BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23772_g5_i1 len=640 path=[236:0-125 8274:126-126 8275:127-234
470:235-284 4046:285-370 4132:371-582 681:583-606 705:607-639]

Length=640
                                                                      Score     E

ref|XP_009629648.1|  PREDICTED: pollen-specific protein SF3-like ...    329   6e-111   
ref|XP_009629647.1|  PREDICTED: pollen-specific protein SF3-like ...    328   1e-110   
ref|XP_009779198.1|  PREDICTED: pollen-specific protein SF3-like        327   4e-110   
ref|XP_009624529.1|  PREDICTED: pollen-specific protein SF3-like ...    318   6e-107   
ref|XP_009762983.1|  PREDICTED: pollen-specific protein SF3-like        317   3e-106   
ref|XP_011093154.1|  PREDICTED: LIM domain-containing protein PLI...    317   4e-106   
ref|XP_006341718.1|  PREDICTED: pollen-specific protein SF3-like        316   4e-106   
ref|XP_004248581.1|  PREDICTED: LIM domain-containing protein PLI...    316   7e-106   
emb|CDP08845.1|  unnamed protein product                                315   8e-106   
ref|XP_009601147.1|  PREDICTED: pollen-specific protein SF3-like        314   4e-105   
ref|XP_009762122.1|  PREDICTED: pollen-specific protein SF3-like        314   4e-105   
ref|XP_009624528.1|  PREDICTED: pollen-specific protein SF3-like ...    313   5e-105   
ref|NP_001288583.1|  uncharacterized protein LOC101266456               313   6e-105   
ref|XP_011091917.1|  PREDICTED: LIM domain-containing protein PLI...    313   1e-104   
gb|EYU35073.1|  hypothetical protein MIMGU_mgv1a013171mg                312   2e-104   
ref|XP_006339787.1|  PREDICTED: pollen-specific protein SF3-like        311   7e-104   
gb|EYU32092.1|  hypothetical protein MIMGU_mgv1a013269mg                303   1e-100   
gb|EPS71497.1|  hypothetical protein M569_03263                         303   1e-100   
ref|XP_004240106.1|  PREDICTED: LIM domain-containing protein WLI...    300   1e-99    
gb|EPS59684.1|  hypothetical protein M569_15118                         297   3e-99    
ref|XP_002269537.1|  PREDICTED: LIM domain-containing protein PLIM2c    293   7e-97    Vitis vinifera
ref|XP_002511828.1|  Pollen-specific protein SF3, putative              288   5e-95    Ricinus communis
ref|XP_008438078.1|  PREDICTED: pollen-specific protein SF3-like ...    286   3e-94    
ref|XP_010255661.1|  PREDICTED: LIM domain-containing protein PLI...    285   4e-94    
ref|XP_011035878.1|  PREDICTED: LIM domain-containing protein PLI...    285   5e-94    
ref|XP_006491462.1|  PREDICTED: pollen-specific protein SF3-like        285   9e-94    
ref|XP_011023373.1|  PREDICTED: LIM domain-containing protein PLIM2b    284   2e-93    
ref|XP_002320783.2|  LIM domain-containing family protein               283   2e-93    Populus trichocarpa [western balsam poplar]
gb|ABK58466.1|  LIM domain protein PLIM2a                               283   2e-93    Populus tremula x Populus alba [gray poplar]
ref|XP_002302574.1|  LIM domain-containing family protein               283   4e-93    Populus trichocarpa [western balsam poplar]
gb|KGN56538.1|  hypothetical protein Csa_3G122620                       283   6e-93    
ref|XP_007051870.1|  GATA type zinc finger transcription factor f...    284   1e-92    
ref|XP_010671960.1|  PREDICTED: LIM domain-containing protein PLI...    281   2e-92    
ref|XP_008438077.1|  PREDICTED: pollen-specific protein SF3-like ...    281   2e-92    
ref|XP_008438068.1|  PREDICTED: pollen-specific protein SF3-like        281   3e-92    
gb|KHG24611.1|  Pollen-specific SF3                                     280   4e-92    
ref|XP_010506557.1|  PREDICTED: LIM domain-containing protein PLIM2a    281   6e-92    
ref|XP_010508108.1|  PREDICTED: LIM domain-containing protein PLI...    281   7e-92    
ref|XP_004134333.1|  PREDICTED: pollen-specific protein SF3-like        280   7e-92    
ref|XP_010469047.1|  PREDICTED: LIM domain-containing protein PLI...    280   9e-92    
gb|KDP28657.1|  hypothetical protein JCGZ_14428                         280   1e-91    
gb|AGJ83944.1|  lim protein 4                                           280   1e-91    
ref|XP_010413443.1|  PREDICTED: LIM domain-containing protein PLI...    280   1e-91    
ref|XP_010523025.1|  PREDICTED: LIM domain-containing protein PLIM2b    279   1e-91    
ref|XP_008232792.1|  PREDICTED: pollen-specific protein SF3             280   1e-91    
ref|XP_010518219.1|  PREDICTED: LIM domain-containing protein PLI...    280   2e-91    
ref|XP_006304383.1|  hypothetical protein CARUB_v10010886mg             278   2e-91    
emb|CDY18899.1|  BnaC04g04510D                                          279   2e-91    
ref|XP_010512457.1|  PREDICTED: LIM domain-containing protein PLI...    279   3e-91    
ref|XP_009143175.1|  PREDICTED: pollen-specific protein SF3-like        279   3e-91    
ref|XP_004133874.1|  PREDICTED: pollen-specific protein SF3-like        278   4e-91    
ref|XP_002882034.1|  LIM domain-containing protein                      278   4e-91    
ref|XP_009138786.1|  PREDICTED: pollen-specific protein SF3-like ...    278   5e-91    
ref|XP_002878372.1|  LIM domain-containing protein                      278   6e-91    
ref|XP_010273176.1|  PREDICTED: LIM domain-containing protein PLIM2c    277   7e-91    
emb|CDX71757.1|  BnaC08g31170D                                          277   1e-90    
ref|XP_004306805.1|  PREDICTED: pollen-specific protein SF3-like        277   1e-90    
ref|NP_191682.2|  GATA type zinc finger transcription factor fami...    276   2e-90    Arabidopsis thaliana [mouse-ear cress]
gb|KFK37370.1|  hypothetical protein AALP_AA4G247900                    277   2e-90    
ref|XP_010474800.1|  PREDICTED: LIM domain-containing protein PLI...    276   2e-90    
ref|XP_006418457.1|  hypothetical protein EUTSA_v10008789mg             276   3e-90    
ref|XP_010469046.1|  PREDICTED: LIM domain-containing protein PLI...    276   3e-90    
ref|XP_010479778.1|  PREDICTED: LIM domain-containing protein PLIM2b    276   3e-90    
ref|XP_010413441.1|  PREDICTED: LIM domain-containing protein PLI...    276   3e-90    
ref|XP_006402504.1|  hypothetical protein EUTSA_v10006235mg             276   3e-90    
ref|XP_010512456.1|  PREDICTED: LIM domain-containing protein PLI...    275   7e-90    
ref|XP_006397773.1|  hypothetical protein EUTSA_v10001618mg             275   1e-89    
emb|CDY27358.1|  BnaC04g50470D                                          275   1e-89    
gb|ABL74496.1|  LIM domain protein PLIM2b                               273   1e-89    Populus tremula x Populus alba [gray poplar]
ref|XP_006296425.1|  hypothetical protein CARUB_v10025604mg             275   2e-89    
emb|CDY56926.1|  BnaAnng14450D                                          274   2e-89    
ref|XP_009116783.1|  PREDICTED: pollen-specific protein SF3             274   2e-89    
ref|XP_009138785.1|  PREDICTED: pollen-specific protein SF3-like ...    274   2e-89    
ref|XP_010055180.1|  PREDICTED: pollen-specific protein SF3-like        274   2e-89    
ref|XP_010054850.1|  PREDICTED: pollen-specific protein SF3-like        274   2e-89    
ref|XP_002892043.1|  LIM domain-containing protein                      273   2e-89    
emb|CDY37066.1|  BnaA04g26440D                                          274   2e-89    
ref|NP_182104.1|  protein PLIM2A                                        274   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142366.1|  PREDICTED: pollen-specific protein SF3-like        274   3e-89    
ref|XP_006292212.1|  hypothetical protein CARUB_v10018418mg             273   6e-89    
gb|KFK35322.1|  hypothetical protein AALP_AA5G269200                    272   8e-89    
ref|NP_171683.1|  LIM family protein                                    271   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521910.2|  PREDICTED: pollen-specific protein SF3-like        270   5e-88    
gb|KEH18910.1|  GATA type zinc finger transcription factor family...    270   5e-88    
ref|XP_010107618.1|  Pollen-specific protein SF3                        270   6e-88    
emb|CDY38028.1|  BnaCnng08890D                                          270   6e-88    
gb|AAF78411.1|AC009273_17  Contains similarity to mRNA for transc...    272   6e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237551.1|  uncharacterized protein LOC100305845               270   7e-88    
ref|XP_009118834.1|  PREDICTED: pollen-specific protein SF3             270   8e-88    
ref|XP_008337059.1|  PREDICTED: pollen-specific protein SF3-like        270   9e-88    
ref|XP_003623892.1|  LIM domain protein 2b                              269   1e-87    
ref|XP_009119735.1|  PREDICTED: pollen-specific protein SF3-like        269   1e-87    
emb|CDY01571.1|  BnaC07g35610D                                          268   2e-87    
emb|CDY15152.1|  BnaC05g00310D                                          268   2e-87    
emb|CAB71053.1|  LIM domain protein                                     268   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008376025.1|  PREDICTED: pollen-specific protein SF3-like        269   2e-87    
gb|KFK35321.1|  hypothetical protein AALP_AA5G269200                    268   3e-87    
ref|XP_007139894.1|  hypothetical protein PHAVU_008G067500g             267   8e-87    
ref|XP_007218397.1|  hypothetical protein PRUPE_ppa011395mg             267   9e-87    
ref|XP_010523732.1|  PREDICTED: LIM domain-containing protein PLI...    267   2e-86    
gb|KHG00940.1|  Pollen-specific SF3                                     265   3e-86    
ref|XP_006827708.1|  hypothetical protein AMTR_s00009p00259550          265   3e-86    
ref|XP_004510816.1|  PREDICTED: pollen-specific protein SF3-like        265   4e-86    
gb|AFK33321.1|  unknown                                                 264   1e-85    
ref|XP_007135027.1|  hypothetical protein PHAVU_010G095700g             264   2e-85    
ref|XP_003551659.1|  PREDICTED: pollen-specific protein SF3-like        263   2e-85    
ref|XP_010544715.1|  PREDICTED: LIM domain-containing protein PLI...    263   5e-85    
ref|XP_009397610.1|  PREDICTED: pollen-specific protein SF3-like        262   7e-85    
ref|XP_003533616.1|  PREDICTED: pollen-specific protein SF3-like        262   9e-85    
gb|KHN29376.1|  Pollen-specific protein SF3                             262   1e-84    
ref|XP_007135026.1|  hypothetical protein PHAVU_010G095700g             262   1e-84    
ref|XP_010089139.1|  Pollen-specific protein SF3                        268   2e-84    
ref|XP_010544716.1|  PREDICTED: LIM domain-containing protein PLI...    259   2e-83    
ref|XP_004492709.1|  PREDICTED: pollen-specific protein SF3-like        259   2e-83    
gb|ACN26203.1|  unknown                                                 258   2e-83    Zea mays [maize]
ref|XP_009340168.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    259   3e-83    
ref|XP_009402055.1|  PREDICTED: pollen-specific protein SF3-like        258   3e-83    
gb|KHG27160.1|  Pollen-specific SF3                                     256   6e-83    
emb|CDX76073.1|  BnaA04g03370D                                          259   1e-82    
emb|CDX72203.1|  BnaC08g26710D                                          256   1e-82    
emb|CDY27267.1|  BnaA09g35350D                                          256   1e-82    
ref|XP_011022732.1|  PREDICTED: LIM domain-containing protein WLI...    256   1e-82    
ref|XP_004150238.1|  PREDICTED: pollen-specific protein SF3-like ...    256   1e-82    
ref|XP_007009106.1|  GATA type zinc finger transcription factor f...    255   2e-82    
ref|XP_009404566.1|  PREDICTED: pollen-specific protein SF3-like        255   2e-82    
ref|XP_009116276.1|  PREDICTED: pollen-specific protein SF3             256   2e-82    
gb|EMT25782.1|  Pollen-specific protein SF3                             256   2e-82    
ref|NP_001140551.1|  uncharacterized LOC100272616                       256   2e-82    Zea mays [maize]
ref|XP_008777895.1|  PREDICTED: pollen-specific protein SF3-like        256   2e-82    
ref|XP_008796793.1|  PREDICTED: pollen-specific protein SF3-like        256   2e-82    
ref|XP_006647592.1|  PREDICTED: pollen-specific protein SF3-like        256   2e-82    
emb|CDY02959.1|  BnaC04g25270D                                          258   2e-82    
ref|XP_010256708.1|  PREDICTED: LIM domain-containing protein WLI...    254   4e-82    
ref|NP_001047550.1|  Os02g0641000                                       255   4e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006445094.1|  hypothetical protein CICLE_v10022448mg             254   5e-82    
ref|NP_001132843.1|  uncharacterized LOC100194335                       254   6e-82    Zea mays [maize]
ref|XP_010907367.1|  PREDICTED: LIM domain-containing protein WLI...    254   7e-82    
ref|XP_009139138.1|  PREDICTED: pollen-specific protein SF3-like        254   7e-82    
ref|XP_004953255.1|  PREDICTED: pollen-specific protein SF3-like        254   8e-82    
ref|NP_001241110.1|  uncharacterized protein LOC100809121               254   9e-82    
gb|KHN17859.1|  Pollen-specific protein SF3                             254   9e-82    
ref|XP_003538442.1|  PREDICTED: pollen-specific protein SF3-like ...    254   1e-81    
ref|XP_010093495.1|  Pollen-specific protein SF3                        253   1e-81    
ref|XP_008392904.1|  PREDICTED: pollen-specific protein SF3-like ...    253   1e-81    
ref|XP_002452860.1|  hypothetical protein SORBIDRAFT_04g033700          253   1e-81    Sorghum bicolor [broomcorn]
ref|XP_008463203.1|  PREDICTED: pollen-specific protein SF3-like        253   1e-81    
ref|XP_009391810.1|  PREDICTED: pollen-specific protein SF3-like        253   1e-81    
ref|XP_009421306.1|  PREDICTED: pollen-specific protein SF3-like        253   1e-81    
emb|CDY20498.1|  BnaC04g05460D                                          253   1e-81    
ref|XP_009344420.1|  PREDICTED: pollen-specific protein SF3-like        253   1e-81    
ref|XP_008381875.1|  PREDICTED: pollen-specific protein SF3-like        253   1e-81    
ref|XP_006411232.1|  hypothetical protein EUTSA_v10017249mg             253   2e-81    
ref|XP_009143273.1|  PREDICTED: pollen-specific protein SF3             253   2e-81    
ref|XP_004167859.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    253   2e-81    
gb|ABK22125.1|  unknown                                                 253   2e-81    Picea sitchensis
ref|XP_010905119.1|  PREDICTED: LIM domain-containing protein WLI...    253   3e-81    
ref|XP_010554627.1|  PREDICTED: LIM domain-containing protein WLIM2b    252   3e-81    
gb|AGJ83942.1|  lim protein 2                                           252   3e-81    
ref|XP_007163504.1|  hypothetical protein PHAVU_001G239700g             252   4e-81    
ref|XP_004307607.1|  PREDICTED: pollen-specific protein SF3-like        252   4e-81    
gb|AAF75284.1|AF116850_1  LIM domain protein PLIM-2                     253   4e-81    Helianthus annuus
ref|XP_010505685.1|  PREDICTED: LIM domain-containing protein WLI...    252   4e-81    
ref|XP_006403418.1|  hypothetical protein EUTSA_v10010740mg             252   5e-81    
ref|XP_008392902.1|  PREDICTED: pollen-specific protein SF3-like ...    251   6e-81    
ref|XP_002279922.1|  PREDICTED: LIM domain-containing protein WLIM2b    251   7e-81    Vitis vinifera
ref|XP_004138434.1|  PREDICTED: pollen-specific protein SF3-like        251   7e-81    
ref|XP_007218461.1|  hypothetical protein PRUPE_ppa011869mg             251   8e-81    
ref|XP_003580212.1|  PREDICTED: LIM domain-containing protein PLI...    251   8e-81    
ref|XP_006295906.1|  hypothetical protein CARUB_v10025036mg             251   8e-81    
gb|AII80545.1|  LIM-domain protein 11                                   252   9e-81    
ref|XP_002879831.1|  LIM domain-containing protein                      251   1e-80    
gb|KHG24101.1|  Pollen-specific SF3                                     252   1e-80    
gb|AGJ83945.1|  lim protein 5                                           251   1e-80    
ref|XP_003544136.1|  PREDICTED: pollen-specific protein SF3 isofo...    251   1e-80    
ref|XP_007009108.1|  GATA type zinc finger transcription factor f...    251   1e-80    
dbj|BAK04207.1|  predicted protein                                      251   1e-80    
ref|XP_008677533.1|  PREDICTED: uncharacterized LOC100381874 isof...    251   2e-80    
ref|XP_010517368.1|  PREDICTED: LIM domain-containing protein WLIM2a    251   2e-80    
ref|XP_003569963.1|  PREDICTED: LIM domain-containing protein WLI...    251   2e-80    
ref|XP_006652565.1|  PREDICTED: pollen-specific protein SF3-like        250   2e-80    
emb|CBI40313.3|  unnamed protein product                                250   2e-80    
ref|XP_002448228.1|  hypothetical protein SORBIDRAFT_06g023600          250   2e-80    Sorghum bicolor [broomcorn]
dbj|BAK06966.1|  predicted protein                                      250   3e-80    
gb|KDP44835.1|  hypothetical protein JCGZ_01335                         249   3e-80    
ref|XP_010508950.1|  PREDICTED: LIM domain-containing protein WLI...    250   3e-80    
ref|NP_181519.1|  protein WLIM2A                                        249   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011076748.1|  PREDICTED: LIM domain-containing protein WLIM2b    249   4e-80    
emb|CDY68273.1|  BnaAnng26690D                                          250   4e-80    
ref|XP_008374043.1|  PREDICTED: pollen-specific protein SF3-like        250   4e-80    
gb|EYU19976.1|  hypothetical protein MIMGU_mgv1a014151mg                249   5e-80    
ref|XP_009133391.1|  PREDICTED: pollen-specific protein SF3-like        249   5e-80    
emb|CDY24943.1|  BnaC03g22290D                                          249   5e-80    
ref|XP_002315180.1|  LIM domain-containing family protein               249   5e-80    Populus trichocarpa [western balsam poplar]
gb|ACX47456.1|  LIM1                                                    249   6e-80    Hevea brasiliensis [jebe]
ref|XP_010067487.1|  PREDICTED: pollen-specific protein SF3             249   6e-80    
emb|CDX95666.1|  BnaC03g25470D                                          250   7e-80    
ref|XP_009369042.1|  PREDICTED: pollen-specific protein SF3-like        249   7e-80    
emb|CDY60999.1|  BnaA03g56620D                                          249   7e-80    
ref|XP_009389159.1|  PREDICTED: pollen-specific protein SF3-like        249   7e-80    
ref|XP_010534537.1|  PREDICTED: LIM domain-containing protein WLI...    249   8e-80    
gb|ABK58469.1|  LIM domain protein WLIM2a                               248   1e-79    Populus tremula x Populus alba [gray poplar]
ref|XP_006435557.1|  hypothetical protein CICLE_v10032838mg             248   1e-79    
ref|XP_009587504.1|  PREDICTED: pollen-specific protein SF3-like        248   1e-79    
ref|XP_009387955.1|  PREDICTED: pollen-specific protein SF3-like        248   1e-79    
ref|XP_007009107.1|  GATA type zinc finger transcription factor f...    248   2e-79    
ref|XP_009133751.1|  PREDICTED: pollen-specific protein SF3-like        250   2e-79    
gb|AFK39062.1|  unknown                                                 248   2e-79    
ref|XP_002530411.1|  Pollen-specific protein SF3, putative              247   2e-79    Ricinus communis
ref|NP_001053405.1|  Os04g0532500                                       248   3e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007009110.1|  GATA type zinc finger transcription factor f...    247   3e-79    
ref|XP_007040178.1|  GATA type zinc finger transcription factor f...    248   3e-79    
ref|XP_010928941.1|  PREDICTED: LIM domain-containing protein WLI...    247   3e-79    
gb|KHG07853.1|  Pollen-specific SF3                                     247   3e-79    
ref|XP_006848064.1|  hypothetical protein AMTR_s00029p00199510          247   4e-79    
ref|XP_002876333.1|  LIM domain-containing protein                      247   4e-79    
emb|CBL95262.1|  lim domain protein                                     246   5e-79    
ref|XP_004976341.1|  PREDICTED: pollen-specific protein SF3-like ...    247   6e-79    
ref|XP_011029226.1|  PREDICTED: LIM domain-containing protein WLI...    247   6e-79    
ref|NP_191136.1|  actin bundler LIM family protein WLIM2b               246   7e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503222.1|  PREDICTED: pollen-specific protein SF3-like ...    246   8e-79    
ref|XP_002304483.2|  hypothetical protein POPTR_0003s12440g             246   9e-79    Populus trichocarpa [western balsam poplar]
ref|XP_004239928.1|  PREDICTED: LIM domain-containing protein WLI...    245   1e-78    
ref|XP_002312139.1|  LIM domain-containing family protein               245   2e-78    Populus trichocarpa [western balsam poplar]
dbj|BAH20111.1|  AT3G55770                                              245   3e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003600847.1|  LIM domain-containing protein                      244   3e-78    
ref|XP_009602682.1|  PREDICTED: pollen-specific protein SF3-like        244   3e-78    
ref|XP_011040324.1|  PREDICTED: LIM domain-containing protein WLI...    244   3e-78    
ref|XP_008798954.1|  PREDICTED: pollen-specific protein SF3-like        244   3e-78    
gb|KDP25467.1|  hypothetical protein JCGZ_20623                         245   4e-78    
ref|XP_003574155.1|  PREDICTED: LIM domain-containing protein PLI...    244   6e-78    
gb|AFK34184.1|  unknown                                                 243   7e-78    
ref|XP_010923152.1|  PREDICTED: LIM domain-containing protein WLI...    243   7e-78    
ref|XP_008392559.1|  PREDICTED: pollen-specific protein SF3-like        244   8e-78    
ref|XP_002283482.1|  PREDICTED: LIM domain-containing protein WLIM2a    244   1e-77    Vitis vinifera
ref|XP_010427370.1|  PREDICTED: LIM domain-containing protein WLIM2b    243   1e-77    
ref|XP_010516165.1|  PREDICTED: LIM domain-containing protein WLI...    243   1e-77    
ref|XP_010504446.1|  PREDICTED: LIM domain-containing protein WLI...    243   1e-77    
gb|ABK94608.1|  unknown                                                 243   2e-77    Populus trichocarpa [western balsam poplar]
ref|XP_011072367.1|  PREDICTED: LIM domain-containing protein WLI...    242   4e-77    
gb|AAL38006.1|AF443117_1  LIM domain protein                            241   6e-77    Gossypium hirsutum [American cotton]
ref|XP_004982687.1|  PREDICTED: pollen-specific protein SF3-like        241   2e-76    
ref|XP_009375790.1|  PREDICTED: pollen-specific protein SF3-like        241   2e-76    
ref|XP_007210077.1|  hypothetical protein PRUPE_ppa019584mg             240   3e-76    
ref|XP_006477522.1|  PREDICTED: pollen-specific protein SF3-like        240   4e-76    
ref|XP_008238877.1|  PREDICTED: pollen-specific protein SF3-like        240   6e-76    
ref|XP_008785448.1|  PREDICTED: pollen-specific protein SF3-like        238   8e-76    
ref|XP_002509768.1|  Pollen-specific protein SF3, putative              239   8e-76    Ricinus communis
dbj|BAJ86406.1|  predicted protein                                      239   1e-75    
gb|KDO76132.1|  hypothetical protein CISIN_1g041875mg                   238   1e-75    
emb|CAA62744.1|  transcription factor L2                                236   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|EAY79118.1|  hypothetical protein OsI_34224                          238   5e-75    Oryza sativa Indica Group [Indian rice]
ref|NP_001064995.1|  Os10g0503100                                       238   5e-75    Oryza sativa Japonica Group [Japonica rice]
gb|EPS58831.1|  hypothetical protein M569_15983                         235   1e-74    
ref|XP_010053293.1|  PREDICTED: pollen-specific protein SF3-like        236   1e-74    
ref|XP_006661927.1|  PREDICTED: pollen-specific protein SF3-like        236   2e-74    
ref|XP_010690195.1|  PREDICTED: LIM domain-containing protein WLIM2b    235   2e-74    
ref|XP_004976340.1|  PREDICTED: pollen-specific protein SF3-like ...    236   5e-74    
gb|KHG08337.1|  Pollen-specific SF3                                     234   1e-73    
ref|XP_006291888.1|  hypothetical protein CARUB_v10018065mg             232   2e-73    
ref|XP_011029229.1|  PREDICTED: LIM domain-containing protein WLI...    233   2e-73    
emb|CDY45697.1|  BnaCnng13620D                                          231   2e-73    
ref|XP_003524464.1|  PREDICTED: pollen-specific protein SF3             233   2e-73    
ref|NP_001147673.1|  pollen-specific protein SF3                        232   2e-73    Zea mays [maize]
ref|XP_002468127.1|  hypothetical protein SORBIDRAFT_01g040050          232   3e-73    Sorghum bicolor [broomcorn]
ref|NP_001049655.1|  Os03g0266100                                       232   3e-73    Oryza sativa Japonica Group [Japonica rice]
dbj|BAM13335.1|  LIM domain-containing protein                          231   5e-73    
dbj|BAM13338.1|  LIM domain-containing protein                          231   9e-73    
dbj|BAM13341.1|  LIM domain-containing protein                          231   9e-73    
dbj|BAM13339.1|  LIM domain-containing protein                          231   9e-73    
ref|XP_004984674.1|  PREDICTED: pollen-specific protein SF3-like        231   1e-72    
dbj|BAM13340.1|  LIM domain-containing protein                          230   1e-72    
gb|KCW77560.1|  hypothetical protein EUGRSUZ_D01873                     230   2e-72    
ref|XP_006649807.1|  PREDICTED: pollen-specific protein SF3-like        229   2e-72    
gb|EPS67160.1|  hypothetical protein M569_07616                         229   3e-72    
gb|EMS55690.1|  Pollen-specific protein SF3                             237   3e-72    
gb|AGJ83943.1|  lim protein 3                                           230   4e-72    
ref|XP_004503760.1|  PREDICTED: pollen-specific protein SF3-like        229   8e-72    
gb|EYU38365.1|  hypothetical protein MIMGU_mgv1a014348mg                228   9e-72    
ref|XP_003532407.1|  PREDICTED: pollen-specific protein SF3             229   1e-71    
ref|XP_009785548.1|  PREDICTED: pollen-specific protein SF3-like        228   1e-71    
ref|NP_001190099.1|  actin bundler LIM family protein WLIM2b            228   2e-71    
ref|XP_009400630.1|  PREDICTED: pollen-specific protein SF3-like        226   3e-71    
ref|XP_010676493.1|  PREDICTED: LIM domain-containing protein WLI...    226   7e-71    
ref|XP_009628860.1|  PREDICTED: pollen-specific protein SF3-like        226   9e-71    
ref|XP_006439594.1|  hypothetical protein CICLE_v10023761mg             226   1e-70    
gb|EYU29736.1|  hypothetical protein MIMGU_mgv1a014022mg                225   1e-70    
ref|XP_011080992.1|  PREDICTED: LIM domain-containing protein WLI...    224   5e-70    
gb|ACU13968.1|  unknown                                                 222   1e-69    
ref|XP_002969252.1|  hypothetical protein SELMODRAFT_146291             221   3e-69    
emb|CDP09772.1|  unnamed protein product                                221   6e-69    
ref|XP_002960609.1|  hypothetical protein SELMODRAFT_229974             220   9e-69    
ref|XP_001765937.1|  predicted protein                                  219   2e-68    
gb|KEH21040.1|  GATA type zinc finger transcription factor family...    219   4e-68    
gb|ABK22236.1|  unknown                                                 218   1e-67    
ref|XP_006352311.1|  PREDICTED: pollen-specific protein SF3-like        218   1e-67    
emb|CDP14069.1|  unnamed protein product                                218   2e-67    
ref|XP_009766754.1|  PREDICTED: pollen-specific protein SF3-like        216   4e-67    
gb|KHG14411.1|  Pollen-specific SF3                                     216   8e-67    
ref|XP_001771340.1|  predicted protein                                  214   2e-66    
gb|ACA33841.1|  LIM2 transcription factor                               213   3e-66    
gb|ABK23670.1|  unknown                                                 214   4e-66    
ref|XP_009786244.1|  PREDICTED: pollen-specific protein SF3-like        213   6e-66    
ref|XP_002965335.1|  hypothetical protein SELMODRAFT_143123             213   8e-66    
ref|XP_009610583.1|  PREDICTED: pollen-specific protein SF3-like ...    212   1e-65    
gb|EMT19855.1|  Pollen-specific protein SF3                             213   2e-65    
ref|XP_011030325.1|  PREDICTED: LIM domain-containing protein WLI...    211   4e-65    
ref|XP_010687903.1|  PREDICTED: LIM domain-containing protein WLIM1     211   5e-65    
ref|XP_002298780.2|  hypothetical protein POPTR_0001s30020g             211   7e-65    
ref|XP_009610584.1|  PREDICTED: pollen-specific protein SF3-like ...    210   1e-64    
gb|ABK94586.1|  unknown                                                 210   1e-64    
ref|XP_008793824.1|  PREDICTED: pollen-specific protein SF3-like ...    211   1e-64    
emb|CDP17006.1|  unnamed protein product                                210   1e-64    
ref|XP_004245622.1|  PREDICTED: LIM domain-containing protein WLI...    209   2e-64    
ref|XP_004136935.1|  PREDICTED: pollen-specific protein SF3-like        209   2e-64    
ref|XP_007209651.1|  hypothetical protein PRUPE_ppa012024mg             209   2e-64    
ref|XP_010322559.1|  PREDICTED: LIM domain-containing protein WLIM1     209   2e-64    
ref|XP_010272870.1|  PREDICTED: LIM domain-containing protein WLI...    209   2e-64    
ref|XP_011002116.1|  PREDICTED: LIM domain-containing protein WLI...    209   2e-64    
ref|XP_011028613.1|  PREDICTED: LIM domain-containing protein WLI...    209   3e-64    
ref|XP_004299580.1|  PREDICTED: pollen-specific protein SF3-like        209   3e-64    
gb|ABK58464.1|  LIM domain protein GLIM1a                               209   3e-64    
ref|NP_001238580.1|  uncharacterized protein LOC100499957               209   4e-64    
ref|XP_011087164.1|  PREDICTED: LIM domain-containing protein WLI...    208   4e-64    
gb|ABK58465.1|  LIM domain protein GLIM1b                               208   4e-64    
ref|XP_002313186.2|  hypothetical protein POPTR_0009s09040g             208   5e-64    
ref|XP_010272036.1|  PREDICTED: LIM domain-containing protein WLI...    207   6e-64    
ref|XP_004289780.1|  PREDICTED: pollen-specific protein SF3-like        208   7e-64    
ref|XP_009590601.1|  PREDICTED: pollen-specific protein SF3-like        208   7e-64    
ref|XP_004250748.1|  PREDICTED: LIM domain-containing protein WLI...    208   7e-64    
ref|NP_001238190.1|  uncharacterized protein LOC100500444               207   8e-64    
ref|NP_001235758.1|  uncharacterized protein LOC100305720               208   8e-64    
ref|XP_006345025.1|  PREDICTED: pollen-specific protein SF3-like        207   8e-64    
gb|KHN16307.1|  Pollen-specific protein SF3                             207   8e-64    
gb|KHN04435.1|  Pollen-specific protein SF3                             207   1e-63    
gb|AGJ83946.1|  lim protein 6                                           207   1e-63    
ref|NP_001238429.1|  uncharacterized protein LOC100499947               207   1e-63    
gb|KHN36972.1|  Pollen-specific protein SF3                             207   1e-63    
ref|XP_002321571.1|  hypothetical protein POPTR_0015s08360g             207   2e-63    
ref|XP_007136766.1|  hypothetical protein PHAVU_009G072200g             207   2e-63    
gb|KHN19331.1|  Pollen-specific protein SF3                             207   2e-63    
ref|XP_002511450.1|  Pollen-specific protein SF3, putative              206   2e-63    
ref|XP_009803543.1|  PREDICTED: pollen-specific protein SF3-like        206   2e-63    
ref|XP_003558280.1|  PREDICTED: LIM domain-containing protein WLI...    207   2e-63    
ref|XP_004236135.1|  PREDICTED: LIM domain-containing protein WLIM1     206   2e-63    
gb|KDP31140.1|  hypothetical protein JCGZ_11516                         206   3e-63    
ref|XP_002283525.1|  PREDICTED: LIM domain-containing protein WLIM1     206   3e-63    
gb|ABK95336.1|  unknown                                                 206   3e-63    
ref|XP_007160919.1|  hypothetical protein PHAVU_001G028200g             206   3e-63    
ref|NP_001237652.1|  uncharacterized protein LOC100527547               206   5e-63    
ref|XP_006857164.1|  hypothetical protein AMTR_s00065p00168710          206   5e-63    
ref|XP_010928557.1|  PREDICTED: LIM domain-containing protein WLI...    207   6e-63    
ref|XP_006595535.1|  PREDICTED: uncharacterized protein LOC100527...    206   6e-63    
gb|AFK47041.1|  unknown                                                 206   6e-63    
gb|AFK42495.1|  unknown                                                 206   6e-63    
ref|XP_007138113.1|  hypothetical protein PHAVU_009G181200g             205   7e-63    
ref|XP_007042657.1|  GATA type zinc finger transcription factor f...    205   8e-63    
ref|XP_007201308.1|  hypothetical protein PRUPE_ppa011881mg             205   8e-63    
ref|XP_011044348.1|  PREDICTED: LIM domain-containing protein WLI...    205   9e-63    
ref|XP_006352087.1|  PREDICTED: pollen-specific protein SF3-like        205   9e-63    
ref|XP_010254782.1|  PREDICTED: LIM domain-containing protein WLI...    205   1e-62    
ref|NP_001235271.1|  uncharacterized protein LOC100500501               205   1e-62    
ref|XP_004498991.1|  PREDICTED: pollen-specific protein SF3-like        205   1e-62    
ref|XP_002318024.1|  hypothetical protein POPTR_0012s07870g             204   1e-62    
ref|XP_010544006.1|  PREDICTED: LIM domain-containing protein WLIM1     204   2e-62    
ref|XP_010548517.1|  PREDICTED: LIM domain-containing protein WLI...    204   2e-62    
gb|AII80541.1|  LIM-domain protein 7                                    204   2e-62    
ref|XP_010027995.1|  PREDICTED: pollen-specific protein SF3-like        204   2e-62    
gb|AAF13231.1|  pollen specific LIM domain protein 1a                   204   2e-62    
ref|XP_010678700.1|  PREDICTED: LIM domain-containing protein WLI...    205   2e-62    
ref|XP_006439752.1|  hypothetical protein CICLE_v10022413mg             204   3e-62    
gb|ABL74498.1|  LIM domain protein BLIM2b                               201   4e-62    
gb|AAX95760.2|  Pollen-specific protein SF3, putative                   203   5e-62    
ref|XP_008393059.1|  PREDICTED: pollen-specific protein SF3-like        203   5e-62    
ref|NP_001148027.1|  pollen-specific protein SF3                        203   6e-62    
ref|XP_009766668.1|  PREDICTED: pollen-specific protein SF3-like        202   7e-62    
ref|XP_008364385.1|  PREDICTED: pollen-specific protein SF3-like        203   7e-62    
ref|XP_007036121.1|  GATA type zinc finger transcription factor f...    202   9e-62    
ref|XP_004138126.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-61    
gb|AAD02543.1|  PGPS/D1                                                 202   1e-61    
ref|XP_009408124.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-61    
ref|XP_008453121.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-61    
ref|XP_008236308.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-61    
ref|XP_009606069.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-61    
ref|XP_006422808.1|  hypothetical protein CICLE_v10029316mg             202   1e-61    
ref|XP_008374471.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-61    
dbj|BAO02514.1|  predicted LIM domain-containing protein ortholog       202   2e-61    
ref|XP_004962903.1|  PREDICTED: pollen-specific protein SF3-like        202   2e-61    
ref|XP_003550749.1|  PREDICTED: pollen-specific protein SF3-like        202   2e-61    
ref|XP_011071800.1|  PREDICTED: LIM domain-containing protein WLI...    201   3e-61    
ref|XP_010037591.1|  PREDICTED: pollen-specific protein SF3-like ...    201   3e-61    
ref|NP_001031545.1|  protein PLIM2A                                     201   3e-61    
emb|CDO97286.1|  unnamed protein product                                201   4e-61    
ref|XP_006836719.1|  hypothetical protein AMTR_s00088p00121090          201   4e-61    
emb|CDP01275.1|  unnamed protein product                                201   4e-61    
gb|EYU39077.1|  hypothetical protein MIMGU_mgv1a014557mg                201   4e-61    
ref|XP_002285355.1|  PREDICTED: LIM domain-containing protein WLIM1     201   4e-61    
ref|XP_002266499.1|  PREDICTED: LIM domain-containing protein WLIM1     201   5e-61    
gb|ACU17588.1|  unknown                                                 199   5e-61    
ref|XP_010091018.1|  Pollen-specific protein SF3                        201   5e-61    
ref|XP_002442217.1|  hypothetical protein SORBIDRAFT_08g016450          201   5e-61    
ref|XP_010913501.1|  PREDICTED: LIM domain-containing protein WLI...    201   6e-61    
ref|XP_008648273.1|  PREDICTED: LOC541782 isoform X1                    200   7e-61    
ref|XP_011092491.1|  PREDICTED: LIM domain-containing protein WLI...    200   7e-61    
ref|XP_009414770.1|  PREDICTED: pollen-specific protein SF3-like        200   1e-60    
ref|XP_008811666.1|  PREDICTED: pollen-specific protein SF3             200   1e-60    
ref|XP_003589058.1|  Transcription factor lim1                          199   1e-60    
ref|XP_003576026.1|  PREDICTED: LIM domain-containing protein WLIM1     199   1e-60    
ref|XP_002532425.1|  Cysteine and glycine-rich protein, putative        199   1e-60    
ref|XP_007018479.1|  GATA type zinc finger transcription factor f...    199   1e-60    
gb|ABW69660.1|  transcription factor LIM                                199   2e-60    
ref|XP_004508840.1|  PREDICTED: pollen-specific protein SF3-like        199   2e-60    
ref|XP_007155394.1|  hypothetical protein PHAVU_003G197600g             199   2e-60    
gb|EYU25518.1|  hypothetical protein MIMGU_mgv1a014425mg                199   2e-60    
ref|XP_004290976.1|  PREDICTED: pollen-specific protein SF3-like        199   2e-60    
ref|XP_011074349.1|  PREDICTED: LIM domain-containing protein WLIM1     199   3e-60    
ref|XP_009148339.1|  PREDICTED: pollen-specific protein SF3             198   3e-60    
ref|XP_010942770.1|  PREDICTED: LIM domain-containing protein WLI...    199   3e-60    
emb|CDX94916.1|  BnaC05g07550D                                          198   3e-60    
ref|XP_004141291.1|  PREDICTED: pollen-specific protein SF3-like        198   3e-60    
ref|XP_008452649.1|  PREDICTED: pollen-specific protein SF3-like ...    198   3e-60    
ref|XP_010028358.1|  PREDICTED: pollen-specific protein SF3-like        198   3e-60    
gb|KHG14633.1|  Pollen-specific SF3                                     198   3e-60    
gb|AII80542.1|  LIM-domain protein 8                                    198   4e-60    
ref|XP_010274389.1|  PREDICTED: LIM domain-containing protein WLI...    198   5e-60    
ref|XP_009415386.1|  PREDICTED: pollen-specific protein SF3-like        198   5e-60    
gb|ACG34183.1|  pollen-specific protein SF3                             198   5e-60    
ref|XP_008220373.1|  PREDICTED: pollen-specific protein SF3-like        198   6e-60    
ref|XP_004501516.1|  PREDICTED: pollen-specific protein SF3-like        197   7e-60    
ref|XP_010938994.1|  PREDICTED: LIM domain-containing protein WLI...    197   7e-60    
gb|EYU29934.1|  hypothetical protein MIMGU_mgv1a014656mg                197   7e-60    
dbj|BAJ94823.1|  predicted protein                                      197   8e-60    
ref|XP_007143127.1|  hypothetical protein PHAVU_007G046100g             197   9e-60    
dbj|BAM05591.1|  LIM transcription factor                               197   1e-59    
gb|AAD56957.1|AF187103_1  LIM domain protein PLIM1b                     198   1e-59    
ref|XP_006664058.1|  PREDICTED: pollen-specific protein SF3-like        197   1e-59    
ref|XP_002892554.1|  hypothetical protein ARALYDRAFT_471134             197   1e-59    
ref|XP_010059807.1|  PREDICTED: pollen-specific protein SF3-like        197   1e-59    
sp|P29675.1|SF3_HELAN  RecName: Full=Pollen-specific protein SF3        198   1e-59    
ref|NP_001104937.2|  LOC541782                                          197   1e-59    
gb|AFV60741.1|  LIM domain protein LIM-2                                197   1e-59    
ref|NP_172491.1|  transcription factor lim1                             197   1e-59    
ref|XP_006304225.1|  hypothetical protein CARUB_v10010373mg             197   1e-59    
ref|XP_009144466.1|  PREDICTED: pollen-specific protein SF3-like        197   1e-59    
gb|EYU42534.1|  hypothetical protein MIMGU_mgv1a021971mg                196   2e-59    
gb|AGE09578.1|  LIM-like protein                                        197   2e-59    
ref|XP_010111544.1|  Pollen-specific protein SF3                        197   2e-59    
ref|XP_007225874.1|  hypothetical protein PRUPE_ppa011761mg             197   2e-59    
ref|XP_010490782.1|  PREDICTED: LIM domain-containing protein WLIM1     196   2e-59    
ref|XP_010458355.1|  PREDICTED: LIM domain-containing protein WLI...    196   2e-59    
ref|XP_010475882.1|  PREDICTED: LIM domain-containing protein WLI...    196   2e-59    
ref|XP_003525489.1|  PREDICTED: pollen-specific protein SF3-like        197   2e-59    
ref|XP_003608956.1|  LIM domain protein                                 196   2e-59    
gb|ABK93551.1|  unknown                                                 196   3e-59    
gb|ABA99040.1|  Pollen-specific protein SF3, putative, expressed        196   3e-59    
ref|XP_002302405.2|  hypothetical protein POPTR_0002s11880g             196   3e-59    
ref|XP_006433641.1|  hypothetical protein CICLE_v10002540mg             196   3e-59    
gb|ABY21316.1|  LIM1                                                    196   3e-59    
ref|XP_007036120.1|  GATA type zinc finger transcription factor f...    196   4e-59    
gb|AAD56959.1|AF187105_1  LIM domain protein WLIM1                      196   4e-59    
ref|XP_004501954.1|  PREDICTED: pollen-specific protein SF3-like        196   4e-59    
gb|AAD39103.1|AF116849_1  LIM domain protein WLIM-1                     195   5e-59    
ref|XP_006417487.1|  hypothetical protein EUTSA_v10008856mg             195   5e-59    
gb|KFK43312.1|  hypothetical protein AALP_AA1G108000                    195   5e-59    
ref|XP_010061652.1|  PREDICTED: pollen-specific protein SF3-like        195   5e-59    
dbj|BAM05589.1|  LIM transcription factor                               195   6e-59    
ref|XP_010923153.1|  PREDICTED: LIM domain-containing protein WLI...    194   6e-59    
ref|XP_001764074.1|  predicted protein                                  196   6e-59    
emb|CDY20647.1|  BnaC08g14110D                                          195   7e-59    
gb|ABB51614.1|  LIM-domain protein                                      195   7e-59    
ref|XP_006342667.1|  PREDICTED: pollen-specific protein SF3-like        195   7e-59    
ref|XP_008444540.1|  PREDICTED: pollen-specific protein SF3             195   8e-59    
ref|XP_004252738.1|  PREDICTED: LIM domain-containing protein WLI...    194   1e-58    
ref|XP_009418011.1|  PREDICTED: pollen-specific protein SF3-like        195   1e-58    
dbj|BAB84581.1|  transcription factor LIM                               194   1e-58    
gb|EEE65408.1|  hypothetical protein OsJ_20745                          197   1e-58    
ref|XP_002320687.1|  transcription factor LIM family protein            194   1e-58    
ref|XP_009598300.1|  PREDICTED: pollen-specific protein SF3-like        194   2e-58    
ref|XP_009769329.1|  PREDICTED: pollen-specific protein SF3-like        194   2e-58    
ref|XP_009623970.1|  PREDICTED: pollen-specific protein SF3-like        194   2e-58    
ref|XP_002510088.1|  Pollen-specific protein SF3, putative              194   2e-58    
ref|XP_010094354.1|  Pollen-specific protein SF3                        194   3e-58    
gb|AGE09584.1|  LIM1-like protein                                       193   3e-58    
gb|AFK42303.1|  unknown                                                 193   3e-58    
gb|KDP41612.1|  hypothetical protein JCGZ_16019                         194   3e-58    
ref|XP_009765343.1|  PREDICTED: pollen-specific protein SF3-like        193   4e-58    
ref|XP_004142897.1|  PREDICTED: pollen-specific protein SF3-like        193   5e-58    
ref|XP_009360821.1|  PREDICTED: pollen-specific protein SF3-like        193   5e-58    
gb|ABK58467.1|  LIM domain protein WLIM1a                               193   5e-58    
ref|XP_008393720.1|  PREDICTED: pollen-specific protein SF3-like        193   6e-58    
ref|XP_008347599.1|  PREDICTED: pollen-specific protein SF3-like        193   6e-58    
gb|KCW55096.1|  hypothetical protein EUGRSUZ_I01055                     192   6e-58    
gb|AII80544.1|  LIM-domain protein 10                                   192   9e-58    
dbj|BAB84584.1|  transcription factor LIM                               192   1e-57    
gb|AAD56948.1|AF184109_1  LIM domain protein WLIM1                      192   1e-57    
ref|XP_009375152.1|  PREDICTED: pollen-specific protein SF3-like        192   1e-57    
ref|XP_010999890.1|  PREDICTED: LIM domain-containing protein WLI...    191   3e-57    
dbj|BAA82827.1|  transcription factor Ntlim1                            191   3e-57    
ref|XP_004496871.1|  PREDICTED: pollen-specific protein SF3-like        190   3e-57    
ref|XP_004238086.1|  PREDICTED: LIM domain-containing protein WLIM1     190   6e-57    
ref|XP_006431569.1|  hypothetical protein CICLE_v10003359mg             189   1e-56    



