNFNKNFQSPVKSAEKLTPMLTKSPSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E +SYHKSCFKCSHGGC+L  + YAALDG+LYCK HF+QLF EKG+Y H++K+   K
Sbjct  121  VTVENQSYHKSCFKCSHGGCSLNPSNYAALDGILYCKPHFSQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +  +YHKSCFKCSH   +L  SNY++++G+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLNPSNYAALDGILYCKPHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLFKE G+++    S+S +  + T
Sbjct  161  SQLFKEKGSYNHLIKSASMKRPAAT  185



>ref|XP_003574155.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Brachypodium 
distachyon]
Length=204

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M F+GT DKCKACDKTV+F+DLL+AD   YHKSCFKCSHCKGTL M NYSSM+GVLYCKT
Sbjct  1    MTFSGTQDKCKACDKTVHFIDLLTADSIPYHKSCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+G F+KNF + +      +K  NK SS+F GTQ+KC AC KT YPLEK+T+E
Sbjct  61   HFEQLFKETGTFNKNFPTGAKANGYQSKVPNKLSSVFCGTQDKCAACKKTAYPLEKMTLE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            GE YHK+CFKC+HGGC LT ATYA+L+G+LYC+HHF QLF E G+Y ++LK    KN
Sbjct  121  GEPYHKTCFKCAHGGCLLTTATYASLNGILYCQHHFWQLFKETGSYDNLLKPASAKN  177


 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
             F GT DKC AC KT Y ++ ++ +G  YHK+CFKC+H    L  + Y+S+ G+LYC+ H
Sbjct  96   VFCGTQDKCAACKKTAYPLEKMTLEGEPYHKTCFKCAHGGCLLTTATYASLNGILYCQHH  155

Query  322  FEQLFKESGNFSKNFHSSSSRENSLTKAS  408
            F QLFKE+G++      +S++ +   +A+
Sbjct  156  FWQLFKETGSYDNLLKPASAKNHDEQEAT  184



>ref|XP_009391810.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 146/172 (85%), Gaps = 2/172 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKCKACDKTV+F+DLL+ADG  YHK+CFKCSHCKG+L M NYSSM+G+LYCK 
Sbjct  1    MSFTGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGSLSMCNYSSMDGILYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKESG+F+K F +   S   N L+K+ +K S MF+GTQ+KC +C KT YPLEK+T
Sbjct  61   HFEQLFKESGSFTKKFPTGAKSGERNELSKSPSKISYMFTGTQDKCVSCKKTAYPLEKLT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVL  648
            +EGESYHK+CFKCSHGGC LT ++YAAL+G++YCKHHF QLF EKG+Y H++
Sbjct  121  VEGESYHKTCFKCSHGGCTLTPSSYAALEGIIYCKHHFAQLFKEKGSYNHLV  172


 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GTQ+KC AC KTV+ ++ +T +G  YHK+CFKCSH   +L+   Y+++DG+LYCK HF
Sbjct  3    FTGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGSLSMCNYSSMDGILYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E G++      G +  +
Sbjct  63   EQLFKESGSFTKKFPTGAKSGE  84



>ref|XP_004976341.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Setaria 
italica]
Length=204

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 145/173 (84%), Gaps = 2/173 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC ACDKTV+F+DLL+ADG  YHK+CFKCSHCKG L M +YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+FSK F     S+ +  L +A +K SS FSGTQ+KC AC KTVYPLEK+T
Sbjct  61   HFEQLFKETGSFSKKFTPGGKSADKGELARAPSKLSSAFSGTQDKCAACQKTVYPLEKLT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK  651
            +EGESYHKSCFKCSHGGC LT ++YAAL+GVLYCK HF QLFMEKG+Y H+ K
Sbjct  121  LEGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYNHMKK  173


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ L+ +G +YHKSCFKCSH    L  S+Y+++ GVLYCK H
Sbjct  98   AFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIH  157

Query  322  FEQLFKESGNFSKNFHSSSSREN  390
            F QLF E G+++     S+S++ 
Sbjct  158  FGQLFMEKGSYNHMKKKSTSQDT  180


 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GTQ+KC AC KTV+ ++ +T +G  YHK+CFKCSH    L+  +Y+++DGVLYCK HF
Sbjct  3    FTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQR  663
             QLF E G++      G +
Sbjct  63   EQLFKETGSFSKKFTPGGK  81



>ref|XP_002448228.1| hypothetical protein SORBIDRAFT_06g023600 [Sorghum bicolor]
 gb|EES12556.1| hypothetical protein SORBIDRAFT_06g023600 [Sorghum bicolor]
Length=203

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 144/172 (84%), Gaps = 1/172 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC ACDKTV+F+DLL+ADG  YHK+CFKCSHCKG L M +YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G+FSK F     S +  L +A +K SS FSGTQ+KC AC KTVYPLEK+T+
Sbjct  61   HFEQLFKETGSFSKKFTPGCKSDKGELARAPSKLSSAFSGTQDKCAACQKTVYPLEKLTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK  651
            EGE+YHKSCFKCSHGGC LT ++YAAL+GVLYCK HF QLFMEKG+Y H+ K
Sbjct  121  EGEAYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYNHMKK  172


 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            AF+GT DKC AC KTVY ++ L+ +G  YHKSCFKCSH    L  S+Y+++ GVLYCK H
Sbjct  97   AFSGTQDKCAACQKTVYPLEKLTLEGEAYHKSCFKCSHGGCILTTSSYAALNGVLYCKIH  156

Query  322  FEQLFKESGNFSKNFHSSSSRE  387
            F QLF E G+++     S+S+E
Sbjct  157  FGQLFMEKGSYNHMKKKSTSQE  178


 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GTQ+KC AC KTV+ ++ +T +G  YHK+CFKCSH    L+  +Y+++DGVLYCK HF
Sbjct  3    FTGTQDKCTACDKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E G++      G + ++
Sbjct  63   EQLFKETGSFSKKFTPGCKSDK  84



>ref|XP_006848064.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
 gb|ERN09645.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
Length=189

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GT  KCKAC+KTVY +D LSADG  YHKSCFKC+HCKGTL + NYSSMEGVLYCK 
Sbjct  1    MAFSGTQQKCKACEKTVYVMDQLSADGVLYHKSCFKCNHCKGTLKLGNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSR----ENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+G+F+K+F S +         LT++ +K +SMFSGTQ+KC  C KT YPLEK
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSVEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E +SYHKSCFKCSHGGC +T +TYAAL+G+LYCKHHF+QLF EKG+Y H++K    K
Sbjct  121  VTVESQSYHKSCFKCSHGGCPITPSTYAALEGILYCKHHFSQLFKEKGSYNHLIKCATMK  180

Query  667  NQ  672
             Q
Sbjct  181  RQ  182



>ref|XP_009369042.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
 ref|XP_009350652.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=219

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT  KCKACDKTV+F+D LSADG  YHK+CFKCSHC G L MS+YSSM+GVLYCK 
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+GNFSK F +S   +N LT+  +K SSMFSGT +KC  C+KTVYPLEKVTME
Sbjct  61   HFEQLFKETGNFSKKFQTSGKSQNELTRTPSKLSSMFSGTVDKCAVCNKTVYPLEKVTME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            G+ YHKSCF+C+HGGC L+ +  AALDG+LYCKHHF QLF EKG+Y H+ K    K
Sbjct  121  GDFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYSHLTKTASLK  176


 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT+DKC  C+KTVY ++ ++ +G  YHKSCF+C+H    L  SN ++++G+LYCK HF
Sbjct  97   FSGTVDKCAVCNKTVYPLEKVTMEGDFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLFKE G++S    ++S ++N  T
Sbjct  157  AQLFKEKGSYSHLTKTASLKKNGAT  181



>ref|XP_008392904.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Malus 
domestica]
 ref|XP_009351067.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Pyrus x bretschneideri]
Length=199

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+ LSADG +YHKSCFKC+HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT++ +K +SMFSGTQ+KC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_009602682.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 ref|XP_009602683.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 ref|XP_009786370.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|AAD56951.1|AF184886_1 LIM domain protein WLIM2 [Nicotiana tabacum]
 emb|CAA71891.1| LIM-domain SF3 protein [Nicotiana tabacum]
Length=189

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 145/180 (81%), Gaps = 4/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+LLSADG  YHKSCFKCSHCKGTL +SN+SSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVNYHKSCFKCSHCKGTLKLSNFSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESGNF+KNF S +         LT++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E +SYHK+CFKCSHGGC+L+ + YAAL+G+LYCK HF+QLF EKG+Y H++K+   K
Sbjct  121  VTVENQSYHKTCFKCSHGGCSLSPSNYAALNGILYCKPHFSQLFKEKGSYNHLIKSASMK  180


