BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23762_g2_i2 len=1021 path=[5725:0-0 3447:1-24 3471:25-72
4550:73-777 5255:778-1020]

Length=1021
                                                                      Score     E

ref|XP_009621969.1|  PREDICTED: uncharacterized protein LOC104113496    216   2e-61   
ref|XP_009604695.1|  PREDICTED: uncharacterized protein LOC104099416    215   8e-61   
ref|XP_009795412.1|  PREDICTED: uncharacterized protein LOC104242110    214   2e-60   
ref|XP_009804994.1|  PREDICTED: uncharacterized protein DDB_G0292...    213   4e-60   
ref|XP_004247791.2|  PREDICTED: uncharacterized protein LOC101245204    209   6e-59   
ref|XP_006342681.1|  PREDICTED: uncharacterized protein LOC102596842    206   1e-57   
ref|XP_011091348.1|  PREDICTED: uncharacterized protein LOC105171810    204   5e-57   
gb|EYU43768.1|  hypothetical protein MIMGU_mgv1a006114mg                201   3e-56   
ref|XP_011073723.1|  PREDICTED: uncharacterized protein LOC105158612    201   7e-56   
ref|XP_004253020.1|  PREDICTED: uncharacterized protein LOC101244358    201   7e-56   
emb|CDO99320.1|  unnamed protein product                                198   1e-54   
ref|XP_004234051.1|  PREDICTED: uncharacterized protein LOC101265801    195   5e-54   
ref|XP_008224037.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    196   6e-54   
ref|XP_006356117.1|  PREDICTED: uncharacterized protein LOC102592369    195   7e-54   
ref|XP_007226487.1|  hypothetical protein PRUPE_ppa026634mg             194   2e-53   
gb|EPS62035.1|  hypothetical protein M569_12761                         184   2e-53   
gb|KCW57324.1|  hypothetical protein EUGRSUZ_H00123                     192   3e-53   
ref|XP_010025827.1|  PREDICTED: uncharacterized protein LOC104416087    192   6e-53   
ref|XP_009767920.1|  PREDICTED: uncharacterized protein LOC104218993    193   7e-53   
ref|XP_002311697.2|  C2 domain-containing family protein                192   9e-53   Populus trichocarpa [western balsam poplar]
ref|XP_009590587.1|  PREDICTED: ankyrin repeat-containing protein...    192   2e-52   
ref|XP_002314508.1|  C2 domain-containing family protein                191   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_011029742.1|  PREDICTED: uncharacterized protein LOC105129399    190   6e-52   
ref|XP_004297932.1|  PREDICTED: uncharacterized protein LOC101311957    190   1e-51   
ref|XP_006489752.1|  PREDICTED: uncharacterized protein DDB_G0271...    189   2e-51   
ref|XP_011041447.1|  PREDICTED: uncharacterized protein LOC105137420    188   2e-51   
gb|KDO41882.1|  hypothetical protein CISIN_1g041258mg                   189   2e-51   
ref|XP_003535258.1|  PREDICTED: uncharacterized protein LOC100787698    190   3e-51   
ref|XP_007144140.1|  hypothetical protein PHAVU_007G132000g             191   4e-51   
ref|XP_003555498.1|  PREDICTED: uncharacterized protein LOC100812185    190   5e-51   
ref|XP_010667096.1|  PREDICTED: uncharacterized protein LOC104884184    186   9e-51   
ref|XP_003590735.1|  RNA-binding protein 12B                            189   1e-50   
ref|XP_006420366.1|  hypothetical protein CICLE_v10006849mg             187   1e-50   
emb|CBI23723.3|  unnamed protein product                                183   7e-50   
ref|XP_009357966.1|  PREDICTED: uncharacterized protein LOC103948651    185   7e-50   
ref|XP_010105208.1|  hypothetical protein L484_011265                   185   1e-49   
ref|XP_002282144.1|  PREDICTED: uncharacterized protein LOC100256206    184   1e-49   Vitis vinifera
emb|CAN83108.1|  hypothetical protein VITISV_026570                     184   1e-49   Vitis vinifera
ref|XP_004495257.1|  PREDICTED: proteoglycan 4-like                     186   2e-49   
ref|XP_007035276.1|  Calcium-dependent lipid-binding family prote...    182   2e-49   
ref|XP_008340669.1|  PREDICTED: uncharacterized protein LOC103403599    183   3e-49   
ref|XP_008460692.1|  PREDICTED: uncharacterized protein LOC103499460    183   5e-49   
ref|XP_004173200.1|  PREDICTED: uncharacterized LOC101215059            182   8e-49   
ref|XP_004147189.1|  PREDICTED: uncharacterized protein LOC101215059    182   8e-49   
ref|XP_002528347.1|  hypothetical protein RCOM_1217340                  178   8e-48   Ricinus communis
gb|KDP33324.1|  hypothetical protein JCGZ_12873                         177   1e-47   
gb|KFK31057.1|  hypothetical protein AALP_AA6G062700                    173   7e-47   
ref|XP_002521996.1|  conserved hypothetical protein                     172   3e-46   Ricinus communis
ref|XP_010025828.1|  PREDICTED: uncharacterized protein LOC104416088    165   5e-46   
ref|XP_006293875.1|  hypothetical protein CARUB_v10022860mg             175   9e-46   
ref|NP_180890.1|  calcium-dependent lipid-binding domain-containi...    174   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881275.1|  C2 domain-containing protein                       174   2e-45   
ref|XP_006410470.1|  hypothetical protein EUTSA_v10016412mg             174   2e-45   
ref|XP_010413889.1|  PREDICTED: uncharacterized protein LOC104700118    174   2e-45   
ref|XP_010469493.1|  PREDICTED: uncharacterized protein LOC104749540    173   3e-45   
ref|XP_010509905.1|  PREDICTED: serine/arginine repetitive matrix...    173   3e-45   
emb|CDY37732.1|  BnaA04g19360D                                          173   3e-45   
ref|XP_009141305.1|  PREDICTED: uncharacterized protein LOC103865261    173   4e-45   
ref|XP_009119477.1|  PREDICTED: uncharacterized protein LOC103844449    172   4e-45   
emb|CDY53195.1|  BnaAnng12200D                                          172   5e-45   
ref|XP_009118638.1|  PREDICTED: uncharacterized protein LOC103843645    172   5e-45   
ref|XP_006303752.1|  hypothetical protein CARUB_v10011922mg             172   7e-45   
emb|CDP04278.1|  unnamed protein product                                168   7e-45   
emb|CDY59181.1|  BnaC08g50140D                                          172   8e-45   
emb|CDY18242.1|  BnaC05g02650D                                          168   1e-44   
ref|XP_010264865.1|  PREDICTED: uncharacterized protein LOC104602763    168   2e-44   
ref|XP_009143873.1|  PREDICTED: uncharacterized protein LOC103867544    171   2e-44   
ref|XP_006358324.1|  PREDICTED: uncharacterized protein LOC102592049    166   3e-44   
ref|XP_010475114.1|  PREDICTED: uncharacterized protein LOC104754591    171   3e-44   
gb|KDP23730.1|  hypothetical protein JCGZ_23563                         167   3e-44   
ref|XP_004494967.1|  PREDICTED: uncharacterized protein LOC101508328    166   4e-44   
ref|XP_003556915.1|  PREDICTED: uncharacterized protein LOC100779058    167   7e-44   
emb|CDY23753.1|  BnaC04g43690D                                          169   7e-44   
gb|KFK42792.1|  hypothetical protein AALP_AA1G039700                    169   8e-44   
ref|XP_010556931.1|  PREDICTED: uncharacterized protein LOC104826097    169   8e-44   
ref|XP_006418119.1|  hypothetical protein EUTSA_v10007144mg             169   8e-44   
ref|XP_010483923.1|  PREDICTED: uncharacterized protein LOC104762347    169   1e-43   
ref|XP_011038591.1|  PREDICTED: uncharacterized protein LOC105135426    165   1e-43   
ref|XP_011069440.1|  PREDICTED: uncharacterized protein LOC105155266    166   1e-43   
ref|XP_009625035.1|  PREDICTED: uncharacterized protein LOC104115988    166   1e-43   
ref|XP_010457504.1|  PREDICTED: uncharacterized protein LOC104738975    168   2e-43   
ref|XP_002889512.1|  hypothetical protein ARALYDRAFT_470434             167   3e-43   
ref|XP_009792812.1|  PREDICTED: uncharacterized protein LOC104239795    164   3e-43   
ref|NP_171948.1|  calcium-dependent lipid-binding domain-containi...    167   4e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAB80639.1|  Contains similarity to Glycine SRC2 (gb|AB000130)       167   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002319115.2|  hypothetical protein POPTR_0013s04590g             164   5e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002325345.1|  hypothetical protein POPTR_0019s03780g             163   6e-43   Populus trichocarpa [western balsam poplar]
ref|XP_004239688.1|  PREDICTED: putative uncharacterized protein ...    163   1e-42   
ref|XP_004497792.1|  PREDICTED: uncharacterized protein LOC101505544    164   2e-42   
ref|XP_006345991.1|  PREDICTED: uncharacterized protein LOC102591105    162   2e-42   
ref|XP_004242771.1|  PREDICTED: formin-J                                161   2e-42   
ref|XP_010522448.1|  PREDICTED: uncharacterized protein LOC104801063    164   5e-42   
gb|KCW60206.1|  hypothetical protein EUGRSUZ_H02915                     162   5e-42   
ref|XP_011077059.1|  PREDICTED: uncharacterized protein LOC105161156    161   6e-42   
ref|XP_007145354.1|  hypothetical protein PHAVU_007G232100g             162   6e-42   
ref|XP_003590193.1|  hypothetical protein MTR_1g045780                  162   7e-42   