>ref|XP_009629648.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=217

 Score =   329 bits (843),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVDLLSADG+TFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT +KPERENS+T+ P+K+SA+FSGTQDKCA C KTVYPLEKVTM
Sbjct  62   FEQLFKESGNFSKNFQTASKPERENSLTRAPSKLSALFSGTQDKCAACNKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGEAFH+SCFKCAHGGCPLTHATYA+LDGVLYCKHHFAQLFMEKGNYQ
Sbjct  122  EGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNYQ  169


 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 2/112 (2%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F    + ER+        K+++ F+GT DKC AC+KTVY ++ ++ +G  FHKSCFKC+
Sbjct  75   NFQTASKPERENSLTRAPSKLSALFSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKG  406
            H    L  + Y+++DGVLYCK HF QLF E GN+    +     ++NS  K 
Sbjct  135  HGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNYQHVLEAAN-NKKNSAEKA  185



>ref|XP_009629647.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=218

 Score =   328 bits (841),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 2/169 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVDLLSADG+TFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTT--KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKESGNFSKNFQT   KPERENS+T+ P+K+SA+FSGTQDKCA C KTVYPLEKVT
Sbjct  62   FEQLFKESGNFSKNFQTASAKPERENSLTRAPSKLSALFSGTQDKCAACNKTVYPLEKVT  121

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            MEGEAFH+SCFKCAHGGCPLTHATYA+LDGVLYCKHHFAQLFMEKGNYQ
Sbjct  122  MEGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNYQ  170


 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
             + ER+        K+++ F+GT DKC AC+KTVY ++ ++ +G  FHKSCFKC+H    
Sbjct  81   AKPERENSLTRAPSKLSALFSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCAHGGCP  140

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKG  406
            L  + Y+++DGVLYCK HF QLF E GN+    +     ++NS  K 
Sbjct  141  LTHATYAALDGVLYCKHHFAQLFMEKGNYQHVLEAAN-NKKNSAEKA  186



>ref|XP_009779198.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=217

 Score =   327 bits (837),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 163/168 (97%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVDLLSADG+TFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT +KPERENS+T+ P+K+SA+FSGTQDKCA C KTVYPLEKVTM
Sbjct  62   FEQLFKESGNFSKNFQTASKPERENSLTRAPSKLSALFSGTQDKCAACNKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGEAFH+SCFKCAHGGCPLTHATYA+LDGVLYCKHHFAQLFMEKGNYQ
Sbjct  122  EGEAFHKSCFKCAHGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNYQ  169


 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F    + ER+        K+++ F+GT DKC AC+KTVY ++ ++ +G  FHKSCFKC+
Sbjct  75   NFQTASKPERENSLTRAPSKLSALFSGTQDKCAACNKTVYPLEKVTMEGEAFHKSCFKCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNF  352
            H    L  + Y+++DGVLYCK HF QLF E GN+
Sbjct  135  HGGCPLTHATYAALDGVLYCKHHFAQLFMEKGNY  168



>ref|XP_009624529.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=206

 Score =   318 bits (815),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVDLL+ADG T+HKSCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLTADGITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE GNFSKNFQTTKPERE+++T+ P+K+SAMFSGTQDKCA C KTVYPLEKVTME
Sbjct  62   FEQLFKECGNFSKNFQTTKPEREHALTRTPSKLSAMFSGTQDKCAACKKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE+FH+SCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKG YQ
Sbjct  122  GESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTYQ  168


 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  A F+GT DKC AC KTVY ++ ++ +G +FHKSCFKC+H    L  + Y+S+DGVL
Sbjct  92   SKLSAMFSGTQDKCAACKKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGVL  151

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENS  394
            YCK HF QLF E G +    +    ++ N+
Sbjct  152  YCKHHFAQLFMEKGTYQHVLEAANHKKINN  181



>ref|XP_009762983.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=212

 Score =   317 bits (811),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKC ACDKTVYFVDLLSADG T+HKSCFKCSHCKGTLVMSNYSSM+GVLYCKTH
Sbjct  2    AFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNF+KNFQ +K ER+NS+T+ P+K+SAMFSGTQDKCA C KTVYPLEKVTME
Sbjct  62   FEQLFKESGNFTKNFQNSKAERQNSLTRAPSKLSAMFSGTQDKCAACDKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE+FH+SCFKCAHGGCPLTHATYASLDG LYCKHHFAQLFMEKGNYQ
Sbjct  122  GESFHKSCFKCAHGGCPLTHATYASLDGNLYCKHHFAQLFMEKGNYQ  168


 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +2

Query  92   RGERQTDQNIHTKKM-ASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            + ERQ        K+ A F+GT DKC ACDKTVY ++ ++ +G +FHKSCFKC+H    L
Sbjct  80   KAERQNSLTRAPSKLSAMFSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCPL  139

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNF  352
              + Y+S+DG LYCK HF QLF E GN+
Sbjct  140  THATYASLDGNLYCKHHFAQLFMEKGNY  167



>ref|XP_011093154.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Sesamum 
indicum]
Length=218

 Score =   317 bits (811),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            MASFTGTLDKCKACDKTVYFVDLLSADG+ FH+SCFKCSHCKGTLVMSNYSSMDGVLYCK
Sbjct  1    MASFTGTLDKCKACDKTVYFVDLLSADGAIFHRSCFKCSHCKGTLVMSNYSSMDGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
             HFEQLFKESGNFSKNFQT  K ERENS+T+ P+K+SA+FSGTQDKC  C KTVYPLEKV
Sbjct  61   PHFEQLFKESGNFSKNFQTGAKSERENSLTRTPSKLSALFSGTQDKCPACNKTVYPLEKV  120

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            TMEGE+FHRSCFKCAHGGCPLTH++YA+LDG+LYCKHHF QLFMEKGNYQ
Sbjct  121  TMEGESFHRSCFKCAHGGCPLTHSSYAALDGILYCKHHFQQLFMEKGNYQ  170


 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 76/124 (61%), Gaps = 4/124 (3%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F    + ER+        K+++ F+GT DKC AC+KTVY ++ ++ +G +FH+SCFKC+
Sbjct  76   NFQTGAKSERENSLTRTPSKLSALFSGTQDKCPACNKTVYPLEKVTMEGESFHRSCFKCA  135

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMF  430
            H    L  S+Y+++DG+LYCK HF+QLF E GN+    +     ++N++   PT+  A  
Sbjct  136  HGGCPLTHSSYAALDGILYCKHHFQQLFMEKGNYQHVLKAAN-NKKNAVE--PTEAEAGS  192

Query  431  SGTQ  442
             G Q
Sbjct  193  DGPQ  196



>ref|XP_006341718.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=212

 Score =   316 bits (810),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVYFVDLLSADG T+HKSCFKC+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYFVDLLSADGITYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE GNFSKNFQT+ KP++EN++ + P+K+SAMFSGTQDKCA CTKTVYPLEKVTM
Sbjct  62   FEQLFKECGNFSKNFQTSPKPDKENALARTPSKLSAMFSGTQDKCAACTKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE+FH+SCFKCAHGGCPLTHATYASLDG+LYCKHHFAQLFMEKG YQ
Sbjct  122  EGESFHKSCFKCAHGGCPLTHATYASLDGILYCKHHFAQLFMEKGTYQ  169


 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  A F+GT DKC AC KTVY ++ ++ +G +FHKSCFKC+H    L  + Y+S+DG+L
Sbjct  93   SKLSAMFSGTQDKCAACTKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGIL  152

Query  305  YCKTHFEQLFKESGNF  352
            YCK HF QLF E G +
Sbjct  153  YCKHHFAQLFMEKGTY  168



>ref|XP_004248581.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Solanum 
lycopersicum]
Length=212

 Score =   316 bits (809),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVYFVDLLSADG T+HKSCFKC+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYFVDLLSADGITYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE GNFSKNFQT+ KP++EN++ + P+K+SAMFSGTQDKCA CTKTVYPLEKVTM
Sbjct  62   FEQLFKECGNFSKNFQTSPKPDKENALARTPSKLSAMFSGTQDKCAACTKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE+FH+SCFKCAHGGCPLTHATYASLDG+LYCKHHFAQLFMEKG YQ
Sbjct  122  EGESFHKSCFKCAHGGCPLTHATYASLDGILYCKHHFAQLFMEKGTYQ  169


 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  A F+GT DKC AC KTVY ++ ++ +G +FHKSCFKC+H    L  + Y+S+DG+L
Sbjct  93   SKLSAMFSGTQDKCAACTKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGIL  152

Query  305  YCKTHFEQLFKESGNF  352
            YCK HF QLF E G +
Sbjct  153  YCKHHFAQLFMEKGTY  168



>emb|CDP08845.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   315 bits (808),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVDLLSADG+TFH+SCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLSADGATFHRSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNF T K ERENS+T+ P+K+SA+FSGTQDKCA C+KTVYPLEKVTME
Sbjct  62   FEQLFKESGNFSKNFNTGKHERENSLTRAPSKLSALFSGTQDKCAACSKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE++H+SCFKCAHGGCPLTH++YA+LDG+LYCKHHFAQLFMEKGNYQ
Sbjct  122  GESYHKSCFKCAHGGCPLTHSSYAALDGILYCKHHFAQLFMEKGNYQ  168


 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             FN  G+ ER+        K+++ F+GT DKC AC KTVY ++ ++ +G ++HKSCFKC+
Sbjct  75   NFN-TGKHERENSLTRAPSKLSALFSGTQDKCAACSKTVYPLEKVTMEGESYHKSCFKCA  133

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNF  352
            H    L  S+Y+++DG+LYCK HF QLF E GN+
Sbjct  134  HGGCPLTHSSYAALDGILYCKHHFAQLFMEKGNY  167



>ref|XP_009601147.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AAF75828.1|AF116851_1 LIM domain protein PLIM-2 [Nicotiana tabacum]
Length=212

 Score =   314 bits (804),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKC ACDKTVYFVDLLSADG T+HKSCFKCSHCKGTLVMSNYSSM+GVLYCK H
Sbjct  2    AFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCKGTLVMSNYSSMEGVLYCKHH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNF+KNFQ +K ER+NS+T+ P+K+SAMFSGTQDKCA C KTVYPLEKVTME
Sbjct  62   FEQLFKESGNFTKNFQNSKAERQNSLTRAPSKLSAMFSGTQDKCAACDKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE+FH+SCFKCAHGGCPLTHATYASLDG LYCKHHFAQLFMEKGNYQ
Sbjct  122  GESFHKSCFKCAHGGCPLTHATYASLDGNLYCKHHFAQLFMEKGNYQ  168


 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +2

Query  92   RGERQTDQNIHTKKM-ASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            + ERQ        K+ A F+GT DKC ACDKTVY ++ ++ +G +FHKSCFKC+H    L
Sbjct  80   KAERQNSLTRAPSKLSAMFSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCAHGGCPL  139

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNF  352
              + Y+S+DG LYCK HF QLF E GN+
Sbjct  140  THATYASLDGNLYCKHHFAQLFMEKGNY  167



>ref|XP_009762122.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|ACB05475.1| LIM domain protein 2b [Nicotiana tabacum]
Length=216

 Score =   314 bits (804),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVDLL+ADG T+HKSCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLTADGITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE GNFSKNFQT+ KPERE+++T+ P+K+SAMFSGTQDKCA C KTVYPLEKVTM
Sbjct  62   FEQLFKECGNFSKNFQTSAKPEREHALTRTPSKLSAMFSGTQDKCAACNKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE+FH+SCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKG YQ
Sbjct  122  EGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTYQ  169


 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  A F+GT DKC AC+KTVY ++ ++ +G +FHKSCFKC+H    L  + Y+S+DGVL
Sbjct  93   SKLSAMFSGTQDKCAACNKTVYPLEKVTMEGESFHKSCFKCAHGGCPLTHATYASLDGVL  152

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMT  400
            YCK HF QLF E G +    +    ++ N+ T
Sbjct  153  YCKHHFAQLFMEKGTYQHVLEAANNKKINAET  184



>ref|XP_009624528.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=207

 Score =   313 bits (803),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVDLL+ADG T+HKSCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLTADGITYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE GNFSKNFQTT KPERE+++T+ P+K+SAMFSGTQDKCA C KTVYPLEKVTM
Sbjct  62   FEQLFKECGNFSKNFQTTAKPEREHALTRTPSKLSAMFSGTQDKCAACKKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE+FH+SCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKG YQ
Sbjct  122  EGESFHKSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTYQ  169


 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKM-ASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F    + ER+        K+ A F+GT DKC AC KTVY ++ ++ +G +FHKSCFKC+
Sbjct  75   NFQTTAKPEREHALTRTPSKLSAMFSGTQDKCAACKKTVYPLEKVTMEGESFHKSCFKCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
            H    L  + Y+S+DGVLYCK HF QLF E G +    +    ++ N+
Sbjct  135  HGGCPLTHATYASLDGVLYCKHHFAQLFMEKGTYQHVLEAANHKKINN  182



>ref|NP_001288583.1| uncharacterized protein LOC101266456 [Solanum lycopersicum]
 gb|AGV29549.1| PLIM2a [Solanum lycopersicum]
Length=223

 Score =   313 bits (803),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKC ACDKTVYFVDLLSADG T+HKSCFKCSHCKGTLVMSNYSSMDG+LYCKTH
Sbjct  2    AFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCKGTLVMSNYSSMDGILYCKTH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ + K ER+NS+T+ P+K+SA+FSGTQDKCA C KTVYPLEKVTM
Sbjct  62   FEQLFKESGNFSKNFQNSAKSERQNSLTRAPSKLSALFSGTQDKCAACDKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE+FH+SCFKCAHGGC LTHATYASLDG LYCKHHFAQLFMEKGNYQ
Sbjct  122  EGESFHKSCFKCAHGGCALTHATYASLDGNLYCKHHFAQLFMEKGNYQ  169


 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F +  + ERQ        K+++ F+GT DKC ACDKTVY ++ ++ +G +FHKSCFKC+
Sbjct  75   NFQNSAKSERQNSLTRAPSKLSALFSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNF  352
            H    L  + Y+S+DG LYCK HF QLF E GN+
Sbjct  135  HGGCALTHATYASLDGNLYCKHHFAQLFMEKGNY  168



>ref|XP_011091917.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Sesamum 
indicum]
Length=223

 Score =   313 bits (801),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            MA+FTGTLDKCKACDKTVYFVDLLSADG+T+HKSCFKCSHCKGTLVMSNYSSMDGVLYCK
Sbjct  1    MAAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
             HFEQLFKESGNFSKNFQTTK ++ENS  K P K+SAMFSGTQDKC  C KTVYPLEKV 
Sbjct  61   PHFEQLFKESGNFSKNFQTTKHDKENSSNKAPNKLSAMFSGTQDKCPACHKTVYPLEKVI  120

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            MEGE+FH+SCFKCAHGGCPLTH++YA+LDG+LYCK HF QLFMEKGNYQ
Sbjct  121  MEGESFHKSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQ  169


 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 1/130 (1%)
 Frame = +2

Query  92   RGERQTDQNIHTKKM-ASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            + +++   N    K+ A F+GT DKC AC KTVY ++ +  +G +FHKSCFKC+H    L
Sbjct  81   KHDKENSSNKAPNKLSAMFSGTQDKCPACHKTVYPLEKVIMEGESFHKSCFKCAHGGCPL  140

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDK  448
              S+Y+++DG+LYCK HF+QLF E GN+    +     +    T  P    A      D+
Sbjct  141  THSSYAALDGILYCKVHFQQLFMEKGNYQHVLEAATNRKSAVETPEPESDQAEEKADDDQ  200

Query  449  CATCTKTVYP  478
              T  +   P
Sbjct  201  EKTEEEEAKP  210



>gb|EYU35073.1| hypothetical protein MIMGU_mgv1a013171mg [Erythranthe guttata]
Length=229

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            MA+FTGTLDKCKACDKTVYFVDLLSADG+TFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK
Sbjct  1    MAAFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            THFEQLFK+S +F+KNFQT+ KPERENS+T+ P K+SAMFSGTQDKC  C K VYPLEKV
Sbjct  61   THFEQLFKDSAHFTKNFQTSAKPERENSLTRAPNKLSAMFSGTQDKCPACDKIVYPLEKV  120

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            TMEGE+FH+SCFKCAHGGCPLTH++YA+LDG+LYCK HF QLFMEKGNYQ
Sbjct  121  TMEGESFHKSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQ  170


 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 1/109 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKM-ASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F    + ER+        K+ A F+GT DKC ACDK VY ++ ++ +G +FHKSCFKC+
Sbjct  76   NFQTSAKPERENSLTRAPNKLSAMFSGTQDKCPACDKIVYPLEKVTMEGESFHKSCFKCA  135

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSM  397
            H    L  S+Y+++DG+LYCK HF+QLF E GN+     +T  +R  SM
Sbjct  136  HGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQHVLNSTNHKRGLSM  184



>ref|XP_006339787.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=221

 Score =   311 bits (796),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKC ACDKTVYFVDLLSADG T+HKSCFKCSHC+GTLVMSNYSSMDG+LYCKTH
Sbjct  2    AFTGTLDKCSACDKTVYFVDLLSADGVTYHKSCFKCSHCRGTLVMSNYSSMDGILYCKTH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ   K ER+NS+T+ P+K+SAMFSGTQDKCA C KTVYPLEKVTM
Sbjct  62   FEQLFKESGNFSKNFQNPAKSERQNSLTRAPSKLSAMFSGTQDKCAACDKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE+FH+SCFKCAHGGC LTHATYASLDG LYCKHHFAQLFMEKGNYQ
Sbjct  122  EGESFHKSCFKCAHGGCALTHATYASLDGNLYCKHHFAQLFMEKGNYQ  169


 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 67/113 (59%), Gaps = 2/113 (2%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKM-ASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F +  + ERQ        K+ A F+GT DKC ACDKTVY ++ ++ +G +FHKSCFKC+
Sbjct  75   NFQNPAKSERQNSLTRAPSKLSAMFSGTQDKCAACDKTVYPLEKVTMEGESFHKSCFKCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGP  409
            H    L  + Y+S+DG LYCK HF QLF E GN+    +     ++NS    P
Sbjct  135  HGGCALTHATYASLDGNLYCKHHFAQLFMEKGNYQHVLKAAN-NKKNSAAITP  186



>gb|EYU32092.1| hypothetical protein MIMGU_mgv1a013269mg [Erythranthe guttata]
Length=225

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 156/172 (91%), Gaps = 3/172 (2%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMS+YSSMDGVLYCK
Sbjct  1    MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSSYSSMDGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQTTKPERE---NSMTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
             HFEQLFKESGNFSKNFQ +K ER+   N   +GP+K SAMF GTQDKC  C KTVYPLE
Sbjct  61   PHFEQLFKESGNFSKNFQASKQERDHNNNLQARGPSKHSAMFCGTQDKCPACNKTVYPLE  120

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            KVTMEGE+FH+SCFKCAHGGCPLTH++YA+LDG+LYCK HF QLFMEKGNYQ
Sbjct  121  KVTMEGESFHKSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQ  172


 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 9/108 (8%)
 Frame = +2

Query  86   VGRGERQTDQNIH----TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
              + ER  + N+     +K  A F GT DKC AC+KTVY ++ ++ +G +FHKSCFKC+H
Sbjct  79   ASKQERDHNNNLQARGPSKHSAMFCGTQDKCPACNKTVYPLEKVTMEGESFHKSCFKCAH  138

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNF-----SKNFQTTKPE  382
                L  S+Y+++DG+LYCK HF+QLF E GN+     S N +   PE
Sbjct  139  GGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQHVLDSANHKKGAPE  186



>gb|EPS71497.1| hypothetical protein M569_03263, partial [Genlisea aurea]
Length=215

 Score =   303 bits (775),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +2

Query  137  ASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKT  316
            ++FTGTLDKCKACDKTVYFVDLLSADG+T+HKSCFKCSHCKGTLVMSNYSSMDGVLYCK 
Sbjct  1    SAFTGTLDKCKACDKTVYFVDLLSADGATYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  317  HFEQLFKESGNFSKNFQTTK--PERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            HFEQLFKESGNFSKNFQT+K   ++EN  +K P KVSAMFSGTQDKCA C+KTVYPLEK+
Sbjct  61   HFEQLFKESGNFSKNFQTSKHVVDKENYGSKAPNKVSAMFSGTQDKCAACSKTVYPLEKM  120

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            TMEGE++H+SCFKCAHGGCPLTH++YA+LDG+LYCK HF QLFMEKGNYQ
Sbjct  121  TMEGESYHKSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQ  170


 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  KKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLY  307
            K  A F+GT DKC AC KTVY ++ ++ +G ++HKSCFKC+H    L  S+Y+++DG+LY
Sbjct  95   KVSAMFSGTQDKCAACSKTVYPLEKMTMEGESYHKSCFKCAHGGCPLTHSSYAALDGILY  154

Query  308  CKTHFEQLFKESGNF  352
            CK HF+QLF E GN+
Sbjct  155  CKVHFQQLFMEKGNY  169



>ref|XP_004240106.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Solanum 
lycopersicum]
Length=228

 Score =   300 bits (769),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 156/168 (93%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVDLLSADG+TFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLSADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT+    + S + K P+KVSAMFSGTQDKCA C+KTVYPLEKV +
Sbjct  62   FEQLFKESGNFSKNFQTSSKSEKESSLAKAPSKVSAMFSGTQDKCAACSKTVYPLEKVIL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGEAFH+SCFKCAHGGC LTHATYA+LDGVLYCKHHFAQLFMEKG+YQ
Sbjct  122  EGEAFHKSCFKCAHGGCALTHATYAALDGVLYCKHHFAQLFMEKGSYQ  169


 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  A F+GT DKC AC KTVY ++ +  +G  FHKSCFKC+H    L  + Y+++DGVL
Sbjct  93   SKVSAMFSGTQDKCAACSKTVYPLEKVILEGEAFHKSCFKCAHGGCALTHATYAALDGVL  152

Query  305  YCKTHFEQLFKESGNFSKNFQTT  373
            YCK HF QLF E G++    + T
Sbjct  153  YCKHHFAQLFMEKGSYQHVLKAT  175



>gb|EPS59684.1| hypothetical protein M569_15118, partial [Genlisea aurea]
Length=180

 Score =   297 bits (761),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVYFVDLL+ADG+TFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYFVDLLTADGATFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTK-GPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ +   +ENS +K  P ++SAMFSGTQDKC  C K VYPLEKVTM
Sbjct  62   FEQLFKESGNFSKNFQPSAANKENSASKAAPNRMSAMFSGTQDKCPACNKIVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE+ HRSCFKCAHGGCPLTH++YA+LDG+LYCK HF QLFMEKGNYQ
Sbjct  122  EGESVHRSCFKCAHGGCPLTHSSYAALDGILYCKVHFQQLFMEKGNYQ  169


 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = +2

Query  98   ERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMS  277
            E    +    +  A F+GT DKC AC+K VY ++ ++ +G + H+SCFKC+H    L  S
Sbjct  84   ENSASKAAPNRMSAMFSGTQDKCPACNKIVYPLEKVTMEGESVHRSCFKCAHGGCPLTHS  143

Query  278  NYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
            +Y+++DG+LYCK HF+QLF E GN+    Q    +R
Sbjct  144  SYAALDGILYCKVHFQQLFMEKGNYQHVLQAATHKR  179



>ref|XP_002269537.1| PREDICTED: LIM domain-containing protein PLIM2c [Vitis vinifera]
 emb|CAN74803.1| hypothetical protein VITISV_006290 [Vitis vinifera]
Length=220

 Score =   293 bits (750),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 159/168 (95%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VDLLSADG+++HK+CFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT-KP-ERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKESGNFSKNFQT+ KP ++ N +++ P+K+S+MFSGTQDKC+ C KTVYPLEKVT
Sbjct  62   FEQLFKESGNFSKNFQTSAKPADKLNELSRAPSKLSSMFSGTQDKCSACRKTVYPLEKVT  121

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            +EGE++H+SCFKCAHGGCPLTH++YA+L+GVLYCKHHF+QLFMEKGNY
Sbjct  122  LEGESYHKSCFKCAHGGCPLTHSSYAALNGVLYCKHHFSQLFMEKGNY  169


 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC AC KTVY ++ ++ +G ++HKSCFKC+H    L  S+Y++++GVL
Sbjct  94   SKLSSMFSGTQDKCSACRKTVYPLEKVTLEGESYHKSCFKCAHGGCPLTHSSYAALNGVL  153

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLF E GN+S
Sbjct  154  YCKHHFSQLFMEKGNYS  170



>ref|XP_002511828.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF50497.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=210

 Score =   288 bits (737),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VD+LS +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVVDMLSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKG-PTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ  K E++N  ++  P+KVS++F GTQDKC+ C KTVYPLEKVTM
Sbjct  62   FEQLFKESGNFSKNFQAGKTEKQNDSSRAPPSKVSSLFCGTQDKCSACGKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE FH+SCF+CAHGGCPLTH++YA+LDGVLYCKHHFAQLFMEKG+Y
Sbjct  122  EGECFHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMEKGSY  168


 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +2

Query  83   HVGRGERQTDQN--IHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHC  256
              G+ E+Q D +    +K  + F GT DKC AC KTVY ++ ++ +G  FHKSCF+C+H 
Sbjct  77   QAGKTEKQNDSSRAPPSKVSSLFCGTQDKCSACGKTVYPLEKVTMEGECFHKSCFRCAHG  136

Query  257  KGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
               L  S+Y+++DGVLYCK HF QLF E G+++   Q    +R  S T  P +++
Sbjct  137  GCPLTHSSYAALDGVLYCKHHFAQLFMEKGSYTHVLQAASHKRSTSSTTPPPELA  191



>ref|XP_008438078.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cucumis 
melo]
Length=208

 Score =   286 bits (731),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY V+LLS +G+ +HKSCFKCSHCKGTL MS+YS MDGVLYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKP-ERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ  KP E++N +++ P+K+S+MFSGTQDKCA CTKTVYPLEKVT+
Sbjct  62   FEQLFKESGNFSKNFQNAKPSEKQNDLSRAPSKLSSMFSGTQDKCAACTKTVYPLEKVTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE +H++CF+CAHGGC LTH++YA+LDGVLYCKHHFAQLFM KGNY
Sbjct  122  EGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNY  168


 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F +    E+Q D +    K++S F+GT DKC AC KTVY ++ ++ +G  +HK+CF+C+
Sbjct  75   NFQNAKPSEKQNDLSRAPSKLSSMFSGTQDKCAACTKTVYPLEKVTLEGECYHKNCFRCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            H    L  S+Y+++DGVLYCK HF QLF   GN++
Sbjct  135  HGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYN  169



>ref|XP_010255661.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Nelumbo 
nucifera]
Length=199

 Score =   285 bits (730),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GTL KCKACDKTVY VDLLSADG  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    SFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+FSKNFQT K E++N  + + P+K+S+MFSGTQDKCA C KT YPLEKVT+
Sbjct  62   FEQLFKETGSFSKNFQTGKSEKQNDQLARAPSKLSSMFSGTQDKCAACKKTAYPLEKVTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H+SCFKC+HGGCPLT +TYA+LDG+LYCKHHFAQLF EKGNY
Sbjct  122  EGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKHHFAQLFKEKGNY  168


 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +2

Query  83   HVGRGERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHC  256
              G+ E+Q DQ     +K  + F+GT DKC AC KT Y ++ ++ +G ++HKSCFKCSH 
Sbjct  77   QTGKSEKQNDQLARAPSKLSSMFSGTQDKCAACKKTAYPLEKVTLEGESYHKSCFKCSHG  136

Query  257  KGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
               L  S Y+++DG+LYCK HF QLFKE GN++
Sbjct  137  GCPLTPSTYAALDGILYCKHHFAQLFKEKGNYN  169



>ref|XP_011035878.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Populus 
euphratica]
Length=206

 Score =   285 bits (730),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVD++S +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYFVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE G+FSKNFQ  KPER + +++ P+K+S++F GTQDKC+TC KTVYPLEKVTME
Sbjct  62   FEQLFKEGGDFSKNFQKGKPERTHDLSRIPSKLSSVFCGTQDKCSTCGKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAHGGCPLTH++YA+LDGVLYCK HFAQLFMEKG Y
Sbjct  122  GECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTY  167


 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = +2

Query  89   GRGERQTD-QNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ ER  D   I +K  + F GT DKC  C KTVY ++ ++ +G  +HK+CF+C+H    
Sbjct  79   GKPERTHDLSRIPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCP  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
            L  S+Y+++DGVLYCK HF QLF E G +S    +   +R NS
Sbjct  139  LTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLASAAHKRSNS  181



>ref|XP_006491462.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|KDO86087.1| hypothetical protein CISIN_1g040947mg [Citrus sinensis]
Length=210