 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +  +YHK+CFKCSH   +L  SNY+++ G+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVENQSYHKTCFKCSHGGCSLSPSNYAALNGILYCKPHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLFKE G+++    S+S +  + T
Sbjct  161  SQLFKEKGSYNHLIKSASMKRPAAT  185



>ref|XP_010256708.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256709.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256710.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256711.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256712.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256713.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
Length=192

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 142/179 (79%), Gaps = 4/179 (2%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT  KCKAC+KTVY VD LSADG TYHKSCFKCSHCKGTL +SNYSSMEGVLYCK HF
Sbjct  4    FGGTQQKCKACEKTVYVVDQLSADGVTYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPHF  63

Query  325  EQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            EQLFKE+G+F KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEKVT
Sbjct  64   EQLFKETGSFKKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVT  123

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            +E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K    K 
Sbjct  124  VESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKCASIKR  182


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +1

Query  421  SMFSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKH  600
            + F GTQ+KC AC KTVY +++++ +G +YHKSCFKCSH    L  + Y++++GVLYCK 
Sbjct  2    AFFGGTQQKCKACEKTVYVVDQLSADGVTYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  61

Query  601  HFTQLFMEKG----NYQHVLKAGQR  663
            HF QLF E G    N+Q   K+ ++
Sbjct  62   HFEQLFKETGSFKKNFQSPAKSAEK  86



>ref|XP_009344420.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=199

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+ LSADG +YHKSCFKC+HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT++ +K +SMFSGTQ+KC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_008381875.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=199

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+ LSADG +YHKSCFKC+HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +         LT++ +K +SMFSGTQ+KC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_011040324.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011040398.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
Length=189

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY ++LLSADG  YHK+CFKC HCKGTL + NYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLGNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HF+QLFKE+GNF+KNF S +         LT++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HFDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGCA+T + YAAL+GVLYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_008374043.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=213

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT  KCKACDKTV+F+D LSADG  YHK+CFKCSHC G L MS+YSSM+GVLYCK 
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+G+FSK F +S   +N LT+  +K SSMFSGT +KC  C+KTVYPLEKVTME
Sbjct  61   HFEQLFKETGSFSKKFQTSGKSQNELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            G+ YHKSCF+C+HGGC L+ +  AALDG+LYCKHHF QLF EKG+Y H+ K A  +KN
Sbjct  121  GDFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYSHLTKTASLKKN  178


 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT+DKC  C KTVY ++ ++ +G  YHKSCF+C+H    L  SN ++++G+LYCK HF
Sbjct  97   FSGTVDKCAVCTKTVYPLEKVTMEGDFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNK  414
             QLFKE G++S    ++S ++N  T    K
Sbjct  157  AQLFKEKGSYSHLTKTASLKKNGATLPEPK  186



>ref|NP_001053405.1| Os04g0532500 [Oryza sativa Japonica Group]
 emb|CAE04568.1| OSJNBb0039L24.7 [Oryza sativa Japonica Group]
 emb|CAE54551.1| OSJNBa0081C01.26 [Oryza sativa Japonica Group]
 dbj|BAF15319.1| Os04g0532500 [Oryza sativa Japonica Group]
 emb|CAJ86411.1| OSIGBa0125M19.14 [Oryza sativa Indica Group]
 gb|EAY94955.1| hypothetical protein OsI_16763 [Oryza sativa Indica Group]
 gb|EAZ31441.1| hypothetical protein OsJ_15578 [Oryza sativa Japonica Group]
 dbj|BAG91667.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEJ08685.1| PLIM2 [Oryza sativa]
Length=201

 Score =   254 bits (650),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC ACDKTV+F+DLL+ADG  YHK+CFKCSHCKG L M +YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G+FSK F     S +  L +A +K  S FSGTQ+KC AC KTVYPLEK+T+
Sbjct  61   HFEQLFKETGSFSKKFAPGCRSTDKELARAPSKICSAFSGTQDKCAACQKTVYPLEKLTL  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGESYHKSCFKCSHGGC LT ++YAAL+GVLYCK HF QLFMEKG+Y H+ K  + + 
Sbjct  121  EGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYNHMKKKSESQE  178



>ref|XP_002312139.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|ABK94456.1| unknown [Populus trichocarpa]
 gb|EEE89506.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   254 bits (649),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY ++LLS DG  YHKSCFKC HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HF+QLFKE+GNF+KNF S +         LT++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HFDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGCA+T + YAAL+GVLYCKHHF+QLF EKG+Y H++K    K
Sbjct  121  VTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKCASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>gb|AGJ83942.1| lim protein 2 [Gossypium hirsutum]
 gb|KHG28834.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   254 bits (649),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 145/180 (81%), Gaps = 3/180 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+L+S DG  +HKSCFKCSHCKGTL   NYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVELVSVDGVPFHKSCFKCSHCKGTLKWGNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS---SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            HFEQLFKE+GN++KNF S   S+ +   LT++ +K + MFSGTQ+KC  C KT YPLEKV
Sbjct  61   HFEQLFKEAGNYNKNFQSPAKSAEKLTQLTRSPSKAAGMFSGTQDKCATCGKTAYPLEKV  120

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            T+EG+SYHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K 
Sbjct  121  TVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKR  180


 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KT Y ++ ++ +G +YHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  100  FSGTQDKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  159

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLFKE G+++    S+S +  + +
Sbjct  160  SQLFKEKGSYNHLIKSASIKRTATS  184



>ref|XP_002279922.1| PREDICTED: LIM domain-containing protein WLIM2b [Vitis vinifera]
 ref|XP_010658484.1| PREDICTED: LIM domain-containing protein WLIM2b [Vitis vinifera]
 emb|CAN81425.1| hypothetical protein VITISV_014590 [Vitis vinifera]
 emb|CBI31546.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   254 bits (649),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 142/181 (78%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC KTVY V+ LSADG  YHKSCFKCSHC GTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACLKTVYPVEQLSADGVVYHKSCFKCSHCNGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESGNF+KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASMK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +   YHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENSLT  399
             QLFKE G+++    S+S + ++ +
Sbjct  161  AQLFKEKGSYNHLIKSASMKRSAAS  185



>ref|XP_008798954.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   254 bits (648),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GT  KCKAC+KTVY +D LSADG +YHKSCFKC+HCKGTL +SNYSS+EGVLYCK 
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGVSYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+G+F+K+F S +         LT++ +K + MFSGTQEKC AC KT YPLEK
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCVACGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K    K
Sbjct  121  VTVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKCASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_004307607.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=200

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC KTVY V+ LSADG +YHKSCFKC+HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACQKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLT----KASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+KNF S +     LT    ++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPEMTRSPSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_007009107.1| GATA type zinc finger transcription factor family protein isoform 
2, partial [Theobroma cacao]
 gb|EOY17917.1| GATA type zinc finger transcription factor family protein isoform 
2, partial [Theobroma cacao]
Length=191

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 4/175 (2%)
 Frame = +1

Query  157  LDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHFEQLF  336
            + KCKAC+KTVY V+LLSADG  YHKSCFKCSHCKGTL + NYSSMEGVLYCK HFEQLF
Sbjct  9    IKKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLF  68

Query  337  KESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTMEGE  504
            KE+GNF+KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEKVT+EG+
Sbjct  69   KETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQ  128

Query  505  SYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            SYHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K 
Sbjct  129  SYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKR  183


 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +G +YHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  325  EQLFKESGNFSKNFHSSSSRE  387
             QLFKE G+++    S+S + 
Sbjct  163  SQLFKEKGSYNHLIKSASIKR  183



>dbj|BAK04207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=203

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 147/173 (85%), Gaps = 2/173 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT DKC AC+KTV+F+DLL+ADG  YHK+CFKCSHCKG L M +YSSM+GVLYCKT
Sbjct  1    MSFTGTQDKCSACEKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSS--SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVT  492
            HFEQLFKE+G+FSK F     S  ++ LT+A +K S+ FSGTQ+KC AC+KTVYPLEK+T
Sbjct  61   HFEQLFKETGSFSKKFTPGNKSGDKSELTRAPSKLSAAFSGTQDKCAACTKTVYPLEKMT  120

Query  493  MEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK  651
            +EG++YHKSCFKCSHGGC LT ++YAAL+GVLYCK HF QLFME+G+Y H+ K
Sbjct  121  LEGDAYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMERGSYSHMKK  173