ref|XP_010026783.1|  PREDICTED: protein bunched, class 2/F/G isof...    162   7e-42   
ref|XP_008366882.1|  PREDICTED: uncharacterized protein LOC103430513    160   8e-42   
gb|EYU39518.1|  hypothetical protein MIMGU_mgv1a007478mg                161   8e-42   
ref|XP_009795461.1|  PREDICTED: uncharacterized protein LOC104242159    160   1e-41   
gb|KCW57325.1|  hypothetical protein EUGRSUZ_H00124                     152   4e-41   
ref|XP_008370760.1|  PREDICTED: uncharacterized protein LOC103434221    159   5e-41   
ref|XP_006437469.1|  hypothetical protein CICLE_v10033675mg             158   6e-41   
ref|XP_009343786.1|  PREDICTED: uncharacterized protein LOC103935702    158   6e-41   
gb|KDO53064.1|  hypothetical protein CISIN_1g035970mg                   158   6e-41   
ref|XP_008388740.1|  PREDICTED: uncharacterized protein LOC103451084    158   7e-41   
ref|XP_010674263.1|  PREDICTED: uncharacterized protein LOC104890461    157   7e-41   
ref|XP_003590980.1|  hypothetical protein MTR_1g080360                  157   9e-41   
ref|XP_009591729.1|  PREDICTED: uncharacterized protein LOC104088710    158   1e-40   
ref|XP_009379739.1|  PREDICTED: uncharacterized protein LOC103968123    157   1e-40   
ref|XP_007205372.1|  hypothetical protein PRUPE_ppa007276mg             157   2e-40   
ref|XP_008218351.1|  PREDICTED: uncharacterized protein LOC103318712    157   2e-40   
emb|CDP04279.1|  unnamed protein product                                155   2e-40   
gb|KHN31488.1|  hypothetical protein glysoja_035595                     152   5e-40   
ref|XP_004495587.1|  PREDICTED: uncharacterized protein LOC101488962    155   5e-40   
ref|XP_011036375.1|  PREDICTED: uncharacterized protein LOC105133911    155   5e-40   
ref|XP_004304780.1|  PREDICTED: uncharacterized protein LOC101296310    157   6e-40   
gb|KEH24577.1|  calcium-dependent lipid-binding (CaLB domain) fam...    155   6e-40   
ref|XP_011077131.1|  PREDICTED: uncharacterized protein LOC105161211    155   7e-40   
ref|XP_006577748.1|  PREDICTED: uncharacterized protein LOC102667983    155   8e-40   
ref|XP_003535375.1|  PREDICTED: uncharacterized protein LOC100795448    154   1e-39   
ref|XP_007132356.1|  hypothetical protein PHAVU_011G087800g             153   5e-39   
gb|AFK13837.1|  C2 domain-containing protein SRC2                       149   4e-38   
gb|EYU32591.1|  hypothetical protein MIMGU_mgv1a006056mg                152   4e-38   
ref|XP_007147205.1|  hypothetical protein PHAVU_006G104400g             150   4e-38   
ref|XP_007132355.1|  hypothetical protein PHAVU_011G087700g             150   5e-38   
gb|KCW85316.1|  hypothetical protein EUGRSUZ_B02156                     149   7e-38   
ref|XP_010043310.1|  PREDICTED: uncharacterized protein LOC104432551    149   8e-38   
emb|CDX89815.1|  BnaA10g02670D                                          149   5e-37   
ref|XP_008441789.1|  PREDICTED: uncharacterized protein LOC103485843    147   5e-37   
ref|XP_004155136.1|  PREDICTED: uncharacterized protein LOC101227028    145   3e-36   
ref|XP_004152866.1|  PREDICTED: uncharacterized protein LOC101218582    144   5e-36   
ref|XP_007051663.1|  Calcium-dependent lipid-binding family prote...    142   7e-36   
emb|CDX81442.1|  BnaC09g08530D                                          139   6e-34   
emb|CDY37207.1|  BnaA09g08280D                                          139   6e-34   
ref|XP_009112245.1|  PREDICTED: uncharacterized protein LOC103837642    139   7e-34   
ref|XP_010533203.1|  PREDICTED: uncharacterized protein LOC104809...    139   8e-34   
emb|CDY37206.1|  BnaA09g08270D                                          139   8e-34   
emb|CDY42921.1|  BnaC05g47300D                                          138   1e-33   
ref|XP_006297897.1|  hypothetical protein CARUB_v10013938mg             138   1e-33   
ref|XP_006842598.1|  hypothetical protein AMTR_s00077p00167680          137   2e-33   
ref|XP_010488836.1|  PREDICTED: uncharacterized protein LOC104766620    137   2e-33   
ref|NP_178968.1|  C2 domain-containing protein                          137   3e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49343.1|  BnaA05g33050D                                          137   3e-33   
ref|XP_010518533.1|  PREDICTED: uncharacterized protein LOC104793798    137   3e-33   
ref|XP_010467176.1|  PREDICTED: uncharacterized protein LOC104747266    137   3e-33   
ref|XP_002885870.1|  hypothetical protein ARALYDRAFT_480303             137   3e-33   
ref|XP_009123999.1|  PREDICTED: uncharacterized protein LOC103848923    137   3e-33   
ref|XP_010485810.1|  PREDICTED: putative lysozyme-like protein          136   5e-33   
ref|XP_010102203.1|  hypothetical protein L484_024484                   136   5e-33   
ref|XP_010463915.1|  PREDICTED: uncharacterized protein LOC104744544    136   7e-33   
gb|KFK39933.1|  hypothetical protein AALP_AA3G308600                    136   8e-33   
gb|AAF26778.1|AC016829_2  hypothetical protein                          135   9e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37859.1|  hypothetical protein AALP_AA3G038400                    135   1e-32   
ref|XP_002884443.1|  hypothetical protein ARALYDRAFT_477695             135   1e-32   
ref|XP_006409691.1|  hypothetical protein EUTSA_v10022712mg             135   1e-32   
gb|ABK28543.1|  unknown                                                 134   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408192.1|  hypothetical protein EUTSA_v10020890mg             135   2e-32   
ref|NP_566225.4|  calcium-dependent lipid-binding family protein        135   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67146.1|  unknown                                                 135   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842901.1|  hypothetical protein AMTR_s00075p00073210          135   2e-32   
emb|CDX92066.1|  BnaC03g33680D                                          134   3e-32   
ref|XP_009377282.1|  PREDICTED: BON1-associated protein 2               130   4e-32   
ref|XP_010936043.1|  PREDICTED: uncharacterized protein LOC105055767    132   5e-32   
ref|XP_009136211.1|  PREDICTED: uncharacterized protein LOC103860372    134   5e-32   
emb|CDX74193.1|  BnaA03g28540D                                          134   5e-32   
emb|CDX89605.1|  BnaC03g45190D                                          134   6e-32   
ref|XP_009420756.1|  PREDICTED: uncharacterized protein LOC104000435    130   7e-32   
ref|XP_010557577.1|  PREDICTED: uncharacterized protein LOC104826528    134   9e-32   
ref|XP_004133823.1|  PREDICTED: uncharacterized protein LOC101212280    130   9e-32   
ref|XP_006300066.1|  hypothetical protein CARUB_v10016294mg             133   1e-31   
ref|XP_009134757.1|  PREDICTED: uncharacterized protein LOC103859027    132   1e-31   
ref|XP_008796382.1|  PREDICTED: uncharacterized protein LOC103711856    130   2e-31   
ref|XP_002511946.1|  conserved hypothetical protein                     129   2e-31   Ricinus communis
gb|EYU39778.1|  hypothetical protein MIMGU_mgv1a009123mg                131   3e-31   
ref|XP_009401202.1|  PREDICTED: uncharacterized protein LOC103985274    129   3e-31   
ref|XP_008437926.1|  PREDICTED: uncharacterized protein LOC103483209    129   3e-31   
ref|XP_010251574.1|  PREDICTED: uncharacterized protein LOC104593437    128   6e-31   
ref|XP_008801291.1|  PREDICTED: uncharacterized protein LOC103715451    129   7e-31   
ref|XP_009625033.1|  PREDICTED: uncharacterized protein LOC104115986    130   7e-31   
gb|EPS68074.1|  hypothetical protein M569_06693                         127   1e-30   
ref|XP_007030351.1|  Calcium-dependent lipid-binding (CaLB domain...    129   1e-30   
ref|XP_010549648.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    129   2e-30   
ref|XP_008362824.1|  PREDICTED: uncharacterized protein LOC103426513    127   2e-30   
ref|XP_010558947.1|  PREDICTED: uncharacterized protein LOC104827473    129   2e-30   
ref|XP_010544424.1|  PREDICTED: uncharacterized protein LOC104817045    126   4e-30   
gb|KDP28538.1|  hypothetical protein JCGZ_14309                         125   5e-30   
ref|XP_002276427.1|  PREDICTED: uncharacterized protein LOC100258448    125   7e-30   Vitis vinifera
ref|XP_010920373.1|  PREDICTED: CASP-like protein 4A1                   128   1e-29   
ref|XP_011093241.1|  PREDICTED: uncharacterized protein LOC105173247    124   2e-29   
ref|XP_002301388.2|  hypothetical protein POPTR_0002s16800g             123   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010456220.1|  PREDICTED: BON1-associated protein 2-like          123   4e-29   
ref|XP_010262513.1|  PREDICTED: uncharacterized protein LOC104601031    124   5e-29   
ref|XP_008233233.1|  PREDICTED: uncharacterized protein LOC103332288    122   1e-28   
ref|XP_011023248.1|  PREDICTED: uncharacterized protein LOC105124808    121   1e-28   
gb|KDO86360.1|  hypothetical protein CISIN_1g047341mg                   121   2e-28   