 Score =   285 bits (729),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VD+LS +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVVDMLSLEGMPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTK-PERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K P   ++  + P+K+S++FSGTQDKCA C KTVYPLEKVTM
Sbjct  62   FEQLFKESGNFSKNFQTGKNPSSCSNQNRTPSKLSSLFSGTQDKCAACEKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EG+ FH++CF+CAHGGCPLTH++YA+LDGVLYCKHHFAQLFMEKGNY
Sbjct  122  EGDCFHKTCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMEKGNY  168


 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +2

Query  107  TDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNY  283
            ++QN    K++S F+GT DKC AC+KTVY ++ ++ +G  FHK+CF+C+H    L  S+Y
Sbjct  86   SNQNRTPSKLSSLFSGTQDKCAACEKTVYPLEKVTMEGDCFHKTCFRCAHGGCPLTHSSY  145

Query  284  SSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
            +++DGVLYCK HF QLF E GN+S   +    +R
Sbjct  146  AALDGVLYCKHHFAQLFMEKGNYSHVLKAANHKR  179



>ref|XP_011023373.1| PREDICTED: LIM domain-containing protein PLIM2b [Populus euphratica]
Length=203

 Score =   284 bits (726),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VD++S +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE G+FSKNFQ  KPER + +T+ P+K+S++F GTQDKC+TC KTVYPLEKVTME
Sbjct  62   FEQLFKEGGDFSKNFQKGKPERTHELTRTPSKLSSVFCGTQDKCSTCGKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAHGGCPLTH++YA+LDGVLYCK HFAQLFMEKG Y
Sbjct  122  GECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTY  167


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ ER  +      K++S F GT DKC  C KTVY ++ ++ +G  +HK+CF+C+H    
Sbjct  79   GKPERTHELTRTPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCP  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
            L  S+Y+++DGVLYCK HF QLF E G +S        +R  S
Sbjct  139  LTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLAGATHKRSTS  181



>ref|XP_002320783.2| LIM domain-containing family protein [Populus trichocarpa]
 gb|EEE99098.2| LIM domain-containing family protein [Populus trichocarpa]
Length=206

 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVD++S +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYFVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE G+FSKNFQ  KPER + +++ P+K+S++F GTQDKC+ C KTVYPLEKVTME
Sbjct  62   FEQLFKEGGDFSKNFQKGKPERTHDLSRIPSKLSSVFCGTQDKCSACGKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAHGGCPLTH++YA+LDGVLYCK HFAQLFMEKG Y
Sbjct  122  GECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTY  167


 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 1/103 (1%)
 Frame = +2

Query  89   GRGERQTD-QNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ ER  D   I +K  + F GT DKC AC KTVY ++ ++ +G  +HK+CF+C+H    
Sbjct  79   GKPERTHDLSRIPSKLSSVFCGTQDKCSACGKTVYPLEKVTMEGECYHKTCFRCAHGGCP  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
            L  S+Y+++DGVLYCK HF QLF E G +S    +   +R NS
Sbjct  139  LTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLASAAHKRSNS  181



>gb|ABK58466.1| LIM domain protein PLIM2a [Populus tremula x Populus alba]
Length=206

 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVD++S +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYFVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE G+FS+NFQ  KPER + +++ P+K+S++F GTQDKC+TC KTVYPLEKVTME
Sbjct  62   FEQLFKEGGDFSRNFQKGKPERTHDLSRIPSKLSSVFCGTQDKCSTCGKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAHGGCPLTH++YA+LDGVLYCK HFAQLFMEKG Y
Sbjct  122  GECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTY  167


 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  89   GRGERQTD-QNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ ER  D   I +K  + F GT DKC  C KTVY ++ ++ +G  +HK+CF+C+H    
Sbjct  79   GKPERTHDLSRIPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCP  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMT  400
            L  S+Y+++DGVLYCK HF QLF E G +S    +   +R NS T
Sbjct  139  LTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLASAAHKRSNSTT  183



>ref|XP_002302574.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|EEE81847.1| LIM domain-containing family protein [Populus trichocarpa]
Length=206

 Score =   283 bits (723),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VD++S +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE G+FSKNFQ  KPER + + + P+K+S++F GTQDKC+TC KTVYPLEKVTME
Sbjct  62   FEQLFKEGGDFSKNFQKGKPERTHELIRTPSKLSSVFCGTQDKCSTCGKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAHGGCPLTH++YA+LDGVLYCK HFAQLFMEKG Y
Sbjct  122  GECYHKTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTY  167


 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 10/115 (9%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ ER  +      K++S F GT DKC  C KTVY ++ ++ +G  +HK+CF+C+H    
Sbjct  79   GKPERTHELIRTPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCP  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFS---------KNFQTTKPERENSMTK  403
            L  S+Y+++DGVLYCK HF QLF E G +S         ++  T  PE   S T+
Sbjct  139  LTHSSYAALDGVLYCKVHFAQLFMEKGTYSHVLAGATHKRSTSTPPPELAESNTE  193



>gb|KGN56538.1| hypothetical protein Csa_3G122620 [Cucumis sativus]
Length=209

 Score =   283 bits (723),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY V+LLS +G+ +HKSC KCSHCKGTL MS+YS MDGVLYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCLKCSHCKGTLSMSSYSWMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKP-ERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ  KP E++N +++ P+K+S+MFSGTQDKCA C+KTVYPLEKVT+
Sbjct  62   FEQLFKESGNFSKNFQNAKPSEKQNDLSRAPSKLSSMFSGTQDKCAACSKTVYPLEKVTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE +H++CF+CAHGGC LTH++YA+LDGVLYCKHHFAQLFM KGNY
Sbjct  122  EGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNY  168


 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F +    E+Q D +    K++S F+GT DKC AC KTVY ++ ++ +G  +HK+CF+C+
Sbjct  75   NFQNAKPSEKQNDLSRAPSKLSSMFSGTQDKCAACSKTVYPLEKVTLEGECYHKNCFRCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            H    L  S+Y+++DGVLYCK HF QLF   GN++
Sbjct  135  HGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYN  169



>ref|XP_007051870.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOX96027.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=276

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +KK  +FTGTLDKCKACD+TV+ VD+LS +G  +HK+CFKCSHCKG LVMS YSSMDGVL
Sbjct  65   SKKEMAFTGTLDKCKACDRTVHVVDMLSLEGVPYHKTCFKCSHCKGNLVMSTYSSMDGVL  124

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
            YCK HFEQLFKESGNFSKNF T K ER+N +++ P+KVS++F GTQDKCA C KTVYPLE
Sbjct  125  YCKPHFEQLFKESGNFSKNFHTVKSERQNELSRTPSKVSSLFCGTQDKCAACQKTVYPLE  184

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            KVTMEGE +H++CF+CAHGGC LTH++YA+L+GVLYCKHHFAQLFMEKGNY 
Sbjct  185  KVTMEGECYHKNCFRCAHGGCHLTHSSYAALNGVLYCKHHFAQLFMEKGNYN  236


 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +2

Query  83   HVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
            H  + ERQ + +    K++S F GT DKC AC KTVY ++ ++ +G  +HK+CF+C+H  
Sbjct  145  HTVKSERQNELSRTPSKVSSLFCGTQDKCAACQKTVYPLEKVTMEGECYHKNCFRCAHGG  204

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
              L  S+Y++++GVLYCK HF QLF E GN++   Q    +R NS
Sbjct  205  CHLTHSSYAALNGVLYCKHHFAQLFMEKGNYNHVLQAASHKRNNS  249



>ref|XP_010671960.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score =   281 bits (720),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVYFVDLLSADG+ FHKSCF+CSHC GTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYFVDLLSADGAIFHKSCFRCSHCNGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNF KNFQ+  K +R     + P K+S+ FSGTQ+KC  C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNFRKNFQSGQKTDRPYEQNRAPNKLSSFFSGTQEKCPGCHKTVYPLEKITM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H+SCFKCA GGCPLTH++YA+LDG+LYCKHHF QLFMEKG+Y 
Sbjct  122  EGESYHKSCFKCAVGGCPLTHSSYAALDGILYCKHHFQQLFMEKGSYN  169


 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 5/133 (4%)
 Frame = +2

Query  98   ERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            +R  +QN    K++SF +GT +KC  C KTVY ++ ++ +G ++HKSCFKC+     L  
Sbjct  83   DRPYEQNRAPNKLSSFFSGTQEKCPGCHKTVYPLEKITMEGESYHKSCFKCAVGGCPLTH  142

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCA  454
            S+Y+++DG+LYCK HF+QLF E G+++      K    +S   G  +++A   G     A
Sbjct  143  SSYAALDGILYCKHHFQQLFMEKGSYNHVKNAAKKNASSSAEAGDGELAAETGGE----A  198

Query  455  TCTKTVYPLEKVT  493
            T      P EK  
Sbjct  199  TAEAEANPEEKAA  211



>ref|XP_008438077.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cucumis 
melo]
Length=209

 Score =   281 bits (719),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 153/168 (91%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY V+LLS +G+ +HKSCFKCSHCKGTL MS+YS MDGVLYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKP-ERENSM-TKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKESGNFSKNFQ  KP E++N + ++ P+K+S+MFSGTQDKCA CTKTVYPLEKVT
Sbjct  62   FEQLFKESGNFSKNFQNAKPSEKQNDLQSRAPSKLSSMFSGTQDKCAACTKTVYPLEKVT  121

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            +EGE +H++CF+CAHGGC LTH++YA+LDGVLYCKHHFAQLFM KGNY
Sbjct  122  LEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNY  169


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +2

Query  74   RFNHVGRGERQTD-QNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKC  247
             F +    E+Q D Q+    K++S F+GT DKC AC KTVY ++ ++ +G  +HK+CF+C
Sbjct  75   NFQNAKPSEKQNDLQSRAPSKLSSMFSGTQDKCAACTKTVYPLEKVTLEGECYHKNCFRC  134

Query  248  SHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            +H    L  S+Y+++DGVLYCK HF QLF   GN++
Sbjct  135  AHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYN  170



>ref|XP_008438068.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008438069.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=205

 Score =   281 bits (718),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VDLL+ +G+ +HK+CFKCSHCKGTL MS+YS MDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVVDLLTLEGNPYHKNCFKCSHCKGTLSMSSYSWMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT   ER+N +T+ P+K+S+MF GTQDKC+ CTKTVYPLEKVT+E
Sbjct  62   FEQLFKESGNFSKNFQTKPSERQNDLTRTPSKLSSMFCGTQDKCSVCTKTVYPLEKVTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE +H+ CF+CAHGGC LTH +YA+LDGVLYCKHHFAQLFM KGNY 
Sbjct  122  GECYHKKCFRCAHGGCHLTHCSYAALDGVLYCKHHFAQLFMVKGNYN  168


 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 7/106 (7%)
 Frame = +2

Query  98   ERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            ERQ D      K++S F GT DKC  C KTVY ++ ++ +G  +HK CF+C+H    L  
Sbjct  82   ERQNDLTRTPSKLSSMFCGTQDKCSVCTKTVYPLEKVTLEGECYHKKCFRCAHGGCHLTH  141

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNF------SKNFQTTKPERENS  394
             +Y+++DGVLYCK HF QLF   GN+      + N +TT P  E++
Sbjct  142  CSYAALDGVLYCKHHFAQLFMVKGNYNHVLEAAANKKTTTPPAEHT  187



>gb|KHG24611.1| Pollen-specific SF3 [Gossypium arboreum]
Length=209

 Score =   280 bits (717),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTV+ VD+++ +G  +HK+CFKCSHCKG LVM+ YSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVHVVDMMTLEGVPYHKTCFKCSHCKGNLVMNTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT K E++N  ++ P K+S++FSGTQDKCA C KTVYPLEK+TME
Sbjct  62   FEQLFKESGNFSKNFQTAKTEKQNDTSRTPNKLSSLFSGTQDKCAACEKTVYPLEKITME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE FH++CF+CAHGGCPLTH++YA+L+G+LYCKHHFAQLFM KGNY 
Sbjct  122  GECFHKTCFRCAHGGCPLTHSSYAALNGILYCKHHFAQLFMVKGNYN  168


 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +2

Query  86   VGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
              + E+Q D +    K++S F+GT DKC AC+KTVY ++ ++ +G  FHK+CF+C+H   
Sbjct  78   TAKTEKQNDTSRTPNKLSSLFSGTQDKCAACEKTVYPLEKITMEGECFHKTCFRCAHGGC  137

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
             L  S+Y++++G+LYCK HF QLF   GN++   Q     R  S
Sbjct  138  PLTHSSYAALNGILYCKHHFAQLFMVKGNYNHVLQAATHRRNTS  181



>ref|XP_010506557.1| PREDICTED: LIM domain-containing protein PLIM2a [Camelina sativa]
Length=228

 Score =   281 bits (718),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HKSCFKCSHCKGTLV+SNYSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGN+SKNFQT K ++ N +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVTME
Sbjct  62   FEQLFKESGNYSKNFQTGKTDKPNDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE +H++CF+CAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  GECYHKNCFRCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  168


 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
             G+ ++  D      K++SF +GT DKC  C KTVY ++ ++ +G  +HK+CF+C+H   
Sbjct  78   TGKTDKPNDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCAHSGC  137

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQ  442
             L  S+Y+S++GVLYCK HF QLF E G+++   Q     R ++ + G +  S       
Sbjct  138  PLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRSASSGGASPPSDDLKPID  197

Query  443  D  445
            D
Sbjct  198  D  198



>ref|XP_010508108.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Camelina 
sativa]
Length=230

 Score =   281 bits (718),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HKSCFKCSHCKGTLV+SNYSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGN+SKNFQT K ++ N +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVTME
Sbjct  62   FEQLFKESGNYSKNFQTGKTDKPNDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE +H++CF+CAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  GECYHKNCFRCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  168


 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
             G+ ++  D      K++SF +GT DKC  C KTVY ++ ++ +G  +HK+CF+C+H   
Sbjct  78   TGKTDKPNDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCAHSGC  137

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQ  442
             L  S+Y+S++GVLYCK HF QLF E G+++   Q     R ++ + G +  S       
Sbjct  138  PLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRSASSGGASPPSDDLKPID  197

Query  443  D  445
            D
Sbjct  198  D  198



>ref|XP_004134333.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155874.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
Length=210

 Score =   280 bits (716),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 153/168 (91%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY V+LLS +G+ +HKSCFKCSHCKGTL MS+YS MDGVLYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYVVELLSLEGNPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKP-ERENSM-TKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKESGNFSKNFQ  KP E++N + ++ P+K+S+MFSGTQDKCA C+KTVYPLEKVT
Sbjct  62   FEQLFKESGNFSKNFQNAKPSEKQNDLQSRAPSKLSSMFSGTQDKCAACSKTVYPLEKVT  121

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            +EGE +H++CF+CAHGGC LTH++YA+LDGVLYCKHHFAQLFM KGNY
Sbjct  122  LEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNY  169


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +2

Query  74   RFNHVGRGERQTD-QNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKC  247
             F +    E+Q D Q+    K++S F+GT DKC AC KTVY ++ ++ +G  +HK+CF+C
Sbjct  75   NFQNAKPSEKQNDLQSRAPSKLSSMFSGTQDKCAACSKTVYPLEKVTLEGECYHKNCFRC  134

Query  248  SHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            +H    L  S+Y+++DGVLYCK HF QLF   GN++
Sbjct  135  AHGGCHLTHSSYAALDGVLYCKHHFAQLFMIKGNYN  170



>ref|XP_010469047.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Camelina sativa]
Length=216

 Score =   280 bits (716),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT K E+ N  ++ P ++S+ FSGTQDKCA C KTVYPLEK+TME
Sbjct  62   FEQLFKESGNFSKNFQTGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H++CF+CAH GCPLTH++YA+LDG+LYCK HF+QLF+EKGNY
Sbjct  122  GESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNY  167


 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +2

Query  83   HVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
              G+ E+  + +    +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H  
Sbjct  77   QTGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSG  136

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
              L  S+Y+++DG+LYCK HF QLF E GN+S   Q     R
Sbjct  137  CPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANNR  178



>gb|KDP28657.1| hypothetical protein JCGZ_14428 [Jatropha curcas]
Length=221

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 152/185 (82%), Gaps = 19/185 (10%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VD+LS +G  +HK CFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVVDMLSLEGVPYHKYCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTK------------------PERENS-MTKGPTKVSAMFSGTQ  442
            FEQLFKESGNFSKNFQ  K                   ER  S MT  P+KVS+MFSGTQ
Sbjct  62   FEQLFKESGNFSKNFQAGKRFLQCSYINIMLFYGMFFQERLRSKMTLAPSKVSSMFSGTQ  121

Query  443  DKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFM  622
            DKC+ C+KTVYPLEKVTMEGE FH+SCF+CAHGGCPLTH++YA+LDGVLYCKHHFAQLFM
Sbjct  122  DKCSACSKTVYPLEKVTMEGECFHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFM  181

Query  623  EKGNY  637
            EKG+Y
Sbjct  182  EKGSY  186


 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = +2

Query  62   VTLLRFNHVGRGER-QTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKS  235
            + ++ F  +   ER ++   +   K++S F+GT DKC AC KTVY ++ ++ +G  FHKS
Sbjct  88   INIMLFYGMFFQERLRSKMTLAPSKVSSMFSGTQDKCSACSKTVYPLEKVTMEGECFHKS  147

Query  236  CFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGP  409
            CF+C+H    L  S+Y+++DGVLYCK HF QLF E G+++   Q    +R  S T  P
Sbjct  148  CFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMEKGSYTHVLQAASHKRTASSTPPP  205



>gb|AGJ83944.1| lim protein 4 [Gossypium hirsutum]
Length=209

 Score =   280 bits (715),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTV+ VD+++ +G  +HK+CFKCSHCKG LVM+ YSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVHVVDMMTLEGVPYHKTCFKCSHCKGNLVMNTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT K E++N  ++ P K+S++FSGTQDKCA C KTVYPLEK+TME
Sbjct  62   FEQLFKESGNFSKNFQTAKTEKQNDTSRTPNKLSSLFSGTQDKCAACEKTVYPLEKITME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE FH++CF+CAHGGCPLTH++YA+L+G+LYCKHH+AQLFM KGNY 
Sbjct  122  GECFHKTCFRCAHGGCPLTHSSYAALNGILYCKHHYAQLFMVKGNYN  168


 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  86   VGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
              + E+Q D +    K++S F+GT DKC AC+KTVY ++ ++ +G  FHK+CF+C+H   
Sbjct  78   TAKTEKQNDTSRTPNKLSSLFSGTQDKCAACEKTVYPLEKITMEGECFHKTCFRCAHGGC  137

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
             L  S+Y++++G+LYCK H+ QLF   GN++   Q+    R  S
Sbjct  138  PLTHSSYAALNGILYCKHHYAQLFMVKGNYNHVLQSATHRRNTS  181



>ref|XP_010413443.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X3 [Camelina 
sativa]
 ref|XP_010413445.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X4 [Camelina 
sativa]
Length=216

 Score =   280 bits (715),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT K E+ N  ++ P ++S+ FSGTQDKCA C KTVYPLEK+TME
Sbjct  62   FEQLFKESGNFSKNFQTGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H++CF+CAH GCPLTH++YA+LDG+LYCK HF+QLF+EKGNY
Sbjct  122  GESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNY  167


 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +2

Query  83   HVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
              G+ E+  + +    +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H  
Sbjct  77   QTGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSG  136

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
              L  S+Y+++DG+LYCK HF QLF E GN+S   Q     R
Sbjct  137  CPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANNR  178



>ref|XP_010523025.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
 ref|XP_010523026.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
 ref|XP_010523027.1| PREDICTED: LIM domain-containing protein PLIM2b [Tarenaya hassleriana]
Length=208

 Score =   279 bits (714),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 149/166 (90%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC ACDKTVY VD+L+ +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCNACDKTVYVVDMLTLEGMPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT K E+   + + P+K+S++FSGT DKCA C KTVYPLEKVTME
Sbjct  62   FEQLFKESGNFSKNFQTGKSEKPE-LNRTPSKLSSLFSGTLDKCAACEKTVYPLEKVTME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAHGGCPLTH++YA+LDGVLYC+HHF QLF+EKGNY
Sbjct  121  GECYHKTCFRCAHGGCPLTHSSYAALDGVLYCRHHFNQLFLEKGNY  166


 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = +2

Query  86   VGRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
             G+ E+       +K  + F+GTLDKC AC+KTVY ++ ++ +G  +HK+CF+C+H    
Sbjct  78   TGKSEKPELNRTPSKLSSLFSGTLDKCAACEKTVYPLEKVTMEGECYHKTCFRCAHGGCP  137

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGP  409
            L  S+Y+++DGVLYC+ HF QLF E GN+S   Q+    R  S    P
Sbjct  138  LTHSSYAALDGVLYCRHHFNQLFLEKGNYSHVLQSAHHHRRTSSGSTP  185



>ref|XP_008232792.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
Length=217

 Score =   280 bits (715),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VD+LS +G  +HKSCFKCSHCKG L MS YSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ    E++N  + + P+K+S+MFSGT DKCATC+KTVYPLEKVT+
Sbjct  62   FEQLFKESGNFSKNFQPKSAEKQNEQLNRAPSKLSSMFSGTLDKCATCSKTVYPLEKVTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H+SCF+CAHGGCPLTH++YA+LDGVLYCKHHF+QLF+EKGNY
Sbjct  122  EGESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNY  168


 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +2

Query  95   GERQTDQ-NIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
             E+Q +Q N    K++S F+GTLDKC  C KTVY ++ ++ +G ++HKSCF+C+H    L
Sbjct  81   AEKQNEQLNRAPSKLSSMFSGTLDKCATCSKTVYPLEKVTLEGESYHKSCFRCAHGGCPL  140

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTT  373
              S+Y+++DGVLYCK HF QLF E GN+S   Q  
Sbjct  141  THSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAA  175



>ref|XP_010518219.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Camelina 
sativa]
Length=229

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HKSCFKCSHCKGTLV+SNYSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGN+SKNFQ  K ++ N +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVTME
Sbjct  62   FEQLFKESGNYSKNFQNGKTDKPNDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE +H++CF+CAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  GECYHKNCFRCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  168


 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 71/120 (59%), Gaps = 1/120 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ ++  D      K++SF +GT DKC  C KTVY ++ ++ +G  +HK+CF+C+H    
Sbjct  79   GKTDKPNDLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCAHSGCP  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQD  445
            L  S+Y+S++GVLYCK HF QLF E G+++   Q     R ++ + G +  S      +D
Sbjct  139  LTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRSASSGGASPPSDDLKPIED  198



>ref|XP_006304383.1| hypothetical protein CARUB_v10010886mg [Capsella rubella]
 gb|EOA37281.1| hypothetical protein CARUB_v10010886mg [Capsella rubella]
Length=205

 Score =   278 bits (712),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC ACDKTVY VD+LS +G  +HKSCF+C+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ  K E+   +TK P+K+S++F GTQDKCA C KTVYPLEKV ME
Sbjct  62   FEQLFKESGNFSKNFQPGKIEKPE-LTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAHGGC LTH++YASLDGVLYC+HHF QLFMEKGNY
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFMEKGNY  166


 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC AC+KTVY ++ +  +G  FHK+CF+C+H   TL
Sbjct  79   GKIEKPELTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTL  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              S+Y+S+DGVLYC+ HF QLF E GN++   Q     R  S    P + +
Sbjct  139  THSSYASLDGVLYCRHHFNQLFMEKGNYAHVLQAANHRRTASGNTLPPEAT  189



>emb|CDY18899.1| BnaC04g04510D [Brassica napus]
Length=227

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DLL+ +G+T+HKSCF+CSHC GTLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K E+ N  MT+ P+K+S+ FSGTQDKCATC KTVYPLEKV M
Sbjct  62   FEQLFKESGNFSKNFQTGKTEKSNDQMTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVNM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE +H++CFKCAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +2

Query  89   GRGERQTDQNIHTK-KMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
            G+ E+  DQ      K++SF +GT DKC  C KTVY ++ ++ +G  +HK+CFKC+H   
Sbjct  79   GKTEKSNDQMTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVNMEGECYHKTCFKCAHSGC  138

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
             L  S+Y+S++GVLYCK HF QLF E G+++   Q     R
Sbjct  139  PLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQAAAKHR  179



>ref|XP_010512457.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Camelina sativa]
Length=218

 Score =   279 bits (713),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT K E+ N  ++ P ++S+ FSGTQDKCA C KTVYPLEK+TME
Sbjct  62   FEQLFKESGNFSKNFQTGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H++CF+CAH GCPLTH++YA+LDG+LYCK HF+QLF+EKGNY
Sbjct  122  GESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNY  167


 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +2

Query  83   HVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
              G+ E+  + +    +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H  
Sbjct  77   QTGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSG  136

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
              L  S+Y+++DG+LYCK HF QLF E GN+S   Q     R
Sbjct  137  CPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANNR  178



>ref|XP_009143175.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDX74767.1| BnaA05g05130D [Brassica napus]
Length=229

 Score =   279 bits (713),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DLL+ +G+T+HKSCF+CSHC GTLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K E+ N  MT+ P+K+S+ FSGTQDKCATC KTVYPLEKV M
Sbjct  62   FEQLFKESGNFSKNFQTGKTEKSNDHMTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVNM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE +H++CFKCAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = +2

Query  86   VGRGERQTDQNIHT-KKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
             G+ E+  D       K++SF +GT DKC  C KTVY ++ ++ +G  +HK+CFKC+H  
Sbjct  78   TGKTEKSNDHMTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVNMEGECYHKTCFKCAHSG  137

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE  388
              L  S+Y+S++GVLYCK HF QLF E G+++   Q     R 
Sbjct  138  CPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQAAAKHRR  180



>ref|XP_004133874.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155817.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN56534.1| hypothetical protein Csa_3G122580 [Cucumis sativus]
Length=205

 Score =   278 bits (711),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VDLL+ +G+ +HK+CFKCSHCKGTL MS+YS MDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVVDLLTLEGNPYHKNCFKCSHCKGTLSMSSYSWMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT   ++ N +T+ P+K+S+MFSGTQDKC+ CTKTVYPLEKV++E
Sbjct  62   FEQLFKESGNFSKNFQTKSSDKPNDLTRTPSKLSSMFSGTQDKCSVCTKTVYPLEKVSLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE +H+ CF+CAHGGC LTH +YA+LDGVLYCKHHFAQLFM KGNY 
Sbjct  122  GECYHKKCFRCAHGGCHLTHCSYAALDGVLYCKHHFAQLFMVKGNYN  168


 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 64/106 (60%), Gaps = 7/106 (7%)
 Frame = +2

Query  98   ERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            ++  D      K++S F+GT DKC  C KTVY ++ +S +G  +HK CF+C+H    L  
Sbjct  82   DKPNDLTRTPSKLSSMFSGTQDKCSVCTKTVYPLEKVSLEGECYHKKCFRCAHGGCHLTH  141

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNF------SKNFQTTKPERENS  394
             +Y+++DGVLYCK HF QLF   GN+      + N +TT P  +++
Sbjct  142  CSYAALDGVLYCKHHFAQLFMVKGNYNHVLEAAANKKTTTPPADHT  187



>ref|XP_002882034.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58293.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score =   278 bits (712),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HKSCF+CSHCKGTLV+SNYSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCKGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGN+SKNFQT K E+ N  +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVTM
Sbjct  62   FEQLFKESGNYSKNFQTGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CF+C+H GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGESYHKTCFRCSHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   VGRGERQTDQNIHTK-KMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
             G+ E+  D    T  K++SF +GT DKC  C KTVY ++ ++ +G ++HK+CF+CSH  
Sbjct  78   TGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGESYHKTCFRCSHSG  137

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              L  S+Y+S++GVLYCK HF QLF E G+++   Q     R ++ + G +  S
Sbjct  138  CPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRSASSGGASPPS  191



>ref|XP_009138786.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Brassica 
rapa]
Length=210

 Score =   278 bits (710),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ+ K E+ N +T+ P+K+S+ FSGTQDKCA C KTVYPLEK+ ME
Sbjct  62   FEQLFKESGNFSKNFQSGKTEKSNDVTRAPSKLSSFFSGTQDKCAACKKTVYPLEKMAME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE++H++CF+CAHGGCPLTH++YA+L+G+LYCK HF+QLF+EKGNY 
Sbjct  122  GESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYN  168


 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 69/112 (62%), Gaps = 1/112 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ E+  D      K++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H    
Sbjct  79   GKTEKSNDVTRAPSKLSSFFSGTQDKCAACKKTVYPLEKMAMEGESYHKTCFRCAHGGCP  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
            L  S+Y++++G+LYCK HF QLF E GN++   +     R +   K    V+
Sbjct  139  LTHSSYAALNGILYCKVHFSQLFLEKGNYNHVLEAANHRRTSEEDKIEPNVN  190



>ref|XP_002878372.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54631.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score =   278 bits (710),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            MA+FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+ NYSSMDGVLYCK
Sbjct  1    MAAFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            THFEQLFKESGNFSKNFQT  K E+ N  T+ P ++S+ FSGTQDKCA C KTVYPLEK+
Sbjct  61   THFEQLFKESGNFSKNFQTAGKTEKSNETTRAPNRLSSFFSGTQDKCAACKKTVYPLEKM  120

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            TMEGE++H++CF+CAH GCPLTH++YA+LDG+LYCK HF+QLF+EKGNY 
Sbjct  121  TMEGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYN  170


 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F   G+ E+  +      +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H
Sbjct  77   FQTAGKTEKSNETTRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAH  136

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTK  415
                L  S+Y+++DG+LYCK HF QLF E GN++   Q     R  +  +  T+
Sbjct  137  SGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYNHVLQAAANHRRTAAEEDKTE  190



>ref|XP_010273176.1| PREDICTED: LIM domain-containing protein PLIM2c [Nelumbo nucifera]
Length=200

 Score =   277 bits (708),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GTL KCKACDKTVY VDLLSADG  +HKSCFKCSHCKGTLVMSNYSS+DGVLYCK H
Sbjct  2    AFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSLDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT K E+ +  +K P+K+S+MF GTQDKCATC KT YPLEKVT+E
Sbjct  62   FEQLFKESGNFSKNFQTGKSEKPSDGSKAPSKLSSMFCGTQDKCATCHKTAYPLEKVTVE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE++H+SCFKC+HGGC LT + YA+LDG+LYCKHHFAQLF EKG+Y 
Sbjct  122  GESYHKSCFKCSHGGCSLTPSNYAALDGILYCKHHFAQLFKEKGSYN  168


 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ E+ +D +    K++S F GT DKC  C KT Y ++ ++ +G ++HKSCFKCSH   +
Sbjct  79   GKSEKPSDGSKAPSKLSSMFCGTQDKCATCHKTAYPLEKVTVEGESYHKSCFKCSHGGCS  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            L  SNY+++DG+LYCK HF QLFKE G+++
Sbjct  139  LTPSNYAALDGILYCKHHFAQLFKEKGSYN  168



>emb|CDX71757.1| BnaC08g31170D [Brassica napus]
Length=216

 Score =   277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT  K ++ N MT+ P+K+S+ FSGTQDKCA C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNFSKNFQTAGKTDKSNEMTRAPSKLSSFFSGTQDKCAACKKTVYPLEKITM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CF+CAHGGCPLTH++YA+L+G+LYCK HF QLF+EKGNY
Sbjct  122  EGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHFNQLFLEKGNY  168


 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F   G+ ++  +      K++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+
Sbjct  75   NFQTAGKTDKSNEMTRAPSKLSSFFSGTQDKCAACKKTVYPLEKITMEGESYHKTCFRCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            H    L  S+Y++++G+LYCK HF QLF E GN+S
Sbjct  135  HGGCPLTHSSYAALNGILYCKVHFNQLFLEKGNYS  169



>ref|XP_004306805.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=216

 Score =   277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKAC+KTVY VD+LS +G  +HKSCFKCSHCKG L MS YSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACEKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNF  +  ++   + + P+K+S+MFSGTQDKCATC+KTVYPLEKVT+E
Sbjct  62   FEQLFKESGNFSKNFAKSAEKQNEVLNRAPSKLSSMFSGTQDKCATCSKTVYPLEKVTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H+SCF+CAHGGCPLTH++YA+LDG+LYCK HFAQLFMEKGNY
Sbjct  122  GESYHKSCFRCAHGGCPLTHSSYAALDGILYCKVHFAQLFMEKGNY  167


 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 65/101 (64%), Gaps = 2/101 (2%)
 Frame = +2

Query  80   NHVGRGERQTD-QNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            N     E+Q +  N    K++S F+GT DKC  C KTVY ++ ++ +G ++HKSCF+C+H
Sbjct  75   NFAKSAEKQNEVLNRAPSKLSSMFSGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCAH  134

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTK  376
                L  S+Y+++DG+LYCK HF QLF E GN+S   Q  K
Sbjct  135  GGCPLTHSSYAALDGILYCKVHFAQLFMEKGNYSHVLQAAK  175



>ref|NP_191682.2| GATA type zinc finger transcription factor family protein [Arabidopsis 
thaliana]
 sp|Q500W4.1|PLI2C_ARATH RecName: Full=LIM domain-containing protein PLIM2c; AltName: 
Full=Pollen-expressed LIM protein 2C [Arabidopsis thaliana]
 gb|AAY34164.1| At3g61230 [Arabidopsis thaliana]
 dbj|BAH30497.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80176.1| GATA type zinc finger transcription factor family protein [Arabidopsis 
thaliana]
Length=213

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            MA+FTGT DKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+ NYSSMDGVLYCK
Sbjct  1    MAAFTGTTDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            THFEQLFKESGNFSKNFQT  K E+ N  TK P ++S+ FSGTQDKCA C KTVYPLEK+
Sbjct  61   THFEQLFKESGNFSKNFQTAGKTEKSNDATKAPNRLSSFFSGTQDKCAACKKTVYPLEKM  120

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            TMEGE++H++CF+CAH GCPLTH++YA+LDGVLYCK HF+QLF+EKGNY 
Sbjct  121  TMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHFSQLFLEKGNYN  170


 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F   G+ E+  D      +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H
Sbjct  77   FQTAGKTEKSNDATKAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAH  136

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTK  415
                L  S+Y+++DGVLYCK HF QLF E GN++   Q     R ++  +  T+
Sbjct  137  SGCPLTHSSYAALDGVLYCKVHFSQLFLEKGNYNHVLQAAANHRRSTAEEDKTE  190



>gb|KFK37370.1| hypothetical protein AALP_AA4G247900 [Arabis alpina]
Length=232

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DLL+ +G+T+HKSCFKCSHCKGTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDLLNLEGNTYHKSCFKCSHCKGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ  K E+ N  +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVTM
Sbjct  62   FEQLFKESGNFSKNFQNGKTEKTNDQLTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CF+C H GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +2

Query  89   GRGERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
            G+ E+  DQ     +K  + F+GT DKC  C KTVY ++ ++ +G ++HK+CF+C+H   
Sbjct  79   GKTEKTNDQLTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVTMEGESYHKTCFRCTHSGC  138

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
             L  S+Y+S++GVLYCK HF QLF E G+++   Q     R
Sbjct  139  PLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHR  179



>ref|XP_010474800.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Camelina 
sativa]
 ref|XP_010474801.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Camelina 
sativa]
Length=205

 Score =   276 bits (706),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC ACDKTVY VD+LS +G  +HKSCF+C+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ  K E+   +T+ P+K+S++F GTQDKCA C KTVYPLEKV ME
Sbjct  62   FEQLFKESGNFSKNFQPGKTEKPE-LTRTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAHGGC LTH++YASLD VLYC+HHF QLFMEKGNY
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNY  166


 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC AC+KTVY ++ +  +G  FHK+CF+C+H   TL
Sbjct  79   GKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTL  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              S+Y+S+D VLYC+ HF QLF E GN++   Q T   R  S    P + +
Sbjct  139  THSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQATNHRRTASGNILPAEAT  189



>ref|XP_006418457.1| hypothetical protein EUTSA_v10008789mg [Eutrema salsugineum]
 gb|ESQ36810.1| hypothetical protein EUTSA_v10008789mg [Eutrema salsugineum]
Length=205

 Score =   276 bits (705),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC ACDKTVY VD+LS +G  +HKSCF+C+HC GTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCNGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ  K E+   +TK P+K+S++F GTQDKCA C KTVYPLEKV ME
Sbjct  62   FEQLFKESGNFSKNFQPGKTEKP-ELTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAHGGC LTH++YASLDGVLYC+HHF QLF+EKGNY
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFLEKGNY  166


 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC AC+KTVY ++ +  +G  FHK+CF+C+H   TL
Sbjct  79   GKTEKPELTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTL  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE---NSMTKGPTKVSAM  427
              S+Y+S+DGVLYC+ HF QLF E GN++   Q     R    N++   PT+  A+
Sbjct  139  THSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQAANHRRTASGNTLPPEPTEDIAV  194



>ref|XP_010469046.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Camelina sativa]
Length=217

 Score =   276 bits (706),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT  K E+ N  ++ P ++S+ FSGTQDKCA C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNFSKNFQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CF+CAH GCPLTH++YA+LDG+LYCK HF+QLF+EKGNY
Sbjct  122  EGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNY  168


 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F   G+ E+  + +    +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H
Sbjct  76   FQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAH  135

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
                L  S+Y+++DG+LYCK HF QLF E GN+S   Q     R
Sbjct  136  SGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANNR  179



>ref|XP_010479778.1| PREDICTED: LIM domain-containing protein PLIM2b [Camelina sativa]
 ref|XP_010457082.1| PREDICTED: LIM domain-containing protein PLIM2b [Camelina sativa]
Length=205

 Score =   276 bits (705),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC ACDKTVY VD+LS +G  +HKSCF+C+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCNACDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ  K E+   +T+ P+K+S++F GTQDKCA C KTVYPLEKV ME
Sbjct  62   FEQLFKESGNFSKNFQPGKTEKPE-LTRTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAHGGC LTH++YASLD VLYC+HHF QLFMEKGNY
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNY  166


 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 65/111 (59%), Gaps = 0/111 (0%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC AC+KTVY ++ +  +G  FHK+CF+C+H   TL
Sbjct  79   GKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTL  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              S+Y+S+D VLYC+ HF QLF E GN++   Q     R  S    P + +
Sbjct  139  THSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQAANHRRTASGNTLPPEAT  189



>ref|XP_010413441.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X1 [Camelina 
sativa]
 ref|XP_010413442.1| PREDICTED: LIM domain-containing protein PLIM2c isoform X2 [Camelina 
sativa]
Length=217

 Score =   276 bits (706),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT  K E+ N  ++ P ++S+ FSGTQDKCA C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNFSKNFQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CF+CAH GCPLTH++YA+LDG+LYCK HF+QLF+EKGNY
Sbjct  122  EGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNY  168


 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F   G+ E+  + +    +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H
Sbjct  76   FQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAH  135

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
                L  S+Y+++DG+LYCK HF QLF E GN+S   Q     R
Sbjct  136  SGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANNR  179



>ref|XP_006402504.1| hypothetical protein EUTSA_v10006235mg [Eutrema salsugineum]
 gb|ESQ43957.1| hypothetical protein EUTSA_v10006235mg [Eutrema salsugineum]
Length=214

 Score =   276 bits (705),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT  K E+ N MT+ P+K+S+ FSGTQDKCA C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNFSKNFQTAGKTEKPNEMTRAPSKLSSFFSGTQDKCAACKKTVYPLEKMTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CF+CAH GCPLTH++YA+L+G+LYCK HF+QLF+EKGNY 
Sbjct  122  EGESYHKTCFRCAHSGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYN  169


 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 68/109 (62%), Gaps = 1/109 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F   G+ E+  +      K++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+
Sbjct  75   NFQTAGKTEKPNEMTRAPSKLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSM  397
            H    L  S+Y++++G+LYCK HF QLF E GN++   Q    +R   +
Sbjct  135  HSGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYNHVLQAAANQRRTPV  183



>ref|XP_010512456.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Camelina sativa]
Length=219

 Score =   275 bits (703),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT  K E+ N  ++ P ++S+ FSGTQDKCA C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNFSKNFQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CF+CAH GCPLTH++YA+LDG+LYCK HF+QLF+EKGNY
Sbjct  122  EGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNY  168


 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F   G+ E+  + +    +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H
Sbjct  76   FQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAH  135

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
                L  S+Y+++DG+LYCK HF QLF E GN+S   Q     R
Sbjct  136  SGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANNR  179



>ref|XP_006397773.1| hypothetical protein EUTSA_v10001618mg [Eutrema salsugineum]
 gb|ESQ39226.1| hypothetical protein EUTSA_v10001618mg [Eutrema salsugineum]
Length=228

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DLL+ +G+T+HKSCF+CSHC GTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K E+ N  +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVTM
Sbjct  62   FEQLFKESGNFSKNFQTGKTEKPNDHLTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CF+C H GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 63/102 (62%), Gaps = 2/102 (2%)
 Frame = +2

Query  89   GRGERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
            G+ E+  D      +K  + F+GT DKC  C KTVY ++ ++ +G ++HK+CF+C+H   
Sbjct  79   GKTEKPNDHLTRAPSKLSSFFSGTQDKCATCHKTVYPLEKVTMEGESYHKTCFRCTHSGC  138

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE  388
             L  S+Y+S++GVLYCK HF QLF E G+++   Q     R 
Sbjct  139  PLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRR  180



>emb|CDY27358.1| BnaC04g50470D [Brassica napus]
Length=230

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HKSCF+CSHC GTL MS YSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMSTYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K E+ N  MT+ P+K+S+ FSGTQDKCA+C KTVYPLEKV M
Sbjct  62   FEQLFKESGNFSKNFQTGKTEKSNDQMTRAPSKLSSFFSGTQDKCASCHKTVYPLEKVNM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE +H++CFKCAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (61%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   VGRGERQTDQNIHTK-KMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
             G+ E+  DQ      K++SF +GT DKC +C KTVY ++ ++ +G  +HK+CFKC+H  
Sbjct  78   TGKTEKSNDQMTRAPSKLSSFFSGTQDKCASCHKTVYPLEKVNMEGECYHKTCFKCAHSG  137

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              L  S+Y+S++GVLYCK HF QLF E G+++   Q     R  + +   T  S
Sbjct  138  CPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRTASSGASTPPS  191



>gb|ABL74496.1| LIM domain protein PLIM2b [Populus tremula x Populus alba]
Length=173

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  155  LDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLF  334
            LDKCKACDKTVY VD++S +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLF
Sbjct  1    LDKCKACDKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLF  60

Query  335  KESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTMEGEAFH  514
            KE G+FSKNFQ  KPER + + + P+K+S++F GTQDKC+TC KTVYPLEKVTMEGE +H
Sbjct  61   KEGGDFSKNFQKGKPERTHELIRTPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYH  120

Query  515  RSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            ++CF+CAHGGCPLTH++YA+LDGVLYCK HFAQLFMEKG Y
Sbjct  121  KTCFRCAHGGCPLTHSSYAALDGVLYCKVHFAQLFMEKGTY  161


 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ ER  +      K++S F GT DKC  C KTVY ++ ++ +G  +HK+CF+C+H    
Sbjct  73   GKPERTHELIRTPSKLSSVFCGTQDKCSTCGKTVYPLEKVTMEGECYHKTCFRCAHGGCP  132

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            L  S+Y+++DGVLYCK HF QLF E G +S
Sbjct  133  LTHSSYAALDGVLYCKVHFAQLFMEKGTYS  162



>ref|XP_006296425.1| hypothetical protein CARUB_v10025604mg [Capsella rubella]
 gb|EOA29323.1| hypothetical protein CARUB_v10025604mg [Capsella rubella]
Length=225

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HKSCFKC+HCKGTLV+SNYSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFKCTHCKGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGN+SKNFQ  K E+ N  +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVTM
Sbjct  62   FEQLFKESGNYSKNFQNGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE +H++CF+C H GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGECYHKNCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = +2

Query  89   GRGERQTDQNIHTK-KMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
            G+ E+  D    T  K++SF +GT DKC  C KTVY ++ ++ +G  +HK+CF+C+H   
Sbjct  79   GKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGECYHKNCFRCTHSGC  138

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
             L  S+Y+S++GVLYCK HF QLF E G+++   Q     R ++ + G +  S
Sbjct  139  PLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRSASSGGASPPS  191



>emb|CDY56926.1| BnaAnng14450D [Brassica napus]
Length=212

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMRYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ+  K E+ N +T+ P+K+S+ FSGTQDKC  C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNFSKNFQSAGKTEKTNDVTRAPSKLSSFFSGTQDKCPACKKTVYPLEKITM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CF+CAHGGCPLTH++YA+L+GVLYCK HF+QLF+EKGNY 
Sbjct  122  EGESYHKTCFRCAHGGCPLTHSSYAALNGVLYCKVHFSQLFLEKGNYN  169


 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F   G+ E+  D      K++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H
Sbjct  76   FQSAGKTEKTNDVTRAPSKLSSFFSGTQDKCPACKKTVYPLEKITMEGESYHKTCFRCAH  135

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
                L  S+Y++++GVLYCK HF QLF E GN++   Q     R
Sbjct  136  GGCPLTHSSYAALNGVLYCKVHFSQLFLEKGNYNHVLQAANNRR  179



>ref|XP_009116783.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
 emb|CDY48936.1| BnaA09g39010D [Brassica napus]
Length=218

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNF T  K E+ N +T+ P+K+S+ FSGTQDKCA C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNFSKNFHTAGKTEKSNDVTRAPSKLSSFFSGTQDKCAACKKTVYPLEKITM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CF+CAHGGCPLTH++YA+L+G+LYCK HF QLF+EKGNY 
Sbjct  122  EGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHFNQLFLEKGNYN  169


 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F+  G+ E+  D      K++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+
Sbjct  75   NFHTAGKTEKSNDVTRAPSKLSSFFSGTQDKCAACKKTVYPLEKITMEGESYHKTCFRCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPT  412
            H    L  S+Y++++G+LYCK HF QLF E GN++        +R +   K  T
Sbjct  135  HGGCPLTHSSYAALNGILYCKVHFNQLFLEKGNYNHVLAAANHKRSSEEDKTET  188



>ref|XP_009138785.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Brassica 
rapa]
 emb|CDX89105.1| BnaA04g00810D [Brassica napus]
Length=211

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ+  K E+ N +T+ P+K+S+ FSGTQDKCA C KTVYPLEK+ M
Sbjct  62   FEQLFKESGNFSKNFQSAGKTEKSNDVTRAPSKLSSFFSGTQDKCAACKKTVYPLEKMAM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CF+CAHGGCPLTH++YA+L+G+LYCK HF+QLF+EKGNY 
Sbjct  122  EGESYHKTCFRCAHGGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYN  169


 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 1/116 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F   G+ E+  D      K++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H
Sbjct  76   FQSAGKTEKSNDVTRAPSKLSSFFSGTQDKCAACKKTVYPLEKMAMEGESYHKTCFRCAH  135

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
                L  S+Y++++G+LYCK HF QLF E GN++   +     R +   K    V+
Sbjct  136  GGCPLTHSSYAALNGILYCKVHFSQLFLEKGNYNHVLEAANHRRTSEEDKIEPNVN  191



>ref|XP_010055180.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW71657.1| hypothetical protein EUGRSUZ_E00179 [Eucalyptus grandis]
Length=218

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VD+LS +G  +HK+CF+CSHC G LVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVVDMLSLEGMPYHKNCFRCSHCNGHLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTK-PERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQL+KESGNFSKNFQT K  ER++ + + P+++S++FSGT DKC TC KTVYPLEKVT+
Sbjct  62   FEQLYKESGNFSKNFQTAKSSERQHDLNRTPSRLSSLFSGTLDKCTTCGKTVYPLEKVTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE FH++CF+CAHGGC LTH++YA+LDGV YCKHHFA+LFMEKGNY
Sbjct  122  EGECFHKNCFRCAHGGCALTHSSYAALDGVFYCKHHFARLFMEKGNY  168


 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 65/107 (61%), Gaps = 1/107 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F      ERQ D N    +++S F+GTLDKC  C KTVY ++ ++ +G  FHK+CF+C+H
Sbjct  76   FQTAKSSERQHDLNRTPSRLSSLFSGTLDKCTTCGKTVYPLEKVTLEGECFHKNCFRCAH  135

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
                L  S+Y+++DGV YCK HF +LF E GN+S   +     R  S
Sbjct  136  GGCALTHSSYAALDGVFYCKHHFARLFMEKGNYSHVLEGAVHRRNMS  182



>ref|XP_010054850.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW78044.1| hypothetical protein EUGRSUZ_D02268 [Eucalyptus grandis]
Length=208

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGT+DKCK CDKTV+ VD+++ +G  +HK+CF+CSHC GTLVMSNYSSMDGVLYCKTH
Sbjct  2    AFTGTVDKCKVCDKTVHVVDMMTLEGIPYHKTCFRCSHCNGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESG+F KNF + K ++ N MT+ P+K+S+MFSGT DKC++C KTVYPLEKVTME
Sbjct  62   FEQLFKESGDFRKNFHSAKSDKPNEMTRTPSKLSSMFSGTLDKCSSCNKTVYPLEKVTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE +H++CF+CAHGGCPLTH++YA+LDGVLYC+HHFA+LFMEKG+++
Sbjct  122  GECYHKTCFRCAHGGCPLTHSSYAALDGVLYCRHHFARLFMEKGDFK  168


 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = +2

Query  83   HVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
            H  + ++  +      K++S F+GTLDKC +C+KTVY ++ ++ +G  +HK+CF+C+H  
Sbjct  77   HSAKSDKPNEMTRTPSKLSSMFSGTLDKCSSCNKTVYPLEKVTMEGECYHKTCFRCAHGG  136

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGT  439
              L  S+Y+++DGVLYC+ HF +LF E G+F     +    R  S    P + + + + T
Sbjct  137  CPLTHSSYAALDGVLYCRHHFARLFMEKGDFKHVLDSATHRRNASSGTPPPEPAELVTET  196

Query  440  Q  442
             
Sbjct  197  D  197



>ref|XP_002892043.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68302.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   273 bits (699),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC  CDKTVY VD+LS +G  +HKSCF+C+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ  K E+   +TK P+K+S++F GTQDKCA C KTVYPLEK+ ME
Sbjct  62   FEQLFKESGNFSKNFQPGKTEKPE-LTKTPSKISSIFCGTQDKCAACEKTVYPLEKIQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAHGGC LTH++YASLD VLYC+HHF QLF+EKGNY
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFLEKGNY  166


 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC AC+KTVY ++ +  +G  FHK+CF+C+H   TL
Sbjct  79   GKTEKPELTKTPSKISSIFCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTL  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE---NSMTKGPTKVSAM  427
              S+Y+S+D VLYC+ HF QLF E GN++   Q     R    N++T  PT+  A+
Sbjct  139  THSSYASLDSVLYCRHHFNQLFLEKGNYAHVLQAANHRRTASGNTLTPEPTEDIAV  194



>emb|CDY37066.1| BnaA04g26440D [Brassica napus]
Length=229

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HKSCF+CSHC GTL M+ YSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMTTYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K E+ N  MT+ P+K+S+ FSGTQDKCA+C KTVYPLEKV M
Sbjct  62   FEQLFKESGNFSKNFQTGKTEKSNDQMTRAPSKLSSFFSGTQDKCASCHKTVYPLEKVNM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE +H++CFKCAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (61%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   VGRGERQTDQNIHTK-KMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
             G+ E+  DQ      K++SF +GT DKC +C KTVY ++ ++ +G  +HK+CFKC+H  
Sbjct  78   TGKTEKSNDQMTRAPSKLSSFFSGTQDKCASCHKTVYPLEKVNMEGECYHKTCFKCAHSG  137

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              L  S+Y+S++GVLYCK HF QLF E G+++   Q     R  + +   T  S
Sbjct  138  CPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRTASSGASTPPS  191



>ref|NP_182104.1| protein PLIM2A [Arabidopsis thaliana]
 sp|O80839.1|PLI2A_ARATH RecName: Full=LIM domain-containing protein PLIM2a; AltName: 
Full=Pollen-expressed LIM protein 2; Short=AtPLIM2 [Arabidopsis 
thaliana]
 gb|AAC28544.1| putative LIM-domain protein [Arabidopsis thaliana]
 dbj|BAC42675.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AAO64006.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AEC10602.1| protein PLIM2A [Arabidopsis thaliana]
Length=226

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HKSCF+C+HCKGTLV+SNYSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGN+SKNFQ  K E+ N  +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVTM
Sbjct  62   FEQLFKESGNYSKNFQAGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CF+C H GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   VGRGERQTDQNIHTK-KMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
             G+ E+  D    T  K++SF +GT DKC  C KTVY ++ ++ +G ++HK+CF+C+H  
Sbjct  78   AGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEKVTMEGESYHKTCFRCTHSG  137

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              L  S+Y+S++GVLYCK HF QLF E G+++   Q     R ++ + G +  S
Sbjct  138  CPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRSASSGGASPPS  191



>ref|XP_009142366.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
Length=229

 Score =   274 bits (700),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HKSCF+CSHC GTL M+ YSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCSHCNGTLQMTTYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K E+ N  MT+ P+K+S+ FSGTQDKCA+C KTVYPLEKV M
Sbjct  62   FEQLFKESGNFSKNFQTGKTEKSNDQMTRAPSKLSSFFSGTQDKCASCHKTVYPLEKVNM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE +H++CFKCAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  122  EGECYHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  169


 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (61%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   VGRGERQTDQNIHTK-KMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
             G+ E+  DQ      K++SF +GT DKC +C KTVY ++ ++ +G  +HK+CFKC+H  
Sbjct  78   TGKTEKSNDQMTRAPSKLSSFFSGTQDKCASCHKTVYPLEKVNMEGECYHKTCFKCAHSG  137

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              L  S+Y+S++GVLYCK HF QLF E G+++   Q     R  + +   T  S
Sbjct  138  CPLTHSSYASLNGVLYCKVHFNQLFLEKGSYNHVHQAAANHRRTASSGASTPPS  191



>ref|XP_006292212.1| hypothetical protein CARUB_v10018418mg [Capsella rubella]
 gb|EOA25110.1| hypothetical protein CARUB_v10018418mg [Capsella rubella]
Length=216

 Score =   273 bits (697),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+ NYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT  K E+ N  ++ P ++S+ FSGTQDKCA C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNFSKNFQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CF+CAH GCPLTH++YA+LDG+LYCK HF+QLF+EKGNY
Sbjct  122  EGESYHKTCFRCAHSGCPLTHSSYAALDGILYCKVHFSQLFLEKGNY  168


 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F   G+ E+  + +    +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H
Sbjct  76   FQTAGKTEKSNETSRAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAH  135

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
                L  S+Y+++DG+LYCK HF QLF E GN+S   Q     R
Sbjct  136  SGCPLTHSSYAALDGILYCKVHFSQLFLEKGNYSHVLQAAANHR  179



>gb|KFK35322.1| hypothetical protein AALP_AA5G269200 [Arabis alpina]
Length=213

 Score =   272 bits (696),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC  TLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNHTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGN+SKNF T K E+ N +TK P+K+S+ FSGTQDKCA C KTVYPLEK+TME
Sbjct  62   FEQLFKESGNYSKNFHTGKTEKSNEVTKAPSKLSSFFSGTQDKCAACKKTVYPLEKMTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H++CF+CAHGGC LTH++YA+L+GVLYCK HF QLF+EKGNY
Sbjct  122  GESYHKNCFRCAHGGCHLTHSSYAALNGVLYCKVHFNQLFLEKGNY  167


 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +2

Query  83   HVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCK  259
            H G+ E+  +      K++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H  
Sbjct  77   HTGKTEKSNEVTKAPSKLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKNCFRCAHGG  136

Query  260  GTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
              L  S+Y++++GVLYCK HF QLF E GN+S    +    R
Sbjct  137  CHLTHSSYAALNGVLYCKVHFNQLFLEKGNYSHVLASANNHR  178



>ref|NP_171683.1| LIM family protein [Arabidopsis thaliana]
 sp|Q1ECF5.1|PLI2B_ARATH RecName: Full=LIM domain-containing protein PLIM2b; AltName: 
Full=Pollen-expressed LIM protein 2B [Arabidopsis thaliana]
 gb|ABF83669.1| At1g01780 [Arabidopsis thaliana]
 dbj|BAH20039.1| AT1G01780 [Arabidopsis thaliana]
 gb|AEE27334.1| LIM domain-containing protein [Arabidopsis thaliana]
Length=205

 Score =   271 bits (694),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC  CDKTVY VD+LS +G  +HKSCF+C+HCKGTL MSNYSSMDGVLYCKTH
Sbjct  2    SFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ  K E+   +T+ P+K+S++F GTQDKCA C KTVYPLEK+ ME
Sbjct  62   FEQLFKESGNFSKNFQPGKTEKPE-LTRTPSKISSIFCGTQDKCAACEKTVYPLEKIQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAHGGC LTH++YASLD VLYC+HHF QLFMEKGNY
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNY  166


 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC AC+KTVY ++ +  +G  FHK+CF+C+H   TL
Sbjct  79   GKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTL  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE---NSMTKGPTKVSAM  427
              S+Y+S+D VLYC+ HF QLF E GN++   Q     R    N++   PT+  A+
Sbjct  139  THSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQAANHRRTASGNTLPPEPTEDVAV  194



>ref|XP_003521910.2| PREDICTED: pollen-specific protein SF3-like [Glycine max]
Length=206

 Score =   270 bits (690),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC ACDKTVY VDLL+ +G T+HK+CFKCSHCKG L MS YSSMDG+LYCKTH
Sbjct  2    SFTGTLDKCTACDKTVYVVDLLTLEGITYHKNCFKCSHCKGCLTMSTYSSMDGILYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNF  +  E++N + + P+K+S+MFSGT DKC+ CTKTVYPLEK+T+E
Sbjct  62   FEQLFKESGNFSKNFAKSS-EKQNDLNRTPSKLSSMFSGTLDKCSVCTKTVYPLEKMTLE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAH GCPLTH+ YA+LDGVLYC+ HFAQLFMEKGNY
Sbjct  121  GECFHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGNY  166


 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +2

Query  80   NHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHC  256
            N     E+Q D N    K++S F+GTLDKC  C KTVY ++ ++ +G  FHK+CF+C+H 
Sbjct  75   NFAKSSEKQNDLNRTPSKLSSMFSGTLDKCSVCTKTVYPLEKMTLEGECFHKTCFRCAHA  134

Query  257  KGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMT  400
               L  SNY+++DGVLYC+ HF QLF E GN+S   Q     R  S T
Sbjct  135  GCPLTHSNYAALDGVLYCRVHFAQLFMEKGNYSHVLQAAAHRRTGSST  182



>gb|KEH18910.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=205

 Score =   270 bits (690),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY VDLL+ +   +HKSCFKCSHCKG L MS YSSMDG+LYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYVVDLLTLENIPYHKSCFKCSHCKGNLTMSTYSSMDGILYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNF  +  ++ N + + P+++S+MFSGT DKCATC+KTVYPLEKVT+E
Sbjct  62   FEQLFKESGNFSKNFAKSS-DKANELNRTPSRLSSMFSGTLDKCATCSKTVYPLEKVTLE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAH GCPLTH+ YA+LDGVLYC+ HFAQLFMEKGNY
Sbjct  121  GEIYHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGNY  166


 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +2

Query  80   NHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHC  256
            N     ++  + N    +++S F+GTLDKC  C KTVY ++ ++ +G  +HK+CF+C+H 
Sbjct  75   NFAKSSDKANELNRTPSRLSSMFSGTLDKCATCSKTVYPLEKVTLEGEIYHKTCFRCAHA  134

Query  257  KGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
               L  SNY+++DGVLYC+ HF QLF E GN+S
Sbjct  135  GCPLTHSNYAALDGVLYCRVHFAQLFMEKGNYS  167



>ref|XP_010107618.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXC16357.1| Pollen-specific protein SF3 [Morus notabilis]
Length=213

 Score =   270 bits (690),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 151/188 (80%), Gaps = 22/188 (12%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKAC+KTVY VD++S +G  +HKSCFKCSHCKGTL MS+YS MDGVLYCK H
Sbjct  2    AFTGTLDKCKACNKTVYVVDMMSLEGVPYHKSCFKCSHCKGTLSMSSYSWMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT---------------------KPERENS-MTKGPTKVSAMFS  433
            FEQLFKESGNFSKNFQT                        ER+N  + + P+K+S++FS
Sbjct  62   FEQLFKESGNFSKNFQTVFLLGLFANNNKRVGEKFVTAKSSERQNDQLARAPSKLSSLFS  121

Query  434  GTQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQ  613
            GTQDKCATC+KTVYPLEKV++EGE +H+SCF+CAHGGCPLTH++YA+LDGVLYCKHHF Q
Sbjct  122  GTQDKCATCSKTVYPLEKVSLEGECYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFQQ  181

Query  614  LFMEKGNY  637
            LFMEKGNY
Sbjct  182  LFMEKGNY  189


 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 3/106 (3%)
 Frame = +2

Query  44   TNNSKRVTLLRFNHVGRGERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVDLLSADG  217
             NN+KRV   +F      ERQ DQ     +K  + F+GT DKC  C KTVY ++ +S +G
Sbjct  86   ANNNKRVGE-KFVTAKSSERQNDQLARAPSKLSSLFSGTQDKCATCSKTVYPLEKVSLEG  144

Query  218  STFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
              +HKSCF+C+H    L  S+Y+++DGVLYCK HF+QLF E GN+S
Sbjct  145  ECYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFQQLFMEKGNYS  190



>emb|CDY38028.1| BnaCnng08890D [Brassica napus]
Length=205

 Score =   270 bits (689),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC  CDKTVY +D+LS +G  +HKSCFKC+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ  K E+    +K P+K+S++F GTQDKCA C KTVYPLEKV ME
Sbjct  62   FEQLFKESGNFSKNFQPGKTEKPE-QSKTPSKISSIFCGTQDKCAACDKTVYPLEKVQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CFKCAHGGC LTH++YASLDGVLYC+HHF QLF+EKGNY
Sbjct  121  GECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHFNQLFLEKGNY  166


 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC ACDKTVY ++ +  +G  FHK+CFKC+H    L
Sbjct  79   GKTEKPEQSKTPSKISSIFCGTQDKCAACDKTVYPLEKVQMEGECFHKTCFKCAHGGCML  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              S+Y+S+DGVLYC+ HF QLF E GN++   Q+    R  S    P + +
Sbjct  139  THSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQSANHRRTASGNTLPPETT  189



>gb|AAF78411.1|AC009273_17 Contains similarity to mRNA for transcription factor L2 from 
Arabidopsis thaliana gb|X91398. It contains LIM domain containing 
proteins PF|00412. ESTs gb|T13084 and gb|T42925 come from 
this gene [Arabidopsis thaliana]
Length=261

 Score =   272 bits (695),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC  CDKTVY VD+LS +G  +HKSCF+C+HCKGTL MSNYSSMDGVLYCKTH
Sbjct  58   SFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKTH  117

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ  K E+   +T+ P+K+S++F GTQDKCA C KTVYPLEK+ ME
Sbjct  118  FEQLFKESGNFSKNFQPGKTEKP-ELTRTPSKISSIFCGTQDKCAACEKTVYPLEKIQME  176

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAHGGC LTH++YASLD VLYC+HHF QLFMEKGNY
Sbjct  177  GECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNY  222


 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC AC+KTVY ++ +  +G  FHK+CF+C+H   TL
Sbjct  135  GKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTL  194

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE---NSMTKGPTKVSAM  427
              S+Y+S+D VLYC+ HF QLF E GN++   Q     R    N++   PT+  A+
Sbjct  195  THSSYASLDSVLYCRHHFNQLFMEKGNYAHVLQAANHRRTASGNTLPPEPTEDVAV  250



>ref|NP_001237551.1| uncharacterized protein LOC100305845 [Glycine max]
 gb|ACU13723.1| unknown [Glycine max]
 gb|KHN04651.1| Pollen-specific protein SF3 [Glycine soja]
Length=210

 Score =   270 bits (690),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC ACDKTVY VDLL+ +G  +HK+CFKCSHCKG L M  YSSMDG+LYCKTH
Sbjct  2    SFTGTLDKCTACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGCLTMCTYSSMDGILYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNF  +  E++N + + P+K+S+MFSGTQDKC+ CTKTVYPLEK+T+E
Sbjct  62   FEQLFKESGNFSKNFAKSS-EKQNELNRTPSKLSSMFSGTQDKCSVCTKTVYPLEKMTLE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAH GCPLTH+ YA+LDGVLYC+ HFAQLFMEKGNY
Sbjct  121  GECFHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGNY  166


 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 80/140 (57%), Gaps = 9/140 (6%)
 Frame = +2

Query  80   NHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHC  256
            N     E+Q + N    K++S F+GT DKC  C KTVY ++ ++ +G  FHK+CF+C+H 
Sbjct  75   NFAKSSEKQNELNRTPSKLSSMFSGTQDKCSVCTKTVYPLEKMTLEGECFHKTCFRCAHA  134

Query  257  KGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMT----KGPTKVSA  424
               L  SNY+++DGVLYC+ HF QLF E GN++   Q     R  S T    + P++  A
Sbjct  135  GCPLTHSNYAALDGVLYCRVHFAQLFMEKGNYNHVLQAAAHRRTGSSTPPLLEEPSQEPA  194

Query  425  MFSGTQDKCATCTKTVYPLE  484
              +  +D+    T+   PLE
Sbjct  195  PPASHEDQ----TEEETPLE  210



>ref|XP_009118834.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=205

 Score =   270 bits (689),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC  CDKTVY +D+LS +G  +HKSCFKC+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQ  K E+     K P+K+S++F GTQDKCA C KTVYPLEKV ME
Sbjct  62   FEQLFKESGNFSKNFQPGKTEKP-EQNKTPSKISSIFCGTQDKCAACDKTVYPLEKVQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CFKCAHGGC LTH++YASLDGVLYC+HHF QLF+EKGNY
Sbjct  121  GECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHFNQLFLEKGNY  166


 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC ACDKTVY ++ +  +G  FHK+CFKC+H    L
Sbjct  79   GKTEKPEQNKTPSKISSIFCGTQDKCAACDKTVYPLEKVQMEGECFHKTCFKCAHGGCML  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              S+Y+S+DGVLYC+ HF QLF E GN++   Q+    R  S    P + +
Sbjct  139  THSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQSANHRRTASGNTLPPETT  189



>ref|XP_008337059.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008343387.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=219

 Score =   270 bits (690),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKC ACDKTVY  ++LS +G  +HKSCFKCSHCKG L MS YSSMDGVLYCK H
Sbjct  2    AFTGTLDKCSACDKTVYVTEMLSLEGVPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNF KNF  +  ++   + + P+K+S+MF GTQDKCATC+KTVYPLEKVT+E
Sbjct  62   FEQLFKESGNFGKNFAKSAEKQGEQLNRAPSKLSSMFCGTQDKCATCSKTVYPLEKVTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H+SCF+CAHGGCPLTH++YA+LDGVLYCKHHF+QLF+EKGNY
Sbjct  122  GESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNY  167


 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 64/100 (64%), Gaps = 2/100 (2%)
 Frame = +2

Query  80   NHVGRGERQTDQ-NIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            N     E+Q +Q N    K++S F GT DKC  C KTVY ++ ++ +G ++HKSCF+C+H
Sbjct  75   NFAKSAEKQGEQLNRAPSKLSSMFCGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCAH  134

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTT  373
                L  S+Y+++DGVLYCK HF QLF E GN+S   Q  
Sbjct  135  GGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAA  174



>ref|XP_003623892.1| LIM domain protein 2b [Medicago truncatula]
 gb|AES80110.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=212

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY VDLL+ +G  +HKSC KC+HCKG L MS YSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVVDLLTLEGIPYHKSCLKCTHCKGNLTMSTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ    E+ N  M + P+++S+MFSGT DKCA CTKTVYPLEK+++
Sbjct  62   FEQLFKESGNFSKNFQAKSSEKINELMNRTPSRLSSMFSGTLDKCAVCTKTVYPLEKMSL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE +H++CF+CAHGGC LTH++YA+LDGVLYCKHHF QLFMEKGNY 
Sbjct  122  EGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHFQQLFMEKGNYN  169


 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GTLDKC  C KTVY ++ +S +G  +HK+CF+C+H    L  S+Y+++DGVLYCK HF
Sbjct  99   FSGTLDKCAVCTKTVYPLEKMSLEGECYHKNCFRCAHGGCHLTHSSYAALDGVLYCKHHF  158

Query  323  EQLFKESGNFSKNFQTTKPERENS  394
            +QLF E GN++   Q    ++ ++
Sbjct  159  QQLFMEKGNYNHVLQAAANKKNST  182



>ref|XP_009119735.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 ref|XP_009119736.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDX90059.1| BnaA10g00230D [Brassica napus]
Length=205

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC  CDKTVY +D+LS +G  +HKSCFKC+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            F+QLFKESGNFSKNFQ  K E+    TK P+K+S++F GTQDKCA C KTVYPLEKV ME
Sbjct  62   FDQLFKESGNFSKNFQPGKTEKPEH-TKTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAHGGC LTH++YASLDGVLYC+HHF QLF+EKGNY
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFLEKGNY  166


 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC AC+KTVY ++ +  +G  FHK+CF+C+H   TL
Sbjct  79   GKTEKPEHTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTL  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE---NSMTKGPT  412
              S+Y+S+DGVLYC+ HF QLF E GN++   Q     R    NS+   PT
Sbjct  139  THSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQAANHRRTASGNSLPPEPT  189



>emb|CDY01571.1| BnaC07g35610D [Brassica napus]
Length=205

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC  CDKTVY +D+LS +G  +HKSCFKC+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTTDKCNVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            F+QLFKESGNFSKNFQ  K E+    +K P+K+S++F GTQDKCA C KTVYPLEKV ME
Sbjct  62   FDQLFKESGNFSKNFQPGKTEKPE-QSKTPSKISSIFCGTQDKCAACDKTVYPLEKVQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CFKCAHGGC LTH++YASLDGVLYC+HHF QLF+EKGNY
Sbjct  121  GECFHKTCFKCAHGGCMLTHSSYASLDGVLYCRHHFNQLFLEKGNY  166


 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC ACDKTVY ++ +  +G  FHK+CFKC+H    L
Sbjct  79   GKTEKPEQSKTPSKISSIFCGTQDKCAACDKTVYPLEKVQMEGECFHKTCFKCAHGGCML  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
              S+Y+S+DGVLYC+ HF QLF E GN++   Q+    R  S    P + +
Sbjct  139  THSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQSANHRRTASGNTLPPETT  189



>emb|CDY15152.1| BnaC05g00310D [Brassica napus]
Length=205

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC  CDKTVY +D+LS +G  +HKSCFKC+HCKGTLVMSNYSSMDGVLYCKTH
Sbjct  2    SFTGTTDKCDVCDKTVYVMDMLSIEGMPYHKSCFKCTHCKGTLVMSNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            F+QLFKESGNFSKNFQ  K E+    TK P+K+S++F GTQDKCA C KTVYPLEKV ME
Sbjct  62   FDQLFKESGNFSKNFQPGKTEKPEH-TKTPSKISSIFCGTQDKCAACEKTVYPLEKVQME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE FH++CF+CAHGGC LTH++YASLDGVLYC+HHF QLF+EKGNY
Sbjct  121  GECFHKTCFRCAHGGCTLTHSSYASLDGVLYCRHHFNQLFLEKGNY  166


 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ E+       +K  + F GT DKC AC+KTVY ++ +  +G  FHK+CF+C+H   TL
Sbjct  79   GKTEKPEHTKTPSKISSIFCGTQDKCAACEKTVYPLEKVQMEGECFHKTCFRCAHGGCTL  138

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE---NSMTKGPT  412
              S+Y+S+DGVLYC+ HF QLF E GN++   Q     R    NS+   PT
Sbjct  139  THSSYASLDGVLYCRHHFNQLFLEKGNYAHVLQAANHRRTASGNSLPPEPT  189



>emb|CAB71053.1| LIM domain protein [Arabidopsis thaliana]
Length=211

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 147/170 (86%), Gaps = 3/170 (2%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            MA+FTGT DKCKACDKTVY +DL++ +G  +HKSCF+CSHC GTLV+ NYSSMDGVLYCK
Sbjct  1    MAAFTGTTDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            THFEQLFKESGNFSKNFQT  K E+ N     P ++S+ FSGTQDKCA C KTVYPLEK+
Sbjct  61   THFEQLFKESGNFSKNFQTAGKTEKSNDA--APNRLSSFFSGTQDKCAACKKTVYPLEKM  118

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            TMEGE++H++CF+CAH GCPLTH++YA+LDGVLYCK HF+QLF+EKGNY 
Sbjct  119  TMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHFSQLFLEKGNYN  168


 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (62%), Gaps = 3/115 (3%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F   G+ E+  D      +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+
Sbjct  76   NFQTAGKTEKSND--AAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCA  133

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTK  415
            H    L  S+Y+++DGVLYCK HF QLF E GN++   Q     R ++  +  T+
Sbjct  134  HSGCPLTHSSYAALDGVLYCKVHFSQLFLEKGNYNHVLQAAANHRRSTAEEDKTE  188



>ref|XP_008376025.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=221

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY  ++LS +G  +HKSCFKCSHCKG L MS YSSMDG+LYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVTEMLSLEGVPYHKSCFKCSHCKGFLSMSTYSSMDGILYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNF  +  ++   + + P+K+SA+FSGTQDKCATC+KTVYPLEKVT+E
Sbjct  62   FEQLFKESGNFSKNFAKSAEKQGEQLNRVPSKLSALFSGTQDKCATCSKTVYPLEKVTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H+SCF+C HGGC LTH++YA+LDGVLYCKHHF+QLF+EKGNY
Sbjct  122  GESYHKSCFRCXHGGCALTHSSYAALDGVLYCKHHFSQLFLEKGNY  167


 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 2/100 (2%)
 Frame = +2

Query  80   NHVGRGERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            N     E+Q +Q   + +K  A F+GT DKC  C KTVY ++ ++ +G ++HKSCF+C H
Sbjct  75   NFAKSAEKQGEQLNRVPSKLSALFSGTQDKCATCSKTVYPLEKVTLEGESYHKSCFRCXH  134

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTT  373
                L  S+Y+++DGVLYCK HF QLF E GN+S   Q  
Sbjct  135  GGCALTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAA  174



>gb|KFK35321.1| hypothetical protein AALP_AA5G269200 [Arabis alpina]
Length=214

 Score =   268 bits (686),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DL++ +G  +HKSCF+CSHC  TLV+SNYSSMDGVLYCKTH
Sbjct  2    AFTGTLDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNHTLVISNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGN+SKNF T  K E+ N +TK P+K+S+ FSGTQDKCA C KTVYPLEK+TM
Sbjct  62   FEQLFKESGNYSKNFHTAGKTEKSNEVTKAPSKLSSFFSGTQDKCAACKKTVYPLEKMTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CF+CAHGGC LTH++YA+L+GVLYCK HF QLF+EKGNY
Sbjct  122  EGESYHKNCFRCAHGGCHLTHSSYAALNGVLYCKVHFNQLFLEKGNY  168


 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F+  G+ E+  +      K++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C+
Sbjct  75   NFHTAGKTEKSNEVTKAPSKLSSFFSGTQDKCAACKKTVYPLEKMTMEGESYHKNCFRCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
            H    L  S+Y++++GVLYCK HF QLF E GN+S    +    R
Sbjct  135  HGGCHLTHSSYAALNGVLYCKVHFNQLFLEKGNYSHVLASANNHR  179



>ref|XP_007139894.1| hypothetical protein PHAVU_008G067500g [Phaseolus vulgaris]
 gb|ESW11888.1| hypothetical protein PHAVU_008G067500g [Phaseolus vulgaris]
Length=208

 Score =   267 bits (682),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY VDLL+ +G+ +HK+CF+CSHCKG L MS YSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVVDLLTLEGTPYHKNCFRCSHCKGCLTMSTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTK-PERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT +  +++N + K P ++S+MFSGT DKC+ C+KTVYPLEK+T+
Sbjct  62   FEQLFKESGNFSKNFQTARSSDKQNEVNKTPNRLSSMFSGTLDKCSVCSKTVYPLEKMTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE +H++CF+CAH GC LTH++YA+LDGVLYC+HHF QLFMEKGNY 
Sbjct  122  EGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYH  169