 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  130  KERMAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLY  309
            K   AF+GT DKC AC KTVY ++ ++ +G  YHKSCFKCSH    L  S+Y+++ GVLY
Sbjct  94   KLSAAFSGTQDKCAACTKTVYPLEKMTLEGDAYHKSCFKCSHGGCILTTSSYAALNGVLY  153

Query  310  CKTHFEQLFKESGNFSKNFHSSSSRE  387
            CK HF QLF E G++S     S S+E
Sbjct  154  CKIHFGQLFMERGSYSHMKKKSPSQE  179


 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GTQ+KC AC KTV+ ++ +T +G  YHK+CFKCSH    L+  +Y+++DGVLYCK HF
Sbjct  3    FTGTQDKCSACEKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTHF  62

Query  607  TQLFMEKGNYQHVLKAGQR  663
             QLF E G++      G +
Sbjct  63   EQLFKETGSFSKKFTPGNK  81



>ref|XP_006661927.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=216

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M F+GTLDKC ACDKTV+F+DLL+AD   YHKSCFKCSHCKGTL M NYSSM+GVLYCKT
Sbjct  1    MTFSGTLDKCNACDKTVHFIDLLTADSIPYHKSCFKCSHCKGTLSMCNYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFK +G F+KNF S +   +   K  NK SS+F GTQ+KC AC KTVYPLEK+T+E
Sbjct  61   HFEQLFKVTGTFNKNFPSGAKANSEQPKVPNKLSSLFCGTQDKCTACKKTVYPLEKMTLE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            GE YHK+CFKC+HGGC LT+A+YAA +G+LYC++HF QLF + G+Y ++LK    KN
Sbjct  121  GEPYHKTCFKCAHGGCLLTNASYAAHNGILYCQNHFWQLFKKTGSYDNLLKPASAKN  177


 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC AC KTVY ++ ++ +G  YHK+CFKC+H    L  ++Y++  G+LYC+ HF
Sbjct  97   FCGTQDKCTACKKTVYPLEKMTLEGEPYHKTCFKCAHGGCLLTNASYAAHNGILYCQNHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKA  405
             QLFK++G++      +S++    ++A
Sbjct  157  WQLFKKTGSYDNLLKPASAKNTCASEA  183



>ref|XP_006403418.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403419.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403420.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403421.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44871.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44872.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44873.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44874.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
Length=199

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG +YH+SCFKC+HCK  L +S YSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVSYHRSCFKCTHCKSRLQLSRYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESG+F+KNF S +         LT+  ++ + MFSGTQEKC  CSKTVYP+EK
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPIEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +T+E ++YHKSCFKCSHGGC L+ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   K
Sbjct  121  ITVESQTYHKSCFKCSHGGCPLSPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    L  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKITVESQTYHKSCFKCSHGGCPLSPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  161  AQLFKEKGSYNHLIKSASIKRS  182



>gb|AFK39062.1| unknown [Lotus japonicus]
 gb|AFK48743.1| unknown [Lotus japonicus]
Length=189

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY VD LSADG +YHK+CF+CSHCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFLGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            H+EQLFKE+G F KNF S +   +     LT++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HYEQLFKETGTFKKNFQSPAKLADKNTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_007009110.1| GATA type zinc finger transcription factor family protein isoform 
5, partial [Theobroma cacao]
 gb|EOY17920.1| GATA type zinc finger transcription factor family protein isoform 
5, partial [Theobroma cacao]
Length=182

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 4/174 (2%)
 Frame = +1

Query  160  DKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHFEQLFK  339
             KCKAC+KTVY V+LLSADG  YHKSCFKCSHCKGTL + NYSSMEGVLYCK HFEQLFK
Sbjct  1    QKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLFK  60

Query  340  ESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTMEGES  507
            E+GNF+KNF S +         LT++ +K +SMFSGTQEKC  C KT YPLEKVT+EG+S
Sbjct  61   ETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQS  120

Query  508  YHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K 
Sbjct  121  YHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKR  174


 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +G +YHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  94   FSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  153

Query  325  EQLFKESGNFSKNFHSSSSRE  387
             QLFKE G+++    S+S + 
Sbjct  154  SQLFKEKGSYNHLIKSASIKR  174



>ref|XP_007040178.1| GATA type zinc finger transcription factor family protein, putative 
[Theobroma cacao]
 gb|EOY24679.1| GATA type zinc finger transcription factor family protein, putative 
[Theobroma cacao]
Length=219

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GT +KCKACDKTV+F+DLLSADG +YHK+CFKCSHC G LVMS+Y SMEGVLYCK 
Sbjct  1    MAFSGTTEKCKACDKTVHFIDLLSADGVSYHKTCFKCSHCNGLLVMSSYCSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS-SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G+++K F S  S + N L +A ++ +S FSGTQ++C  C+KT YPLEKVT+
Sbjct  61   HFEQLFKETGSYTKKFQSGKSDKPNGLARAPSRLASFFSGTQDRCGVCNKTAYPLEKVTV  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGE+YHKSCF+C HGGC L  ++YAALDG+LYCKHHF QLF EKG+Y H+ K    K
Sbjct  121  EGENYHKSCFRCCHGGCFLNPSSYAALDGILYCKHHFAQLFKEKGSYSHLTKTASLK  177


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +1

Query  136  RMA--FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLY  309
            R+A  F+GT D+C  C+KT Y ++ ++ +G  YHKSCF+C H    L  S+Y++++G+LY
Sbjct  93   RLASFFSGTQDRCGVCNKTAYPLEKVTVEGENYHKSCFRCCHGGCFLNPSSYAALDGILY  152

Query  310  CKTHFEQLFKESGNFSKNFHSSSSRENS  393
            CK HF QLFKE G++S    ++S ++NS
Sbjct  153  CKHHFAQLFKEKGSYSHLTKTASLKKNS  180



>ref|XP_010516165.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
Length=197

 Score =   253 bits (645),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 145/182 (80%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG  YHKSCFKC+HCK  L +S+YSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS-----SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESG+F+KNF S +     S    LT+  ++ +  FSGTQEKC  CSKTVYP+E
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPADKSTTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E ++YHKSCFKCSHGGCAL+ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182


 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    L  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  161

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  162  AQLFKEKGSYNHLIKSASIKRS  183



>emb|CBL95262.1| lim domain protein [Pinus pinaster]
Length=197

 Score =   253 bits (645),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 6/183 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGT  KCKACDKTVYFVD LSADG +YHK+CF+C+HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MAFTGTQQKCKACDKTVYFVDQLSADGVSYHKACFRCNHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSR------ENSLTKASNKYSSMFSGTQEKCPACSKTVYPL  480
            HF+QLF+ESGNF+KNF S  S       +  +T++ +K S MF GTQ+KC  C KT YPL
Sbjct  61   HFDQLFRESGNFNKNFQSQRSSKAIDGLQPEMTRSPSKVSMMFFGTQDKCGTCGKTAYPL  120

Query  481  EKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQ  660
            EKVT+   S+HKSCF+CSHGGC+++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K   
Sbjct  121  EKVTVGNLSFHKSCFRCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKTAS  180

Query  661  RKN  669
             K 
Sbjct  181  MKR  183


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  130  KERMAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLY  309
            K  M F GT DKC  C KT Y ++ ++    ++HKSCF+CSH   ++  SNY+++EG+LY
Sbjct  98   KVSMMFFGTQDKCGTCGKTAYPLEKVTVGNLSFHKSCFRCSHGGCSISPSNYAALEGILY  157

Query  310  CKTHFEQLFKESGNFSKNFHSSSSRE  387
            CK HF QLFKE G+++    ++S + 
Sbjct  158  CKHHFSQLFKEKGSYNHLIKTASMKR  183



>ref|XP_010923152.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Elaeis 
guineensis]
Length=189

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 148/181 (82%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GT  KCKACDKTVY +D LSADG  YHKSCFKC+HCKGTL +SNYSS+EGVLYCK 
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHS---SSSRENS-LTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+G+F+K+F S   S+ + N  LT++ +K + MFSGT EKC  C KT YPLEK
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSAEKSNPELTRSRSKAAGMFSGTLEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG++YHKSCF+CSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVEGQAYHKSCFRCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GTL+KC  C KT Y ++ ++ +G  YHKSCF+CSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTLEKCATCGKTAYPLEKVTVEGQAYHKSCFRCSHGGCPISPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE G+++    S+S +  +
Sbjct  161  SQLFKEKGSYNHLIKSASIKRTA  183



>ref|XP_010427370.1| PREDICTED: LIM domain-containing protein WLIM2b [Camelina sativa]
Length=200

 Score =   253 bits (645),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 145/182 (80%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG  YHKSCFKC+HCK  L +S+YSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS-----SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESG+F+KNF S +     S    LT+  ++ +  FSGTQEKC  CSKTVYP+E
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPADKSATPELTRTPSRVAGRFSGTQEKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E ++YHKSCFKCSHGGCAL+ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182