ref|XP_006444911.1|  hypothetical protein CICLE_v10021815mg             121   2e-28   
ref|XP_007218843.1|  hypothetical protein PRUPE_ppa010336mg             120   2e-28   
ref|XP_010669605.1|  PREDICTED: uncharacterized protein LOC104886787    121   3e-28   
ref|XP_009111426.1|  PREDICTED: uncharacterized protein LOC103836878    120   3e-28   
ref|XP_006289671.1|  hypothetical protein CARUB_v10003230mg             120   5e-28   
ref|XP_009385178.1|  PREDICTED: uncharacterized protein LOC103972545    121   5e-28   
ref|XP_006577334.1|  PREDICTED: BON1-associated protein 2-like          119   6e-28   
ref|NP_192029.1|  calcium-dependent lipid-binding domain-containi...    119   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396291.1|  hypothetical protein EUTSA_v10028892mg             120   6e-28   
ref|XP_010422779.1|  PREDICTED: BON1-associated protein 2-like          119   8e-28   
ref|XP_009406969.1|  PREDICTED: uncharacterized protein LOC103989745    120   8e-28   
ref|XP_011093070.1|  PREDICTED: uncharacterized protein LOC105173112    119   1e-27   
gb|KDP30266.1|  hypothetical protein JCGZ_17048                         117   2e-27   
ref|XP_010427687.1|  PREDICTED: BON1-associated protein 2-like          118   2e-27   
gb|EAY87999.1|  hypothetical protein OsI_09421                          119   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_003553776.1|  PREDICTED: uncharacterized protein LOC100793541    118   2e-27   
ref|XP_006339653.1|  PREDICTED: uncharacterized protein LOC102592387    117   5e-27   
gb|EYU38921.1|  hypothetical protein MIMGU_mgv1a022778mg                117   5e-27   
ref|XP_007147256.1|  hypothetical protein PHAVU_006G109100g             117   5e-27   
ref|XP_002872904.1|  C2 domain-containing protein                       117   6e-27   
ref|XP_010092894.1|  hypothetical protein L484_022489                   117   6e-27   
ref|XP_009347863.1|  PREDICTED: uncharacterized protein LOC103939495    115   4e-26   
emb|CDY48509.1|  BnaA09g00140D                                          120   5e-26   
ref|XP_004229965.1|  PREDICTED: BON1-associated protein 2               114   5e-26   
emb|CDY07180.1|  BnaCnng01950D                                          120   7e-26   
ref|XP_008679175.1|  PREDICTED: uncharacterized protein LOC103654122    114   8e-26   
ref|XP_009350266.1|  PREDICTED: uncharacterized protein LOC103941795    114   1e-25   
ref|XP_009764572.1|  PREDICTED: uncharacterized protein LOC104216252    114   1e-25   
emb|CDP08734.1|  unnamed protein product                                113   2e-25   
ref|XP_010055064.1|  PREDICTED: uncharacterized protein LOC104443389    113   2e-25   
ref|XP_004494776.1|  PREDICTED: uncharacterized protein LOC101496947    112   5e-25   
ref|XP_010914471.1|  PREDICTED: uncharacterized protein LOC105039856    111   5e-25   
ref|XP_004308328.1|  PREDICTED: uncharacterized protein LOC101301728    112   7e-25   
ref|XP_008798687.1|  PREDICTED: uncharacterized protein LOC103713510    109   2e-24   
emb|CDP17419.1|  unnamed protein product                                110   2e-24   
ref|XP_008791481.1|  PREDICTED: uncharacterized protein LOC103708363    109   3e-24   
gb|AES82742.2|  calcium-dependent lipid-binding (CaLB domain) fam...    109   3e-24   
emb|CAN79006.1|  hypothetical protein VITISV_040896                     111   3e-24   Vitis vinifera
ref|XP_003626524.1|  hypothetical protein MTR_7g116840                  109   6e-24   
ref|XP_010914657.1|  PREDICTED: uncharacterized protein LOC105039993    108   7e-24   
ref|XP_003572941.1|  PREDICTED: uncharacterized protein LOC100843074    108   1e-23   
ref|XP_009591358.1|  PREDICTED: uncharacterized protein LOC104088405    107   2e-23   
ref|XP_009400560.1|  PREDICTED: uncharacterized protein LOC103984726    105   8e-23   
gb|ABK22654.1|  unknown                                                 103   1e-22   Picea sitchensis
ref|NP_001048499.1|  Os02g0815100                                       104   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AFG52315.1|  hypothetical protein 2_3193_01                          100   4e-22   
gb|ABK23345.1|  unknown                                                 101   5e-22   Picea sitchensis
gb|AFG52320.1|  hypothetical protein 2_3193_01                          100   6e-22   
gb|AEW08214.1|  hypothetical protein 2_3193_01                        99.4    1e-21   
ref|XP_007031704.1|  Calcium-dependent lipid-binding (CaLB domain...    102   1e-21   
ref|XP_010936622.1|  PREDICTED: uncharacterized protein LOC105056210  97.8    2e-20   
ref|XP_008365038.1|  PREDICTED: uncharacterized protein LOC103428692  98.6    2e-20   
dbj|BAK03653.1|  predicted protein                                    98.6    3e-20   
ref|XP_003569491.1|  PREDICTED: uncharacterized protein LOC100842238  94.4    8e-19   
emb|CDM83573.1|  unnamed protein product                              93.2    2e-18   
ref|XP_002992362.1|  hypothetical protein SELMODRAFT_430579           92.0    4e-18   
ref|XP_010245272.1|  PREDICTED: uncharacterized protein LOC104588843  90.1    6e-18   
ref|XP_002967740.1|  hypothetical protein SELMODRAFT_408999           91.3    7e-18   
ref|NP_001043768.1|  Os01g0659800                                     90.1    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001170657.1|  hypothetical protein                             88.6    7e-17   Zea mays [maize]
ref|XP_004985378.1|  PREDICTED: uncharacterized protein LOC101774...  87.4    2e-16   
ref|XP_004985379.1|  PREDICTED: uncharacterized protein LOC101774...  87.0    3e-16   
ref|XP_010097658.1|  hypothetical protein L484_023798                 85.1    3e-16   
ref|XP_002456081.1|  hypothetical protein SORBIDRAFT_03g030080        85.1    1e-15   Sorghum bicolor [broomcorn]
ref|XP_002970540.1|  hypothetical protein SELMODRAFT_441151           84.0    2e-15   
ref|XP_006605265.1|  PREDICTED: uncharacterized protein LOC102668124  82.0    3e-15   
gb|ABR18223.1|  unknown                                               84.0    4e-15   Picea sitchensis
gb|ABK24127.1|  unknown                                               82.0    4e-15   Picea sitchensis
gb|ACN40336.1|  unknown                                               82.8    1e-14   Picea sitchensis
ref|XP_002978619.1|  hypothetical protein SELMODRAFT_443918           84.0    1e-14   
ref|XP_010101600.1|  hypothetical protein L484_001120                 80.1    2e-14   
ref|XP_002976843.1|  hypothetical protein SELMODRAFT_443351           80.9    4e-14   
ref|XP_001759306.1|  predicted protein                                82.8    4e-14   
gb|AFW83462.1|  C2 domain containing protein                          80.9    4e-14   
ref|XP_002453028.1|  hypothetical protein SORBIDRAFT_04g037000        80.1    5e-14   Sorghum bicolor [broomcorn]
ref|XP_010096455.1|  hypothetical protein L484_001160                 79.7    5e-14   
gb|ABR17336.1|  unknown                                               80.5    7e-14   Picea sitchensis
ref|NP_001152648.1|  C2 domain containing protein                     79.7    8e-14   Zea mays [maize]
ref|XP_002272904.1|  PREDICTED: cytokinesis protein sepA-like         80.1    8e-14   Vitis vinifera
ref|XP_010269468.1|  PREDICTED: abl interactor homolog                79.3    1e-13   
ref|XP_001782642.1|  predicted protein                                79.3    1e-13   
gb|ABU98655.1|  SRC2 protein                                          80.1    1e-13   Taiwania cryptomerioides
gb|KDP32089.1|  hypothetical protein JCGZ_12550                       80.9    2e-13   
ref|XP_002968005.1|  hypothetical protein SELMODRAFT_440190           77.8    2e-13   
ref|XP_002989504.1|  hypothetical protein SELMODRAFT_428112           75.1    8e-13   
ref|XP_002964639.1|  hypothetical protein SELMODRAFT_406042           75.1    1e-12   
ref|XP_010417623.1|  PREDICTED: uncharacterized protein LOC104703311  74.3    1e-11   
ref|XP_004955273.1|  PREDICTED: uncharacterized protein LOC101765467  73.2    2e-11   
ref|XP_011090948.1|  PREDICTED: protein diaphanous homolog 1-like     73.9    2e-11   
ref|XP_011016831.1|  PREDICTED: BON1-associated protein 2-like        70.9    3e-11   
ref|XP_001778275.1|  predicted protein                                71.2    4e-11   
ref|XP_009792811.1|  PREDICTED: uncharacterized protein LOC104239794  72.4    5e-11   
gb|KDP37957.1|  hypothetical protein JCGZ_04600                       69.7    8e-11   
ref|XP_010319948.1|  PREDICTED: uncharacterized protein LOC104647076  71.6    1e-10   
ref|XP_011035593.1|  PREDICTED: BON1-associated protein 2-like        69.7    1e-10   
gb|EPS60622.1|  hypothetical protein M569_14180                       70.9    1e-10   
ref|XP_010275059.1|  PREDICTED: uncharacterized protein LOC104610232  68.9    2e-10   
ref|XP_008225460.1|  PREDICTED: uncharacterized protein LOC103325105  69.3    2e-10   