>ref|XP_007218397.1| hypothetical protein PRUPE_ppa011395mg [Prunus persica]
 gb|EMJ19596.1| hypothetical protein PRUPE_ppa011395mg [Prunus persica]
Length=212

 Score =   267 bits (682),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 147/166 (89%), Gaps = 4/166 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VD+LS +G  +HKSCFKCSHCKG L MS YSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVVDMLSLEGLPYHKSCFKCSHCKGFLSMSTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNF+K+ +    ++   + + P+K+S+MFSGT DKCATC+KTVYPLEKVT+E
Sbjct  62   FEQLFKESGNFTKSAE----KQNEQLNRAPSKLSSMFSGTLDKCATCSKTVYPLEKVTLE  117

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H+SCF+CAHGGCPLTH++YA+LDGVLYCKHHF+QLF+EKGNY
Sbjct  118  GESYHKSCFRCAHGGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNY  163


 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 71/108 (66%), Gaps = 3/108 (3%)
 Frame = +2

Query  80   NHVGRGERQTDQ-NIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            N     E+Q +Q N    K++S F+GTLDKC  C KTVY ++ ++ +G ++HKSCF+C+H
Sbjct  71   NFTKSAEKQNEQLNRAPSKLSSMFSGTLDKCATCSKTVYPLEKVTLEGESYHKSCFRCAH  130

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSM  397
                L  S+Y+++DGVLYCK HF QLF E GN+S   Q     R+N++
Sbjct  131  GGCPLTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQAAA-NRKNAL  177



>ref|XP_010523732.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Tarenaya 
hassleriana]
Length=234

 Score =   267 bits (682),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 146/169 (86%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +DLL+ +G  +HKSCF+CSHC GTLV+SNYSSM+GVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDLLTLEGMPYHKSCFRCSHCNGTLVISNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT---TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESGNFSKNFQT   T+   +   T+ P ++S+ FSGTQDKCA C KTVYPLEK+
Sbjct  62   FEQLFKESGNFSKNFQTAGKTEKSSDAPQTRAPNRLSSFFSGTQDKCAACQKTVYPLEKM  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            TMEGE++H++CF+CAH GCPLTH++YA+LDGVLYCK HF QLF+EKG+Y
Sbjct  122  TMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHFNQLFLEKGSY  170


 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = +2

Query  77   FNHVGRGERQTD--QNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKC  247
            F   G+ E+ +D  Q     +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+C
Sbjct  76   FQTAGKTEKSSDAPQTRAPNRLSSFFSGTQDKCAACQKTVYPLEKMTMEGESYHKTCFRC  135

Query  248  SHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGP  409
            +H    L  S+Y+++DGVLYCK HF QLF E G+++   Q+    R  S +  P
Sbjct  136  AHSGCPLTHSSYAALDGVLYCKVHFNQLFLEKGSYNHVLQSANHRRTASSSSTP  189



>gb|KHG00940.1| Pollen-specific SF3 [Gossypium arboreum]
Length=208

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTV+ VD+++ +G  +HK+CFKCSHCKG L M+ YS MDG+LYCK H
Sbjct  2    AFTGTLDKCKACDKTVHVVDMMTLEGVPYHKTCFKCSHCKGNLQMTTYSWMDGILYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT    R   + + P+K+S++FSGT DKCA C KTVYPLEKVTME
Sbjct  62   FEQLFKESGNFSKNFQTGT--RPTELNRTPSKLSSLFSGTLDKCAACEKTVYPLEKVTME  119

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE FH++CF+CAHGGCPLTH++YA+LDGVLYCKHHFAQLFM KGNY 
Sbjct  120  GECFHKTCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMVKGNYN  166


 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 1/109 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            G R T+ N    K++S F+GTLDKC AC+KTVY ++ ++ +G  FHK+CF+C+H    L 
Sbjct  79   GTRPTELNRTPSKLSSLFSGTLDKCAACEKTVYPLEKVTMEGECFHKTCFRCAHGGCPLT  138

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKV  418
             S+Y+++DGVLYCK HF QLF   GN++   Q     R NS       V
Sbjct  139  HSSYAALDGVLYCKHHFAQLFMVKGNYNHVLQAATHRRNNSTASSSENV  187



>ref|XP_006827708.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
 gb|ERM95124.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
Length=195

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 148/169 (88%), Gaps = 2/169 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GTL KCK CDKTVY VDLLSADG  +HKSCFKCSHCKGTL +SNYSS++GVLYCK H
Sbjct  2    AFSGTLQKCKMCDKTVYVVDLLSADGVNYHKSCFKCSHCKGTLSISNYSSLEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTK--PERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKE+G+F+K+FQ      ++++ + + P+K+S++FSGTQDKCATC KT YPLEKVT
Sbjct  62   FEQLFKETGSFNKSFQLPPKSADKQHDLARAPSKLSSLFSGTQDKCATCYKTAYPLEKVT  121

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            +EGE++H+SCFKC+HGGCPLT +TYA+LDG+LYCKHHFAQLF EKGNY 
Sbjct  122  VEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKHHFAQLFKEKGNYN  170


 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
             ++Q D      K++S F+GT DKC  C KT Y ++ ++ +G ++HKSCFKCSH    L 
Sbjct  83   ADKQHDLARAPSKLSSLFSGTQDKCATCYKTAYPLEKVTVEGESYHKSCFKCSHGGCPLT  142

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKG  406
             S Y+++DG+LYCK HF QLFKE GN++   +T   +R  ++   
Sbjct  143  PSTYAALDGILYCKHHFAQLFKEKGNYNHLIKTASMKRNAALIPA  187



>ref|XP_004510816.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=210

 Score =   265 bits (678),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY VDLL+ +   +HK+CFKCSHCKG L MS YSSMDG+LYCKTH
Sbjct  2    SFTGTLDKCKACDKTVYVVDLLTLENIPYHKNCFKCSHCKGCLTMSTYSSMDGILYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNF  +  +++N + + P+++S+MFSGT DKCA CTKTVYPLEKVT+E
Sbjct  62   FEQLFKESGNFSKNFAKSS-DKQNELNRTPSRLSSMFSGTLDKCAVCTKTVYPLEKVTLE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAH GCPLTH+ YA+LDGVLYC+ HFAQLFMEKG Y
Sbjct  121  GECYHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGTY  166


 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = +2

Query  80   NHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHC  256
            N     ++Q + N    +++S F+GTLDKC  C KTVY ++ ++ +G  +HK+CF+C+H 
Sbjct  75   NFAKSSDKQNELNRTPSRLSSMFSGTLDKCAVCTKTVYPLEKVTLEGECYHKTCFRCAHA  134

Query  257  KGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
               L  SNY+++DGVLYC+ HF QLF E G +S    +T  +R  S
Sbjct  135  GCPLTHSNYAALDGVLYCRVHFAQLFMEKGTYSHVLNSTAHKRNGS  180



>gb|AFK33321.1| unknown [Lotus japonicus]
Length=208

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKC ACDKTVY VDLL+ +G  +HKSCFKCSHCKG L MS YSSMDGVLYC+TH
Sbjct  2    SFTGTLDKCAACDKTVYVVDLLTLEGIPYHKSCFKCSHCKGNLTMSTYSSMDGVLYCRTH  61

Query  320  FEQLFKESGNFSKNFQTTK-PERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQ  K  E++  + + P+++S+MFSGT DKCA CTKTVY LEKVT+
Sbjct  62   FEQLFKESGNFSKNFQNAKSSEKQGELNRTPSRLSSMFSGTLDKCAVCTKTVYSLEKVTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE +H++CF+CAH GCPLTH+ YA+LDG LYC+ HFAQLFMEKG+Y
Sbjct  122  EGECYHKTCFRCAHAGCPLTHSNYAALDGNLYCRVHFAQLFMEKGSY  168


 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            F +    E+Q + N    +++S F+GTLDKC  C KTVY ++ ++ +G  +HK+CF+C+H
Sbjct  76   FQNAKSSEKQGELNRTPSRLSSMFSGTLDKCAVCTKTVYSLEKVTLEGECYHKTCFRCAH  135

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
                L  SNY+++DG LYC+ HF QLF E G++S
Sbjct  136  AGCPLTHSNYAALDGNLYCRVHFAQLFMEKGSYS  169



>ref|XP_007135027.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
 gb|ESW07021.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
Length=225

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY VDLL+ +G  +HK+CFKCSHCKG L M  YSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMCTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNF  +  E++N + + P+K+S+MFSGT DKCA C+KTVYPLEKV++E
Sbjct  62   FEQLFKESGNFSKNFAKST-EKQNDINRTPSKLSSMFSGTLDKCAVCSKTVYPLEKVSLE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAH GCPLTH+ YA+LDGV+YC+ HFAQLFMEKGNY
Sbjct  121  GECYHKTCFRCAHAGCPLTHSNYAALDGVVYCRVHFAQLFMEKGNY  166


 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = +2

Query  80   NHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHC  256
            N     E+Q D N    K++S F+GTLDKC  C KTVY ++ +S +G  +HK+CF+C+H 
Sbjct  75   NFAKSTEKQNDINRTPSKLSSMFSGTLDKCAVCSKTVYPLEKVSLEGECYHKTCFRCAHA  134

Query  257  KGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMT  400
               L  SNY+++DGV+YC+ HF QLF E GN+S   Q    +R  S T
Sbjct  135  GCPLTHSNYAALDGVVYCRVHFAQLFMEKGNYSHVLQAAAHKRTGSST  182



>ref|XP_003551659.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHM99398.1| Pollen-specific protein SF3 [Glycine soja]
Length=216

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCKACDKTVY VD+L+ +G  +HK+CF+CSHCKG L M+ YSSMDGVLYCK H
Sbjct  2    SFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCFRCSHCKGYLTMNTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKP-ERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K  +++N   K P ++S+MFSGT DKC+ C+KTVYPLEK+T+
Sbjct  62   FEQLFKESGNFSKNFQTAKSSDKQNETNKAPNRLSSMFSGTLDKCSVCSKTVYPLEKMTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE +H++CF+CAH GC LTH++YA+LDGVLYC+HHF QLFMEKGNY
Sbjct  122  EGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNY  168


 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 73/118 (62%), Gaps = 3/118 (3%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F      ++Q + N    +++S F+GTLDKC  C KTVY ++ ++ +G  +HK+CF+C+
Sbjct  75   NFQTAKSSDKQNETNKAPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSA  424
            H    L  S+Y+++DGVLYC+ HF+QLF E GN+    Q+     + ++T  P + +A
Sbjct  135  HAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQSAN--HKKNVTPEPAEPAA  190



>ref|XP_010544715.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X1 [Tarenaya hassleriana]
Length=235

 Score =   263 bits (673),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +D+L+ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQ----TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEK  487
            FEQLFKESGNFSKNFQ    T KP      T+ P ++S+ FSGTQDKCA C KTVYPLEK
Sbjct  62   FEQLFKESGNFSKNFQASGKTDKPNDAQPPTRAPNRLSSFFSGTQDKCAACQKTVYPLEK  121

Query  488  VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            +T+EGE++H++CF+CAH GC LTH++YA+L+GVLYCK HF+QLF+EKG+Y
Sbjct  122  MTLEGESYHKTCFRCAHSGCSLTHSSYAALNGVLYCKAHFSQLFLEKGSY  171


 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = +2

Query  77   FNHVGRGERQTDQNIHTK---KMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFK  244
            F   G+ ++  D    T+   +++SF +GT DKC AC KTVY ++ ++ +G ++HK+CF+
Sbjct  76   FQASGKTDKPNDAQPPTRAPNRLSSFFSGTQDKCAACQKTVYPLEKMTLEGESYHKTCFR  135

Query  245  CSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
            C+H   +L  S+Y++++GVLYCK HF QLF E G+++   Q+    R  S +  P + +
Sbjct  136  CAHSGCSLTHSSYAALNGVLYCKAHFSQLFLEKGSYNHVLQSANHRRTASSSSTPPEPA  194



>ref|XP_009397610.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=201

 Score =   262 bits (669),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT DKCKACDKTV+F+DLL+ADG  +HK+CFKCSHCKGTL M NYSSMDG+LYCK H
Sbjct  2    SFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGTLSMCNYSSMDGILYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+FSK F T+    E  +++ P+KVS+MFSGTQDKCA+C KT YPLEK+T+E
Sbjct  62   FEQLFKETGSFSKKFPTSSKSGEKELSRTPSKVSSMFSGTQDKCASCKKTAYPLEKLTVE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H++CFKC+HGGC LT ++YA+LDG+LYCKHHFAQLF EKG+Y
Sbjct  122  GESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSY  167


 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            GE++  +   +K  + F+GT DKC +C KT Y ++ L+ +G ++HK+CFKCSH   TL  
Sbjct  83   GEKELSRTP-SKVSSMFSGTQDKCASCKKTAYPLEKLTVEGESYHKTCFKCSHGGCTLTP  141

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNFS  355
            S+Y+++DG+LYCK HF QLFKE G+++
Sbjct  142  SSYAALDGILYCKHHFAQLFKEKGSYN  168



>ref|XP_003533616.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
Length=219

 Score =   262 bits (670),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCKACDKTVY VD+L+ +G  +HK+CF+CSHCKG L MS YSSMDGVLYCK H
Sbjct  2    SFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCFRCSHCKGCLTMSTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTK-PERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K  +++N   K P ++S+MFSGT DKC+ C+KTVYPLEK+T+
Sbjct  62   FEQLFKESGNFSKNFQTAKSSDKQNETHKTPNRLSSMFSGTLDKCSVCSKTVYPLEKMTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE +H++CF+CAH GC LTH++YA+LDGVLYC+HHF QLFMEKGNY
Sbjct  122  EGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNY  168


 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F      ++Q + +    +++S F+GTLDKC  C KTVY ++ ++ +G  +HK+CF+C+
Sbjct  75   NFQTAKSSDKQNETHKTPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQT  370
            H    L  S+Y+++DGVLYC+ HF+QLF E GN+    Q+
Sbjct  135  HAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQS  174



>gb|KHN29376.1| Pollen-specific protein SF3 [Glycine soja]
Length=219

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCKACDKTVY VD+L+ +G  +HK+CF+CSHCKG L MS YSSMDGVLYCK H
Sbjct  2    SFTGTTDKCKACDKTVYVVDMLTLEGIPYHKNCFRCSHCKGCLTMSTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTK-PERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESGNFSKNFQT K  +++N   K P ++S+MFSGT DKC+ C+KTVYPLEK+T+
Sbjct  62   FEQLFKESGNFSKNFQTAKSSDKQNETHKTPNRLSSMFSGTLDKCSVCSKTVYPLEKMTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE +H++CF+CAH GC LTH++YA+LDGVLYC+HHF QLFMEKGNY
Sbjct  122  EGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNY  168


 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
             F      ++Q + +    +++S F+GTLDKC  C KTVY ++ ++ +G  +HK+CF+C+
Sbjct  75   NFQTAKSSDKQNETHKTPNRLSSMFSGTLDKCSVCSKTVYPLEKMTLEGECYHKNCFRCA  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGP  409
            H    L  S+Y+++DGVLYC+ HF+QLF E GN+    Q+   ++  + T+ P
Sbjct  135  HAGCHLTHSSYAALDGVLYCRHHFQQLFMEKGNYHHVLQSANHKK--NATQSP  185



>ref|XP_007135026.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
 gb|ESW07020.1| hypothetical protein PHAVU_010G095700g [Phaseolus vulgaris]
Length=226

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY VDLL+ +G  +HK+CFKCSHCKG L M  YSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMCTYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNF  +  ++ +   + P+K+S+MFSGT DKCA C+KTVYPLEKV++E
Sbjct  62   FEQLFKESGNFSKNFAKSTEKQNDIQNRTPSKLSSMFSGTLDKCAVCSKTVYPLEKVSLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CF+CAH GCPLTH+ YA+LDGV+YC+ HFAQLFMEKGNY
Sbjct  122  GECYHKTCFRCAHAGCPLTHSNYAALDGVVYCRVHFAQLFMEKGNY  167


 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +2

Query  80   NHVGRGERQTD-QNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            N     E+Q D QN    K++S F+GTLDKC  C KTVY ++ +S +G  +HK+CF+C+H
Sbjct  75   NFAKSTEKQNDIQNRTPSKLSSMFSGTLDKCAVCSKTVYPLEKVSLEGECYHKTCFRCAH  134

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMT  400
                L  SNY+++DGV+YC+ HF QLF E GN+S   Q    +R  S T
Sbjct  135  AGCPLTHSNYAALDGVVYCRVHFAQLFMEKGNYSHVLQAAAHKRTGSST  183



>ref|XP_010089139.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB37386.1| Pollen-specific protein SF3 [Morus notabilis]
Length=421

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  128  KKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLY  307
            +KM SF+GT  KCKACDKTV+F+D LSADG  +HK+CFKCSHC G LV+S+YSSMDGVLY
Sbjct  216  RKM-SFSGTQQKCKACDKTVHFIDALSADGVVYHKTCFKCSHCNGLLVISSYSSMDGVLY  274

Query  308  CKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEK  487
            CK HFEQLFKE+G+F+K FQ+ KP+  + +T+ P+K+S++FSGTQDKCA CTKTVYPLEK
Sbjct  275  CKPHFEQLFKETGSFTKKFQSGKPQN-DQLTRAPSKLSSLFSGTQDKCAVCTKTVYPLEK  333

Query  488  VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            VT+EGE +H+SCF+C+HGGC LT ++YA+L+G+LYCKHHFAQLFMEKG+Y
Sbjct  334  VTVEGEFYHKSCFRCSHGGCFLTPSSYAALEGILYCKHHFAQLFMEKGSY  383


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +2

Query  95   GERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            G+ Q DQ     +K  + F+GT DKC  C KTVY ++ ++ +G  +HKSCF+CSH    L
Sbjct  296  GKPQNDQLTRAPSKLSSLFSGTQDKCAVCTKTVYPLEKVTVEGEFYHKSCFRCSHGGCFL  355

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQT  370
              S+Y++++G+LYCK HF QLF E G+++   +T
Sbjct  356  TPSSYAALEGILYCKHHFAQLFMEKGSYNHLIKT  389



>ref|XP_010544716.1| PREDICTED: LIM domain-containing protein PLIM2c-like isoform 
X2 [Tarenaya hassleriana]
Length=234

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 146/171 (85%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY +D+L+ +G  +HKSCF+CSHC GTLV+SNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVMDMLTLEGMPYHKSCFRCSHCNGTLVISNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQ----TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEK  487
            FEQLFKESGNFSKNFQ    T KP  +   T+ P ++S+ FSGTQDKCA C KTVYPLEK
Sbjct  62   FEQLFKESGNFSKNFQASGKTDKP-NDAPPTRAPNRLSSFFSGTQDKCAACQKTVYPLEK  120

Query  488  VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            +T+EGE++H++CF+CAH GC LTH++YA+L+GVLYCK HF+QLF+EKG+Y 
Sbjct  121  MTLEGESYHKTCFRCAHSGCSLTHSSYAALNGVLYCKAHFSQLFLEKGSYN  171


 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC AC KTVY ++ ++ +G ++HK+CF+C+H   +L  S+Y++++GVLYCK HF
Sbjct  101  FSGTQDKCAACQKTVYPLEKMTLEGESYHKTCFRCAHSGCSLTHSSYAALNGVLYCKAHF  160

Query  323  EQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
             QLF E G+++   Q+    R  S +  P + +
Sbjct  161  SQLFLEKGSYNHVLQSANHRRTASSSSTPPEPA  193



>ref|XP_004492709.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=230

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 145/169 (86%), Gaps = 2/169 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY VDLL+ +G  +HK+CFKCSHCKG L MS   SMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMSTCCSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTK-PERENSMT-KGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKESGNFSKNFQT K  +R+N +  K P+++S+MFSGT DKC+ C+KTVYPLEK++
Sbjct  62   FEQLFKESGNFSKNFQTAKSSDRQNELVNKTPSRLSSMFSGTLDKCSVCSKTVYPLEKMS  121

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            +EGE +H++CF+CAH GC LTH++YA+LDGVLYCKHHF QLFMEKGNY 
Sbjct  122  LEGECYHKNCFRCAHAGCHLTHSSYAALDGVLYCKHHFQQLFMEKGNYN  170


 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 70/117 (60%), Gaps = 2/117 (2%)
 Frame = +2

Query  74   RFNHVGRGERQTDQ-NIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKC  247
             F      +RQ +  N    +++S F+GTLDKC  C KTVY ++ +S +G  +HK+CF+C
Sbjct  75   NFQTAKSSDRQNELVNKTPSRLSSMFSGTLDKCSVCSKTVYPLEKMSLEGECYHKNCFRC  134

Query  248  SHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKV  418
            +H    L  S+Y+++DGVLYCK HF+QLF E GN++   Q     +  +    P ++
Sbjct  135  AHAGCHLTHSSYAALDGVLYCKHHFQQLFMEKGNYNHVLQAAANRKNATPPPEPAEL  191



>gb|ACN26203.1| unknown [Zea mays]
 gb|ADX60140.1| LIM transcription factor [Zea mays]
 gb|AFW72521.1| putative LIM-type zinc finger domain family protein [Zea mays]
Length=204

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCKACDKTV+ +DLL+ADG ++HK+CFKCSHCKG L +S+YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCKACDKTVHIIDLLTADGVSYHKTCFKCSHCKGVLSISSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G FSKNFQ      +N   K P+K+S+ FSGTQDKCA C KTVYPLEK+T+E
Sbjct  62   FEQLFKETGTFSKNFQGGASSNKNDQAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H+SCFKC+HGGC LT ++YA+L+GVLYCK HF+QLF EKG+Y
Sbjct  122  GESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFSQLFKEKGSY  167


 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G    + DQ     K++S F+GT DKC AC KTVY ++ ++ +G ++HKSCFKCSH    
Sbjct  79   GASSNKNDQAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCI  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGP  409
            L  S+Y++++GVLYCK HF QLFKE G+++   +T + ++  +   GP
Sbjct  139  LTTSSYAALNGVLYCKIHFSQLFKEKGSYNHLIETAQTKKNEAAEAGP  186



>ref|XP_009340168.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3 [Pyrus 
x bretschneideri]
Length=243

 Score =   259 bits (662),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 22/188 (12%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY  ++LS +G  +HKSCFKCSHCKG L MS YSSMDG+LYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVTEMLSLEGVPYHKSCFKCSHCKGFLSMSTYSSMDGILYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEK----  487
            FEQLFKESGNFSKNF  +  ++   + + P+K+SA+FSGTQDKCATC+KTVYPLEK    
Sbjct  62   FEQLFKESGNFSKNFAKSAEKQGEQLNRVPSKLSALFSGTQDKCATCSKTVYPLEKVSNI  121

Query  488  ------------------VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQ  613
                              VT+EGE++H+SCF+CAHGGC LTH++YA+LDGVLYCKHHF+Q
Sbjct  122  IKGINLISMSPCFSXQTIVTLEGESYHKSCFRCAHGGCALTHSSYAALDGVLYCKHHFSQ  181

Query  614  LFMEKGNY  637
            LF+EKGNY
Sbjct  182  LFLEKGNY  189


 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 65/122 (53%), Gaps = 24/122 (20%)
 Frame = +2

Query  80   NHVGRGERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVD------------------  199
            N     E+Q +Q   + +K  A F+GT DKC  C KTVY ++                  
Sbjct  75   NFAKSAEKQGEQLNRVPSKLSALFSGTQDKCATCSKTVYPLEKVSNIIKGINLISMSPCF  134

Query  200  ----LLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ  367
                +++ +G ++HKSCF+C+H    L  S+Y+++DGVLYCK HF QLF E GN+S   Q
Sbjct  135  SXQTIVTLEGESYHKSCFRCAHGGCALTHSSYAALDGVLYCKHHFSQLFLEKGNYSHVLQ  194

Query  368  TT  373
              
Sbjct  195  AA  196



>ref|XP_009402055.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=201

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT DKCKAC+KTV+F+DLL+ADG T+HK+CFKCSHCKGTL M NYSSMDGVLYCK H
Sbjct  2    SFSGTQDKCKACEKTVHFIDLLTADGVTYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G F++ F T TK    N  +K PTK+S+MF GTQDKCATC KT YPLE +TM
Sbjct  62   FEQLFKETGTFTRKFPTGTKSGERNEQSKAPTKISSMFCGTQDKCATCKKTAYPLETMTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CFKC+ GGC LT ++YA+LDG+LYCKHHFAQLFMEKG+Y
Sbjct  122  EGESYHKTCFKCSVGGCMLTPSSYAALDGILYCKHHFAQLFMEKGSY  168


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            GER       TK  + F GT DKC  C KT Y ++ ++ +G ++HK+CFKCS     L  
Sbjct  83   GERNEQSKAPTKISSMFCGTQDKCATCKKTAYPLETMTMEGESYHKTCFKCSVGGCMLTP  142

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
            S+Y+++DG+LYCK HF QLF E G+++   Q    E++N+
Sbjct  143  SSYAALDGILYCKHHFAQLFMEKGSYNHVIQAA-LEKQNA  181



>gb|KHG27160.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   256 bits (655),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 144/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG  +HKSCFKCSHCKGTL + NYSSM+GV+YCK H
Sbjct  2    SFTGTQQKCKACEKTVYPVELLSADGIPYHKSCFKCSHCKGTLKLGNYSSMEGVVYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESGNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+++H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQSYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G ++HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>emb|CDX76073.1| BnaA04g03370D [Brassica napus]
Length=270

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 155/185 (84%), Gaps = 6/185 (3%)
 Frame = +2

Query  92   RGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            +G+RQ        +M+SFTGT  KCKAC+KTVY V+LLSADG T+HKSCFKC+HCK  L 
Sbjct  60   KGQRQKGVE---GRMSSFTGTQQKCKACEKTVYPVELLSADGVTYHKSCFKCTHCKSRLQ  116

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQT-TKPERENS--MTKGPTKVSAMFSGTQ  442
            +S YSSM+GVLYCK H+EQLFKESG+F+KNFQ+  KP  ++S  +T+ P++V+ MFSGTQ
Sbjct  117  LSRYSSMEGVLYCKPHYEQLFKESGSFTKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQ  176

Query  443  DKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFM  622
            +KCATC+KTVYP+EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF 
Sbjct  177  EKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFK  236

Query  623  EKGNY  637
            EKG+Y
Sbjct  237  EKGSY  241


 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 72/127 (57%), Gaps = 7/127 (6%)
 Frame = +2

Query  278  NYSSMDGVLYCKTHFEQ--LFKESGNFSKNFQTTKP-----ERENSMTKGPTKVSAMFSG  436
            +++S+   L   ++F +  +F  S   S   +   P     E++    KG     + F+G
Sbjct  17   HFTSIRRKLLPLSYFSEANIFVRSWTLSVQREVIDPSISLEEKKGQRQKGVEGRMSSFTG  76

Query  437  TQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQL  616
            TQ KC  C KTVYP+E ++ +G  +H+SCFKC H    L  + Y+S++GVLYCK H+ QL
Sbjct  77   TQQKCKACEKTVYPVELLSADGVTYHKSCFKCTHCKSRLQLSRYSSMEGVLYCKPHYEQL  136

Query  617  FMEKGNY  637
            F E G++
Sbjct  137  FKESGSF  143


 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  172  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  231

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  232  AQLFKEKGSYNHLIKSASIKR  252



>emb|CDX72203.1| BnaC08g26710D [Brassica napus]
Length=201

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 148/172 (86%), Gaps = 4/172 (2%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            M+SFTGT  KCKAC+KTVY V+LLSADG ++HKSCFKCSHCK  L +S YSSM+GVLYCK
Sbjct  1    MSSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQT-TKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
             H+EQLFKESG+F+KNFQ+  KP  E S   +T+ P++V+ MFSGTQ+KCATC+KTVYP+
Sbjct  61   PHYEQLFKESGSFTKNFQSPVKPAAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPI  120

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  121  EKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  172


 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  163  AQLFKEKGSYNHLIKSASIKR  183



>emb|CDY27267.1| BnaA09g35350D [Brassica napus]
Length=201

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 148/172 (86%), Gaps = 4/172 (2%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            M+SFTGT  KCKAC+KTVY V+LLSADG ++HKSCFKCSHCK  L +S YSSM+GVLYCK
Sbjct  1    MSSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQT-TKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
             H+EQLFKESG+F+KNFQ+  KP  E S   +T+ P++V+ MFSGTQ+KCATC+KTVYP+
Sbjct  61   PHYEQLFKESGSFTKNFQSPVKPAAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPI  120

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  121  EKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  172


 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  103  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  163  AQLFKEKGSYNHLIKSASIKR  183



>ref|XP_011022732.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
Length=212

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            FTGTL+KCKACDKTVYF++L+SADG  +HK CFKCSHC G LVMS+YSS+DGVLYCK H+
Sbjct  3    FTGTLEKCKACDKTVYFIELVSADGVPYHKKCFKCSHCNGLLVMSSYSSIDGVLYCKPHY  62

Query  323  EQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTMEG  502
            +QLFKE+GNF+K  Q++  E++N +TK P+K+S+MFSGTQDKCA+C KTVYPLEKVT+EG
Sbjct  63   DQLFKETGNFTKKLQSSG-EKKNGLTKAPSKLSSMFSGTQDKCASCKKTVYPLEKVTVEG  121

Query  503  EAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            E FH+SCF+C+HGGC +T ++YA+LDG+LYCK HF+QLF +KG+Y
Sbjct  122  EFFHKSCFRCSHGGCFITPSSYAALDGILYCKAHFSQLFKQKGSY  166


 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            GE++        K++S F+GT DKC +C KTVY ++ ++ +G  FHKSCF+CSH    + 
Sbjct  80   GEKKNGLTKAPSKLSSMFSGTQDKCASCKKTVYPLEKVTVEGEFFHKSCFRCSHGGCFIT  139

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFS  355
             S+Y+++DG+LYCK HF QLFK+ G++S
Sbjct  140  PSSYAALDGILYCKAHFSQLFKQKGSYS  167



>ref|XP_004150238.1| PREDICTED: pollen-specific protein SF3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004150239.1| PREDICTED: pollen-specific protein SF3-like isoform 2 [Cucumis 
sativus]
 gb|KGN50627.1| hypothetical protein Csa_5G198170 [Cucumis sativus]
Length=195

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 143/171 (84%), Gaps = 7/171 (4%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKACDKTVY VD LSADG +FHKSCFKCSHCKGTL +SNYSSMDGVLYCK H
Sbjct  2    SFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNF-----QTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
            FEQLFKE+GNFSKNF      + KP  E  +T+ P+K ++MFSGTQ+KCATC KT YPLE
Sbjct  62   FEQLFKETGNFSKNFLSPAKSSEKPTPE--LTRSPSKAASMFSGTQEKCATCGKTAYPLE  119

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            KVT+E +A+H+SCFKC+HGGC L+ + YA+LDG+LYCKHHF+QLF EKG+Y
Sbjct  120  KVTVESQAYHKSCFKCSHGGCSLSPSNYAALDGILYCKHHFSQLFKEKGSY  170


 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 67/101 (66%), Gaps = 1/101 (1%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH   +L  SNY+++DG+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALDGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMT-KGPTKVSA  424
            YCK HF QLFKE G+++   ++   +R+ + +   P+KV +
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASMKRQAATSDPDPSKVES  195



>ref|XP_007009106.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009109.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17916.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17919.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
Length=189

 Score =   255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 144/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG  +HKSCFKCSHCKGTL + NYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+++H+SCFKC+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G ++HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>ref|XP_009404566.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 143/168 (85%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGT  KCKACDKTVY +D L+ADG  FHKSCFKC+HCKGTL +S YSSM+GVLYCK H
Sbjct  4    NFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPH  63

Query  320  FEQLFKESGNFSKNFQTT--KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKESGNF+KNFQ+     E+   +T+ P+K ++MFSGTQ+KCATC KT YPLEKVT
Sbjct  64   FEQLFKESGNFNKNFQSPAKSAEKAPELTRSPSKAASMFSGTQEKCATCAKTAYPLEKVT  123

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            +EG+A+H+SCFKC+HGGC +T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  124  VEGQAYHKSCFKCSHGGCSITPSNYAALEGILYCKHHFSQLFKEKGSY  171


 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G  +HKSCFKCSH   ++  SNY++++G+L
Sbjct  96   SKAASMFSGTQEKCATCAKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALEGIL  155

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  156  YCKHHFSQLFKEKGSYNHLIKSASIKR  182



>ref|XP_009116276.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=201

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 148/172 (86%), Gaps = 4/172 (2%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            M+SFTGT  KCKAC+KTVY V+LLSADG ++HKSCFKCSHCK  L +S YSSM+GVLYCK
Sbjct  1    MSSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQT-TKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
             H+EQLFKESG+F+KNFQ+  KP  E S   +T+ P++V+ MFSGTQ+KCATC+KTVYP+
Sbjct  61   PHYEQLFKESGSFTKNFQSPVKPAAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPI  120

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  121  EKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  172



>gb|EMT25782.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=213

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCK CDKTV+F+DLL+ADG ++HK+CFKCSHCKGTL M NYSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+GNFSKNF       E    K P+K+S+ FSGTQDKCA C KTVYPLEK+T+E
Sbjct  62   FEQLFKETGNFSKNFTPGGKSAEKGEAKAPSKMSSAFSGTQDKCAACQKTVYPLEKLTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE +H+SCFKC+HGGC LT ++YA+L+G+LYCK HF+QLF EKG+Y 
Sbjct  122  GECYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYN  168


 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 70/106 (66%), Gaps = 0/106 (0%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
             F   G+   + +    +K  ++F+GT DKC AC KTVY ++ L+ +G  +HKSCFKCSH
Sbjct  75   NFTPGGKSAEKGEAKAPSKMSSAFSGTQDKCAACQKTVYPLEKLTLEGECYHKSCFKCSH  134

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPEREN  391
                L  S+Y++++G+LYCK HF QLFKE G+++   +T + ++E+
Sbjct  135  GGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIKTAQTKKES  180



>ref|NP_001140551.1| uncharacterized LOC100272616 [Zea mays]
 gb|ACF84061.1| unknown [Zea mays]
 gb|AFW58965.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB05143.1| LIM transcription factor, partial [Zea mays]
Length=205

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            M+SFTGT DKC  CDKTV+F+DLL+ADG T+HK+CFKCSHCKG L M +YSSMDGVLYCK
Sbjct  1    MSSFTGTQDKCAECDKTVHFIDLLTADGVTYHKTCFKCSHCKGILSMCSYSSMDGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            THFEQLFKE+G+FSKNF    K   +  +T+ P+K+S+ FSGTQDKCA C KTVYPLEK+
Sbjct  61   THFEQLFKETGSFSKNFTPGGKSSDKGELTRAPSKLSSAFSGTQDKCAACQKTVYPLEKL  120

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EGE++H+SCFKC+HGGC LT ++YA+L+GVLYCK HFAQLFMEKG+Y
Sbjct  121  TLEGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFAQLFMEKGSY  169


 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  ++F+GT DKC AC KTVY ++ L+ +G ++HKSCFKCSH    L  S+Y++++GVL
Sbjct  94   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGVL  153

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLF E G++S
Sbjct  154  YCKIHFAQLFMEKGSYS  170



>ref|XP_008777895.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=204

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT DKCKACDKTV+F+DLL+ADG  +HK+CFKCSHCKG L M NYSSMDGVLYCK H
Sbjct  2    SFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+F+K F T   ++ N + + P+KVS MFSGTQDKCA+C KT YPLEK+T+E
Sbjct  62   FEQLFKETGSFTKKFPTGAKDK-NELNRTPSKVSYMFSGTQDKCASCKKTAYPLEKITVE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE++H++CFKC+HGGC LT ++YA+LDG+LYCKHHFAQLF EKG+Y 
Sbjct  121  GESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSYN  167



>ref|XP_008796793.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=205

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT DKCKACDKTV+F+DLL+ADG  +HK+CFKCSHCKG L M +YSSMDGVLYCK H
Sbjct  2    SFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCSYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+F+K F T  K   +N + + P+KVS MFSGTQDKCA+C KT YPLEK+T+
Sbjct  62   FEQLFKETGSFTKKFPTGAKSGDKNELNRTPSKVSYMFSGTQDKCASCNKTAYPLEKITV  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CFKC+HGGC LT ++YA+LDG+LYCKHHFAQLF EKG+Y
Sbjct  122  EGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSY  168


 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +2

Query  95   GERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            G++       +K    F+GT DKC +C+KT Y ++ ++ +G ++HK+CFKCSH   TL  
Sbjct  83   GDKNELNRTPSKVSYMFSGTQDKCASCNKTAYPLEKITVEGESYHKTCFKCSHGGCTLTP  142

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNFS  355
            S+Y+++DG+LYCK HF QLFKE G+++
Sbjct  143  SSYAALDGILYCKHHFAQLFKEKGSYN  169



>ref|XP_006647592.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=206

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCKACDKTV+F+DLL+ADG ++HK+CFKCSHCKGTL M NYSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNF-QTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+FSK F Q  K   +N   K P+K+S+ FSGTQDKCA C KTVYPLEK+T+
Sbjct  62   FEQLFKETGSFSKKFSQGGKSSDKNDQGKAPSKLSSAFSGTQDKCAACQKTVYPLEKLTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H+SCFKC+HGGC LT ++YA+L+G+LYCK HF+QLF EKG+Y
Sbjct  122  EGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSY  168


 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
            +F+  G+   + DQ     K++S F+GT DKC AC KTVY ++ L+ +G ++HKSCFKCS
Sbjct  75   KFSQGGKSSDKNDQGKAPSKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCS  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE  388
            H    L  S+Y++++G+LYCK HF QLFKE G+++   QT + +++
Sbjct  135  HGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTAQSKQK  180



>emb|CDY02959.1| BnaC04g25270D [Brassica napus]
Length=269

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = +2

Query  92   RGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            +G+RQ        +M+SFTGT  KCKAC+KTVY V+LLSADG ++HKSCFKCSHCK  L 
Sbjct  59   KGQRQKGVE---GRMSSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQ  115