 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    L  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  161

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  162  AQLFKEKGSYNHLIKSASIKRS  183



>ref|XP_010504446.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
 ref|XP_010504447.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
Length=200

 Score =   253 bits (645),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 145/182 (80%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG  YHKSCFKC+HCK  L +S+YSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSS-----SRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESG+F+KNF S +     S    LT+  ++ +  FSGTQEKC  CSKTVYP+E
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPTDKSATPELTRTPSRVAGRFSGTQEKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E ++YHKSCFKCSHGGCAL+ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182


 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    L  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  161

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  162  AQLFKEKGSYNHLIKSASIKRS  183



>ref|XP_010534537.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534538.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534539.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534540.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
Length=199

 Score =   252 bits (644),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG +YHKSCFKC+HCK  L +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTHCKSRLQLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+G+F KNF S +         LT+  +K + MFSGTQ+KC  C KTVYPLEK
Sbjct  61   HFEQLFKETGSFHKNFQSPAKPAEKPTPELTRTPSKVAGMFSGTQDKCTTCGKTVYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E +SYHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_010928941.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=189

 Score =   252 bits (643),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GT  KCKAC+KTVY +D LSADG  YHKSCFKC+HCKGTL +SNYSS+EGVLYCK 
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+G+F+K+F S +         LT++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K    K
Sbjct  121  VTVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKCASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_002876333.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52592.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=199

 Score =   252 bits (644),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG  YHKSCFKC+HCK  L +S+YSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESG+F+KNF S +   +     LT+  ++ +S FSGTQEKC  CSKTVYP+EK
Sbjct  61   HFEQLFKESGSFNKNFQSPAKPADKSTPELTRTPSRVASRFSGTQEKCATCSKTVYPIEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   K
Sbjct  121  VTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  161  AQLFKEKGSYNHLIKSASIKRS  182



>gb|ABK94608.1| unknown [Populus trichocarpa]
Length=189

 Score =   252 bits (643),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 142/181 (78%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY ++LLS DG  YHKSCFKC HCKGTL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            H +QLFKE+GNF+KNF S +         LT++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HLDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT E ++YHKSCFKCSHGGCA+T + YAAL+GVLYCKHHF+QLF EKG+Y H++K    K
Sbjct  121  VTAESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYNHLIKCASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_008785448.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   252 bits (643),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF+GT  KCKACDKTVY +D LSADG  YHKSCFKC+HCKGTL +SNYSS+EGVLYCK 
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+G+F+K+F S +         LT++ +K + MFSGTQEKC  C KT YPLEK
Sbjct  61   HFEQLFKETGSFNKSFQSPAKPAEKPTPELTRSRSKAAGMFSGTQEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG++YHK CF+CSHGGC+++ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVEGQAYHKFCFRCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KT Y ++ ++ +G  YHK CF+CSH   ++  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVEGQAYHKFCFRCSHGGCSISPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSRENS  393
             QLFKE G+++    S+S +  +
Sbjct  161  SQLFKEKGSYNHLIKSASIKRTA  183



>emb|CDX76073.1| BnaA04g03370D [Brassica napus]
Length=270

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 145/183 (79%), Gaps = 5/183 (3%)
 Frame = +1

Query  136  RMA-FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYC  312
            RM+ FTGT  KCKAC+KTVY V+LLSADG TYHKSCFKC+HCK  L +S YSSMEGVLYC
Sbjct  70   RMSSFTGTQQKCKACEKTVYPVELLSADGVTYHKSCFKCTHCKSRLQLSRYSSMEGVLYC  129

Query  313  KTHFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPL  480
            K H+EQLFKESG+F+KNF S +         LT+  ++ + MFSGTQEKC  CSKTVYP+
Sbjct  130  KPHYEQLFKESGSFTKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPI  189

Query  481  EKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQ  660
            EKVT+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+  
Sbjct  190  EKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSAS  249

Query  661  RKN  669
             K 
Sbjct  250  IKR  252


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  172  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  231

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  232  AQLFKEKGSYNHLIKSASIKRS  253



>ref|XP_009133391.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 gb|AID61745.1| LIM domain-containing protein [Brassica rapa subsp. pekinensis]
Length=200

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY ++LLSADG ++HKSCFKCSHCK TL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSHCKTTLQLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSR-----ENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKE+G+F+KNF S +          LT+  ++ + MFSGTQ+KC  CSKTVYP+E
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGCA++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182



>emb|CDY02959.1| BnaC04g25270D [Brassica napus]
Length=269

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 145/183 (79%), Gaps = 5/183 (3%)
 Frame = +1

Query  136  RMA-FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYC  312
            RM+ FTGT  KCKAC+KTVY V+LLSADG +YHKSCFKCSHCK  L +S YSSMEGVLYC
Sbjct  69   RMSSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYC  128

Query  313  KTHFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPL  480
            K H+EQLFKESG+F+KNF S +         LT+  ++ + MFSGTQEKC  CSKTVYP+
Sbjct  129  KPHYEQLFKESGSFTKNFQSPAKPAEKSNPELTRTPSRVAGMFSGTQEKCATCSKTVYPI  188

Query  481  EKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQ  660
            EKVT+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+  
Sbjct  189  EKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSAS  248

Query  661  RKN  669
             K 
Sbjct  249  IKR  251


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  171  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  230

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  231  AQLFKEKGSYNHLIKSASIKRS  252



>dbj|BAJ86406.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=209

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M F GT DKCKAC+KTV+F+DLL+AD   YHK CFKCSHCKGTL M +YSSM+GVL+CKT
Sbjct  1    MTFYGTQDKCKACNKTVHFIDLLTADSVPYHKYCFKCSHCKGTLSMCSYSSMDGVLFCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+G F KNF + +   N  +K  NKY S+F GTQ+KC AC KTVYPLEK+T+E
Sbjct  61   HFEQLFKETGTFKKNFPTCTKANNEQSKVPNKYGSVFCGTQDKCAACKKTVYPLEKMTLE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE YHK+CFKC+HGGC LT+A+YA+L+G+LYC+HHF QLF E G+Y ++LK    K
Sbjct  121  GEPYHKTCFKCAHGGCILTNASYASLNGILYCQHHFWQLFKETGSYSNLLKPASAK  176


 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 66/102 (65%), Gaps = 0/102 (0%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
             F GT DKC AC KTVY ++ ++ +G  YHK+CFKC+H    L  ++Y+S+ G+LYC+ H
Sbjct  96   VFCGTQDKCAACKKTVYPLEKMTLEGEPYHKTCFKCAHGGCILTNASYASLNGILYCQHH  155

Query  322  FEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEK  447
            F QLFKE+G++S     +S++  +  +A+ +     S  +E+
Sbjct  156  FWQLFKETGSYSNLLKPASAKHANQPEAAKEEEQAGSSKEEE  197



>ref|XP_002879831.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56090.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 144/182 (79%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY V+LLSADG +YHKSCFKCSHCK  L +SNYSSMEGV+YC+ 
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGISYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  319  HFEQLFKESGNFSKNFHSSSSR-----ENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESG+FSKNF S +          LT+  ++ + MFSGTQ+KC  CSKTVYP+E
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLTDKPTPELTRTPSRLAGMFSGTQDKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182



>ref|XP_004503222.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503223.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cicer 
arietinum]
Length=189

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY VD LSADG +YHK+CF+CSHCKGTL +S+YSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            H+EQLFKE+G F KNF S +   +     LT++ +K +SMFSGTQ+KC  C KT YPLEK
Sbjct  61   HYEQLFKETGTFKKNFTSPAKLADKTTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>emb|CDY24943.1| BnaC03g22290D [Brassica napus]
Length=197

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY ++LLSADG ++HKSCFKCSHCK TL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSHCKTTLQLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSR-----ENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKE+G+F+KNF S +          LT+  ++ + MFSGTQ+KC  CSKTVYP+E
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGCA++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182


 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ ++ +   YHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHF  161

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  162  AQLFKEKGSYNHLIKSASIKRS  183



>ref|XP_006295906.1| hypothetical protein CARUB_v10025036mg [Capsella rubella]
 gb|EOA28804.1| hypothetical protein CARUB_v10025036mg [Capsella rubella]
Length=200

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 144/182 (79%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY V+LLSADG +YHKSCFKCSHCK  L +SNYSSMEGV+YC+ 
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  319  HFEQLFKESGNFSKNFHS-----SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESG+FSKNF S     S      LT+  ++ + MFSGTQ+KC  C+KTVYP+E
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLSDKPTPELTRTPSRVAGMFSGTQDKCATCNKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182