ref|XP_008438876.1|  PREDICTED: protein diaphanous homolog 1          70.9    2e-10   
ref|XP_001761054.1|  predicted protein                                68.9    3e-10   
ref|XP_007138900.1|  hypothetical protein PHAVU_009G247100g           70.1    3e-10   
ref|XP_002283998.1|  PREDICTED: uncharacterized protein LOC100245905  69.3    4e-10   
ref|XP_007051905.1|  BON association protein 2, putative              67.4    5e-10   
ref|XP_001772125.1|  predicted protein                                70.1    7e-10   
gb|EYU45555.1|  hypothetical protein MIMGU_mgv1a018032mg              68.9    8e-10   
ref|XP_002320774.1|  BON association protein 1                        67.0    9e-10   
gb|KDP21440.1|  hypothetical protein JCGZ_21911                       65.5    1e-09   
ref|XP_004970615.1|  PREDICTED: leucine-rich repeat extensin-like...  68.9    1e-09   
gb|EYU43935.1|  hypothetical protein MIMGU_mgv1a013059mg              67.0    2e-09   
ref|XP_006445134.1|  hypothetical protein CICLE_v10022449mg           66.2    2e-09   
ref|XP_003609663.1|  hypothetical protein MTR_4g119780                66.6    2e-09   
emb|CDP14057.1|  unnamed protein product                              67.8    2e-09   
gb|AFK33423.1|  unknown                                               66.2    3e-09   
ref|XP_006855523.1|  hypothetical protein AMTR_s00057p00209740        67.4    3e-09   
gb|KEH34781.1|  C2 domain protein                                     67.4    3e-09   
gb|KDO86040.1|  hypothetical protein CISIN_1g036193mg                 65.5    3e-09   
ref|XP_004134204.1|  PREDICTED: uncharacterized protein LOC101222610  67.4    3e-09   
ref|XP_004159813.1|  PREDICTED: uncharacterized protein LOC101229597  67.4    4e-09   
ref|XP_011084443.1|  PREDICTED: uncharacterized protein LOC105166693  66.2    4e-09   
ref|XP_002299003.1|  hypothetical protein POPTR_0001s46230g           64.3    5e-09   
ref|XP_002279465.1|  PREDICTED: formin-1                              65.9    6e-09   
ref|XP_002315561.1|  shock protein SRC2                               66.2    6e-09   
ref|XP_007030973.1|  Soybean gene regulated by cold-2, putative       66.2    6e-09   
ref|XP_011076733.1|  PREDICTED: pollen-specific leucine-rich repe...  66.2    6e-09   
gb|KCW85018.1|  hypothetical protein EUGRSUZ_B01852                   64.3    6e-09   
ref|XP_004247617.1|  PREDICTED: formin-like protein 14                66.2    9e-09   
gb|ABK23901.1|  unknown                                               65.9    9e-09   
gb|AAB61031.1|  A_IG002N01.24 gene product                            67.0    1e-08   
gb|KDP44823.1|  hypothetical protein JCGZ_01323                       65.5    1e-08   
ref|XP_008343828.1|  PREDICTED: formin-like protein 20                65.9    1e-08   
emb|CDY17163.1|  BnaA05g10250D                                        61.6    1e-08   
gb|ACV71018.1|  UPA18                                                 65.9    1e-08   
ref|XP_003600860.1|  BAHD acyltransferase DCR                         66.6    1e-08   
ref|XP_002965668.1|  hypothetical protein SELMODRAFT_407234           65.9    1e-08   
gb|EEE55117.1|  hypothetical protein OsJ_02891                        65.1    1e-08   
ref|XP_002456650.1|  hypothetical protein SORBIDRAFT_03g040170        65.5    1e-08   
ref|XP_010256631.1|  PREDICTED: leucine-rich repeat extensin-like...  65.5    1e-08   
gb|KDP46959.1|  hypothetical protein JCGZ_07976                       64.7    1e-08   
ref|XP_011087410.1|  PREDICTED: uncharacterized protein LOC105168911  65.5    2e-08   
ref|XP_002302565.1|  BON association protein 1                        63.2    2e-08   
ref|XP_002511807.1|  conserved hypothetical protein                   63.2    2e-08   
ref|XP_009627866.1|  PREDICTED: uncharacterized protein LOC104118341  64.3    2e-08   
ref|XP_004296826.1|  PREDICTED: uncharacterized protein LOC101304564  64.7    2e-08   
ref|XP_009588589.1|  PREDICTED: pollen-specific leucine-rich repe...  64.7    2e-08   
ref|XP_010938433.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  64.7    2e-08   
ref|XP_010111003.1|  BON1-associated protein 2                        63.2    2e-08   
ref|XP_011023397.1|  PREDICTED: BON1-associated protein 2-like        62.8    2e-08   
ref|XP_010046182.1|  PREDICTED: uncharacterized protein LOC104435055  64.3    3e-08   
ref|XP_010921798.1|  PREDICTED: ingression protein fic1-like          64.3    3e-08   
ref|NP_001132444.1|  Ras association and pleckstrin y domain 1 is...  64.3    4e-08   
dbj|BAK04302.1|  predicted protein                                    63.5    4e-08   
ref|XP_008789935.1|  PREDICTED: small nuclear ribonucleoprotein-a...  63.9    4e-08   
ref|XP_011041338.1|  PREDICTED: leucine-rich repeat extensin-like...  63.9    4e-08   
dbj|BAJ85055.1|  predicted protein                                    64.3    4e-08   
gb|AEX12186.1|  hypothetical protein 0_741_02                         60.5    4e-08   
ref|XP_011044520.1|  PREDICTED: actin cytoskeleton-regulatory com...  63.5    5e-08   
ref|XP_010666732.1|  PREDICTED: uncharacterized protein LOC104883866  62.8    5e-08   
ref|XP_007208693.1|  hypothetical protein PRUPE_ppa1027138mg          62.0    5e-08   
ref|XP_009136710.1|  PREDICTED: uncharacterized protein LOC103860797  62.0    5e-08   
emb|CDP21817.1|  unnamed protein product                              63.2    6e-08   
ref|XP_002971671.1|  hypothetical protein SELMODRAFT_412188           63.9    6e-08   
ref|XP_003529574.1|  PREDICTED: toll-interacting protein-like         63.2    6e-08   
ref|XP_009779320.1|  PREDICTED: pollen-specific leucine-rich repe...  63.5    6e-08   
gb|KHN26566.1|  hypothetical protein glysoja_019805                   62.8    6e-08   
ref|XP_010671657.1|  PREDICTED: uncharacterized protein LOC104888396  62.8    7e-08   
ref|XP_004967742.1|  PREDICTED: forkhead box protein D1-like          63.2    7e-08   
ref|XP_004157192.1|  PREDICTED: uncharacterized protein LOC101224685  62.8    7e-08   
ref|XP_007035560.1|  Soybean gene regulated by cold-2, putative       62.8    8e-08   
ref|NP_001238642.1|  cold-regulated protein                           62.8    8e-08   
ref|XP_004230221.1|  PREDICTED: uncharacterized protein LOC101248717  62.8    8e-08   
ref|XP_006425035.1|  hypothetical protein CICLE_v10028899mg           63.2    8e-08   
ref|XP_008392919.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    8e-08   
ref|XP_011071658.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  62.8    9e-08   
ref|XP_004140766.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  61.6    9e-08   
ref|XP_008801062.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  63.2    1e-07   
gb|AEX12629.1|  hypothetical protein 2_5809_01                        59.7    1e-07   
ref|XP_001779834.1|  predicted protein                                62.0    1e-07   
ref|XP_004487863.1|  PREDICTED: ribonucleoprotein RB97D-like          62.4    1e-07   
ref|XP_008779256.1|  PREDICTED: uncharacterized protein LOC103698987  62.0    1e-07   
ref|XP_002512414.1|  conserved hypothetical protein                   62.0    2e-07   
emb|CDP19538.1|  unnamed protein product                              62.4    2e-07   
ref|XP_009384169.1|  PREDICTED: basic proline-rich protein-like       62.4    2e-07   
ref|XP_011076131.1|  PREDICTED: WW domain-containing protein C11B...  61.6    2e-07   
gb|EAY96559.1|  hypothetical protein OsI_18464                        61.6    2e-07   
ref|XP_010934387.1|  PREDICTED: large proline-rich protein bag6-like  61.6    2e-07   
ref|XP_008439269.1|  PREDICTED: zinc finger matrin-type protein C...  61.6    2e-07   
ref|NP_001054654.1|  Os05g0149100                                     61.6    2e-07   
gb|KDP27783.1|  hypothetical protein JCGZ_18863                       61.6    2e-07   
ref|XP_009350922.1|  PREDICTED: formin-like protein 20                61.6    2e-07   
ref|XP_006365577.1|  PREDICTED: uncharacterized protein LOC102595643  59.7    3e-07   
ref|XP_007218347.1|  hypothetical protein PRUPE_ppa008681mg           61.6    3e-07   
ref|XP_007163517.1|  hypothetical protein PHAVU_001G240600g           61.2    3e-07   
ref|XP_007009086.1|  Calcium-dependent lipid-binding family protein   61.2    3e-07   
gb|KDP25484.1|  hypothetical protein JCGZ_20640                       59.3    3e-07   
ref|XP_006601957.1|  PREDICTED: uncharacterized protein LOC102666...  61.2    3e-07   
ref|XP_006827562.1|  hypothetical protein AMTR_s00009p00222310        60.5    3e-07   
ref|XP_002311204.1|  hypothetical protein POPTR_0008s06510g           61.2    3e-07   
gb|ABK92946.1|  unknown                                               60.8    4e-07   
ref|XP_010098296.1|  hypothetical protein L484_023544                 60.8    4e-07   
gb|EYU25119.1|  hypothetical protein MIMGU_mgv1a021760mg              60.8    4e-07   
emb|CAN68012.1|  hypothetical protein VITISV_005112                   58.9    5e-07   