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS---MTKGPTKVSAMFSGTQ  442
            +S YSSM+GVLYCK H+EQLFKESG+F+KNFQ+     E S   +T+ P++V+ MFSGTQ
Sbjct  116  LSRYSSMEGVLYCKPHYEQLFKESGSFTKNFQSPAKPAEKSNPELTRTPSRVAGMFSGTQ  175

Query  443  DKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFM  622
            +KCATC+KTVYP+EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF 
Sbjct  176  EKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFK  235

Query  623  EKGNY  637
            EKG+Y
Sbjct  236  EKGSY  240


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 5/108 (5%)
 Frame = +2

Query  329  LFKESGNFSKNFQTTKP-----ERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            +F  S   S   +   P     E++    KG     + F+GTQ KC  C KTVYP+E ++
Sbjct  35   IFVRSWTLSAQREVIDPSIPVEEKKGQRQKGVEGRMSSFTGTQQKCKACEKTVYPVELLS  94

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
             +G ++H+SCFKC+H    L  + Y+S++GVLYCK H+ QLF E G++
Sbjct  95   ADGVSYHKSCFKCSHCKSRLQLSRYSSMEGVLYCKPHYEQLFKESGSF  142


 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  171  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  230

Query  323  EQLFKESGNFS  355
             QLFKE G+++
Sbjct  231  AQLFKEKGSYN  241



>ref|XP_010256708.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256709.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256710.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256711.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256712.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256713.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
Length=192

 Score =   254 bits (650),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 143/171 (84%), Gaps = 3/171 (2%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            MA F GT  KCKAC+KTVY VD LSADG T+HKSCFKCSHCKGTL +SNYSSM+GVLYCK
Sbjct  1    MAFFGGTQQKCKACEKTVYVVDQLSADGVTYHKSCFKCSHCKGTLKLSNYSSMEGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
             HFEQLFKE+G+F KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLE
Sbjct  61   PHFEQLFKETGSFKKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLE  120

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            KVT+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  121  KVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  171


 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  96   SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGIL  155

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  156  YCKHHFSQLFKEKGSYN  172


 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  422  AMFSGTQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKH  601
            A F GTQ KC  C KTVY +++++ +G  +H+SCFKC+H    L  + Y+S++GVLYCK 
Sbjct  2    AFFGGTQQKCKACEKTVYVVDQLSADGVTYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  61

Query  602  HFAQLFMEKGNYQ  640
            HF QLF E G+++
Sbjct  62   HFEQLFKETGSFK  74



>ref|NP_001047550.1| Os02g0641000 [Oryza sativa Japonica Group]
 dbj|BAD25223.1| putative LIM domain protein PLIM-2 [Oryza sativa Japonica Group]
 dbj|BAD25371.1| putative LIM domain protein PLIM-2 [Oryza sativa Japonica Group]
 dbj|BAF09464.1| Os02g0641000 [Oryza sativa Japonica Group]
 gb|EAY86851.1| hypothetical protein OsI_08235 [Oryza sativa Indica Group]
 gb|EAZ23959.1| hypothetical protein OsJ_07685 [Oryza sativa Japonica Group]
 gb|AEJ08684.1| PLIM [Oryza sativa]
Length=206

 Score =   255 bits (651),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCKACDKTV+F+DLL+ADG ++HK+CFKCSHCKGTL M NYSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNF-QTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+FSK F Q  K   ++   + P+K+S+ FSGTQDKCA C KTVYPLEK+T+
Sbjct  62   FEQLFKETGSFSKKFSQGGKSSEKSDQGRAPSKLSSAFSGTQDKCAACQKTVYPLEKLTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H+SCFKC+HGGC LT ++YA+L+G+LYCK HF+QLF EKG+Y
Sbjct  122  EGESYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSY  168


 Score =   104 bits (260),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
            +F+  G+   ++DQ     K++S F+GT DKC AC KTVY ++ L+ +G ++HKSCFKCS
Sbjct  75   KFSQGGKSSEKSDQGRAPSKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCS  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVS  421
            H    L  S+Y++++G+LYCK HF QLFKE G+++   QT + +++ S    P   +
Sbjct  135  HGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTAQSKQKESEEAAPVAAT  191



>ref|XP_006445094.1| hypothetical protein CICLE_v10022448mg [Citrus clementina]
 gb|ESR58334.1| hypothetical protein CICLE_v10022448mg [Citrus clementina]
Length=185

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 134/166 (81%), Gaps = 24/166 (14%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VD+LS +G  +HKSCFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVVDMLSLEGMPYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKESGNFSKNFQT                        DKCA C KTVYPLEKVTME
Sbjct  62   FEQLFKESGNFSKNFQT------------------------DKCAACEKTVYPLEKVTME  97

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            G+ FH++CF+CAHGGCPLTH++YA+LDGVLYCKHHFAQLFMEKGNY
Sbjct  98   GDCFHKTCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFMEKGNY  143


 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +2

Query  158  DKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFK  337
            DKC AC+KTVY ++ ++ +G  FHK+CF+C+H    L  S+Y+++DGVLYCK HF QLF 
Sbjct  79   DKCAACEKTVYPLEKVTMEGDCFHKTCFRCAHGGCPLTHSSYAALDGVLYCKHHFAQLFM  138

Query  338  ESGNFSKNFQTTKPER  385
            E GN+S   +    +R
Sbjct  139  EKGNYSHVLKAANHKR  154



>ref|NP_001132843.1| uncharacterized LOC100194335 [Zea mays]
 gb|ACF81859.1| unknown [Zea mays]
 tpg|DAA36695.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
 gb|AIB04292.1| LIM transcription factor, partial [Zea mays]
Length=204

 Score =   254 bits (650),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC ACDKTV+F+DLL+ADG+ +HK+CFKCSHCKG L M +YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCTACDKTVHFIDLLTADGAIYHKTCFKCSHCKGVLSMCSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+FSKNF    K   +  +T+ P+K+S+ FSGTQDKCA C KTVYPLEK+T+
Sbjct  62   FEQLFKETGSFSKNFTPGGKSSDKGELTRAPSKLSSAFSGTQDKCAACQKTVYPLEKLTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H+SCFKC+HGGC LT ++YA+L+GVLYCK HFAQLFMEKG+Y 
Sbjct  122  EGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFAQLFMEKGSYN  169


 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  ++F+GT DKC AC KTVY ++ L+ +G ++HKSCFKCSH    L  S+Y++++GVL
Sbjct  93   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGVL  152

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERE  388
            YCK HF QLF E G+++ +     P +E
Sbjct  153  YCKIHFAQLFMEKGSYN-HMNKKSPSQE  179



>ref|XP_010907367.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=200

 Score =   254 bits (649),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT DKCKACDKTV+F+DLL+ADG  +HK+CFKCSHCKG L M NYSSMDGVLYCK H
Sbjct  2    SFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+F+K F T   ++ N + + P+KVS MF GTQDKCA+C KT YPLEK+T+E
Sbjct  62   FEQLFKETGSFTKKFPTGAKDK-NELNRTPSKVSYMFCGTQDKCASCNKTAYPLEKITVE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H++CFKC+HGGC LT ++YA+LDG+LYCKHHFAQLF EKG+Y
Sbjct  121  GESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHFAQLFKEKGSY  166


 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F GT DKC +C+KT Y ++ ++ +G ++HK+CFKCSH   TL  S+Y+++DG+LYCK HF
Sbjct  97   FCGTQDKCASCNKTAYPLEKITVEGESYHKTCFKCSHGGCTLTPSSYAALDGILYCKHHF  156

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   +    +R
Sbjct  157  AQLFKEKGSYNHLIKAASTKR  177



>ref|XP_009139138.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 gb|AID61744.1| LIM domain-containing protein [Brassica rapa subsp. pekinensis]
Length=200

 Score =   254 bits (649),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 149/171 (87%), Gaps = 3/171 (2%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            M+SFTGT  KCKAC+KTVY V+LLSADG ++HKSCFKC+HCK  L +S YSSM+GVLYCK
Sbjct  1    MSSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTHCKSRLQLSRYSSMEGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQT-TKPERENS--MTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
             H+EQLFKESG+F+KNFQ+  KP  ++S  +T+ P++V+ MFSGTQ+KCATC+KTVYP+E
Sbjct  61   PHYEQLFKESGSFTKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPIE  120

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            KVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  121  KVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_004953255.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=197

 Score =   254 bits (648),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCK CDKTV+F+DLL+ADG ++HK+CFKCSHCKGTL +S+YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSISSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G FSK FQ      ++   K P+K+S+ FSGTQDKCA C KTVYPLEK+T+E
Sbjct  62   FEQLFKETGTFSKKFQGGGSSNKSDQAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H+SCFKC+HGGC LT ++YA+L+G+LYCK HF+QLF EKG+Y
Sbjct  122  GESYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSY  167


 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G    ++DQ     K++S F+GT DKC AC KTVY ++ ++ +G ++HKSCFKCSH    
Sbjct  79   GGSSNKSDQAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCI  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
            L  S+Y++++G+LYCK HF QLFKE G+++   QT + ++
Sbjct  139  LTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTAQTKK  178



>ref|NP_001241110.1| uncharacterized protein LOC100809121 [Glycine max]
 ref|XP_006601833.1| PREDICTED: uncharacterized protein LOC100809121 isoform X1 [Glycine 
max]
 ref|XP_006601834.1| PREDICTED: uncharacterized protein LOC100809121 isoform X2 [Glycine 
max]
 gb|ACU23614.1| unknown [Glycine max]
 gb|KHN07635.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   254 bits (648),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 146/173 (84%), Gaps = 11/173 (6%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY VD LSADG+ +HK+CF+CSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-------TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYP  478
            +EQLFKESG+FSKNFQ+       T PE    +T+ P+K ++MFSGTQ+KCATC KT YP
Sbjct  62   YEQLFKESGSFSKNFQSPAKLADKTTPE----LTRSPSKAASMFSGTQEKCATCGKTAYP  117

Query  479  LEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            LEKVT+EG+A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  118  LEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G  +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKHHFSQLFKEKGSYN  171



>gb|KHN17859.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   254 bits (648),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 145/169 (86%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY VD LSADG+ +HK+CF+CSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESG+FSKNFQ+     + +   +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKESGSFSKNFQSPAKLADKTTHELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G  +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKHHFSQLFKEKGSYN  171



>ref|XP_003538442.1| PREDICTED: pollen-specific protein SF3-like isoformX1 [Glycine 
max]
 ref|XP_006591370.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Glycine 
max]
 ref|XP_006591371.1| PREDICTED: pollen-specific protein SF3-like isoform X3 [Glycine 
max]
Length=200

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 145/169 (86%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY VD LSADG+ +HK+CF+CSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESG+FSKNFQ+     + +   +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKESGSFSKNFQSPAKLADKTTHELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G  +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKHHFSQLFKEKGSYN  171



>ref|XP_010093495.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB54148.1| Pollen-specific protein SF3 [Morus notabilis]
Length=192

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKACDKTVY V+ LSADG ++HKSCFKCSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACDKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+G+F+KNFQ+     E     +T+ P+K ++MFSGTQDKCATC KT YPLEKV
Sbjct  62   FEQLFKETGSFNKNFQSPAKSAEKLNPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E   +H+SCFKC+HGGC +T + YA+L+GVLYCKHHFAQLF EKGNY
Sbjct  122  TVESLTYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFAQLFKEKGNY  170


 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC  C KT Y ++ ++ +  T+HKSCFKCSH    +  SNY++++GVL
Sbjct  95   SKAASMFSGTQDKCATCGKTAYPLEKVTVESLTYHKSCFKCSHGGCAITPSNYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE GN++   ++   +R
Sbjct  155  YCKHHFAQLFKEKGNYNHVLRSASSKR  181



>ref|XP_008392904.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Malus 
domestica]
 ref|XP_009351067.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Pyrus x bretschneideri]
Length=199

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+ LSADG ++HKSCFKC+HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQDKCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>ref|XP_002452860.1| hypothetical protein SORBIDRAFT_04g033700 [Sorghum bicolor]
 gb|EES05836.1| hypothetical protein SORBIDRAFT_04g033700 [Sorghum bicolor]
Length=200

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCK CDKTV+F+DLL+ADG ++HK+CFKCSHCKGTL +S+YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSISSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G FSK FQ      +    K P+K+S+ FSGTQDKCA C KTVYPLEK+T+E
Sbjct  62   FEQLFKETGTFSKKFQGGASSTKTDQAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H+SCFKC+HGGC LT ++YA+L+G+LYCK HF+QLF EKG+Y
Sbjct  122  GESYHKSCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSY  167


 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G    +TDQ     K++S F+GT DKC AC KTVY ++ ++ +G ++HKSCFKCSH    
Sbjct  79   GASSTKTDQAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKSCFKCSHGGCI  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
            L  S+Y++++G+LYCK HF QLFKE G+++   QT + ++
Sbjct  139  LTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIQTAQTKK  178



>ref|XP_008463203.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463204.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463205.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=195

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 143/171 (84%), Gaps = 7/171 (4%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKACDKTVY VD LSADG +FHKSCFKCSHCKGTL +SNYSSMDGVLYCK H
Sbjct  2    SFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNF-----QTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
            FEQLFKE+GNFSKNF      + KP  E  +T+ P++ ++MFSGTQ+KCATC KT YPLE
Sbjct  62   FEQLFKETGNFSKNFLSPAKSSEKPTPE--LTRSPSRAASMFSGTQEKCATCGKTAYPLE  119

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            KVT+E +A+H+SCFKC+HGGC L+ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  120  KVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 67/101 (66%), Gaps = 1/101 (1%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            ++  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH   +L  SNY++++G+L
Sbjct  95   SRAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMTKG-PTKVSA  424
            YCK HF QLFKE G+++   ++   +R+ + +   P+KV +
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASMKRQAATSDSDPSKVES  195



>ref|XP_009391810.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCKACDKTV+F+DLL+ADG  +HK+CFKCSHCKG+L M NYSSMDG+LYCK H
Sbjct  2    SFTGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGSLSMCNYSSMDGILYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKESG+F+K F T  K    N ++K P+K+S MF+GTQDKC +C KT YPLEK+T+
Sbjct  62   FEQLFKESGSFTKKFPTGAKSGERNELSKSPSKISYMFTGTQDKCVSCKKTAYPLEKLTV  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CFKC+HGGC LT ++YA+L+G++YCKHHFAQLF EKG+Y 
Sbjct  122  EGESYHKTCFKCSHGGCTLTPSSYAALEGIIYCKHHFAQLFKEKGSYN  169


 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  95   GERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            GER       +K    FTGT DKC +C KT Y ++ L+ +G ++HK+CFKCSH   TL  
Sbjct  83   GERNELSKSPSKISYMFTGTQDKCVSCKKTAYPLEKLTVEGESYHKTCFKCSHGGCTLTP  142

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNFS  355
            S+Y++++G++YCK HF QLFKE G+++
Sbjct  143  SSYAALEGIIYCKHHFAQLFKEKGSYN  169



>ref|XP_009421306.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 143/168 (85%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGT  KCKACDKTVY +D L+ADG  FHKSCFKC+HCKGTL +S YSSM+GVLYCK H
Sbjct  4    NFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPH  63

Query  320  FEQLFKESGNFSKNFQTT--KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKESGNF+KNFQ+     E+   +T+  +K ++MFSGTQ+KCATCTKT YPLEKVT
Sbjct  64   FEQLFKESGNFNKNFQSPAKSAEKAPELTRSTSKAASMFSGTQEKCATCTKTAYPLEKVT  123

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            +EG+A+H+SCFKC+HGGC +T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  124  VEGQAYHKSCFKCSHGGCSITPSNYAALEGILYCKHHFSQLFKEKGSY  171


 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
             E+  +    T K AS F+GT +KC  C KT Y ++ ++ +G  +HKSCFKCSH   ++ 
Sbjct  85   AEKAPELTRSTSKAASMFSGTQEKCATCTKTAYPLEKVTVEGQAYHKSCFKCSHGGCSIT  144

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
             SNY++++G+LYCK HF QLFKE G+++   ++   +R
Sbjct  145  PSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKR  182



>emb|CDY20498.1| BnaC04g05460D [Brassica napus]
 emb|CDX74822.1| BnaA05g05680D [Brassica napus]
Length=200

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 146/172 (85%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY ++LLSADG  FHKSCFKCSHCK TL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSHCKSTLQLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQ------TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKE+G+F+KNFQ      T KP  E  +T+ P++V+ MFSGTQDKCATC+KTVYP+
Sbjct  62   FEQLFKETGSFNKNFQSPAKPLTDKPTPE--LTRTPSRVAGMFSGTQDKCATCSKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_009344420.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=199

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+ LSADG ++HKSCFKC+HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQDKCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>ref|XP_008381875.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=199

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+ LSADG ++HKSCFKC+HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQDKCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>ref|XP_006411232.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 ref|XP_006411233.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 ref|XP_006411234.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52685.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52686.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
 gb|ESQ52687.1| hypothetical protein EUTSA_v10017249mg [Eutrema salsugineum]
Length=203

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            M SFTGT  KC+AC+KTVY ++LLSADG  FHKSCFKCSHCK  L +SNYSSM+GVLYCK
Sbjct  1    MMSFTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSHCKSRLQLSNYSSMEGVLYCK  60

Query  314  THFEQLFKESGNFSKNFQ------TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVY  475
             HFEQLFKE+G+F+KNFQ      T KP  E  +T+ P++V+ MFSGTQDKCATC+KTVY
Sbjct  61   PHFEQLFKETGSFNKNFQSPAKPLTDKPTPE--LTRTPSRVAGMFSGTQDKCATCSKTVY  118

Query  476  PLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            P+EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  119  PIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  172


 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  103  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  162

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  163  AQLFKEKGSYNHLIKSASIKR  183



>ref|XP_009143273.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
Length=199

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 146/172 (85%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY ++LLSADG  FHKSCFKCSHCK TL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCRACEKTVYPMELLSADGVPFHKSCFKCSHCKSTLQLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQ------TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKE+G+F+KNFQ      T KP  E  +T+ P++V+ MFSGTQDKCATC+KTVYP+
Sbjct  62   FEQLFKETGSFNKNFQSPAKPLTDKPTPE--LTRTPSRVAGMFSGTQDKCATCSKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_004167859.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3-like 
[Cucumis sativus]
Length=195

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKACDKTVY VD LSADG +FHKSCFKCSHCKGTL +SNYSSMDGVLYCK H
Sbjct  2    SFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNFSKNF +     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFSKNFLSPAKSSEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGC L+ + YA+LDG+L CKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCSLSPSNYAALDGILXCKHHFSQLFKEKGSY  170


 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 66/101 (65%), Gaps = 1/101 (1%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH   +L  SNY+++DG+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALDGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMT-KGPTKVSA  424
             CK HF QLFKE G+++   ++   +R+ + +   P+KV +
Sbjct  155  XCKHHFSQLFKEKGSYNHLIKSASMKRQAATSDPDPSKVES  195



>gb|ABK22125.1| unknown [Picea sitchensis]
Length=197

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 144/171 (84%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGT  KCKACDKTVYFVD LSADG ++HKSCF+C+HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    AFTGTQQKCKACDKTVYFVDQLSADGVSYHKSCFRCNHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPER-----ENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
            F+QLF+ESGNF+KNFQ+ +  +        +T+ P+KVS MFSGTQDKCATC KT YPLE
Sbjct  62   FDQLFRESGNFNKNFQSQRSSKVIDGLSPELTRSPSKVSMMFSGTQDKCATCGKTAYPLE  121

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            KVT+E  ++H+SCFKC+HGGC ++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  KVTVESLSYHKSCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSY  172


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KT Y ++ ++ +  ++HKSCFKCSH   ++  SNY++++G+LYCK HF
Sbjct  103  FSGTQDKCATCGKTAYPLEKVTVESLSYHKSCFKCSHGGCSISPSNYAALEGILYCKHHF  162

Query  323  EQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAM  427
             QLFKE G+++   +T   +R  ++ +  + V  +
Sbjct  163  SQLFKEKGSYNHLIKTATMKRAAAVPEVASAVPEI  197



>ref|XP_010905119.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=208

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT DKCKACDKTV+F+DLL+ADG  +HK+CFKCSHCKG L M +YSSMDGVLYCK H
Sbjct  2    SFSGTQDKCKACDKTVHFIDLLTADGVPYHKTCFKCSHCKGNLTMCSYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+F+K F T  K   +N + + P+KVS MFSGTQDKCA+C KT YPLEK+T+
Sbjct  62   FEQLFKETGSFTKKFPTGAKSGDKNELNRTPSKVSYMFSGTQDKCASCKKTAYPLEKITV  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H++CFKC+HGGC LT ++YA++DG+LYCKHHFAQLF EKG+Y 
Sbjct  122  EGESYHKTCFKCSHGGCTLTPSSYAAIDGILYCKHHFAQLFKEKGSYN  169


 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +2

Query  95   GERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            G++       +K    F+GT DKC +C KT Y ++ ++ +G ++HK+CFKCSH   TL  
Sbjct  83   GDKNELNRTPSKVSYMFSGTQDKCASCKKTAYPLEKITVEGESYHKTCFKCSHGGCTLTP  142

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
            S+Y+++DG+LYCK HF QLFKE G+++   +    +R
Sbjct  143  SSYAAIDGILYCKHHFAQLFKEKGSYNHVIKAASMKR  179



>ref|XP_010554627.1| PREDICTED: LIM domain-containing protein WLIM2b [Tarenaya hassleriana]
 ref|XP_010554628.1| PREDICTED: LIM domain-containing protein WLIM2b [Tarenaya hassleriana]
Length=196

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 146/169 (86%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCK CDKTVY V+LLSADG  +HKSCFKC+HCK  L +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKTCDKTVYPVELLSADGVGYHKSCFKCTHCKSRLQLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS--MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+  KP  + +  +T+ P+K ++MFSGTQDKCATC+KTVYPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKPAEKPTPELTRTPSKFASMFSGTQDKCATCSKTVYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +++H+SCFKC+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +2

Query  95   GERQTDQNIHTK-KMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
             E+ T +   T  K AS F+GT DKC  C KTVY ++ ++ +  ++HKSCFKCSH    +
Sbjct  83   AEKPTPELTRTPSKFASMFSGTQDKCATCSKTVYPLEKVTVESQSYHKSCFKCSHGGCPI  142

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGP  409
              SNY++++G+LYCK HF QLFKE G+++   ++   +R  +    P
Sbjct  143  SPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRTAAAAGVP  189



>gb|AGJ83942.1| lim protein 2 [Gossypium hirsutum]
 gb|KHG28834.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+L+S DG  FHKSCFKCSHCKGTL   NYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVELVSVDGVPFHKSCFKCSHCKGTLKWGNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT--KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKE+GN++KNFQ+     E+   +T+ P+K + MFSGTQDKCATC KT YPLEKVT
Sbjct  62   FEQLFKEAGNYNKNFQSPAKSAEKLTQLTRSPSKAAGMFSGTQDKCATCGKTAYPLEKVT  121

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            +EG+++H+SCFKC+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  VEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  169


 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT DKC  C KT Y ++ ++ +G ++HKSCFKCSH    +  SNY++++G+L
Sbjct  94   SKAAGMFSGTQDKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGIL  153

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  154  YCKHHFSQLFKEKGSYNHLIKSASIKR  180



>ref|XP_007163504.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 ref|XP_007163505.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|AGV54419.1| pollen-specific protein SF3-like isoform 1 [Phaseolus vulgaris]
 gb|ESW35498.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|ESW35499.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
Length=194

 Score =   252 bits (643),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 145/173 (84%), Gaps = 11/173 (6%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY VD LSADG+ +HK+CF+CSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-------TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYP  478
            +EQLFKE+G FSKNFQ+       T PE    +T+ P+K ++MFSGTQ+KCATC KT YP
Sbjct  62   YEQLFKETGTFSKNFQSPAKLADKTTPE----LTRSPSKAASMFSGTQEKCATCGKTAYP  117

Query  479  LEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            LEKVT+EG+A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  118  LEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G  +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKHHFSQLFKEKGSYN  171



>ref|XP_004307607.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=200

 Score =   252 bits (644),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC KTVY V+ LSADG ++HKSCFKC+HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACQKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     MT+ P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPEMTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>gb|AAF75284.1|AF116850_1 LIM domain protein PLIM-2 [Helianthus annuus]
 gb|AAD15745.1| LIM domain protein PLIM-2 [Helianthus annuus]
Length=240

 Score =   253 bits (647),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F GT+DKC ACDKTV+FVDL++ D   +HK CFKC+HCKGTLVMSNYSSMDGVLYC  H
Sbjct  2    AFGGTIDKCNACDKTVHFVDLMTVDNVIYHKKCFKCTHCKGTLVMSNYSSMDGVLYCMPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+GN+SKNF+T+K  R+NS  + P K S  FSGT DKC  C KTVY ++K+TME
Sbjct  62   FEQLFKETGNYSKNFRTSKLNRDNSTAQLPNKFSYFFSGTLDKCRICEKTVYFIDKMTME  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKG  631
            GE++H+ CF+C HGGCPLTH++YA+L+G LYC+HHFAQLF+EKG
Sbjct  122  GESYHKQCFRCVHGGCPLTHSSYAALNGNLYCRHHFAQLFLEKG  165


 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GTLDKC+ C+KTVYF+D ++ +G ++HK CF+C H    L  S+Y++++G LYC+ HF
Sbjct  98   FSGTLDKCRICEKTVYFIDKMTMEGESYHKQCFRCVHGGCPLTHSSYAALNGNLYCRHHF  157

Query  323  EQLFKESGNFSKNFQTTKPERENSM  397
             QLF E G  S   +     ++N++
Sbjct  158  AQLFLEKGTLSHVLKAAADRKKNTI  182


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  428  FSGTQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHF  607
            F GT DKC  C KTV+ ++ +T++   +H+ CFKC H    L  + Y+S+DGVLYC  HF
Sbjct  3    FGGTIDKCNACDKTVHFVDLMTVDNVIYHKKCFKCTHCKGTLVMSNYSSMDGVLYCMPHF  62

Query  608  AQLFMEKGNY  637
             QLF E GNY
Sbjct  63   EQLFKETGNY  72



>ref|XP_010505685.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
 ref|XP_010505686.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
Length=207

 Score =   252 bits (644),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 147/170 (86%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY V+LLSADG ++HKSCFKCSHCK  L +SNYSSM+GV+YC+ H
Sbjct  2    SFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEK  487
            FEQLFKESG+FSKNFQ+  KP  E +   +T+ P++V+ +FSGTQDKCATC+KTVYP+EK
Sbjct  62   FEQLFKESGSFSKNFQSPAKPLSEKATPELTRTPSRVAGLFSGTQDKCATCSKTVYPIEK  121

Query  488  VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            VT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  122  VTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_006403418.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403419.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403420.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 ref|XP_006403421.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44871.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44872.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44873.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
 gb|ESQ44874.1| hypothetical protein EUTSA_v10010740mg [Eutrema salsugineum]
Length=199

 Score =   252 bits (643),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 147/169 (87%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG ++H+SCFKC+HCK  L +S YSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPVELLSADGVSYHRSCFKCTHCKSRLQLSRYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS--MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESG+F+KNFQ+  KP  ++S  +T+ P++V+ MFSGTQ+KCATC+KTVYP+EK+
Sbjct  62   FEQLFKESGSFNKNFQSPAKPAEKSSPELTRTPSRVAGMFSGTQEKCATCSKTVYPIEKI  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E + +H+SCFKC+HGGCPL+ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  122  TVESQTYHKSCFKCSHGGCPLSPSNYAALEGILYCKHHFAQLFKEKGSY  170


 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    L  SNY++++G+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKITVESQTYHKSCFKCSHGGCPLSPSNYAALEGILYCKHHF  160

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  161  AQLFKEKGSYNHLIKSASIKR  181



>ref|XP_008392902.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_008392903.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_009351060.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Pyrus x bretschneideri]
Length=200

 Score =   251 bits (642),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 143/170 (84%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+ LSADG ++HKSCFKC+HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN----SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEK  487
            FEQLFKE+GNF+KNFQ+   +        +T+ P+K ++MFSGTQDKCATC KT YPLEK
Sbjct  62   FEQLFKETGNFNKNFQSPAAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK  121

Query  488  VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            VT+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  171


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  96   SKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGIL  155

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  156  YCKHHFSQLFKEKGSYNHLIKSASIKR  182



>ref|XP_002279922.1| PREDICTED: LIM domain-containing protein WLIM2b [Vitis vinifera]
 ref|XP_010658484.1| PREDICTED: LIM domain-containing protein WLIM2b [Vitis vinifera]
 emb|CAN81425.1| hypothetical protein VITISV_014590 [Vitis vinifera]
 emb|CBI31546.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   251 bits (641),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC KTVY V+ LSADG  +HKSCFKCSHC GTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACLKTVYPVEQLSADGVVYHKSCFKCSHCNGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESGNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  170


 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPISPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFAQLFKEKGSYNHLIKSASMKR  181



>ref|XP_004138434.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004165359.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_008441430.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441431.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441432.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 gb|KGN45769.1| hypothetical protein Csa_6G009480 [Cucumis sativus]
Length=189

 Score =   251 bits (641),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+ LSADG ++HKSCFKCSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K + MFSGTQDKCATC KTVYPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQDKCATCGKTVYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +++H+SCFKC+HGGC L+ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQSYHKSCFKCSHGGCALSPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT DKC  C KTVY ++ ++ +  ++HKSCFKCSH    L  SNY++++G+L
Sbjct  95   SKAAGMFSGTQDKCATCGKTVYPLEKVTVESQSYHKSCFKCSHGGCALSPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASMKR  181



>ref|XP_007218461.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_007218462.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_008233707.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 ref|XP_008233708.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 gb|EMJ19660.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 gb|EMJ19661.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
Length=192

 Score =   251 bits (641),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+ LSADG ++HK+CFKC+HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVEELSADGVSYHKACFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>ref|XP_003580212.1| PREDICTED: LIM domain-containing protein PLIM2b-like [Brachypodium 
distachyon]
Length=205

 Score =   251 bits (642),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC ACDKTV+F+DLL+ADG  +HK+CFKCSHCKG L M +YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCFACDKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+FSK F          +++ P+K+S++FSGTQDKC  CTKTVYPLEK+T+E
Sbjct  62   FEQLFKETGSFSKKFTPGTKSDRGELSRAPSKLSSIFSGTQDKCTACTKTVYPLEKMTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GEA+H+SCFKC+HGGC LT ++YA+L+GVLYCK HF QLFMEKG+Y
Sbjct  122  GEAYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSY  167


 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            +F    + +R       +K  + F+GT DKC AC KTVY ++ ++ +G  +HKSCFKCSH
Sbjct  75   KFTPGTKSDRGELSRAPSKLSSIFSGTQDKCTACTKTVYPLEKMTLEGEAYHKSCFKCSH  134

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
                L  S+Y++++GVLYCK HF QLF E G++S
Sbjct  135  GGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYS  168



>ref|XP_006295906.1| hypothetical protein CARUB_v10025036mg [Capsella rubella]
 gb|EOA28804.1| hypothetical protein CARUB_v10025036mg [Capsella rubella]
Length=200

 Score =   251 bits (642),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 145/172 (84%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY V+LLSADG ++HKSCFKCSHCK  L +SNYSSM+GV+YC+ H
Sbjct  2    SFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRPH  61

Query  320  FEQLFKESGNFSKNFQTT------KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKESG+FSKNFQ+       KP  E  +T+ P++V+ MFSGTQDKCATC KTVYP+
Sbjct  62   FEQLFKESGSFSKNFQSPAKPLSDKPTPE--LTRTPSRVAGMFSGTQDKCATCNKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C+KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCNKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>gb|AII80545.1| LIM-domain protein 11 [Gossypium hirsutum]
Length=225

 Score =   252 bits (644),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT DKC  CDKTV+F+DLL+ADG  +HK+CFKC+HC G LVMSNY SM+GVLYCK H
Sbjct  2    AFSGTTDKCTICDKTVHFIDLLTADGIPYHKTCFKCTHCNGLLVMSNYCSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G ++KNFQ+ K +R N  TK P +++A FSGTQDKC  C KT YPLEKVT+E
Sbjct  62   FEQLFKETGTYTKNFQSKKSDRPNGQTKTPNRLAAFFSGTQDKCGVCNKTAYPLEKVTVE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H+SCF+C+ GGC LT +TYA++DG+LYCKHHFAQLFMEKG Y
Sbjct  122  GENYHKSCFRCSPGGCLLTPSTYAAMDGILYCKHHFAQLFMEKGCY  167


 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +2

Query  92   RGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            + +R   Q     ++A+F +GT DKC  C+KT Y ++ ++ +G  +HKSCF+CS     L
Sbjct  80   KSDRPNGQTKTPNRLAAFFSGTQDKCGVCNKTAYPLEKVTVEGENYHKSCFRCSPGGCLL  139

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFS---------KNFQTTKPERE  388
              S Y++MDG+LYCK HF QLF E G +S         KN   + PE++
Sbjct  140  TPSTYAAMDGILYCKHHFAQLFMEKGCYSHLAKQACMKKNLAGSSPEQK  188



>ref|XP_002879831.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56090.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 146/172 (85%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY V+LLSADG ++HKSCFKCSHCK  L +SNYSSM+GV+YC+ H
Sbjct  2    SFTGTQQKCRACEKTVYPVELLSADGISYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRPH  61

Query  320  FEQLFKESGNFSKNFQ------TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKESG+FSKNFQ      T KP  E  +T+ P++++ MFSGTQDKCATC+KTVYP+
Sbjct  62   FEQLFKESGSFSKNFQSPAKPLTDKPTPE--LTRTPSRLAGMFSGTQDKCATCSKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>gb|KHG24101.1| Pollen-specific SF3 [Gossypium arboreum]
Length=227

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT DKC  CDKTV+F+DLL+ADG  +HK+CFKC+HC G LVMSNY SM+GVLYCK H
Sbjct  2    AFSGTTDKCTICDKTVHFIDLLTADGIPYHKTCFKCTHCNGLLVMSNYCSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G ++KNFQ+ K +R N  TK P +++A FSGTQDKC  C KT YPLEKVT+E
Sbjct  62   FEQLFKETGTYTKNFQSKKSDRPNGQTKTPNRLAAFFSGTQDKCGVCNKTAYPLEKVTVE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H+SCF+C+ GGC LT +TYA++DG+LYCKHHFAQLFMEKG Y
Sbjct  122  GENYHKSCFRCSPGGCLLTPSTYAAMDGILYCKHHFAQLFMEKGCY  167


 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +2

Query  92   RGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            + +R   Q     ++A+F +GT DKC  C+KT Y ++ ++ +G  +HKSCF+CS     L
Sbjct  80   KSDRPNGQTKTPNRLAAFFSGTQDKCGVCNKTAYPLEKVTVEGENYHKSCFRCSPGGCLL  139

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFS---------KNFQTTKPERE  388
              S Y++MDG+LYCK HF QLF E G +S         KN   + PE++
Sbjct  140  TPSTYAAMDGILYCKHHFAQLFMEKGCYSHLAKQACMKKNLAGSSPEQK  188



>gb|AGJ83945.1| lim protein 5 [Gossypium hirsutum]
Length=189

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+LLSADG  +HKSCFKCSHCKGTL ++NYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLANYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ++    E     MT+ P+K ++MFSGT +KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSSAKAAEKLTPEMTRSPSKAASMFSGTVEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+++H+SCFKC+HGGC L+ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQSYHKSCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT++KC  C KT Y ++ ++ +G ++HKSCFKCSH   +L  SNY++++G+L
Sbjct  95   SKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCSLSPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>ref|XP_003544136.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Glycine max]
 ref|XP_006595876.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Glycine max]
 ref|XP_006595877.1| PREDICTED: pollen-specific protein SF3 isoform X3 [Glycine max]
 gb|KHN20876.1| Pollen-specific protein SF3 [Glycine soja]
Length=189

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 144/173 (83%), Gaps = 11/173 (6%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KC+ACDKTVY VD LSADG+ +HK+CFKCSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-------TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYP  478
            +EQLFKE+G+F KNFQ+       T PE    +T+ P+K ++MFSGTQ+KCATC KT YP
Sbjct  62   YEQLFKETGSFKKNFQSPAKQAVKTTPE----LTRSPSKAASMFSGTQEKCATCGKTAYP  117

Query  479  LEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            LEKVT+EG+A+H+SCFKC+HG CP+T + YA+L+GVLYCKHHF+QLF EKG+Y
Sbjct  118  LEKVTVEGQAYHKSCFKCSHGSCPITPSNYAALEGVLYCKHHFSQLFKEKGSY  170


 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G  +HKSCFKCSH    +  SNY++++GVL
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGSCPITPSNYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERE-NSMTKG  406
            YCK HF QLFKE G+++   ++   +RE NS+ + 
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKREANSVPQA  189


 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  428  FSGTQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHF  607
            F GTQ KC  C KTVYP+++++ +G A+H++CFKC+H    L  + Y+S++GVLYCK H+
Sbjct  3    FIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKPHY  62

Query  608  AQLFMEKGNYQ  640
             QLF E G+++
Sbjct  63   EQLFKETGSFK  73



>ref|XP_007009108.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOY17918.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
Length=197

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 145/177 (82%), Gaps = 11/177 (6%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG  +HKSCFKCSHCKGTL + NYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-----------TKPERENSMTKGPTKVSAMFSGTQDKCATCTK  466
            FEQLFKE+GNF+KNFQ+           +  +    +T+ P+K ++MFSGTQ+KCATC K
Sbjct  62   FEQLFKETGNFNKNFQSLSLILLSAAAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGK  121

Query  467  TVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T YPLEKVT+EG+++H+SCFKC+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  178


 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 72/122 (59%), Gaps = 3/122 (2%)
 Frame = +2

Query  29   QTTRHTNNSKRVTLLRFNHVGRGERQTDQNI---HTKKMASFTGTLDKCKACDKTVYFVD  199
            +T     N + ++L+  +   +   +    +    +K  + F+GT +KC  C KT Y ++
Sbjct  68   ETGNFNKNFQSLSLILLSAAAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLE  127