>ref|XP_010517368.1| PREDICTED: LIM domain-containing protein WLIM2a [Camelina sativa]
Length=201

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 144/182 (79%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY V+LLSADG +YHKSCFKCSHCK  L +SNYSSMEGV+YC+ 
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  319  HFEQLFKESGNFSKNFHS-----SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESG+FSKNF S     S      LT+  ++ + +FSGTQ+KC  CSKTVYP+E
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLSDKPTPELTRTPSRVAGLFSGTQDKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182



>ref|XP_002283482.1| PREDICTED: LIM domain-containing protein WLIM2a [Vitis vinifera]
 emb|CBI34710.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT  KCKACDKTV+ +D +SADG  YHK+CF+CSHC G LVMSNYSSM+GVLYCK 
Sbjct  1    MSFSGTTQKCKACDKTVHIIDTISADGIAYHKTCFRCSHCNGPLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLF+ESG+ SK F SS   +  L++  +K SSMFSGTQ+KC  C KTVYPLEKVT+E
Sbjct  61   HFEQLFRESGSLSKKFQSSGKAD--LSRTPSKLSSMFSGTQDKCSLCKKTVYPLEKVTVE  118

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE YHKSCF+CSHGGC LT ++YAALDG+LYCK HFTQLF E+G+Y  + K    K
Sbjct  119  GEFYHKSCFRCSHGGCFLTPSSYAALDGILYCKPHFTQLFRERGSYSTLNKTASMK  174



>emb|CDY60999.1| BnaA03g56620D [Brassica napus]
Length=200

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY ++LLSADG ++HKSCFKCSHCK TL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSHCKTTLQLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSR-----ENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKE+G+F+KNF S +          LT+  ++ + MFSGTQ+KC  CSKTVYP+E
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGCA++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182



>gb|AAL38006.1|AF443117_1 LIM domain protein [Gossypium hirsutum]
 gb|AII80543.1| LIM-domian protein 9 [Gossypium hirsutum]
Length=189

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY V+LLSADG  YHKSC KCSHCKGTL ++NYSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCSKCSHCKGTLKLANYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLT----KASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+GNF+K+F  S+     LT    ++ +K +SMFSGT EKC  C KT YPLEK
Sbjct  61   HFEQLFKETGNFNKDFQLSAKAAEKLTPEMTRSPSKAASMFSGTVEKCATCGKTAYPLEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+EG+SY KSCFKCSHGGC+L+ + YAAL+G+LYCKHHF+QLF EKG+Y H++K+   K
Sbjct  121  VTVEGQSYLKSCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_006477522.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
Length=208

 Score =   251 bits (640),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 145/176 (82%), Gaps = 2/176 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF GT +KCKACDKTV+ +D+++ADG +YHK CFKCSHC G LVM N+SSMEGVLYCK 
Sbjct  1    MAFCGTQEKCKACDKTVHIIDMVTADGISYHKICFKCSHCNGKLVMGNFSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+G+F+       +++N LT+  +K+S+MFSGTQ+KC +C KTVYPLEKVT+E
Sbjct  61   HFEQLFKETGSFTNKL--KPAQKNGLTRTPSKFSTMFSGTQDKCTSCKKTVYPLEKVTVE  118

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GES+HK+CF+CSHGGC LT ++YAALDG+LYCK HF+QLF EKG Y H+ K   +K
Sbjct  119  GESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHFSQLFKEKGCYNHLTKTASQK  174


 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 66/101 (65%), Gaps = 2/101 (2%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC +C KTVY ++ ++ +G ++HK+CF+CSH    L  S+Y++++G+LYCK+HF
Sbjct  95   FSGTQDKCTSCKKTVYPLEKVTVEGESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHF  154

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEK  447
             QLFKE G +  N  + ++ +  +  AS   +     T+ K
Sbjct  155  SQLFKEKGCY--NHLTKTASQKKIVAASADQNPEAEATEAK  193



>ref|XP_010505685.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
 ref|XP_010505686.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
Length=207

 Score =   251 bits (640),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 144/182 (79%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY V+LLSADG +YHKSCFKCSHCK  L +SNYSSMEGV+YC+ 
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  319  HFEQLFKESGNFSKNFHS-----SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESG+FSKNF S     S      LT+  ++ + +FSGTQ+KC  CSKTVYP+E
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLSEKATPELTRTPSRVAGLFSGTQDKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182



>emb|CDX72203.1| BnaC08g26710D [Brassica napus]
Length=201

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 145/181 (80%), Gaps = 5/181 (3%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            +FTGT  KCKAC+KTVY V+LLSADG +YHKSCFKCSHCK  L +S YSSMEGVLYCK H
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKPH  62

Query  322  FEQLFKESGNFSKNFHSS--SSRENS---LTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            +EQLFKESG+F+KNF S    + E S   LT+  ++ + MFSGTQEKC  CSKTVYP+EK
Sbjct  63   YEQLFKESGSFTKNFQSPVKPAAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPIEK  122

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   K
Sbjct  123  VTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASIK  182

Query  667  N  669
             
Sbjct  183  R  183


 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = +1

Query  421  SMFSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKH  600
            S F+GTQ+KC AC KTVYP+E ++ +G SYHKSCFKCSH    L  + Y++++GVLYCK 
Sbjct  2    SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKP  61

Query  601  HFTQLFMEKG----NYQHVLKAGQRKN  669
            H+ QLF E G    N+Q  +K    K+
Sbjct  62   HYEQLFKESGSFTKNFQSPVKPAAEKS  88


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  163  AQLFKEKGSYNHLIKSASIKRS  184



>emb|CDY27267.1| BnaA09g35350D [Brassica napus]
Length=201

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 145/181 (80%), Gaps = 5/181 (3%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            +FTGT  KCKAC+KTVY V+LLSADG +YHKSCFKCSHCK  L +S YSSMEGVLYCK H
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKPH  62

Query  322  FEQLFKESGNFSKNFHSS--SSRENS---LTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            +EQLFKESG+F+KNF S    + E S   LT+  ++ + MFSGTQEKC  CSKTVYP+EK
Sbjct  63   YEQLFKESGSFTKNFQSPVKPAAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPIEK  122

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   K
Sbjct  123  VTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASIK  182

Query  667  N  669
             
Sbjct  183  R  183


 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = +1

Query  421  SMFSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKH  600
            S F+GTQ+KC AC KTVYP+E ++ +G SYHKSCFKCSH    L  + Y++++GVLYCK 
Sbjct  2    SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKP  61

Query  601  HFTQLFMEKG----NYQHVLKAGQRKN  669
            H+ QLF E G    N+Q  +K    K+
Sbjct  62   HYEQLFKESGSFTKNFQSPVKPAAEKS  88


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  163  AQLFKEKGSYNHLIKSASIKRS  184



>ref|XP_009139138.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 gb|AID61744.1| LIM domain-containing protein [Brassica rapa subsp. pekinensis]
Length=200

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 143/180 (79%), Gaps = 4/180 (2%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            +FTGT  KCKAC+KTVY V+LLSADG +YHKSCFKC+HCK  L +S YSSMEGVLYCK H
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTHCKSRLQLSRYSSMEGVLYCKPH  62

Query  322  FEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            +EQLFKESG+F+KNF S +         LT+  ++ + MFSGTQEKC  CSKTVYP+EKV
Sbjct  63   YEQLFKESGSFTKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPIEKV  122

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            T+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   K 
Sbjct  123  TVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASIKR  182


 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +1

Query  421  SMFSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKH  600
            S F+GTQ+KC AC KTVYP+E ++ +G SYHKSCFKC+H    L  + Y++++GVLYCK 
Sbjct  2    SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTHCKSRLQLSRYSSMEGVLYCKP  61

Query  601  HFTQLFMEKG----NYQHVLKAGQR  663
            H+ QLF E G    N+Q   K  ++
Sbjct  62   HYEQLFKESGSFTKNFQSPAKPAEK  86


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  162  AQLFKEKGSYNHLIKSASIKRS  183



>ref|XP_004982687.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=208

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M F+GT DKCKACDKTV+F+DLL+AD   YHKSCF+CSHCKGTL M +YSSM+GVLYCKT
Sbjct  1    MTFSGTQDKCKACDKTVHFIDLLTADSIPYHKSCFRCSHCKGTLSMCSYSSMDGVLYCKT  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFK +G FSKNF +     N  +K  NK SS+F GTQ+KC AC+KTVYPLEK+T+E
Sbjct  61   HFEQLFKATGTFSKNFPTGPKANNEQSKVPNKLSSLFCGTQDKCAACNKTVYPLEKITLE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            GE YHK+CFKC+ GGC LT ATYA+ +G+LYC+ HF Q+F E G+Y ++LK    KN
Sbjct  121  GEPYHKTCFKCARGGCLLTTATYASHNGILYCQIHFWQVFKETGSYSNLLKPAPAKN  177