ref|XP_010662671.1|  PREDICTED: uncharacterized protein LOC104882187  58.9    5e-07   
emb|CDY72474.1|  BnaCnng77840D                                        59.3    5e-07   
ref|XP_008439354.1|  PREDICTED: BON1-associated protein 2-like        58.5    5e-07   
ref|XP_010024687.1|  PREDICTED: formin-F-like                         60.5    5e-07   
ref|XP_010025284.1|  PREDICTED: uncharacterized protein LOC104415652  58.9    5e-07   
ref|XP_010092739.1|  BON1-associated protein 2                        58.9    5e-07   
ref|XP_011030162.1|  PREDICTED: uncharacterized protein LOC105129684  60.1    5e-07   
ref|XP_009774894.1|  PREDICTED: uncharacterized protein LOC104224872  60.1    6e-07   
gb|KDP41888.1|  hypothetical protein JCGZ_26906                       60.5    6e-07   
ref|XP_009359909.1|  PREDICTED: uncharacterized protein LOC103950433  60.1    6e-07   
ref|XP_010662792.1|  PREDICTED: uncharacterized protein LOC104882216  58.5    7e-07   
gb|EYU19982.1|  hypothetical protein MIMGU_mgv1a024988mg              60.1    8e-07   
ref|XP_004229314.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  60.1    8e-07   
ref|XP_002519702.1|  conserved hypothetical protein                   58.5    9e-07   
gb|AEX12631.1|  hypothetical protein 2_5809_01                        57.4    9e-07   
ref|XP_009340617.1|  PREDICTED: BON1-associated protein 2-like        58.2    9e-07   
ref|XP_006342789.1|  PREDICTED: formin-A-like isoform X1              59.7    9e-07   
ref|XP_006645033.1|  PREDICTED: protein enabled homolog               59.7    1e-06   
gb|KHG21324.1|  BON1-associated 2 -like protein                       59.3    1e-06   
ref|XP_010548935.1|  PREDICTED: extensin isoform X1                   59.7    1e-06   
gb|AEX12187.1|  hypothetical protein 0_741_02                         56.6    1e-06   
ref|XP_010519178.1|  PREDICTED: uncharacterized protein LOC104798699  59.3    1e-06   
gb|EMT21195.1|  hypothetical protein F775_15531                       58.9    1e-06   
ref|XP_004240724.1|  PREDICTED: uncharacterized protein LOC101263030  58.5    1e-06   
ref|XP_010259736.1|  PREDICTED: uncharacterized protein LOC104599071  58.2    1e-06   
emb|CDM83636.1|  unnamed protein product                              59.3    2e-06   
ref|XP_002526856.1|  protein with unknown function                    58.9    2e-06   
ref|XP_008369595.1|  PREDICTED: uncharacterized protein LOC103433141  58.5    2e-06   
ref|XP_002513669.1|  conserved hypothetical protein                   58.2    2e-06   
ref|NP_001236659.1|  src2 protein                                     58.5    2e-06   
ref|NP_001063992.1|  Os09g0571200                                     58.5    2e-06   
ref|XP_004974238.1|  PREDICTED: transcriptional repressor scratch...  58.5    2e-06   
ref|XP_009779515.1|  PREDICTED: formin-like protein 18                58.5    2e-06   
emb|CDX74290.1|  BnaA03g27570D                                        57.0    3e-06   
ref|XP_003578699.1|  PREDICTED: tropomyosin-1, isoforms 33/34-like    58.5    3e-06   
ref|XP_009401591.1|  PREDICTED: uncharacterized protein LOC103985575  58.2    3e-06   
gb|EAY76529.1|  hypothetical protein OsI_04471                        58.5    3e-06   
ref|NP_001044834.1|  Os01g0853800                                     58.5    3e-06   
ref|XP_010278593.1|  PREDICTED: BON1-associated protein 2             57.4    3e-06   
gb|KDP20267.1|  hypothetical protein JCGZ_06853                       56.6    3e-06   
gb|ABK26354.1|  unknown                                               58.2    3e-06   
ref|XP_006394656.1|  hypothetical protein EUTSA_v10004867mg           57.4    3e-06   
ref|NP_197783.2|  calcium-dependent lipid-binding domain-containi...  57.0    3e-06   
ref|XP_010557218.1|  PREDICTED: leucine-rich repeat extensin-like...  58.5    3e-06   
emb|CAN64035.1|  hypothetical protein VITISV_020002                   57.4    3e-06   
emb|CAN69351.1|  hypothetical protein VITISV_017753                   57.8    3e-06   
emb|CDP08873.1|  unnamed protein product                              56.2    4e-06   
ref|XP_011076565.1|  PREDICTED: cleavage and polyadenylation spec...  58.2    4e-06   
gb|KDO36355.1|  hypothetical protein CISIN_1g021949mg                 57.8    4e-06   
tpg|DAA55958.1|  TPA: hypothetical protein ZEAMMB73_567157            58.2    4e-06   
ref|XP_003564634.1|  PREDICTED: leucine-rich repeat extensin-like...  57.8    4e-06   
ref|XP_002275480.1|  PREDICTED: uncharacterized protein LOC100242355  57.4    4e-06   
ref|XP_009363765.1|  PREDICTED: wiskott-Aldrich syndrome protein-...  57.8    4e-06   
ref|XP_004307752.1|  PREDICTED: uncharacterized protein LOC101311043  57.8    4e-06   
gb|KCW65820.1|  hypothetical protein EUGRSUZ_G031711                  57.0    4e-06   
dbj|BAB10068.1|  unnamed protein product                              57.0    5e-06   
dbj|BAK04679.1|  predicted protein                                    57.4    5e-06   
gb|KDP28677.1|  hypothetical protein JCGZ_14448                       55.8    5e-06   
ref|XP_010940561.1|  PREDICTED: transcription elongation factor SPT5  57.4    5e-06   
ref|XP_010259665.1|  PREDICTED: uncharacterized protein LOC104599004  55.5    5e-06   
emb|CBI22681.3|  unnamed protein product                              58.2    5e-06   
gb|KEH18937.1|  C2 domain protein                                     55.8    6e-06   
ref|XP_002271409.1|  PREDICTED: BAHD acyltransferase DCR              58.2    6e-06   
ref|XP_004155872.1|  PREDICTED: BON1-associated protein 2-like        55.5    6e-06   
ref|XP_006422081.1|  hypothetical protein CICLE_v10005598mg           57.0    6e-06   
ref|XP_009592495.1|  PREDICTED: cytokinesis protein sepA              57.4    6e-06   
ref|XP_002319528.1|  C2 domain-containing family protein              57.0    6e-06   
emb|CAI58613.1|  C2 domain-containing protein                         57.4    7e-06   
ref|XP_010024685.1|  PREDICTED: uncharacterized protein LOC104415126  55.1    7e-06   
ref|XP_004134335.1|  PREDICTED: BON1-associated protein 2-like        55.5    7e-06   
ref|XP_010662790.1|  PREDICTED: uncharacterized protein LOC104882214  55.1    8e-06   
ref|XP_001758594.1|  predicted protein                                55.8    8e-06   
emb|CAN72571.1|  hypothetical protein VITISV_017490                   55.1    8e-06   
gb|KDO56853.1|  hypothetical protein CISIN_1g023810mg                 56.6    8e-06   
ref|XP_007213255.1|  hypothetical protein PRUPE_ppb020632mg           55.1    8e-06   
ref|NP_001062521.1|  Os08g0562600                                     56.6    9e-06   
ref|XP_001775930.1|  predicted protein                                57.0    9e-06   
ref|XP_009340618.1|  PREDICTED: BON1-associated protein 2-like        55.1    9e-06   
ref|XP_011023669.1|  PREDICTED: WW domain-binding protein 2-like      56.6    1e-05   
ref|XP_002320329.2|  hypothetical protein POPTR_0014s07460g           54.7    1e-05   
ref|XP_004510853.1|  PREDICTED: BON1-associated protein 2-like        55.1    1e-05   
ref|XP_008232746.1|  PREDICTED: BON1-associated protein 2-like        54.7    1e-05   
ref|XP_011001103.1|  PREDICTED: formin-like                           56.2    1e-05   
ref|XP_002271267.1|  PREDICTED: uncharacterized protein LOC100249100  56.2    1e-05   
ref|XP_006419602.1|  hypothetical protein CICLE_v10005548mg           56.2    1e-05   
gb|AEX12630.1|  hypothetical protein 2_5809_01                        54.3    1e-05   
ref|XP_002449622.1|  hypothetical protein SORBIDRAFT_05g020330        56.6    1e-05   
gb|KDP23491.1|  hypothetical protein JCGZ_23324                       56.2    1e-05   
ref|XP_006827556.1|  hypothetical protein AMTR_s00009p00221230        56.2    1e-05   
gb|KDP28676.1|  hypothetical protein JCGZ_14447                       54.7    1e-05   
ref|XP_002271138.1|  PREDICTED: BON1-associated protein 2             54.7    1e-05   
ref|XP_008800861.1|  PREDICTED: formin-like protein 18                56.6    1e-05   
gb|AFD97530.1|  BAP1                                                  54.7    1e-05   
ref|XP_006344643.1|  PREDICTED: uncharacterized protein LOC102596739  55.8    1e-05   
ref|XP_011032146.1|  PREDICTED: basic salivary proline-rich prote...  56.2    1e-05   
ref|XP_006646653.1|  PREDICTED: C2 domain-containing protein At1g...  55.5    1e-05   
ref|XP_010068940.1|  PREDICTED: uncharacterized protein LOC104455934  56.2    1e-05   
gb|KDP34549.1|  hypothetical protein JCGZ_11099                       56.2    1e-05   
ref|XP_009340622.1|  PREDICTED: BON1-associated protein 2-like        54.3    1e-05   
emb|CAN78886.1|  hypothetical protein VITISV_002549                   55.8    1e-05   
ref|XP_003634095.1|  PREDICTED: uncharacterized protein LOC100852496  55.8    1e-05   
gb|EYU23916.1|  hypothetical protein MIMGU_mgv1a0260082mg             53.5    2e-05   
ref|XP_006363329.1|  PREDICTED: uncharacterized protein LOC102600321  55.8    2e-05   