Query  200  LLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKP  379
             ++ +G ++HKSCFKCSH    +  SNY++++G+LYCK HF QLFKE G+++   ++   
Sbjct  128  KVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASI  187

Query  380  ER  385
            +R
Sbjct  188  KR  189



>dbj|BAK04207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=203

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC AC+KTV+F+DLL+ADG  +HK+CFKCSHCKG L M +YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCSACEKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+FSK F    K   ++ +T+ P+K+SA FSGTQDKCA CTKTVYPLEK+T+
Sbjct  62   FEQLFKETGSFSKKFTPGNKSGDKSELTRAPSKLSAAFSGTQDKCAACTKTVYPLEKMTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EG+A+H+SCFKC+HGGC LT ++YA+L+GVLYCK HF QLFME+G+Y
Sbjct  122  EGDAYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMERGSY  168


 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            G++       +K  A+F+GT DKC AC KTVY ++ ++ +G  +HKSCFKCSH    L  
Sbjct  83   GDKSELTRAPSKLSAAFSGTQDKCAACTKTVYPLEKMTLEGDAYHKSCFKCSHGGCILTT  142

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERE  388
            S+Y++++GVLYCK HF QLF E G++S + +   P +E
Sbjct  143  SSYAALNGVLYCKIHFGQLFMERGSYS-HMKKKSPSQE  179



>ref|XP_008677533.1| PREDICTED: uncharacterized LOC100381874 isoform X1 [Zea mays]
 gb|AFW63175.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB04943.1| LIM transcription factor, partial [Zea mays]
Length=207

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCKACDKTV+F+DLL+ADG ++HK+CFKCSHCKG L +S+YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCKACDKTVHFIDLLTADGVSYHKTCFKCSHCKGVLSISSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQ--TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKE+GNFSK FQ        +N   K P+K+S+ FSGTQDKCA C KTVYPLEK+T
Sbjct  62   FEQLFKETGNFSKKFQGGGGASSNKNDPAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMT  121

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            +EGE++H+ CFKC+HGGC LT ++YA+L+G+LYCK HF+QLF EKG+Y 
Sbjct  122  LEGESYHKGCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSYN  170


 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 66/100 (66%), Gaps = 1/100 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G    + D      K++S F+GT DKC AC KTVY ++ ++ +G ++HK CFKCSH    
Sbjct  81   GASSNKNDPAKAPSKLSSAFSGTQDKCAACQKTVYPLEKMTLEGESYHKGCFKCSHGGCI  140

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
            L  S+Y++++G+LYCK HF QLFKE G+++   +T + ++
Sbjct  141  LTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIETAQTKK  180



>ref|XP_010517368.1| PREDICTED: LIM domain-containing protein WLIM2a [Camelina sativa]
Length=201

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 146/172 (85%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY V+LLSADG ++HKSCFKCSHCK  L +SNYSSM+GV+YC+ H
Sbjct  2    SFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRPH  61

Query  320  FEQLFKESGNFSKNFQTT------KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKESG+FSKNFQ+       KP  E  +T+ P++V+ +FSGTQDKCATC+KTVYP+
Sbjct  62   FEQLFKESGSFSKNFQSPAKPLSDKPTPE--LTRTPSRVAGLFSGTQDKCATCSKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_003569963.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Brachypodium 
distachyon]
Length=210

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCK CDKTV+F+DLLSADG ++HK+CFKCSHCKGTL M NYSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCKTCDKTVHFIDLLSADGISYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+FSK F    K   +N   K P K+S++FSGTQDKCA C KTVYPLEK+T+
Sbjct  62   FEQLFKETGSFSKKFTPGGKSSDKNDQAKAPNKLSSVFSGTQDKCAACQKTVYPLEKLTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE +H+SCFKC+HGGC LT ++YA+L+G+LYCK HF+QLF EKG+Y 
Sbjct  122  EGECYHKSCFKCSHGGCTLTTSSYAALNGILYCKIHFSQLFKEKGSYN  169


 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCS  250
            +F   G+   + DQ     K++S F+GT DKC AC KTVY ++ L+ +G  +HKSCFKCS
Sbjct  75   KFTPGGKSSDKNDQAKAPNKLSSVFSGTQDKCAACQKTVYPLEKLTLEGECYHKSCFKCS  134

Query  251  HCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTK  376
            H   TL  S+Y++++G+LYCK HF QLFKE G+++   +T +
Sbjct  135  HGGCTLTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIKTAQ  176



>ref|XP_006652565.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=200

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC ACDKTV+F+DLL+ADG  +HK+CFKCSHCKG L M +YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+FSK F       +  + + P+K+S+ FSGTQDKCA C KTVYPLEK+T+E
Sbjct  62   FEQLFKETGSFSKKFTPGCRSSDKELARAPSKISSAFSGTQDKCAACQKTVYPLEKLTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE++H+SCFKC+HGGC LT ++YA+L+GVLYCK HF QLFMEKG+Y
Sbjct  122  GESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSY  167


 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = +2

Query  95   GERQTDQNI---HTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G R +D+ +    +K  ++F+GT DKC AC KTVY ++ L+ +G ++HKSCFKCSH    
Sbjct  79   GCRSSDKELARAPSKISSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCI  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            L  S+Y++++GVLYCK HF QLF E G+++
Sbjct  139  LTTSSYAALNGVLYCKIHFGQLFMEKGSYN  168



>emb|CBI40313.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 138/147 (94%), Gaps = 2/147 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGTLDKCKACDKTVY VDLLSADG+++HK+CFKCSHCKGTLVMSNYSSMDGVLYCK H
Sbjct  2    AFTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTT-KP-ERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKESGNFSKNFQT+ KP ++ N +++ P+K+S+MFSGTQDKC+ C KTVYPLEKVT
Sbjct  62   FEQLFKESGNFSKNFQTSAKPADKLNELSRAPSKLSSMFSGTQDKCSACRKTVYPLEKVT  121

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYAS  574
            +EGE++H+SCFKCAHGGCPLTH++YA+
Sbjct  122  LEGESYHKSCFKCAHGGCPLTHSSYAA  148


 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +2

Query  428  FSGTQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHF  607
            F+GT DKC  C KTVY ++ ++ +G ++H++CFKC+H    L  + Y+S+DGVLYCK HF
Sbjct  3    FTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKPHF  62

Query  608  AQLFMEKGNY  637
             QLF E GN+
Sbjct  63   EQLFKESGNF  72


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSS  289
            +K  + F+GT DKC AC KTVY ++ ++ +G ++HKSCFKC+H    L  S+Y++
Sbjct  94   SKLSSMFSGTQDKCSACRKTVYPLEKVTLEGESYHKSCFKCAHGGCPLTHSSYAA  148



>ref|XP_002448228.1| hypothetical protein SORBIDRAFT_06g023600 [Sorghum bicolor]
 gb|EES12556.1| hypothetical protein SORBIDRAFT_06g023600 [Sorghum bicolor]
Length=203

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC ACDKTV+F+DLL+ADG  +HK+CFKCSHCKG L M +YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCTACDKTVHFIDLLTADGVIYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+FSK F       +  + + P+K+S+ FSGTQDKCA C KTVYPLEK+T+E
Sbjct  62   FEQLFKETGSFSKKFTPGCKSDKGELARAPSKLSSAFSGTQDKCAACQKTVYPLEKLTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GEA+H+SCFKC+HGGC LT ++YA+L+GVLYCK HF QLFMEKG+Y
Sbjct  122  GEAYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSY  167


 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  ++F+GT DKC AC KTVY ++ L+ +G  +HKSCFKCSH    L  S+Y++++GVL
Sbjct  92   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGEAYHKSCFKCSHGGCILTTSSYAALNGVL  151

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLF E G+++
Sbjct  152  YCKIHFGQLFMEKGSYN  168



>dbj|BAK06966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKCK CDKTV+F+DLL+ADG ++HK+CFKCSHCKGTL M NYSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCKTCDKTVHFIDLLTADGVSYHKTCFKCSHCKGTLSMCNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+FSK F       E S  K P+K+S+ FSGTQDKCA C KTVYPLEK+++E
Sbjct  62   FEQLFKETGSFSKKFTPGGKSAEKSEAKAPSKMSSAFSGTQDKCAACQKTVYPLEKLSLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H+ CFKC+HGGC LT ++YA+L+G+LYCK HF+QLF EKG+Y
Sbjct  122  GECYHKGCFKCSHGGCILTTSSYAALNGILYCKIHFSQLFKEKGSY  167


 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +2

Query  74   RFNHVGRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSH  253
            +F   G+   +++    +K  ++F+GT DKC AC KTVY ++ LS +G  +HK CFKCSH
Sbjct  75   KFTPGGKSAEKSEAKAPSKMSSAFSGTQDKCAACQKTVYPLEKLSLEGECYHKGCFKCSH  134

Query  254  CKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPEREN  391
                L  S+Y++++G+LYCK HF QLFKE G+++   +T + ++EN
Sbjct  135  GGCILTTSSYAALNGILYCKIHFSQLFKEKGSYNHLIKTAQTKKEN  180



>gb|KDP44835.1| hypothetical protein JCGZ_01335 [Jatropha curcas]
Length=189

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY ++LLSADG ++HKSCFKC HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGISYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGC L+ + YA+L+GVLYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLYCKHHFSQLFKEKGSY  170


 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH   +L  SNY++++GVL
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASMKR  181



>ref|XP_010508950.1| PREDICTED: LIM domain-containing protein WLIM2a-like [Camelina 
sativa]
Length=199

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 146/172 (85%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY V+LLSADG ++HKSCFKCSHCK  L +SNYSSM+GV+YC+ H
Sbjct  2    SFTGTQQKCRACEKTVYPVELLSADGVSYHKSCFKCSHCKSRLQLSNYSSMEGVVYCRPH  61

Query  320  FEQLFKESGNFSKNFQTT------KPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKESG+FSKNFQ+       KP  E  +T+ P++V+ +FSGTQDKCATC+KTVYP+
Sbjct  62   FEQLFKESGSFSKNFQSPAKPLSDKPTPE--LTRTPSRVAGLFSGTQDKCATCSKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFS  355
             QLFKE G+++
Sbjct  162  AQLFKEKGSYN  172



>ref|NP_181519.1| protein WLIM2A [Arabidopsis thaliana]
 sp|O04193.1|WLI2A_ARATH RecName: Full=LIM domain-containing protein WLIM2a; AltName: 
Full=Widely-expressed LIM protein 2; Short=AtWLIM2 [Arabidopsis 
thaliana]
 gb|AAB95275.1| putative LIM-domain protein [Arabidopsis thaliana]
 gb|AAM19819.1| At2g39900/T28M21.6 [Arabidopsis thaliana]
 gb|AAM67434.1| At2g39900/T28M21.6 [Arabidopsis thaliana]
 gb|AEC09747.1| protein WLIM2A [Arabidopsis thaliana]
Length=200

 Score =   249 bits (637),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 145/172 (84%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY V+LLSADG ++HK+CFKCSHCK  L +SNYSSM+GV+YC+ H
Sbjct  2    SFTGTQQKCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPH  61

Query  320  FEQLFKESGNFSKNFQ------TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKESG+FSKNFQ      T KP  E  + + P++++ MFSGTQDKCATCTKTVYP+
Sbjct  62   FEQLFKESGSFSKNFQSPAKPLTDKPTPE--LNRTPSRLAGMFSGTQDKCATCTKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCTKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_011076748.1| PREDICTED: LIM domain-containing protein WLIM2b [Sesamum indicum]
Length=189

 Score =   249 bits (636),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+LLSADG ++HKSCFKCSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            +EQLFKE+G+FSKNFQ+     E     +T+ P+K + MFSGTQDKCATC KT YPLEKV
Sbjct  62   YEQLFKETGSFSKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQDKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +++H+SCFKC+HGGC LT + YA+LDG+LYCK HF+QLF EKG+Y
Sbjct  122  TVESQSYHKSCFKCSHGGCSLTPSNYAALDGILYCKPHFSQLFKEKGSY  170


 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT DKC  C KT Y ++ ++ +  ++HKSCFKCSH   +L  SNY+++DG+L
Sbjct  95   SKAAGMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCSLTPSNYAALDGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMT  400
            YCK HF QLFKE G+++   ++   +R  ++ 
Sbjct  155  YCKPHFSQLFKEKGSYNHLIKSASMKRATTVV  186



>emb|CDY68273.1| BnaAnng26690D [Brassica napus]
 emb|CDX83389.1| BnaA03g21170D [Brassica napus]
Length=226

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HK+CF+CSHC G+LV+SNYSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKNCFRCSHCNGSLVISNYSSMDGVLYCKRH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKES    K+  T  K ++ N  +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVT
Sbjct  62   FEQLFKES---VKSLHTGGKTDKTNDQLTRAPSKLSSFFSGTQDKCATCQKTVYPLEKVT  118

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            MEGE FH++CFKCAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  119  MEGECFHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  167


 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +2

Query  89   GRGERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
            G+ ++  DQ     +K  + F+GT DKC  C KTVY ++ ++ +G  FHK+CFKC+H   
Sbjct  77   GKTDKTNDQLTRAPSKLSSFFSGTQDKCATCQKTVYPLEKVTMEGECFHKTCFKCAHSGC  136

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ  367
             L  S+Y+S++GVLYCK HF QLF E G+++   Q
Sbjct  137  PLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQ  171



>ref|XP_008374043.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=213

 Score =   250 bits (638),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT  KCKACDKTV+F+D LSADG  +HK+CFKCSHC G L MS+YSSMDGVLYCK H
Sbjct  2    SFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+FSK FQT+  + +N +T+ P+K+S+MFSGT DKCA CTKTVYPLEKVTME
Sbjct  62   FEQLFKETGSFSKKFQTSG-KSQNELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            G+ +H+SCF+C HGGC L+ +  A+LDG+LYCKHHFAQLF EKG+Y
Sbjct  121  GDFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSY  166


 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 71/127 (56%), Gaps = 10/127 (8%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            G+ Q +      K++S F+GT+DKC  C KTVY ++ ++ +G  +HKSCF+C+H    L 
Sbjct  80   GKSQNELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGDFYHKSCFRCNHGGCFLS  139

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFS---------KNFQTTKPERENSMTKGPTKVSA  424
             SN +++DG+LYCK HF QLFKE G++S         KN  T    +       P   + 
Sbjct  140  PSNCAALDGILYCKHHFAQLFKEKGSYSHLTKTASLKKNGATLPEPKPEESQPEPAXETE  199

Query  425  MFSGTQD  445
            +   TQD
Sbjct  200  VAQETQD  206



>gb|EYU19976.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
 gb|EYU19977.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
Length=199

 Score =   249 bits (636),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 141/171 (82%), Gaps = 4/171 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+LLSADG +FHKSCF+CSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFLGTTQKCKACEKTVYHVELLSADGISFHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS----MTKGPTKVSAMFSGTQDKCATCTKTVYPLEK  487
            +EQLFKE+G+F+KNF +     E S    MT+ P+K + MFSGTQDKCATC KT YPLEK
Sbjct  62   YEQLFKETGSFTKNFTSPAKSAEKSSTPEMTRSPSKAAGMFSGTQDKCATCAKTAYPLEK  121

Query  488  VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            VT+E +++H+SCFKC+HGGC LT + YA+LDG+LYCK HF+QLF EKG+Y 
Sbjct  122  VTVENQSYHKSCFKCSHGGCSLTPSNYAALDGILYCKPHFSQLFKEKGSYN  172


 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT DKC  C KT Y ++ ++ +  ++HKSCFKCSH   +L  SNY+++DG+L
Sbjct  96   SKAAGMFSGTQDKCATCAKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTPSNYAALDGIL  155

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGP  409
            YCK HF QLFKE G+++   ++   +R  ++   P
Sbjct  156  YCKPHFSQLFKEKGSYNHVLKSASMKRPTAVVAVP  190



>ref|XP_009133391.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 gb|AID61745.1| LIM domain-containing protein [Brassica rapa subsp. pekinensis]
Length=200

 Score =   249 bits (636),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 146/172 (85%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY ++LLSADG +FHKSCFKCSHCK TL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSHCKTTLQLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQ------TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKE+G+F+KNFQ      T KP  E  +T+ P++V+ MFSGTQDKCATC+KTVYP+
Sbjct  62   FEQLFKETGSFNKNFQSPAKPLTDKPTPE--LTRTPSRVAGMFSGTQDKCATCSKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGC ++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>emb|CDY24943.1| BnaC03g22290D [Brassica napus]
Length=197

 Score =   249 bits (636),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 146/172 (85%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY ++LLSADG +FHKSCFKCSHCK TL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSHCKTTLQLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQ------TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKE+G+F+KNFQ      T KP  E  +T+ P++V+ MFSGTQDKCATC+KTVYP+
Sbjct  62   FEQLFKETGSFNKNFQSPAKPLTDKPTPE--LTRTPSRVAGMFSGTQDKCATCSKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGC ++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_002315180.1| LIM domain-containing family protein [Populus trichocarpa]
 ref|XP_011036022.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011036023.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 gb|ABK96192.1| unknown [Populus trichocarpa]
 gb|EEF01351.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   249 bits (635),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY ++LLSADG  +HK+CFKC HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLNPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGC +T + YA+L+GVLYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSY  170


 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++GVL
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSATMKR  181



>gb|ACX47456.1| LIM1 [Hevea brasiliensis]
Length=189

 Score =   249 bits (635),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY ++LLSADG  +HKSCFKC HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGC L+ + YA+L+GVLYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLYCKHHFSQLFKEKGSY  170


 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH   +L  SNY++++GVL
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKHHFSQLFKEKGSYN  171



>ref|XP_010067487.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067488.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067489.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 gb|KCW65631.1| hypothetical protein EUGRSUZ_G03023 [Eucalyptus grandis]
Length=189

 Score =   249 bits (635),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+ LSADG  +HKSCFKCSHCKGTL +S+YSSM+GVLYCK H
Sbjct  2    SFTGTQVKCKACEKTVYPVEQLSADGVAYHKSCFKCSHCKGTLKLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     +     + + P+K + MFSGTQDKCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSADKLTPELARSPSKAAGMFSGTQDKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +++H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQSYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT DKC  C KT Y ++ ++ +  ++HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAAGMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASMKR  181



>emb|CDX95666.1| BnaC03g25470D [Brassica napus]
Length=228

 Score =   250 bits (638),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGTLDKCKACDKTVY +DLL+ +G+T+HK+CF+CSHC G+LV+SNYSSMDGVLYCK H
Sbjct  2    SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKNCFRCSHCNGSLVISNYSSMDGVLYCKRH  61

Query  320  FEQLFKESGNFSKNFQTT-KPERENS-MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVT  493
            FEQLFKES    K+  T  K ++ N  +T+ P+K+S+ FSGTQDKCATC KTVYPLEKVT
Sbjct  62   FEQLFKES---VKSLHTGGKTDKTNDQLTRAPSKLSSFFSGTQDKCATCQKTVYPLEKVT  118

Query  494  MEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            MEGE FH++CFKCAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y 
Sbjct  119  MEGECFHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN  167


 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +2

Query  89   GRGERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
            G+ ++  DQ     +K  + F+GT DKC  C KTVY ++ ++ +G  FHK+CFKC+H   
Sbjct  77   GKTDKTNDQLTRAPSKLSSFFSGTQDKCATCQKTVYPLEKVTMEGECFHKTCFKCAHSGC  136

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ  367
             L  S+Y+S++GVLYCK HF QLF E G+++   Q
Sbjct  137  PLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQ  171



>ref|XP_009369042.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
 ref|XP_009350652.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=219

 Score =   249 bits (637),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT  KCKACDKTV+F+D LSADG  +HK+CFKCSHC G L MS+YSSMDGVLYCK H
Sbjct  2    SFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+GNFSK FQT+  + +N +T+ P+K+S+MFSGT DKCA C KTVYPLEKVTME
Sbjct  62   FEQLFKETGNFSKKFQTSG-KSQNELTRTPSKLSSMFSGTVDKCAVCNKTVYPLEKVTME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            G+ +H+SCF+C HGGC L+ +  A+LDG+LYCKHHFAQLF EKG+Y
Sbjct  121  GDFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSY  166


 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            G+ Q +      K++S F+GT+DKC  C+KTVY ++ ++ +G  +HKSCF+C+H    L 
Sbjct  80   GKSQNELTRTPSKLSSMFSGTVDKCAVCNKTVYPLEKVTMEGDFYHKSCFRCNHGGCFLS  139

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFS  355
             SN +++DG+LYCK HF QLFKE G++S
Sbjct  140  PSNCAALDGILYCKHHFAQLFKEKGSYS  167



>emb|CDY60999.1| BnaA03g56620D [Brassica napus]
Length=200

 Score =   249 bits (636),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 146/172 (85%), Gaps = 8/172 (5%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KC+AC+KTVY ++LLSADG +FHKSCFKCSHCK TL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCRACEKTVYPMELLSADGVSFHKSCFKCSHCKTTLQLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQ------TTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPL  481
            FEQLFKE+G+F+KNFQ      T KP  E  +T+ P++V+ MFSGTQDKCATC+KTVYP+
Sbjct  62   FEQLFKETGSFNKNFQSPAKPLTDKPTPE--LTRTPSRVAGMFSGTQDKCATCSKTVYPI  119

Query  482  EKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EKVT+E + +H+SCFKC+HGGC ++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  120  EKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KTVY ++ ++ +   +HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  102  FSGTQDKCATCSKTVYPIEKVTVESQCYHKSCFKCSHGGCAISPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_009389159.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=200

 Score =   249 bits (635),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT DKCKACDKTV+F+DLL+ADG  FHK+CFKCS CKGTL M NYSS+DG+LYCK H
Sbjct  2    SFSGTQDKCKACDKTVHFIDLLTADGVPFHKTCFKCSRCKGTLSMCNYSSLDGILYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+F+K F    K    N + +  ++VS+MFSGTQDKCATC KT YPLEK+T+
Sbjct  62   FEQLFKETGSFTKKFPIGAKSGERNELARPASRVSSMFSGTQDKCATCHKTAYPLEKLTV  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CFKC+HGGC LT ++YA+L+G++YCKHHFAQLF EKG+Y
Sbjct  122  EGESYHKTCFKCSHGGCKLTPSSYAALEGIIYCKHHFAQLFKEKGSY  168


 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  95   GERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVM  274
            GER       ++  + F+GT DKC  C KT Y ++ L+ +G ++HK+CFKCSH    L  
Sbjct  83   GERNELARPASRVSSMFSGTQDKCATCHKTAYPLEKLTVEGESYHKTCFKCSHGGCKLTP  142

Query  275  SNYSSMDGVLYCKTHFEQLFKESGNFS  355
            S+Y++++G++YCK HF QLFKE G+++
Sbjct  143  SSYAALEGIIYCKHHFAQLFKEKGSYN  169



>ref|XP_010534537.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534538.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534539.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534540.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
Length=199

 Score =   249 bits (635),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 145/169 (86%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG ++HKSCFKC+HCK  L +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTHCKSRLQLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS--MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+G+F KNFQ+  KP  + +  +T+ P+KV+ MFSGTQDKC TC KTVYPLEKV
Sbjct  62   FEQLFKETGSFHKNFQSPAKPAEKPTPELTRTPSKVAGMFSGTQDKCTTCGKTVYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +++H+SCFKC+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = +2

Query  95   GERQTDQNIHT--KKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
             E+ T +   T  K    F+GT DKC  C KTVY ++ ++ +  ++HKSCFKCSH    +
Sbjct  83   AEKPTPELTRTPSKVAGMFSGTQDKCTTCGKTVYPLEKVTVESQSYHKSCFKCSHGGCPI  142

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
              SNY++++G+LYCK HF QLFKE G+++   ++   +R
Sbjct  143  SPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKR  181



>gb|ABK58469.1| LIM domain protein WLIM2a [Populus tremula x Populus alba]
Length=189

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY ++LLSADG  +HKSCFKC HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            F+QLFKE+GNF+KNFQ+     E     +T+ P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FDQLFKETGNFNKNFQSPAKTAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGC +T ++YA+L+GVLYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCAITPSSYAALEGVLYCKHHFSQLFKEKGSY  170


 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH    +  S+Y++++GVL
Sbjct  95   SKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSSYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASMKR  181



>ref|XP_006435557.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006435558.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006486459.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR48797.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|ESR48798.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|KDO69271.1| hypothetical protein CISIN_1g029695mg [Citrus sinensis]
Length=189

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCK C+KTVY V+ LSADG  +HKSCFKCSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKVCEKTVYPVEQLSADGVVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESGNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCA+C+KTVYPLEKV
Sbjct  62   FEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCASCSKTVYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
             +E +A+H++CFKC+HGGC ++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  AVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC +C KTVY ++ ++ +   +HK+CFKCSH   ++  SNY++++G+L
Sbjct  95   SKAASMFSGTQEKCASCSKTVYPLEKVAVENQAYHKTCFKCSHGGCSISPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASMKR  181



>ref|XP_009587504.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=189

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG ++HKSCFKC+HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQL+KESGNF+KNFQ+     E     +T+ P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLYKESGNFNKNFQSPAKSAEKLTPELTRSPSKAARMFSGTQEKCATCDKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +++H+SCFKC+HGGC L  + YA+LDG+LYCK HF+QLF EKG+Y
Sbjct  122  TVENQSYHKSCFKCSHGGCSLNPSNYAALDGILYCKPHFSQLFKEKGSY  170


 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  CDKT Y ++ ++ +  ++HKSCFKCSH   +L  SNY+++DG+L
Sbjct  95   SKAARMFSGTQEKCATCDKTAYPLEKVTVENQSYHKSCFKCSHGGCSLNPSNYAALDGIL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKPHFSQLFKEKGSYN  171



>ref|XP_009387955.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=186

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GTLDKCKAC+KTV+F+DLLSADG  +HKSCF+CSHC GTL M NYSSM+GVLYCK H
Sbjct  2    SFSGTLDKCKACEKTVHFIDLLSADGVIYHKSCFRCSHCNGTLSMCNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G F+K F T  K    N ++K P+K S+MFSGTQDKCA+C KT YPLE +TM
Sbjct  62   FEQLFKETGTFTKKFPTGIKAGERNELSKTPSKFSSMFSGTQDKCASCKKTAYPLETLTM  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            EGE++H++CFKC+ GGC LT ++ A+L+G+LYCKHHFA+LFMEKG+Y
Sbjct  122  EGESYHKTCFKCSVGGCTLTPSSCAALNGILYCKHHFARLFMEKGSY  168


 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +2

Query  86   VGRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            +  GER       +K  + F+GT DKC +C KT Y ++ L+ +G ++HK+CFKCS    T
Sbjct  80   IKAGERNELSKTPSKFSSMFSGTQDKCASCKKTAYPLETLTMEGESYHKTCFKCSVGGCT  139

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ  367
            L  S+ ++++G+LYCK HF +LF E G++S   Q
Sbjct  140  LTPSSCAALNGILYCKHHFARLFMEKGSYSHVIQ  173



>ref|XP_007009107.1| GATA type zinc finger transcription factor family protein isoform 
2, partial [Theobroma cacao]
 gb|EOY17917.1| GATA type zinc finger transcription factor family protein isoform 
2, partial [Theobroma cacao]
Length=191

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 140/164 (85%), Gaps = 3/164 (2%)
 Frame = +2

Query  155  LDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLF  334
            + KCKAC+KTVY V+LLSADG  +HKSCFKCSHCKGTL + NYSSM+GVLYCK HFEQLF
Sbjct  9    IKKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLF  68

Query  335  KESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTMEGE  505
            KE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKVT+EG+
Sbjct  69   KETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQ  128

Query  506  AFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            ++H+SCFKC+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  129  SYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  172


 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G ++HKSCFKCSH    +  SNY++++G+L
Sbjct  97   SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGIL  156

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  157  YCKHHFSQLFKEKGSYNHLIKSASIKR  183



>ref|XP_009133751.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
Length=254

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 152/181 (84%), Gaps = 8/181 (4%)
 Frame = +2

Query  104  QTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNY  283
            +T Q I  +KM SFTGTLDKCKACDKTVY +DLL+ +G+T+HK+CF+CSHC G+LV+SNY
Sbjct  21   ETTQKI--EKM-SFTGTLDKCKACDKTVYVMDLLTLEGNTYHKNCFRCSHCNGSLVISNY  77

Query  284  SSMDGVLYCKTHFEQLFKESGNFSKNFQTT-KPERENS-MTKGPTKVSAMFSGTQDKCAT  457
            SSMDGVLYCK HFEQLFKES    K+  T  K ++ N  +T+ P+K+S+ FSGT+DKCAT
Sbjct  78   SSMDGVLYCKRHFEQLFKES---VKSLHTGGKTDKTNDQLTRAPSKLSSFFSGTRDKCAT  134

Query  458  CTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            C KTVYPLEKVTMEGE FH++CFKCAH GCPLTH++YASL+GVLYCK HF QLF+EKG+Y
Sbjct  135  CQKTVYPLEKVTMEGECFHKTCFKCAHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSY  194

Query  638  Q  640
             
Sbjct  195  N  195


 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +2

Query  89   GRGERQTDQ--NIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKG  262
            G+ ++  DQ     +K  + F+GT DKC  C KTVY ++ ++ +G  FHK+CFKC+H   
Sbjct  105  GKTDKTNDQLTRAPSKLSSFFSGTRDKCATCQKTVYPLEKVTMEGECFHKTCFKCAHSGC  164

Query  263  TLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQ  367
             L  S+Y+S++GVLYCK HF QLF E G+++   Q
Sbjct  165  PLTHSSYASLNGVLYCKVHFNQLFLEKGSYNNVHQ  199



>gb|AFK39062.1| unknown [Lotus japonicus]
 gb|AFK48743.1| unknown [Lotus japonicus]
Length=189

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 144/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY VD LSADG+++HK+CF+CSHCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFLGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS--MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            +EQLFKE+G F KNFQ+  K   +N+  +T+ P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   YEQLFKETGTFKKNFQSPAKLADKNTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181


 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  428  FSGTQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHF  607
            F GTQ KC  C KTVYP+++++ +G ++H++CF+C+H    L  + Y+S++GVLYCK H+
Sbjct  3    FLGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPHY  62

Query  608  AQLFMEKGNYQ  640
             QLF E G ++
Sbjct  63   EQLFKETGTFK  73



>ref|XP_002530411.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF31981.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=189

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY ++LLSADG  +HKSCFKC HCKGTL +SNYSSM+GV+YCK H
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVVYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGC ++ + YA+L+GVLYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCSISPSNYAALEGVLYCKHHFSQLFKEKGSY  170


 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH   ++  SNY++++GVL
Sbjct  95   SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSISPSNYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASMKR  181



>ref|NP_001053405.1| Os04g0532500 [Oryza sativa Japonica Group]
 emb|CAE04568.1| OSJNBb0039L24.7 [Oryza sativa Japonica Group]
 emb|CAE54551.1| OSJNBa0081C01.26 [Oryza sativa Japonica Group]
 dbj|BAF15319.1| Os04g0532500 [Oryza sativa Japonica Group]
 emb|CAJ86411.1| OSIGBa0125M19.14 [Oryza sativa Indica Group]
 gb|EAY94955.1| hypothetical protein OsI_16763 [Oryza sativa Indica Group]
 gb|EAZ31441.1| hypothetical protein OsJ_15578 [Oryza sativa Japonica Group]
 dbj|BAG91667.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEJ08685.1| PLIM2 [Oryza sativa]
Length=201

 Score =   248 bits (632),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC ACDKTV+F+DLL+ADG  +HK+CFKCSHCKG L M +YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+FSK F       +  + + P+K+ + FSGTQDKCA C KTVYPLEK+T+E
Sbjct  62   FEQLFKETGSFSKKFAPGCRSTDKELARAPSKICSAFSGTQDKCAACQKTVYPLEKLTLE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            GE++H+SCFKC+HGGC LT ++YA+L+GVLYCK HF QLFMEKG+Y 
Sbjct  122  GESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYN  168


 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = +2

Query  95   GERQTDQNIH---TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G R TD+ +    +K  ++F+GT DKC AC KTVY ++ L+ +G ++HKSCFKCSH    
Sbjct  79   GCRSTDKELARAPSKICSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCI  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            L  S+Y++++GVLYCK HF QLF E G+++
Sbjct  139  LTTSSYAALNGVLYCKIHFGQLFMEKGSYN  168



>ref|XP_007009110.1| GATA type zinc finger transcription factor family protein isoform 
5, partial [Theobroma cacao]
 gb|EOY17920.1| GATA type zinc finger transcription factor family protein isoform 
5, partial [Theobroma cacao]
Length=182

 Score =   247 bits (630),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = +2

Query  158  DKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFK  337
             KCKAC+KTVY V+LLSADG  +HKSCFKCSHCKGTL + NYSSM+GVLYCK HFEQLFK
Sbjct  1    QKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPHFEQLFK  60

Query  338  ESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTMEGEA  508
            E+GNF+KNFQ+     E     +T+ P+K ++MFSGTQ+KCATC KT YPLEKVT+EG++
Sbjct  61   ETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKVTVEGQS  120

Query  509  FHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  121  YHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  163


 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT +KC  C KT Y ++ ++ +G ++HKSCFKCSH    +  SNY++++G+L
Sbjct  88   SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGIL  147

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  148  YCKHHFSQLFKEKGSYNHLIKSASIKR  174



>ref|XP_007040178.1| GATA type zinc finger transcription factor family protein, putative 
[Theobroma cacao]
 gb|EOY24679.1| GATA type zinc finger transcription factor family protein, putative 
[Theobroma cacao]
Length=219

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT +KCKACDKTV+F+DLLSADG ++HK+CFKCSHC G LVMS+Y SM+GVLYCK H
Sbjct  2    AFSGTTEKCKACDKTVHFIDLLSADGVSYHKTCFKCSHCNGLLVMSSYCSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+++K FQ+ K ++ N + + P+++++ FSGTQD+C  C KT YPLEKVT+E
Sbjct  62   FEQLFKETGSYTKKFQSGKSDKPNGLARAPSRLASFFSGTQDRCGVCNKTAYPLEKVTVE  121

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H+SCF+C HGGC L  ++YA+LDG+LYCKHHFAQLF EKG+Y
Sbjct  122  GENYHKSCFRCCHGGCFLNPSSYAALDGILYCKHHFAQLFKEKGSY  167


 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +2

Query  89   GRGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
            G+ ++         ++ASF +GT D+C  C+KT Y ++ ++ +G  +HKSCF+C H    
Sbjct  79   GKSDKPNGLARAPSRLASFFSGTQDRCGVCNKTAYPLEKVTVEGENYHKSCFRCCHGGCF  138

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            L  S+Y+++DG+LYCK HF QLFKE G++S
Sbjct  139  LNPSSYAALDGILYCKHHFAQLFKEKGSYS  168



>ref|XP_010928941.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=189

 Score =   247 bits (630),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT  KCKAC+KTVY +D LSADG  +HKSCFKC+HCKGTL +SNYSS++GVLYCK H
Sbjct  2    AFSGTQQKCKACNKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+G+F+K+FQ+     E     +T+ P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+A+H+SCFKC+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  C KT Y ++ ++ +G  +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAAGMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMT  400
            YCK HF QLFKE G+++   +    +R  + T
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKCASIKRTAAST  186



>gb|KHG07853.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   247 bits (630),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+LLSADG  +HKSCFKCSHCKGTL ++NYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLANYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+KNFQ++    E     +T+ P+K ++MFSGT +KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKNFQSSAKAAEKLTPELTRSPSKAASMFSGTVEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+++H+SCFKC+H GC L+ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQSYHKSCFKCSHSGCSLSPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT++KC  C KT Y ++ ++ +G ++HKSCFKCSH   +L  SNY++++G+L
Sbjct  95   SKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHSGCSLSPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>ref|XP_006848064.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
 gb|ERN09645.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
Length=189

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT  KCKAC+KTVY +D LSADG  +HKSCFKC+HCKGTL + NYSSM+GVLYCK H
Sbjct  2    AFSGTQQKCKACEKTVYVMDQLSADGVLYHKSCFKCNHCKGTLKLGNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+G+F+K+FQ+     E     +T+ P+K ++MFSGTQDKCATC KT YPLEKV
Sbjct  62   FEQLFKETGSFNKSFQSPAKSVEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +++H+SCFKC+HGGCP+T +TYA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVESQSYHKSCFKCSHGGCPITPSTYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC  C KT Y ++ ++ +  ++HKSCFKCSH    +  S Y++++G+L
Sbjct  95   SKAASMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCPITPSTYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKHHFSQLFKEKGSYN  171



>ref|XP_002876333.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52592.1| LIM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=199

 Score =   247 bits (631),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 147/169 (87%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG  +HKSCFKC+HCK  L +S+YSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS--MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESG+F+KNFQ+  KP  +++  +T+ P++V++ FSGTQ+KCATC+KTVYP+EKV
Sbjct  62   FEQLFKESGSFNKNFQSPAKPADKSTPELTRTPSRVASRFSGTQEKCATCSKTVYPIEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  122  TVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  170


 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            ++  + F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SRVASRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFAQLFKEKGSYNHLIKSASIKR  181



>emb|CBL95262.1| lim domain protein [Pinus pinaster]
Length=197

 Score =   246 bits (629),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 142/171 (83%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +FTGT  KCKACDKTVYFVD LSADG ++HK+CF+C+HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    AFTGTQQKCKACDKTVYFVDQLSADGVSYHKACFRCNHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPER-----ENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
            F+QLF+ESGNF+KNFQ+ +  +     +  MT+ P+KVS MF GTQDKC TC KT YPLE
Sbjct  62   FDQLFRESGNFNKNFQSQRSSKAIDGLQPEMTRSPSKVSMMFFGTQDKCGTCGKTAYPLE  121

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            KVT+   +FH+SCF+C+HGGC ++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  KVTVGNLSFHKSCFRCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSY  172