>emb|CDY20498.1| BnaC04g05460D [Brassica napus]
 emb|CDX74822.1| BnaA05g05680D [Brassica napus]
Length=200

 Score =   250 bits (638),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY ++LLSADG  +HKSCFKCSHCK TL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSHCKSTLQLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSR-----ENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKE+G+F+KNF S +          LT+  ++ + MFSGTQ+KC  CSKTVYP+E
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ ++ +   YHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  162  AQLFKEKGSYNHLIKSASIKRS  183



>ref|XP_009116276.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=201

 Score =   250 bits (638),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 146/181 (81%), Gaps = 5/181 (3%)
 Frame = +1

Query  142  AFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  321
            +FTGT  KCKAC+KTVY V+LLSADG +YHKSCFKCSHCK  L +S YSSMEGVLYCK H
Sbjct  3    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKPH  62

Query  322  FEQLFKESGNFSKNFHSS--SSRENS---LTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            +EQLFKESG+F+KNF S    + E S   LT+  ++ + MFSGTQEKC  CSKTVYP+EK
Sbjct  63   YEQLFKESGSFTKNFQSPVKPAAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPIEK  122

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   K
Sbjct  123  VTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASIK  182

Query  667  N  669
            +
Sbjct  183  H  183


 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = +1

Query  421  SMFSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKH  600
            S F+GTQ+KC AC KTVYP+E ++ +G SYHKSCFKCSH    L  + Y++++GVLYCK 
Sbjct  2    SSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKP  61

Query  601  HFTQLFMEKG----NYQHVLKAGQRKN  669
            H+ QLF E G    N+Q  +K    K+
Sbjct  62   HYEQLFKESGSFTKNFQSPVKPAAEKS  88



>ref|XP_009143273.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=199

 Score =   250 bits (638),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY ++LLSADG  +HKSCFKCSHCK TL +SNYSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSHCKSTLQLSNYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSR-----ENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKE+G+F+KNF S +          LT+  ++ + MFSGTQ+KC  CSKTVYP+E
Sbjct  61   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ ++ +   YHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  162  AQLFKEKGSYNHLIKSASIKRS  183



>ref|NP_191136.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030868.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030869.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030870.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_680133.2| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 sp|Q9M047.1|WLI2B_ARATH RecName: Full=LIM domain-containing protein WLIM2b; AltName: 
Full=Widely-expressed LIM protein 2B [Arabidopsis thaliana]
 emb|CAB81602.1| transcription factor L2 [Arabidopsis thaliana]
 gb|AAL36280.1| putative transcription factor L2 [Arabidopsis thaliana]
 gb|AAM14188.1| putative transcription factor L2 [Arabidopsis thaliana]
 gb|AAM60942.1| transcription factor L2 [Arabidopsis thaliana]
 dbj|BAH19816.1| AT3G55770 [Arabidopsis thaliana]
 dbj|BAH20021.1| AT3G55770 [Arabidopsis thaliana]
 gb|AEE79434.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79435.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79436.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79437.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79438.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
Length=199

 Score =   250 bits (638),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC+KTVY V+LLSADG  YHKSCFKC+HCK  L +S+YSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESG+F+KNF S +   +     LT+  ++ +  FSGTQEKC  CSKTVYP+EK
Sbjct  61   HFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   K
Sbjct  121  VTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  161  AQLFKEKGSYNHLIKSASIKRS  182



>ref|XP_002509768.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF51155.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=215

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M F+GT +KCKACDKTV+F+++++ADG +YHK+CFKCSHC G LVMS+YSSMEGVLYCK 
Sbjct  1    MGFSGTTEKCKACDKTVHFIEMITADGISYHKTCFKCSHCDGRLVMSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLF+E+G+F K F SS  ++N L K  +K SS+FSGTQ+KC  C KT YPLEK+++E
Sbjct  61   HFEQLFRETGSFGKKFPSSVEKKNGLVKTPSKLSSLFSGTQDKCAKCKKTAYPLEKLSVE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKNQ  672
            GE YHKSCF+CSHGGC LT +TYAALDG +YCK HF QLF EKG+Y ++ K+   K  
Sbjct  121  GEFYHKSCFRCSHGGCYLTPSTYAALDGFIYCKPHFAQLFKEKGSYSYLTKSASVKKN  178



>ref|XP_003600847.1| LIM domain-containing protein [Medicago truncatula]
 gb|ACJ85930.1| unknown [Medicago truncatula]
 gb|ACJ86074.1| unknown [Medicago truncatula]
 gb|AES71098.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
 gb|AFK39027.1| unknown [Medicago truncatula]
 gb|AFK39398.1| unknown [Medicago truncatula]
Length=191

 Score =   249 bits (636),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 144/183 (79%), Gaps = 6/183 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY VD LSADG +YHK+CF+CSHCKGTL +S+YSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKN--FHSSSSRENS----LTKASNKYSSMFSGTQEKCPACSKTVYPL  480
            HFEQLFKE GNFSKN  F S +   +     LT+  +K + MFSGTQEKC  C KT YPL
Sbjct  61   HFEQLFKEHGNFSKNKNFQSPAKVADGTTPVLTRTPSKAAGMFSGTQEKCATCGKTAYPL  120

Query  481  EKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQ  660
            EKVT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H++K+  
Sbjct  121  EKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSAS  180

Query  661  RKN  669
             K 
Sbjct  181  IKR  183



>emb|CBI40313.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   249 bits (636),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 134/148 (91%), Gaps = 3/148 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAFTGTLDKCKACDKTVY VDLLSADGA+YHK+CFKCSHCKGTLVMSNYSSM+GVLYCK 
Sbjct  1    MAFTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSS---SSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKV  489
            HFEQLFKESGNFSKNF +S   + + N L++A +K SSMFSGTQ+KC AC KTVYPLEKV
Sbjct  61   HFEQLFKESGNFSKNFQTSAKPADKLNELSRAPSKLSSMFSGTQDKCSACRKTVYPLEKV  120

Query  490  TMEGESYHKSCFKCSHGGCALTHATYAA  573
            T+EGESYHKSCFKC+HGGC LTH++YAA
Sbjct  121  TLEGESYHKSCFKCAHGGCPLTHSSYAA  148


 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            F+GT +KC AC KTVY ++ ++ +G SYHK+CFKCSH    L  + Y+++DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKPHF  62

Query  607  TQLFMEKGNY  636
             QLF E GN+
Sbjct  63   EQLFKESGNF  72



>ref|XP_011029226.1| PREDICTED: LIM domain-containing protein WLIM2b-like isoform 
X1 [Populus euphratica]
 ref|XP_011029227.1| PREDICTED: LIM domain-containing protein WLIM2b-like isoform 
X1 [Populus euphratica]
 ref|XP_011029228.1| PREDICTED: LIM domain-containing protein WLIM2b-like isoform 
X1 [Populus euphratica]
Length=216

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M FTGTL+KCKACDKTVYF++L+SADG  YHK CFKCSHC G L MS+YSS++GVLYC+ 
Sbjct  1    MGFTGTLEKCKACDKTVYFIELVSADGVPYHKKCFKCSHCNGLLGMSSYSSIDGVLYCRP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            H++QLFKE+G F+K F +   ++N L KA +K SSMFSGTQ+KC  C KT YPLEKVT+E
Sbjct  61   HYDQLFKETGTFTKKFQTYEEKKNCLKKAPSKLSSMFSGTQDKCAFCKKTAYPLEKVTVE  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            GE YHKSCF+CSHGGC +T ++YAALDG+LYCK HF QLF +KG+Y ++ K A  +KN
Sbjct  121  GEFYHKSCFRCSHGGCYITPSSYAALDGILYCKAHFAQLFKQKGSYSYLTKTATMKKN  178


 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KT Y ++ ++ +G  YHKSCF+CSH    +  S+Y++++G+LYCK HF
Sbjct  97   FSGTQDKCAFCKKTAYPLEKVTVEGEFYHKSCFRCSHGGCYITPSSYAALDGILYCKAHF  156

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNK  414
             QLFK+ G++S    +++ ++N++     K
Sbjct  157  AQLFKQKGSYSYLTKTATMKKNAVNLPEEK  186



>ref|XP_010508950.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
Length=199