>ref|XP_009621969.1| PREDICTED: uncharacterized protein LOC104113496 [Nicotiana tomentosiformis]
Length=523

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 125/165 (76%), Gaps = 6/165 (4%)
 Frame = -3

Query  917  IIKMANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWN  738
            I KM   KPF+LLEI IIS QDLEP +K  M+TY TAWI+P +K TT +D EGG+NP WN
Sbjct  4    ISKMGMLKPFQLLEINIISVQDLEPTSK-KMKTYVTAWIHPTQKLTTGVDVEGGNNPTWN  62

Query  737  DKFVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHH-QNLGT  561
            DKFVF+VDE FLRQ+TSA+  EI+ + W  DSLIGTVR+LVGNLIPP     HH  +LG 
Sbjct  63   DKFVFRVDEEFLRQDTSAVHIEIFSVHWFRDSLIGTVRVLVGNLIPPIRAYGHHNHHLGM  122

Query  560  RFAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
            RF A+Q+RRPSGRPQGILNIGVA+LDGS RS PL R     A GY
Sbjct  123  RFVALQIRRPSGRPQGILNIGVALLDGSMRSMPLYRQMSTSAVGY  167



>ref|XP_009604695.1| PREDICTED: uncharacterized protein LOC104099416 [Nicotiana tomentosiformis]
Length=545

 Score =   215 bits (547),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 5/162 (3%)
 Frame = -3

Query  911  KMANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDK  732
            K+   KPF+LLE+ IISAQDLEP +K  M+TY TAW++P RK TT +DTEGG+NP WNDK
Sbjct  4    KIGVLKPFQLLEVNIISAQDLEPVSK-KMKTYATAWVHPTRKLTTGVDTEGGNNPTWNDK  62

Query  731  FVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFA  552
            FVF+VDE FLRQ+TSA++ +IY + W  DSL+G+VR+LVGNLIPPP+   H  ++G RF 
Sbjct  63   FVFRVDEEFLRQDTSAVQIDIYSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQHHIGMRFV  122

Query  551  AVQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
            A+Q+RRPSGRPQGILNIGV +L G+ RS PL R     A GY
Sbjct  123  ALQIRRPSGRPQGILNIGVTLLGGTMRSMPLYRQLSMSAVGY  164



>ref|XP_009795412.1| PREDICTED: uncharacterized protein LOC104242110 [Nicotiana sylvestris]
Length=545

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 124/157 (79%), Gaps = 5/157 (3%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            KPF+LLE+ IISAQDLEP +K  M+TY TAW++P RK TT +DTEGG+NP WNDKFVF+V
Sbjct  9    KPFQLLEVNIISAQDLEPVSK-RMKTYATAWVHPTRKLTTGVDTEGGNNPTWNDKFVFRV  67

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            DE FLRQ+TSA++ +IY + W  DSL+G+VR+LVGNLIPPP+   H  ++G RF A+Q+R
Sbjct  68   DEEFLRQDTSAVQIDIYSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQHHIGMRFVALQIR  127

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
            RPSGRPQGILNIGV +L G+ RS PL R     A GY
Sbjct  128  RPSGRPQGILNIGVTLLGGTMRSMPLYRQLSMSAVGY  164



>ref|XP_009804994.1| PREDICTED: uncharacterized protein DDB_G0292186-like [Nicotiana 
sylvestris]
Length=526

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 124/165 (75%), Gaps = 6/165 (4%)
 Frame = -3

Query  917  IIKMANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWN  738
            I KM   K F+LLEI IISAQDLEP +K  M+TY TAW++P RK TT +D EGG+NP WN
Sbjct  4    ISKMGMLKSFQLLEINIISAQDLEPTSK-KMKTYATAWVHPTRKLTTGVDVEGGNNPTWN  62

Query  737  DKFVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHH-QNLGT  561
            DKFVF+VDE FLRQ+TSA+  EI+ + W  DSL+GTVR+LV NLIPP     HH  +LG 
Sbjct  63   DKFVFRVDEEFLRQDTSAVHIEIFSVHWFRDSLVGTVRVLVRNLIPPIRAHGHHNHHLGM  122

Query  560  RFAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
            RF A+Q+RRPSGRPQGILNIGVA+LDGS RS PL R     A GY
Sbjct  123  RFVALQIRRPSGRPQGILNIGVALLDGSMRSMPLYRQMSTSAVGY  167



>ref|XP_004247791.2| PREDICTED: uncharacterized protein LOC101245204 [Solanum lycopersicum]
Length=521

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 125/164 (76%), Gaps = 8/164 (5%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M   KPF+LLEI IISAQDLEP +K  M+TY T W++P RK TT +D EGG+NP WNDKF
Sbjct  1    MGILKPFQLLEINIISAQDLEPVSK-KMKTYATVWVHPTRKLTTAVDIEGGNNPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPP--NHH-QNLGTR  558
            VF+VDE FLRQ+TSA++ EI+   W  DSL+G+VR+LVGNLIP PS    NHH  NLG R
Sbjct  60   VFRVDEEFLRQDTSAVQIEIHCGHWFKDSLVGSVRVLVGNLIPSPSRTHHNHHPHNLGMR  119

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTP----LDRYAAGY  438
            F A+QVRRPSGRPQGILNIGVA+LD + RS P    L++ A GY
Sbjct  120  FVALQVRRPSGRPQGILNIGVALLDSTMRSMPLYTELNKSAVGY  163



>ref|XP_006342681.1| PREDICTED: uncharacterized protein LOC102596842 [Solanum tuberosum]
Length=528

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 126/163 (77%), Gaps = 6/163 (4%)
 Frame = -3

Query  911  KMANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDK  732
            KM   KPF+LLE+ IISAQDLEP +K  M+TY +AW++P RK TT +DTEGG+NP WNDK
Sbjct  4    KMGALKPFQLLEVNIISAQDLEPISK-KMKTYASAWVHPTRKLTTGVDTEGGNNPTWNDK  62

Query  731  FVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRF  555
            FVF+VD+ FL+Q+TSAI+ +I+ + W  DSL+G+VR+LVGNLIPPP+   H Q ++G RF
Sbjct  63   FVFRVDDEFLQQDTSAIQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIGMRF  122

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
             A+Q+RRPSGRPQGILNIGV +L G+ RS  L R     A GY
Sbjct  123  VALQIRRPSGRPQGILNIGVTLLGGTMRSMQLYRQLSMSAVGY  165



>ref|XP_011091348.1| PREDICTED: uncharacterized protein LOC105171810 [Sesamum indicum]
Length=545

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 122/162 (75%), Gaps = 5/162 (3%)
 Frame = -3

Query  911  KMANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDK  732
            KMA  KPF+LLEI IISAQDLEP +K  MRTY TAW++P RK ++ +D EG ++P WNDK
Sbjct  34   KMAPEKPFQLLEINIISAQDLEPVSK-KMRTYATAWLHPNRKLSSCVDAEGNNSPTWNDK  92

Query  731  FVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFA  552
            FVFKV+E FLR++TSA+  EIY   WL D+L+GTVR+LVGNLIP  +    H + G RF 
Sbjct  93   FVFKVEEEFLRRDTSAVMIEIYAKQWLRDTLVGTVRVLVGNLIPSSTRTLGHHHFGMRFV  152