 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F GT DKC  C KT Y ++ ++    +FHKSCF+CSH   ++  SNY++++G+LYCK HF
Sbjct  103  FFGTQDKCGTCGKTAYPLEKVTVGNLSFHKSCFRCSHGGCSISPSNYAALEGILYCKHHF  162

Query  323  EQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAM  427
             QLFKE G+++   +T   +R  ++ +  + V  +
Sbjct  163  SQLFKEKGSYNHLIKTASMKRAAAVPEVASAVPEI  197



>ref|XP_004976341.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Setaria 
italica]
Length=204

 Score =   247 bits (630),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT DKC ACDKTV+F+DLL+ADG  +HK+CFKCSHCKG L M +YSSMDGVLYCKTH
Sbjct  2    SFTGTQDKCTACDKTVHFIDLLTADGVPYHKTCFKCSHCKGILSMCSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTM  496
            FEQLFKE+G+FSK F    K   +  + + P+K+S+ FSGTQDKCA C KTVYPLEK+T+
Sbjct  62   FEQLFKETGSFSKKFTPGGKSADKGELARAPSKLSSAFSGTQDKCAACQKTVYPLEKLTL  121

Query  497  EGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNYQ  640
            EGE++H+SCFKC+HGGC LT ++YA+L+GVLYCK HF QLFMEKG+Y 
Sbjct  122  EGESYHKSCFKCSHGGCILTTSSYAALNGVLYCKIHFGQLFMEKGSYN  169


 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  ++F+GT DKC AC KTVY ++ L+ +G ++HKSCFKCSH    L  S+Y++++GVL
Sbjct  93   SKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILTTSSYAALNGVL  152

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSM  397
            YCK HF QLF E G++  N    K   +++M
Sbjct  153  YCKIHFGQLFMEKGSY--NHMKKKSTSQDTM  181



>ref|XP_011029226.1| PREDICTED: LIM domain-containing protein WLIM2b-like isoform 
X1 [Populus euphratica]
 ref|XP_011029227.1| PREDICTED: LIM domain-containing protein WLIM2b-like isoform 
X1 [Populus euphratica]
 ref|XP_011029228.1| PREDICTED: LIM domain-containing protein WLIM2b-like isoform 
X1 [Populus euphratica]
Length=216

 Score =   247 bits (631),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            FTGTL+KCKACDKTVYF++L+SADG  +HK CFKCSHC G L MS+YSS+DGVLYC+ H+
Sbjct  3    FTGTLEKCKACDKTVYFIELVSADGVPYHKKCFKCSHCNGLLGMSSYSSIDGVLYCRPHY  62

Query  323  EQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTMEG  502
            +QLFKE+G F+K FQT + E++N + K P+K+S+MFSGTQDKCA C KT YPLEKVT+EG
Sbjct  63   DQLFKETGTFTKKFQTYE-EKKNCLKKAPSKLSSMFSGTQDKCAFCKKTAYPLEKVTVEG  121

Query  503  EAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            E +H+SCF+C+HGGC +T ++YA+LDG+LYCK HFAQLF +KG+Y
Sbjct  122  EFYHKSCFRCSHGGCYITPSSYAALDGILYCKAHFAQLFKQKGSY  166


 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC  C KT Y ++ ++ +G  +HKSCF+CSH    +  S+Y+++DG+L
Sbjct  91   SKLSSMFSGTQDKCAFCKKTAYPLEKVTVEGEFYHKSCFRCSHGGCYITPSSYAALDGIL  150

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFK+ G++S
Sbjct  151  YCKAHFAQLFKQKGSYS  167



>ref|NP_191136.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030868.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030869.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_001030870.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 ref|NP_680133.2| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 sp|Q9M047.1|WLI2B_ARATH RecName: Full=LIM domain-containing protein WLIM2b; AltName: 
Full=Widely-expressed LIM protein 2B [Arabidopsis thaliana]
 emb|CAB81602.1| transcription factor L2 [Arabidopsis thaliana]
 gb|AAL36280.1| putative transcription factor L2 [Arabidopsis thaliana]
 gb|AAM14188.1| putative transcription factor L2 [Arabidopsis thaliana]
 gb|AAM60942.1| transcription factor L2 [Arabidopsis thaliana]
 dbj|BAH19816.1| AT3G55770 [Arabidopsis thaliana]
 dbj|BAH20021.1| AT3G55770 [Arabidopsis thaliana]
 gb|AEE79434.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79435.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79436.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79437.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
 gb|AEE79438.1| actin bundler LIM family protein WLIM2b [Arabidopsis thaliana]
Length=199

 Score =   246 bits (629),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG  +HKSCFKC+HCK  L +S+YSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESG+F+KNFQ+     + S   +T+ P++V+  FSGTQ+KCATC+KTVYP+EKV
Sbjct  62   FEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  122  TVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  170


 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  161  AQLFKEKGSYNHLIKSASIKR  181



>ref|XP_004503222.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503223.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cicer 
arietinum]
Length=189

 Score =   246 bits (628),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 143/173 (83%), Gaps = 11/173 (6%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY VD LSADG+++HK+CF+CSHCKGTL +S+YSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-------TKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYP  478
            +EQLFKE+G F KNF +       T PE    +T+ P+K ++MFSGTQDKCATC KT YP
Sbjct  62   YEQLFKETGTFKKNFTSPAKLADKTTPE----LTRSPSKAASMFSGTQDKCATCGKTAYP  117

Query  479  LEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            LEKVT+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  118  LEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181


 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  428  FSGTQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHF  607
            F GTQ KC  C KTVYP+++++ +G ++H++CF+C+H    L  ++Y+S++GVLYCK H+
Sbjct  3    FIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKPHY  62

Query  608  AQLFMEKGNYQ  640
             QLF E G ++
Sbjct  63   EQLFKETGTFK  73



>ref|XP_002304483.2| hypothetical protein POPTR_0003s12440g [Populus trichocarpa]
 gb|EEE79462.2| hypothetical protein POPTR_0003s12440g [Populus trichocarpa]
Length=210

 Score =   246 bits (629),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            FTGTL+KCKACDKTVYF++L+SADG  +HK CFKCSHC G LVMS+YSS+DGVLYC+ H+
Sbjct  3    FTGTLEKCKACDKTVYFIELVSADGVPYHKKCFKCSHCNGLLVMSSYSSIDGVLYCRPHY  62

Query  323  EQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTMEG  502
            +QLFKE+GNF+K  Q+ +       TK P+K+S+MFSGTQDKCA+C KTVYPLEKVT+EG
Sbjct  63   DQLFKETGNFTKKLQSCEIPL---FTKAPSKLSSMFSGTQDKCASCKKTVYPLEKVTVEG  119

Query  503  EAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            E FH+SCF+C+HGGC +T ++YA+LDG+LYCK HF+QLF +KG+Y
Sbjct  120  EFFHKSCFRCSHGGCFITPSSYAALDGILYCKAHFSQLFKQKGSY  164


 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC +C KTVY ++ ++ +G  FHKSCF+CSH    +  S+Y+++DG+L
Sbjct  89   SKLSSMFSGTQDKCASCKKTVYPLEKVTVEGEFFHKSCFRCSHGGCFITPSSYAALDGIL  148

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFK+ G++S
Sbjct  149  YCKAHFSQLFKQKGSYS  165



>ref|XP_004239928.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Solanum 
lycopersicum]
 ref|XP_006355670.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=189

 Score =   245 bits (626),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG ++HKSCFKC+HCKGTL +S+YSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPVELLSADGISYHKSCFKCTHCKGTLKLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQL+KESGNF+KNFQ+     E     +TK P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLYKESGNFNKNFQSPVKSAEKLTPMLTKSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +++H+SCFKC+HGGC L  + YA+LDG+LYCK HF+QLF EKG+Y
Sbjct  122  TVENQSYHKSCFKCSHGGCSLNPSNYAALDGILYCKPHFSQLFKEKGSY  170


 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  C KT Y ++ ++ +  ++HKSCFKCSH   +L  SNY+++DG+L
Sbjct  95   SKAAGMFSGTQEKCATCGKTAYPLEKVTVENQSYHKSCFKCSHGGCSLNPSNYAALDGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKPHFSQLFKEKGSYNHLIKSASMKR  181



>ref|XP_002312139.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|ABK94456.1| unknown [Populus trichocarpa]
 gb|EEE89506.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY ++LLS DG  +HKSCFKC HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            F+QLFKE+GNF+KNFQ+     E     +T+ P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGC +T + YA+L+GVLYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSY  170


 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++GVL
Sbjct  95   SKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKHHFSQLFKEKGSYN  171



>dbj|BAH20111.1| AT3G55770 [Arabidopsis thaliana]
Length=199

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC KTVY V+LLSADG  +HKSCFKC+HCK  L +S+YSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACGKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESG+F+KNFQ+     + S   +T+ P++V+  FSGTQ+KCATC+KTVYP+EKV
Sbjct  62   FEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  122  TVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSY  170


 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    +  SNY++++G+LYCK HF
Sbjct  101  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  161  AQLFKEKGSYNHLIKSASIKR  181



>ref|XP_003600847.1| LIM domain-containing protein [Medicago truncatula]
 gb|ACJ85930.1| unknown [Medicago truncatula]
 gb|ACJ86074.1| unknown [Medicago truncatula]
 gb|AES71098.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
 gb|AFK39027.1| unknown [Medicago truncatula]
 gb|AFK39398.1| unknown [Medicago truncatula]
Length=191

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY VD LSADG+++HK+CF+CSHCKGTL +S+YSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-----MTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
            FEQLFKE GNFSKN     P +        +T+ P+K + MFSGTQ+KCATC KT YPLE
Sbjct  62   FEQLFKEHGNFSKNKNFQSPAKVADGTTPVLTRTPSKAAGMFSGTQEKCATCGKTAYPLE  121

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            KVT+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  KVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  172


 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 0/116 (0%)
 Frame = +2

Query  38   RHTNNSKRVTLLRFNHVGRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADG  217
             H N SK         V  G         +K    F+GT +KC  C KT Y ++ ++ + 
Sbjct  68   EHGNFSKNKNFQSPAKVADGTTPVLTRTPSKAAGMFSGTQEKCATCGKTAYPLEKVTVES  127

Query  218  STFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPER  385
              +HKSCFKCSH    +  SNY++++G+LYCK HF QLFKE G+++   ++   +R
Sbjct  128  QAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKR  183



>ref|XP_009602682.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 ref|XP_009602683.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 ref|XP_009786370.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|AAD56951.1|AF184886_1 LIM domain protein WLIM2 [Nicotiana tabacum]
 emb|CAA71891.1| LIM-domain SF3 protein [Nicotiana tabacum]
Length=189

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+LLSADG  +HKSCFKCSHCKGTL +SN+SSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVELLSADGVNYHKSCFKCSHCKGTLKLSNFSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESGNF+KNFQ+     E     +T+ P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +++H++CFKC+HGGC L+ + YA+L+G+LYCK HF+QLF EKG+Y
Sbjct  122  TVENQSYHKTCFKCSHGGCSLSPSNYAALNGILYCKPHFSQLFKEKGSY  170


 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  C KT Y ++ ++ +  ++HK+CFKCSH   +L  SNY++++G+L
Sbjct  95   SKAAGMFSGTQEKCATCGKTAYPLEKVTVENQSYHKTCFKCSHGGCSLSPSNYAALNGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKPHFSQLFKEKGSYNHLIKSASMKR  181



>ref|XP_011040324.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011040398.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
Length=189

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY ++LLSADG  +HK+CFKC HCKGTL + NYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLGNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            F+QLFKE+GNF+KNFQ+     E     +T+ P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+E +A+H+SCFKC+HGGC +T + YA+L+GVLYCKHHF+QLF EKG+Y
Sbjct  122  TVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSY  170


 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  C KT Y ++ ++ +   +HKSCFKCSH    +  SNY++++GVL
Sbjct  95   SKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASMKR  181



>ref|XP_008798954.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT  KCKAC+KTVY +D LSADG ++HKSCFKC+HCKGTL +SNYSS++GVLYCK H
Sbjct  2    AFSGTQQKCKACNKTVYLMDQLSADGVSYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+G+F+K+FQ+     E     +T+ P+K + MFSGTQ+KC  C KT YPLEKV
Sbjct  62   FEQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCVACGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+A+H+SCFKC+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC AC KT Y ++ ++ +G  +HKSCFKCSH    +  SNY++++G+L
Sbjct  95   SKAAGMFSGTQEKCVACGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKHHFSQLFKEKGSYN  171



>gb|KDP25467.1| hypothetical protein JCGZ_20623 [Jatropha curcas]
Length=212

 Score =   245 bits (625),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GTL+KCKACDKTV+F+++++ADG  +HK+CFKCSHC G LVM +YSSM+GVLYCK HF
Sbjct  3    FSGTLEKCKACDKTVHFIEMVTADGINYHKTCFKCSHCNGLLVMGSYSSMEGVLYCKPHF  62

Query  323  EQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTMEG  502
            EQLF+E+G+++K F ++  E++N++T+ P+K S+MFSGTQDKCA C KT YPLEKV++EG
Sbjct  63   EQLFRETGSYAKKFPSSG-EKKNALTRTPSKFSSMFSGTQDKCARCNKTAYPLEKVSVEG  121

Query  503  EAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            E++H+SCF+C+HGGC ++ ++YA+LDGVLYCK HFAQLF EKG+Y
Sbjct  122  ESYHKSCFRCSHGGCYISPSSYAALDGVLYCKPHFAQLFKEKGSY  166


 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            GE++        K +S F+GT DKC  C+KT Y ++ +S +G ++HKSCF+CSH    + 
Sbjct  80   GEKKNALTRTPSKFSSMFSGTQDKCARCNKTAYPLEKVSVEGESYHKSCFRCSHGGCYIS  139

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFS  355
             S+Y+++DGVLYCK HF QLFKE G+++
Sbjct  140  PSSYAALDGVLYCKPHFAQLFKEKGSYN  167



>ref|XP_003574155.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Brachypodium 
distachyon]
Length=204

 Score =   244 bits (623),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT DKCKACDKTV+F+DLL+AD   +HKSCFKCSHCKGTL M NYSSMDGVLYCKTH
Sbjct  2    TFSGTQDKCKACDKTVHFIDLLTADSIPYHKSCFKCSHCKGTLSMCNYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G F+KNF  T  +     +K P K+S++F GTQDKCA C KT YPLEK+T+E
Sbjct  62   FEQLFKETGTFNKNF-PTGAKANGYQSKVPNKLSSVFCGTQDKCAACKKTAYPLEKMTLE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CFKCAHGGC LT ATYASL+G+LYC+HHF QLF E G+Y
Sbjct  121  GEPYHKTCFKCAHGGCLLTTATYASLNGILYCQHHFWQLFKETGSY  166


 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +2

Query  119  IHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDG  298
            +  K  + F GT DKC AC KT Y ++ ++ +G  +HK+CFKC+H    L  + Y+S++G
Sbjct  89   VPNKLSSVFCGTQDKCAACKKTAYPLEKMTLEGEPYHKTCFKCAHGGCLLTTATYASLNG  148

Query  299  VLYCKTHFEQLFKESGNF  352
            +LYC+ HF QLFKE+G++
Sbjct  149  ILYCQHHFWQLFKETGSY  166



>gb|AFK34184.1| unknown [Medicago truncatula]
Length=191

 Score =   243 bits (621),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY VD LSADG+++HK+CF+CSHCKGTL +S+YSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS-----MTKGPTKVSAMFSGTQDKCATCTKTVYPLE  484
            FEQLFKE GNFSKN     P +        +T+ P+K + MFSGTQ+KCATC KT YPLE
Sbjct  62   FEQLFKEHGNFSKNKNFQSPAKVADGTTPVLTRTPSKAAGMFSGTQEKCATCGKTAYPLE  121

Query  485  KVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            KVT+E +A+H+SCFKC+HGGCP+T + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  KVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSY  172


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 59/106 (56%), Gaps = 0/106 (0%)
 Frame = +2

Query  38   RHTNNSKRVTLLRFNHVGRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADG  217
             H N SK         V  G         +K    F+GT +KC  C KT Y ++ ++ + 
Sbjct  68   EHGNFSKNKNFQSPAKVADGTTPVLTRTPSKAAGMFSGTQEKCATCGKTAYPLEKVTVES  127

Query  218  STFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
              +HKSCFKCSH    +  SNY++++G+LYCK HF QLFKE G+++
Sbjct  128  QAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYN  173



>ref|XP_010923152.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Elaeis 
guineensis]
Length=189

 Score =   243 bits (621),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT  KCKACDKTVY +D LSADG  +HKSCFKC+HCKGTL +SNYSS++GVLYCK H
Sbjct  2    AFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+G+F+K+FQ+     E S   +T+  +K + MFSGT +KCATC KT YPLEKV
Sbjct  62   FEQLFKETGSFNKSFQSPAKSAEKSNPELTRSRSKAAGMFSGTLEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+A+H+SCF+C+HGGCP++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQAYHKSCFRCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GTL+KC  C KT Y ++ ++ +G  +HKSCF+CSH    +  SNY++++G+L
Sbjct  95   SKAAGMFSGTLEKCATCGKTAYPLEKVTVEGQAYHKSCFRCSHGGCPISPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMT  400
            YCK HF QLFKE G+++   ++   +R  + T
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKRTAAST  186



>ref|XP_008392559.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=222

 Score =   244 bits (624),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT  KCKACDKTV+F+D LSADG  +HK+CFKCSHC G L MS+YSSMD VLYCK H
Sbjct  2    SFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDEVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+FSK FQT+  + +  +T+ P+K+S+MFSGT DKCA CTKTVYPLEKVTME
Sbjct  62   FEQLFKETGSFSKKFQTSG-KSQTELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            G  +H+SCF+C HGGC L+ +  A+LDG+LYCKHHFAQLF EKG+Y
Sbjct  121  GAFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSY  166


 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            G+ QT+      K++S F+GT+DKC  C KTVY ++ ++ +G+ +HKSCF+C+H    L 
Sbjct  80   GKSQTELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGAFYHKSCFRCNHGGCFLS  139

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFS  355
             SN +++DG+LYCK HF QLFKE G+++
Sbjct  140  PSNCAALDGILYCKHHFAQLFKEKGSYN  167



>ref|XP_002283482.1| PREDICTED: LIM domain-containing protein WLIM2a [Vitis vinifera]
 emb|CBI34710.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 140/166 (84%), Gaps = 3/166 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT  KCKACDKTV+ +D +SADG  +HK+CF+CSHC G LVMSNYSSMDGVLYCK H
Sbjct  2    SFSGTTQKCKACDKTVHIIDTISADGIAYHKTCFRCSHCNGPLVMSNYSSMDGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLF+ESG+ SK FQ++    +  +++ P+K+S+MFSGTQDKC+ C KTVYPLEKVT+E
Sbjct  62   FEQLFRESGSLSKKFQSSG---KADLSRTPSKLSSMFSGTQDKCSLCKKTVYPLEKVTVE  118

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H+SCF+C+HGGC LT ++YA+LDG+LYCK HF QLF E+G+Y
Sbjct  119  GEFYHKSCFRCSHGGCFLTPSSYAALDGILYCKPHFTQLFRERGSY  164


 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT DKC  C KTVY ++ ++ +G  +HKSCF+CSH    L  S+Y+++DG+L
Sbjct  89   SKLSSMFSGTQDKCSLCKKTVYPLEKVTVEGEFYHKSCFRCSHGGCFLTPSSYAALDGIL  148

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSA  424
            YCK HF QLF+E G++S   +T   ++  +    P + S 
Sbjct  149  YCKPHFTQLFRERGSYSTLNKTASMKKSTAAAPLPDQNSG  188



>ref|XP_010427370.1| PREDICTED: LIM domain-containing protein WLIM2b [Camelina sativa]
Length=200

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG  +HKSCFKC+HCK  L +S+YSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEK  487
            FEQLFKESG+F+KNFQ+  KP  +++   +T+ P++V+  FSGTQ+KCATC+KTVYP+EK
Sbjct  62   FEQLFKESGSFNKNFQSPAKPADKSATPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEK  121

Query  488  VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            VT+E + +H+SCFKC+HGGC L+ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  122  VTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    L  SNY++++G+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_010516165.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
Length=197

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG  +HKSCFKC+HCK  L +S+YSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEK  487
            FEQLFKESG+F+KNFQ+  KP  +++   +T+ P++V+  FSGTQ+KCATC+KTVYP+EK
Sbjct  62   FEQLFKESGSFNKNFQSPAKPADKSTTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEK  121

Query  488  VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            VT+E + +H+SCFKC+HGGC L+ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  122  VTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    L  SNY++++G+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>ref|XP_010504446.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
 ref|XP_010504447.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Camelina 
sativa]
Length=200

 Score =   243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG  +HKSCFKC+HCK  L +S+YSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEK  487
            FEQLFKESG+F+KNFQ+  KP  +++   +T+ P++V+  FSGTQ+KCATC+KTVYP+EK
Sbjct  62   FEQLFKESGSFNKNFQSPAKPTDKSATPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEK  121

Query  488  VTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            VT+E + +H+SCFKC+HGGC L+ + YA+L+G+LYCKHHFAQLF EKG+Y
Sbjct  122  VTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHFAQLFKEKGSY  171


 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KC  C KTVY ++ ++ +  T+HKSCFKCSH    L  SNY++++G+LYCK HF
Sbjct  102  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  161

Query  323  EQLFKESGNFSKNFQTTKPER  385
             QLFKE G+++   ++   +R
Sbjct  162  AQLFKEKGSYNHLIKSASIKR  182



>gb|ABK94608.1| unknown [Populus trichocarpa]
Length=189

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 138/169 (82%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY ++LLS DG  +HKSCFKC HCKGTL +SNYSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
             +QLFKE+GNF+KNFQ+     E     +T+ P+K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   LDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T E +A+H+SCFKC+HGGC +T + YA+L+GVLYCKHHF+QLF EKG+Y
Sbjct  122  TAESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSY  170


 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K    F+GT +KC  C KT Y ++ ++A+   +HKSCFKCSH    +  SNY++++GVL
Sbjct  95   SKAAGMFSGTQEKCATCGKTAYPLEKVTAESQAYHKSCFKCSHGGCAITPSNYAALEGVL  154

Query  305  YCKTHFEQLFKESGNFS  355
            YCK HF QLFKE G+++
Sbjct  155  YCKHHFSQLFKEKGSYN  171



>ref|XP_011072367.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Sesamum 
indicum]
Length=206

 Score =   242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = +2

Query  134  MASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCK  313
            MA F GT  KCKACDKTV+FV+++SADG  +HKSCFKCSHC G L MSNYS+MDG LYCK
Sbjct  1    MAQF-GTTQKCKACDKTVHFVEMMSADGVPYHKSCFKCSHCNGRLAMSNYSAMDGQLYCK  59

Query  314  THFEQLFKESGNF-SKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
             HFEQLFKES  F SK FQ   P ++    K  +KVS+ FSGTQDKCA C KTVYPLEKV
Sbjct  60   PHFEQLFKESAGFTSKKFQ---PPKQGETNKNASKVSSFFSGTQDKCAVCAKTVYPLEKV  116

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            TMEGE +H+SCFKCAHGGC LT ++YA+LDG+LYCK HFAQLF EKG+Y
Sbjct  117  TMEGEFYHKSCFKCAHGGCLLTTSSYAALDGILYCKPHFAQLFKEKGSY  165


 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = +2

Query  92   RGERQTDQNIHTKKMASF-TGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
            +  +Q + N +  K++SF +GT DKC  C KTVY ++ ++ +G  +HKSCFKC+H    L
Sbjct  78   QPPKQGETNKNASKVSSFFSGTQDKCAVCAKTVYPLEKVTMEGEFYHKSCFKCAHGGCLL  137

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENS  394
              S+Y+++DG+LYCK HF QLFKE G+++ +  TT   R+NS
Sbjct  138  TTSSYAALDGILYCKPHFAQLFKEKGSYN-HLTTTANSRKNS  178



>gb|AAL38006.1|AF443117_1 LIM domain protein [Gossypium hirsutum]
 gb|AII80543.1| LIM-domian protein 9 [Gossypium hirsutum]
Length=189

 Score =   241 bits (615),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF GT  KCKAC+KTVY V+LLSADG  +HKSC KCSHCKGTL ++NYSSM+GVLYCK H
Sbjct  2    SFIGTQQKCKACEKTVYPVELLSADGVPYHKSCSKCSHCKGTLKLANYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPEREN---SMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+GNF+K+FQ +    E     MT+ P+K ++MFSGT +KCATC KT YPLEKV
Sbjct  62   FEQLFKETGNFNKDFQLSAKAAEKLTPEMTRSPSKAASMFSGTVEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+++ +SCFKC+HGGC L+ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQSYLKSCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +2

Query  125  TKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVL  304
            +K  + F+GT++KC  C KT Y ++ ++ +G ++ KSCFKCSH   +L  SNY++++G+L
Sbjct  95   SKAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYLKSCFKCSHGGCSLSPSNYAALEGIL  154

Query  305  YCKTHFEQLFKESGNFSKNFQTTKPER  385
            YCK HF QLFKE G+++   ++   +R
Sbjct  155  YCKHHFSQLFKEKGSYNHLIKSASIKR  181



>ref|XP_004982687.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=208

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT DKCKACDKTV+F+DLL+AD   +HKSCF+CSHCKGTL M +YSSMDGVLYCKTH
Sbjct  2    TFSGTQDKCKACDKTVHFIDLLTADSIPYHKSCFRCSHCKGTLSMCSYSSMDGVLYCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFK +G FSKNF  T P+  N  +K P K+S++F GTQDKCA C KTVYPLEK+T+E
Sbjct  62   FEQLFKATGTFSKNF-PTGPKANNEQSKVPNKLSSLFCGTQDKCAACNKTVYPLEKITLE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CFKCA GGC LT ATYAS +G+LYC+ HF Q+F E G+Y
Sbjct  121  GEPYHKTCFKCARGGCLLTTATYASHNGILYCQIHFWQVFKETGSY  166


 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +2

Query  86   VGRGERQTDQNIHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGT  265
             G         +  K  + F GT DKC AC+KTVY ++ ++ +G  +HK+CFKC+     
Sbjct  78   TGPKANNEQSKVPNKLSSLFCGTQDKCAACNKTVYPLEKITLEGEPYHKTCFKCARGGCL  137

Query  266  LVMSNYSSMDGVLYCKTHFEQLFKESGNFS  355
            L  + Y+S +G+LYC+ HF Q+FKE+G++S
Sbjct  138  LTTATYASHNGILYCQIHFWQVFKETGSYS  167



>ref|XP_009375790.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=222

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT  KCKACDKTV+F+D LSADG  +HK+CFKCSHC G L MS+YSSMD VLYCK H
Sbjct  2    SFSGTQQKCKACDKTVHFIDQLSADGIAYHKTCFKCSHCNGQLSMSSYSSMDEVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+FSK FQ +  + +  +T+ P+K+S+MFSGT DKCA CTKTVYPLEKVTME
Sbjct  62   FEQLFKETGSFSKKFQISG-KLQTELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            G  +H+SCF+C HGGC L+ +  A+LDG+LYCKHHFAQLF EKG+Y
Sbjct  121  GAFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSY  166


 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            G+ QT+      K++S F+GT+DKC  C KTVY ++ ++ +G+ +HKSCF+C+H    L 
Sbjct  80   GKLQTELTRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGAFYHKSCFRCNHGGCFLS  139

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGP  409
             SN +++DG+LYCK HF QLFKE G+++   QT   ++  +    P
Sbjct  140  PSNCAALDGILYCKHHFAQLFKEKGSYNYLTQTASLKKNGAPMPEP  185



>ref|XP_007210077.1| hypothetical protein PRUPE_ppa019584mg [Prunus persica]
 gb|EMJ11276.1| hypothetical protein PRUPE_ppa019584mg [Prunus persica]
Length=221

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT  KCKACDKTV+F+D LSADG T+H+ CFKCSHC G L MS+YSSM+GVLYCK H
Sbjct  2    SFSGTQQKCKACDKTVHFIDQLSADGVTYHRPCFKCSHCNGQLSMSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLF+ESG+FSK     K + E  + + P+K+S+MFSGT DKCA CTKTVYPLEKVTME
Sbjct  62   FEQLFRESGSFSKKLTCGKSQTE--LGRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  119

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H+SCF+C HGGC L+ +  A+LDG+LYCKHHFAQLF EKG+Y
Sbjct  120  GEFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSY  165


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            G+ QT+      K++S F+GT+DKC  C KTVY ++ ++ +G  +HKSCF+C+H    L 
Sbjct  79   GKSQTELGRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGEFYHKSCFRCNHGGCFLS  138

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFS  355
             SN +++DG+LYCK HF QLFKE G+++
Sbjct  139  PSNCAALDGILYCKHHFAQLFKEKGSYN  166



>ref|XP_006477522.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
Length=208

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 139/166 (84%), Gaps = 3/166 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F GT +KCKACDKTV+ +D+++ADG ++HK CFKCSHC G LVM N+SSM+GVLYCK H
Sbjct  2    AFCGTQEKCKACDKTVHIIDMVTADGISYHKICFKCSHCNGKLVMGNFSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+F+      KP ++N +T+ P+K S MFSGTQDKC +C KTVYPLEKVT+E
Sbjct  62   FEQLFKETGSFTNKL---KPAQKNGLTRTPSKFSTMFSGTQDKCTSCKKTVYPLEKVTVE  118

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE+FH++CF+C+HGGC LT ++YA+LDG+LYCK HF+QLF EKG Y
Sbjct  119  GESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHFSQLFKEKGCY  164



>ref|XP_008238877.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
Length=222

 Score =   240 bits (612),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SF+GT  KCKACDKTV+F+D LSADG T+H+ CFKCSHC G L MS+YSSM+G+LYCK H
Sbjct  2    SFSGTQQKCKACDKTVHFIDQLSADGITYHRPCFKCSHCNGQLSMSSYSSMEGILYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLF+ESG+FSK     K + E  + + P+K+S+MFSGT DKCA CTKTVYPLEKVTME
Sbjct  62   FEQLFRESGSFSKKLTCGKSQTE--LGRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTME  119

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H+SCF+C HGGC L+ +  A+LDG+LYCKHHFAQLF EKG+Y
Sbjct  120  GEFYHKSCFRCNHGGCFLSPSNCAALDGILYCKHHFAQLFKEKGSY  165


 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS-FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLV  271
            G+ QT+      K++S F+GT+DKC  C KTVY ++ ++ +G  +HKSCF+C+H    L 
Sbjct  79   GKSQTELGRTPSKLSSMFSGTVDKCAVCTKTVYPLEKVTMEGEFYHKSCFRCNHGGCFLS  138

Query  272  MSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKC  451
             SN +++DG+LYCK HF QLFKE G+++ +   T   ++N      TK     SG   + 
Sbjct  139  PSNCAALDGILYCKHHFAQLFKEKGSYN-HLTKTASVKKNGAPMPETKPEEADSGKPQEV  197

Query  452  A  454
            A
Sbjct  198  A  198



>ref|XP_008785448.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   238 bits (608),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F+GT  KCKACDKTVY +D LSADG  +HKSCFKC+HCKGTL +SNYSS++GVLYCK H
Sbjct  2    AFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQT-TKPERENS--MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKE+G+F+K+FQ+  KP  + +  +T+  +K + MFSGTQ+KCATC KT YPLEKV
Sbjct  62   FEQLFKETGSFNKSFQSPAKPAEKPTPELTRSRSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            T+EG+A+H+ CF+C+HGGC ++ + YA+L+G+LYCKHHF+QLF EKG+Y
Sbjct  122  TVEGQAYHKFCFRCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSY  170


 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 66/104 (63%), Gaps = 2/104 (2%)
 Frame = +2

Query  95   GERQTDQNIHTKKMAS--FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTL  268
             E+ T +   ++  A+  F+GT +KC  C KT Y ++ ++ +G  +HK CF+CSH   ++
Sbjct  83   AEKPTPELTRSRSKAAGMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKFCFRCSHGGCSI  142

Query  269  VMSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQTTKPERENSMT  400
              SNY++++G+LYCK HF QLFKE G+++   ++   +R  + T
Sbjct  143  SPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIKRTAAST  186



>ref|XP_002509768.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF51155.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=215

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT +KCKACDKTV+F+++++ADG ++HK+CFKCSHC G LVMS+YSSM+GVLYCK HF
Sbjct  3    FSGTTEKCKACDKTVHFIEMITADGISYHKTCFKCSHCDGRLVMSSYSSMEGVLYCKPHF  62

Query  323  EQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTMEG  502
            EQLF+E+G+F K F ++  E++N + K P+K+S++FSGTQDKCA C KT YPLEK+++EG
Sbjct  63   EQLFRETGSFGKKFPSS-VEKKNGLVKTPSKLSSLFSGTQDKCAKCKKTAYPLEKLSVEG  121

Query  503  EAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            E +H+SCF+C+HGGC LT +TYA+LDG +YCK HFAQLF EKG+Y
Sbjct  122  EFYHKSCFRCSHGGCYLTPSTYAALDGFIYCKPHFAQLFKEKGSY  166


 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 9/86 (10%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F+GT DKC  C KT Y ++ LS +G  +HKSCF+CSH    L  S Y+++DG +YCK HF
Sbjct  97   FSGTQDKCAKCKKTAYPLEKLSVEGEFYHKSCFRCSHGGCYLTPSTYAALDGFIYCKPHF  156

Query  323  EQLFKESGNFS---------KNFQTT  373
             QLFKE G++S         KN Q T
Sbjct  157  AQLFKEKGSYSYLTKSASVKKNIQNT  182



>dbj|BAJ86406.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=209

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F GT DKCKAC+KTV+F+DLL+AD   +HK CFKCSHCKGTL M +YSSMDGVL+CKTH
Sbjct  2    TFYGTQDKCKACNKTVHFIDLLTADSVPYHKYCFKCSHCKGTLSMCSYSSMDGVLFCKTH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G F KNF T   +  N  +K P K  ++F GTQDKCA C KTVYPLEK+T+E
Sbjct  62   FEQLFKETGTFKKNFPTCT-KANNEQSKVPNKYGSVFCGTQDKCAACKKTVYPLEKMTLE  120

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE +H++CFKCAHGGC LT+A+YASL+G+LYC+HHF QLF E G+Y
Sbjct  121  GEPYHKTCFKCAHGGCILTNASYASLNGILYCQHHFWQLFKETGSY  166


 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = +2

Query  119  IHTKKMASFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDG  298
            +  K  + F GT DKC AC KTVY ++ ++ +G  +HK+CFKC+H    L  ++Y+S++G
Sbjct  89   VPNKYGSVFCGTQDKCAACKKTVYPLEKMTLEGEPYHKTCFKCAHGGCILTNASYASLNG  148

Query  299  VLYCKTHFEQLFKESGNFSKNFQTTKPEREN  391
            +LYC+ HF QLFKE+G++S   +    +  N
Sbjct  149  ILYCQHHFWQLFKETGSYSNLLKPASAKHAN  179


 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  428  FSGTQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHF  607
            F GTQDKC  C KTV+ ++ +T +   +H+ CFKC+H    L+  +Y+S+DGVL+CK HF
Sbjct  3    FYGTQDKCKACNKTVHFIDLLTADSVPYHKYCFKCSHCKGTLSMCSYSSMDGVLFCKTHF  62

Query  608  AQLFMEKGNYQ  640
             QLF E G ++
Sbjct  63   EQLFKETGTFK  73



>gb|KDO76132.1| hypothetical protein CISIN_1g041875mg [Citrus sinensis]
Length=195

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            +F GT +KCKACDKTV+ +D+++ADG ++HK CFKCSHC G LVM N+SSM+GVLYCK H
Sbjct  2    AFCGTQEKCKACDKTVHIIDMVTADGISYHKICFKCSHCNGKLVMGNFSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENSMTKGPTKVSAMFSGTQDKCATCTKTVYPLEKVTME  499
            FEQLFKE+G+F+      KP ++N +T+ P+K S MF GTQDKC +C KTVYPLEKVT+E
Sbjct  62   FEQLFKETGSFTNKL---KPAQKNGLTRTPSKFSTMFCGTQDKCTSCKKTVYPLEKVTVE  118

Query  500  GEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEKGNY  637
            GE+FH++CF+C+HGGC LT ++YA+LDG+LYCK HFAQLF EKG Y
Sbjct  119  GESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHFAQLFKEKGCY  164


 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  143  FTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTHF  322
            F GT DKC +C KTVY ++ ++ +G +FHK+CF+CSH    L  S+Y+++DG+LYCK+HF
Sbjct  95   FCGTQDKCTSCKKTVYPLEKVTVEGESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHF  154

Query  323  EQLFKESGNFS  355
             QLFKE G ++
Sbjct  155  AQLFKEKGCYN  165



>emb|CAA62744.1| transcription factor L2 [Arabidopsis thaliana]
Length=172

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = +2

Query  140  SFTGTLDKCKACDKTVYFVDLLSADGSTFHKSCFKCSHCKGTLVMSNYSSMDGVLYCKTH  319
            SFTGT  KCKAC+KTVY V+LLSADG  +HKSCFKC+HCK  L +S+YSSM+GVLYCK H
Sbjct  2    SFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPH  61

Query  320  FEQLFKESGNFSKNFQTTKPERENS---MTKGPTKVSAMFSGTQDKCATCTKTVYPLEKV  490
            FEQLFKESG+F+KNFQ+     + S   +T+ P++V+  FSGTQ+KCATC+KTVYP+EKV
Sbjct  62   FEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEKV  121

Query  491  TMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHFAQLFMEK  628
            T+E + +H+SCFKC+HGGCP++ + YA+L+G+LYCKHHFAQL   +
Sbjct  122  TVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLLRRR  167


 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  428  FSGTQDKCATCTKTVYPLEKVTMEGEAFHRSCFKCAHGGCPLTHATYASLDGVLYCKHHF  607
            F+GTQ KC  C KTVY +E ++ +G  +H+SCFKC H    L  ++Y+S++GVLYCK HF
Sbjct  3    FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHF  62

Query  608  AQLFMEKGNY  637
             QLF E G++
Sbjct  63   EQLFKESGSF  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 889286245264