 Score =   249 bits (636),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 142/176 (81%), Gaps = 5/176 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY V+LLSADG +YHKSCFKCSHCK  L +SNYSSMEGV+YC+ 
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  319  HFEQLFKESGNFSKNFHS-----SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESG+FSKNF S     S      LT+  ++ + +FSGTQ+KC  CSKTVYP+E
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLSDKPTPELTRTPSRVAGLFSGTQDKCATCSKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK  651
            KVT+E + YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K
Sbjct  121  KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIK  176



>ref|XP_008392559.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=222

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT  KCKACDKTV+F+D LSADG  YHK+CFKCSHC G L MS+YSSM+ VLYCK 
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDEVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+G+FSK F +S   +  LT+  +K SSMFSGT +KC  C+KTVYPLEKVTME
Sbjct  61   HFEQLFKETGSFSKKFQTSGKSQTELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKNQ  672
            G  YHKSCF+C+HGGC L+ +  AALDG+LYCKHHF QLF EKG+Y H+ K    K +
Sbjct  121  GAFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYNHLTKTASLKKK  178



>dbj|BAH20111.1| AT3G55770 [Arabidopsis thaliana]
Length=199

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 143/181 (79%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KCKAC KTVY V+LLSADG  YHKSCFKC+HCK  L +S+YSSMEGVLYCK 
Sbjct  1    MSFTGTQQKCKACGKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSREN----SLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKESG+F+KNF S +   +     LT+  ++ +  FSGTQEKC  CSKTVYP+EK
Sbjct  61   HFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            VT+E ++YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   K
Sbjct  121  VTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASIK  180

Query  667  N  669
             
Sbjct  181  R  181


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT +KC  C KTVY ++ ++ +  TYHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  161  AQLFKEKGSYNHLIKSASIKRS  182



>ref|XP_010053293.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 ref|XP_010053294.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 ref|XP_010053295.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
Length=219

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M F+GT DKCKACDKTV+ ++L+SADG  YHK+CFKCSHC G LV+S++SSM+G LYCK 
Sbjct  1    MGFSGTQDKCKACDKTVHLIELVSADGVPYHKTCFKCSHCNGKLVISSFSSMDGALYCKP  60

Query  319  HFEQLFKESGNFSKNFH----SSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEK  486
            HFEQLFKE+G++SK FH    SS+ ++N L++  +K S  FSGTQ+KC  C KT YP+EK
Sbjct  61   HFEQLFKETGSYSKKFHQLGKSSNQQQNLLSRTPSKLSHRFSGTQDKCALCLKTAYPIEK  120

Query  487  VTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            +T+EGESYHKSCF+CSHGGC LT +TYAALDG+LYCK HF+QLF EKG+Y H+ K    K
Sbjct  121  LTVEGESYHKSCFRCSHGGCFLTPSTYAALDGILYCKPHFSQLFKEKGSYNHLNKIASMK  180

Query  667  N  669
             
Sbjct  181  R  181



>ref|XP_006411232.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 ref|XP_006411233.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 ref|XP_006411234.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52685.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52686.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52687.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
Length=203

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 143/182 (79%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY ++LLSADG  +HKSCFKCSHCK  L +SNYSSMEGVLYCK 
Sbjct  2    MSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSHCKSRLQLSNYSSMEGVLYCKP  61

Query  319  HFEQLFKESGNFSKNFHSSSSR-----ENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKE+G+F+KNF S +          LT+  ++ + MFSGTQ+KC  CSKTVYP+E
Sbjct  62   HFEQLFKETGSFNKNFQSPAKPLTDKPTPELTRTPSRVAGMFSGTQDKCATCSKTVYPIE  121

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  122  KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  181

Query  664  KN  669
            K 
Sbjct  182  KR  183


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ ++ +   YHKSCFKCSH    +  SNY+++EG+LYCK HF
Sbjct  103  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  325  EQLFKESGNFSKNFHSSSSREN  390
             QLFKE G+++    S+S + +
Sbjct  163  AQLFKEKGSYNHLIKSASIKRS  184



>gb|KDO76132.1| hypothetical protein CISIN_1g041875mg [Citrus sinensis]
Length=195

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 143/176 (81%), Gaps = 2/176 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            MAF GT +KCKACDKTV+ +D+++ADG +YHK CFKCSHC G LVM N+SSMEGVLYCK 
Sbjct  1    MAFCGTQEKCKACDKTVHIIDMVTADGISYHKICFKCSHCNGKLVMGNFSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+G+F+       +++N LT+  +K+S+MF GTQ+KC +C KTVYPLEKVT+E
Sbjct  61   HFEQLFKETGSFTNKL--KPAQKNGLTRTPSKFSTMFCGTQDKCTSCKKTVYPLEKVTVE  118

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GES+HK+CF+CSHGGC LT ++YAALDG+LYCK HF QLF EKG Y H+ K   +K
Sbjct  119  GESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHFAQLFKEKGCYNHLTKTASQK  174


 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 65/101 (64%), Gaps = 2/101 (2%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F GT DKC +C KTVY ++ ++ +G ++HK+CF+CSH    L  S+Y++++G+LYCK+HF
Sbjct  95   FCGTQDKCTSCKKTVYPLEKVTVEGESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHF  154

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEK  447
             QLFKE G +  N  + ++ +  +  AS   +     T+ K
Sbjct  155  AQLFKEKGCY--NHLTKTASQKKIVAASADQNPEAEATEAK  193



>ref|XP_002304483.2| hypothetical protein POPTR_0003s12440g [Populus trichocarpa]
 gb|EEE79462.2| hypothetical protein POPTR_0003s12440g [Populus trichocarpa]
Length=210

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 143/176 (81%), Gaps = 2/176 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M FTGTL+KCKACDKTVYF++L+SADG  YHK CFKCSHC G LVMS+YSS++GVLYC+ 
Sbjct  1    MGFTGTLEKCKACDKTVYFIELVSADGVPYHKKCFKCSHCNGLLVMSSYSSIDGVLYCRP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            H++QLFKE+GNF+K   S        TKA +K SSMFSGTQ+KC +C KTVYPLEKVT+E
Sbjct  61   HYDQLFKETGNFTKKLQSC--EIPLFTKAPSKLSSMFSGTQDKCASCKKTVYPLEKVTVE  118

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            GE +HKSCF+CSHGGC +T ++YAALDG+LYCK HF+QLF +KG+Y ++ K    K
Sbjct  119  GEFFHKSCFRCSHGGCFITPSSYAALDGILYCKAHFSQLFKQKGSYSYLTKTSTMK  174


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC +C KTVY ++ ++ +G  +HKSCF+CSH    +  S+Y++++G+LYCK HF
Sbjct  95   FSGTQDKCASCKKTVYPLEKVTVEGEFFHKSCFRCSHGGCFITPSSYAALDGILYCKAHF  154

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNK  414
             QLFK+ G++S    +S+ ++N++     K
Sbjct  155  SQLFKQKGSYSYLTKTSTMKKNAVNSPEEK  184



>ref|NP_181519.1| protein WLIM2A [Arabidopsis thaliana]
 sp|O04193.1|WLI2A_ARATH RecName: Full=LIM domain-containing protein WLIM2a; AltName: 
Full=Widely-expressed LIM protein 2; Short=AtWLIM2 [Arabidopsis 
thaliana]
 gb|AAB95275.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AAM19819.1| At2g39900/T28M21.6 [Arabidopsis thaliana]
 gb|AAM67434.1| At2g39900/T28M21.6 [Arabidopsis thaliana]
 gb|AEC09747.1| protein WLIM2A [Arabidopsis thaliana]
Length=200

 Score =   247 bits (631),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 5/182 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+FTGT  KC+AC+KTVY V+LLSADG +YHK+CFKCSHCK  L +SNYSSMEGV+YC+ 
Sbjct  1    MSFTGTQQKCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRP  60

Query  319  HFEQLFKESGNFSKNFHSSSSR-----ENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            HFEQLFKESG+FSKNF S +          L +  ++ + MFSGTQ+KC  C+KTVYP+E
Sbjct  61   HFEQLFKESGSFSKNFQSPAKPLTDKPTPELNRTPSRLAGMFSGTQDKCATCTKTVYPIE  120

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQR  663
            KVT+E + YHKSCFKCSHGGC ++ + YAAL+G+LYCKHHF QLF EKG+Y H++K+   
Sbjct  121  KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI  180