Query  551  AVQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
            A+QVRRPSGRPQGILNIGVA+LD S RS PL R     A GY
Sbjct  153  ALQVRRPSGRPQGILNIGVALLDSSMRSMPLYRQLSASAVGY  194



>gb|EYU43768.1| hypothetical protein MIMGU_mgv1a006114mg [Erythranthe guttata]
Length=456

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 119/155 (77%), Gaps = 4/155 (3%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            MA +KPF+LLEI IISAQDLEP ++  MRTY TAW++ +RK ++ +D EG +NP WNDKF
Sbjct  1    MAPSKPFQLLEINIISAQDLEPVSR-KMRTYATAWMHQSRKLSSCVDNEGKTNPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNL---GTR  558
            VF+VD+ FLRQ+TSAI  EIY   W  D L+GTVR+LVGNLIPPP+  +   N    G R
Sbjct  60   VFRVDDEFLRQDTSAIMIEIYATHWFRDVLVGTVRVLVGNLIPPPTRTHQQTNHYTGGMR  119

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPLDR  453
            F A+QVRRPSGRPQGILNIGVA+LD S RS PL R
Sbjct  120  FVALQVRRPSGRPQGILNIGVALLDSSMRSMPLYR  154



>ref|XP_011073723.1| PREDICTED: uncharacterized protein LOC105158612 [Sesamum indicum]
Length=505

 Score =   201 bits (510),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 120/161 (75%), Gaps = 11/161 (7%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            KPF+LLEI IIS QDLEP A+  MRTY  AW++P RK ++ +D EG +NP WNDKFVF+V
Sbjct  6    KPFQLLEINIISGQDLEPVAR-KMRTYAKAWVHPNRKLSSCVDKEGNNNPTWNDKFVFRV  64

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN----LGTRFAA  549
            +E FLR+++SA+  EIY   WL D L+GTVR+LVGNLIPPP     HQN    +G RF A
Sbjct  65   EEEFLREDSSAVMIEIYSAHWLRDVLVGTVRVLVGNLIPPPV--RTHQNNSHYMGMRFVA  122

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
            +QVRRPSGRPQGILNIGVA+LDGS RS PL R     A GY
Sbjct  123  LQVRRPSGRPQGILNIGVALLDGSLRSMPLYRQLSSSAVGY  163



>ref|XP_004253020.1| PREDICTED: uncharacterized protein LOC101244358 [Solanum lycopersicum]
Length=534

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 125/163 (77%), Gaps = 6/163 (4%)
 Frame = -3

Query  911  KMANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDK  732
            KM   KPF+LLE+ IISAQDLEP +K  M+TY +AW++P RK TT +D +GG+NP WNDK
Sbjct  4    KMGALKPFQLLEVNIISAQDLEPISK-KMKTYASAWVHPTRKLTTGVDNDGGNNPTWNDK  62

Query  731  FVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRF  555
            FVF+VD+ FL+Q+TSA++ +I+ + W  DSL+G+VR+LVGNLIPPP+   H Q ++G RF
Sbjct  63   FVFRVDDEFLQQDTSAVQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIGMRF  122

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
             A+Q+RRPSGRPQGILNIGV +L G+ RS  L R     A GY
Sbjct  123  VALQIRRPSGRPQGILNIGVTLLGGTMRSMQLYRQLSMSAVGY  165



>emb|CDO99320.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -3

Query  902  NTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            N K F+LLEI +ISAQDLEP ++  M+TY TAW+N +RK ++ +D+ G  NP WNDKFVF
Sbjct  4    NLKAFQLLEINVISAQDLEPVSR-KMKTYATAWVNSSRKLSSRVDSGGHVNPTWNDKFVF  62

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
            +VDE FLRQ+TSA++ EI+ + W  D+L+GTVR+LVGNLIPP     HH ++G RF A+Q
Sbjct  63   RVDEDFLRQDTSAVQIEIHAVHWFKDTLVGTVRVLVGNLIPPLLRSRHHNHIGMRFVALQ  122

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            VRRPSGRPQGILNIGV +LD S RS PL
Sbjct  123  VRRPSGRPQGILNIGVTLLDSSMRSMPL  150



>ref|XP_004234051.1| PREDICTED: uncharacterized protein LOC101265801 [Solanum lycopersicum]
Length=485

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            KPF+LLEI IISAQDLEP +K  ++TY  AW++P RK  T +D  GG NP WNDKFVF+V
Sbjct  13   KPFQLLEINIISAQDLEPMSK-KLKTYAAAWVHPTRKLATGVDVNGGHNPTWNDKFVFRV  71

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            DE FLR E SA+  EIY + W  DSL+GTVR+LVGNLIPP        + G RF A+Q+R
Sbjct  72   DEEFLRHENSAVHIEIYSVHWFRDSLVGTVRVLVGNLIPPIRTHLRTHHHGMRFVALQIR  131

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPLDR  453
            RPSGRPQGILNIGV++LD S RS PL R
Sbjct  132  RPSGRPQGILNIGVSLLDSSMRSMPLYR  159



>ref|XP_008224037.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103323799 
[Prunus mume]
Length=516

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P ++ +MRTY  AW++P RK +T +DT+G SNP WNDKFVF+VD
Sbjct  8    PFQLLELNVISAQDLAPISR-SMRTYAIAWVHPDRKLSTRVDTQGHSNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFAAVQVR  537
            E FL ++TSA+  EIY + W  D  +GTVR+LVGNLIP P+ P+HH   LG RF A+QVR
Sbjct  67   EDFLHEDTSAVMIEIYALHWFKDVHVGTVRVLVGNLIPTPAKPHHHNPQLGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILNIGVA+L  S RS PL
Sbjct  127  RPSGRPQGILNIGVALLHSSMRSMPL  152



>ref|XP_006356117.1| PREDICTED: uncharacterized protein LOC102592369 [Solanum tuberosum]
Length=482

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            KPF+LLEI IISAQDLEP +K  M+TY  AW++P RK  T +D EGG NP WNDKFVF+V
Sbjct  13   KPFQLLEINIISAQDLEPMSK-KMKTYAAAWVHPTRKLATGVDVEGGHNPTWNDKFVFRV  71

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            D+ FLR + SA+  EIY + W  D+L+GTVR+LVGNLIPP        + G RF A+QVR
Sbjct  72   DDEFLRHDNSAVHIEIYSVHWFRDTLVGTVRVLVGNLIPPIRTHLRTHHHGMRFIALQVR  131

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPLDR  453
            RPSGRPQGILNIGV++LD S RS PL R
Sbjct  132  RPSGRPQGILNIGVSLLDSSMRSMPLYR  159



>ref|XP_007226487.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
 gb|EMJ27686.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
Length=492

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 115/146 (79%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P ++ +MRTY  AW++P RK +T +DT+G +NP WNDKFVF+VD
Sbjct  8    PFQLLELNVISAQDLAPISR-SMRTYAIAWVHPDRKLSTRVDTQGHNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFAAVQVR  537
            E FL ++TSA+  EIY + W  D  +GTVR+LVGNLIP P+ P+HH  +LG RF A+QVR
Sbjct  67   EDFLHEDTSAVMIEIYALHWFKDVHVGTVRVLVGNLIPTPAKPHHHNPHLGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILNIGVA+L  S RS PL
Sbjct  127  RPSGRPQGILNIGVALLHSSMRSMPL  152



>gb|EPS62035.1| hypothetical protein M569_12761, partial [Genlisea aurea]
Length=167

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 112/148 (76%), Gaps = 3/148 (2%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            KPF LLEI +ISAQ+LEP  K  M+TY TAW++P RK +T +D +G ++P WNDKFVFKV
Sbjct  6    KPFHLLEINVISAQELEPVRK-KMQTYATAWVHPQRKLSTSVDNDGNTSPTWNDKFVFKV  64

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPP--SPPNHHQNLGTRFAAVQ  543
            DE FLR +TSA+  EI    W  D ++G+VR+++GNLIPP   +   HH  +G +F A+Q
Sbjct  65   DEDFLRNDTSAVSIEILAEHWFTDIVVGSVRIIIGNLIPPHVWTDRRHHHRIGMQFIALQ  124

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            VRRPSGRPQGILNIGVAVL+G+ RS PL
Sbjct  125  VRRPSGRPQGILNIGVAVLNGTMRSMPL  152



>gb|KCW57324.1| hypothetical protein EUGRSUZ_H00123 [Eucalyptus grandis]
Length=462

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL   ++ +MR+Y   W++P RK +T +DT G  NP WNDKFVF+VD
Sbjct  8    PFQLLEVNIISAQDLRSVSR-SMRSYAVVWVHPDRKLSTRVDTRGRRNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFAAVQVR  537
            E FLR +TSA+  EIY + W  D L+GT+RLLV NL+PPPS P  HQ ++G RF A+QVR
Sbjct  67   EEFLRCDTSAVMIEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILN+GVA+LD S RS PL
Sbjct  127  RPSGRPQGILNVGVALLDSSMRSMPL  152



>ref|XP_010025827.1| PREDICTED: uncharacterized protein LOC104416087 [Eucalyptus grandis]
Length=481