Query  664  KN  669
            K 
Sbjct  181  KR  182



>gb|AFK34184.1| unknown [Medicago truncatula]
Length=191

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 141/177 (80%), Gaps = 6/177 (3%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F GT  KCKAC+KTVY VD LSADG +YHK+CF+CSHCKGTL +S+YSSMEGVLYCK 
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKN--FHSSSSRENS----LTKASNKYSSMFSGTQEKCPACSKTVYPL  480
            HFEQLFKE GNFSKN  F S +   +     LT+  +K + MFSGTQEKC  C KT YPL
Sbjct  61   HFEQLFKEHGNFSKNKNFQSPAKVADGTTPVLTRTPSKAAGMFSGTQEKCATCGKTAYPL  120

Query  481  EKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK  651
            EKVT+E ++YHKSCFKCSHGGC +T + YAAL+G+LYCKHHF+QLF EKG+Y H +K
Sbjct  121  EKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHFIK  177



>gb|KHG08337.1| Pollen-specific SF3 [Gossypium arboreum]
Length=217

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M F+GT +KCKACDKTV+ +DLL+ADG +YHK+CFKCSHC G LVM NY SM+ VLYCK 
Sbjct  1    MTFSGTTEKCKACDKTVHVIDLLTADGISYHKTCFKCSHCHGVLVMGNYCSMDSVLYCKP  60

Query  319  HFEQLFKESGNF-SKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            HFEQLFKE+G + +KN   SS   N   KA +K++S FSGTQ+KC AC KT YPLEKVT+
Sbjct  61   HFEQLFKETGTYQNKNAKPSSENSNGTGKAPSKFASFFSGTQDKCGACKKTAYPLEKVTI  120

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRK  666
            EGE+YHKSCF+CSHGGC LT +TYAAL+G LYCKHHF+QLF EKG Y H+ +    K
Sbjct  121  EGENYHKSCFRCSHGGCVLTPSTYAALEGFLYCKHHFSQLFKEKGTYAHLTETSTSK  177


 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC AC KT Y ++ ++ +G  YHKSCF+CSH    L  S Y+++EG LYCK HF
Sbjct  98   FSGTQDKCGACKKTAYPLEKVTIEGENYHKSCFRCSHGGCVLTPSTYAALEGFLYCKHHF  157

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEK  447
             QLFKE G ++    +S+S+++S   +    S   S ++ K
Sbjct  158  SQLFKEKGTYAHLTETSTSKKSSAAPSPEVRSEAESDSESK  198



>gb|EMS55690.1| Pollen-specific protein SF3 [Triticum urartu]
Length=432

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  136  RMAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCK  315
            +M F GT DKCKACDKTV+F+DLL+ADG  YHK CFKCSHCKGTL M +YSSM+GVL+CK
Sbjct  232  KMTFYGTQDKCKACDKTVHFIDLLTADGIPYHKYCFKCSHCKGTLSMCSYSSMDGVLFCK  291

Query  316  THFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTM  495
            THFEQLFKE+G+F KNF + +   N  +K  NKY S+F GTQ+KC AC KTVYPLEK+T+
Sbjct  292  THFEQLFKETGSFKKNFPTCAKANNEQSKVPNKYGSVFCGTQDKCAACKKTVYPLEKMTL  351

Query  496  EGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAGQRKN  669
            EGE YHK+CFKC+HGGC LT A+ A+L+G+LYC++HF QLF E G+Y ++LK    KN
Sbjct  352  EGEPYHKTCFKCAHGGCILTTASCASLNGILYCQNHFWQLFKETGSYSNLLKPASAKN  409



>ref|XP_007210077.1| hypothetical protein PRUPE_ppa019584mg [Prunus persica]
 gb|EMJ11276.1| hypothetical protein PRUPE_ppa019584mg [Prunus persica]
Length=221

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT  KCKACDKTV+F+D LSADG TYH+ CFKCSHC G L MS+YSSMEGVLYCK 
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGVTYHRPCFKCSHCNGQLSMSSYSSMEGVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLF+ESG+FSK      S +  L +  +K SSMFSGT +KC  C+KTVYPLEKVTME
Sbjct  61   HFEQLFRESGSFSKKLTCGKS-QTELGRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  119

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            GE YHKSCF+C+HGGC L+ +  AALDG+LYCKHHF QLF EKG+Y H+ K A  +KN
Sbjct  120  GEFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYNHLTKTASVKKN  177


 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            FSGTQ+KC AC KTV+ +++++ +G +YH+ CFKCSH    L+ ++Y++++GVLYCK HF
Sbjct  3    FSGTQQKCKACDKTVHFIDQLSADGVTYHRPCFKCSHCNGQLSMSSYSSMEGVLYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E G++   L  G+ + +
Sbjct  63   EQLFRESGSFSKKLTCGKSQTE  84



>ref|XP_008238877.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
Length=222

 Score =   245 bits (625),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT  KCKACDKTV+F+D LSADG TYH+ CFKCSHC G L MS+YSSMEG+LYCK 
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGITYHRPCFKCSHCNGQLSMSSYSSMEGILYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLF+ESG+FSK      S +  L +  +K SSMFSGT +KC  C+KTVYPLEKVTME
Sbjct  61   HFEQLFRESGSFSKKLTCGKS-QTELGRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  119

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            GE YHKSCF+C+HGGC L+ +  AALDG+LYCKHHF QLF EKG+Y H+ K A  +KN
Sbjct  120  GEFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYNHLTKTASVKKN  177


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  427  FSGTQEKCPACSKTVYPLEKVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHF  606
            FSGTQ+KC AC KTV+ +++++ +G +YH+ CFKCSH    L+ ++Y++++G+LYCK HF
Sbjct  3    FSGTQQKCKACDKTVHFIDQLSADGITYHRPCFKCSHCNGQLSMSSYSSMEGILYCKPHF  62

Query  607  TQLFMEKGNYQHVLKAGQRKNQ  672
             QLF E G++   L  G+ + +
Sbjct  63   EQLFRESGSFSKKLTCGKSQTE  84


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT+DKC  C KTVY ++ ++ +G  YHKSCF+C+H    L  SN ++++G+LYCK HF
Sbjct  96   FSGTVDKCAVCTKTVYPLEKVTMEGEFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHF  155

Query  325  EQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEK  447
             QLFKE G+++    ++S ++N       K     SG  ++
Sbjct  156  AQLFKEKGSYNHLTKTASVKKNGAPMPETKPEEADSGKPQE  196



>ref|XP_009133751.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
Length=254

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 146/178 (82%), Gaps = 6/178 (3%)
 Frame = +1

Query  133  ERMAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYC  312
            E+M+FTGTLDKCKACDKTVY +DLL+ +G TYHK+CF+CSHC G+LV+SNYSSM+GVLYC
Sbjct  27   EKMSFTGTLDKCKACDKTVYVMDLLTLEGNTYHKNCFRCSHCNGSLVISNYSSMDGVLYC  86

Query  313  KTHFEQLFKESGNFSKNFHS---SSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLE  483
            K HFEQLFKES    K+ H+   +    + LT+A +K SS FSGT++KC  C KTVYPLE
Sbjct  87   KRHFEQLFKES---VKSLHTGGKTDKTNDQLTRAPSKLSSFFSGTRDKCATCQKTVYPLE  143

Query  484  KVTMEGESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLKAG  657
            KVTMEGE +HK+CFKC+H GC LTH++YA+L+GVLYCK HF QLF+EKG+Y +V +A 
Sbjct  144  KVTMEGECFHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQAA  201


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  145  FTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTHF  324
            F+GT DKC  C KTVY ++ ++ +G  +HK+CFKC+H    L  S+Y+S+ GVLYCK HF
Sbjct  125  FSGTRDKCATCQKTVYPLEKVTMEGECFHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHF  184

Query  325  EQLFKESGNFSKNFHSSSS  381
             QLF E G+++ N H +++
Sbjct  185  NQLFLEKGSYN-NVHQAAA  202



>ref|XP_009375790.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=222

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  139  MAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKT  318
            M+F+GT  KCKACDKTV+F+D LSADG  YHK+CFKCSHC G L MS+YSSM+ VLYCK 
Sbjct  1    MSFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDEVLYCKP  60

Query  319  HFEQLFKESGNFSKNFHSSSSRENSLTKASNKYSSMFSGTQEKCPACSKTVYPLEKVTME  498
            HFEQLFKE+G+FSK F  S   +  LT+  +K SSMFSGT +KC  C+KTVYPLEKVTME
Sbjct  61   HFEQLFKETGSFSKKFQISGKLQTELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  120

Query  499  GESYHKSCFKCSHGGCALTHATYAALDGVLYCKHHFTQLFMEKGNYQHVLK-AGQRKN  669
            G  YHKSCF+C+HGGC L+ +  AALDG+LYCKHHF QLF EKG+Y ++ + A  +KN
Sbjct  121  GAFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSYNYLTQTASLKKN  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1664082826224