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL   ++ +MR+Y   W++P RK +T +DT G  NP WNDKFVF+VD
Sbjct  8    PFQLLEVNIISAQDLRSVSR-SMRSYAVVWVHPDRKLSTRVDTRGRRNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFAAVQVR  537
            E FLR +TSA+  EIY + W  D L+GT+RLLV NL+PPPS P  HQ ++G RF A+QVR
Sbjct  67   EEFLRCDTSAVMIEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILN+GVA+LD S RS PL
Sbjct  127  RPSGRPQGILNVGVALLDSSMRSMPL  152



>ref|XP_009767920.1| PREDICTED: uncharacterized protein LOC104218993 [Nicotiana sylvestris]
Length=520

 Score =   193 bits (490),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 124/163 (76%), Gaps = 7/163 (4%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M   KPF+LLEI IISAQDL+P +K  M+TY T W++P RK TT +D EGG+NP WNDKF
Sbjct  1    MGALKPFQLLEINIISAQDLQPISK-KMKTYATVWVHPTRKLTTAVDVEGGNNPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLI--PPPSPPNHHQNLGTRF  555
            VF+VDE FLRQ+TSA++ EI+ + W  DSL+G+VR+LVGNLI  PP    NHH + G RF
Sbjct  60   VFRVDEEFLRQDTSAVQIEIHCVHWFKDSLVGSVRVLVGNLIPPPPRPHHNHHHHFGMRF  119

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTP----LDRYAAGY  438
             A+QVRRPSGRPQGILNIGVA+LD + RS P    L++ A GY
Sbjct  120  VALQVRRPSGRPQGILNIGVALLDSTMRSMPLYTELNKSAVGY  162



>ref|XP_002311697.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE89064.2| C2 domain-containing family protein [Populus trichocarpa]
Length=492

 Score =   192 bits (488),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL  K    M+TY  AWI+P RK +T +D+EG +NP WNDKFVF+VD
Sbjct  8    PFQLLELNVISAQDL-AKVSRKMKTYAVAWIHPDRKLSTRIDSEGRNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFAAVQVR  537
            + FL  +TSA+  EIY + W  D  +GTVR++VGNLIPPP P +H+Q  +G RF A+QVR
Sbjct  67   DRFLHGDTSAVMIEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILNIGVA+LD S RS PL
Sbjct  127  RPSGRPQGILNIGVALLDSSMRSMPL  152



>ref|XP_009590587.1| PREDICTED: ankyrin repeat-containing protein kinase A-like [Nicotiana 
tomentosiformis]
Length=535

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 124/163 (76%), Gaps = 7/163 (4%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M   KPF+LLEI IISAQDL+P +K  M+TY T W++P RK TT +D EGG+NP WNDKF
Sbjct  1    MGALKPFQLLEINIISAQDLQPISK-KMKTYATVWVHPTRKLTTAVDVEGGNNPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLI--PPPSPPNHHQNLGTRF  555
            VF+VDE FLRQ+TSA++ EI+ + W  DS++G+VR+LVGNLI  PP    NHH + G RF
Sbjct  60   VFRVDEEFLRQDTSAVQIEIHCVHWFKDSVVGSVRVLVGNLIPPPPRPHHNHHHHFGMRF  119

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTP----LDRYAAGY  438
             A+QVRRPSGRPQGILNIGVA+LD + RS P    L++ A GY
Sbjct  120  VALQVRRPSGRPQGILNIGVALLDSTMRSMPLYTELNKSAVGY  162



>ref|XP_002314508.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF00679.1| C2 domain-containing family protein [Populus trichocarpa]
Length=460

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL  K    M+TY  AW++P R+ +T +D+EG +NP WNDKFVF+VD
Sbjct  8    PFQLLELNVISAQDL-VKVSRKMKTYAVAWVHPDRRLSTRVDSEGCNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFAAVQVR  537
            + FL  +TSA+  EIY + W  D  IGTVR++VGNLIPPP P +H+Q  LG RF A+QVR
Sbjct  67   DRFLHGDTSAVMIEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILNIGVA+LD S RS PL
Sbjct  127  RPSGRPQGILNIGVALLDSSMRSMPL  152



>ref|XP_011029742.1| PREDICTED: uncharacterized protein LOC105129399 [Populus euphratica]
Length=492

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL  K    M+TY  AWI+P RK +T +D+EG +NP WNDKFVF+VD
Sbjct  8    PFQLLELNVISAQDL-AKVSRKMKTYAVAWIHPDRKLSTRIDSEGRNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFAAVQVR  537
            + FL  +TSA+  EIY + W  D  +GTVR++VGNLIPPP P +H+Q  +G RF A+QVR
Sbjct  67   DRFLHGDTSAVMIEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRP+GILNIGVA+LD S RS PL
Sbjct  127  RPSGRPKGILNIGVALLDSSMRSMPL  152



>ref|XP_004297932.1| PREDICTED: uncharacterized protein LOC101311957 [Fragaria vesca 
subsp. vesca]
Length=519

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 118/162 (73%), Gaps = 6/162 (4%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   PF+LLE+ +ISAQDL P ++ +MRTY  AW++P RK +T +DT G +NP WNDKF
Sbjct  1    MSILAPFQLLELNVISAQDLAPVSR-SMRTYAIAWVHPDRKLSTRVDTHGHNNPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFA  552
            VF+VDE FL ++TSA+  EIY + W  D  +GT+R+LVGNLI  P+ P+HH   LG RF 
Sbjct  60   VFRVDEDFLHEDTSAVMIEIYALHWFKDVHVGTIRVLVGNLIQTPAKPHHHHPQLGMRFV  119

Query  551  AVQVRRPSGRPQGILNIGVAVLDGSKRSTP----LDRYAAGY  438
            A+QVRRPSGRPQGILNIGVA+L  S RS P    L+  A GY
Sbjct  120  ALQVRRPSGRPQGILNIGVALLHSSMRSMPLYSQLNSSAVGY  161



>ref|XP_006489752.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=510

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL P ++ +MRTY  AW++P RK +T +D  G +NP WNDKFVF+VD
Sbjct  8    PFQLLELNIISAQDLAPVSR-SMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNH--HQNLGTRFAAVQV  540
            E FL  +TSA+  EI+ + W  D  +GTVR+LVGNLIPPP+   H  H++ G RF A+QV
Sbjct  67   EDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQV  126

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL  459
            RRPSGRPQGILNIGVA+LD S RS PL
Sbjct  127  RRPSGRPQGILNIGVALLDSSMRSMPL  153



>ref|XP_011041447.1| PREDICTED: uncharacterized protein LOC105137420 [Populus euphratica]
Length=459

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL  K    M+TY  AW++P R+ +T + +EG +NP WNDKFVF+VD
Sbjct  8    PFQLLELNVISAQDL-VKVSRKMKTYAVAWVHPDRRLSTRVTSEGCNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFAAVQVR  537
            + FL  +TSA+  EIY + W  D  IGTVR++VGNLIPPP P +H+Q  LG RF A+QVR
Sbjct  67   DRFLHGDTSAVMIEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILNIGVA+LD S RS PL
Sbjct  127  RPSGRPQGILNIGVALLDSSMRSMPL  152



>gb|KDO41882.1| hypothetical protein CISIN_1g041258mg [Citrus sinensis]
Length=510

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL P ++ +MRTY  AW++P RK +T +D  G +NP WNDKFVF+VD
Sbjct  8    PFQLLELNIISAQDLAPVSR-SMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNH--HQNLGTRFAAVQV  540
            E FL  +TSA+  EI+ + W  D  +GTVR+LVGNLIPPP+   H  H++ G RF A+QV
Sbjct  67   EDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQV  126

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL  459
            RRPSGRPQGILNIGVA+LD S RS PL
Sbjct  127  RRPSGRPQGILNIGVALLDSSMRSMPL  153



>ref|XP_003535258.1| PREDICTED: uncharacterized protein LOC100787698 [Glycine max]
Length=657

 Score =   190 bits (483),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 115/157 (73%), Gaps = 6/157 (4%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P ++ NMRTY  +W++P RK +T +DTEG ++P WNDKFVF+VD
Sbjct  7    PFQLLELNVISAQDLAPVSR-NMRTYAVSWVHPERKLSTRVDTEGHTHPTWNDKFVFRVD  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--LGTRFAAVQV  540
            E FL  +TSAI  EIY + W  D  +GTVR+LVGNL PPPS P H+    LG RF A+Q+
Sbjct  66   EEFLYSDTSAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPSKPFHNNRTPLGMRFVALQM  125

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL---DRYAAGY  438
            RRPSGRPQGILNIG  VLD S RS PL   +  A GY
Sbjct  126  RRPSGRPQGILNIGFTVLDSSMRSMPLYTHNASAVGY  162



>ref|XP_007144140.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
 gb|ESW16134.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
Length=736

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 116/157 (74%), Gaps = 6/157 (4%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P ++ NMRTY  +W++P RK +T +DT+G ++P WNDKFVF+VD
Sbjct  7    PFQLLELNVISAQDLAPVSR-NMRTYAVSWVHPDRKLSTRVDTQGHTHPTWNDKFVFRVD  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--LGTRFAAVQV  540
            + FL  +TS+I  EIY + W  D  +GTVR+L+GNL PPPS P H     LGTRFAAVQV
Sbjct  66   DEFLCSDTSSIMIEIYALHWFKDIHVGTVRVLIGNLAPPPSRPFHSNRTPLGTRFAAVQV  125

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL---DRYAAGY  438
            RRPSGRPQGILNIG  VLDGS  S PL   +  A GY
Sbjct  126  RRPSGRPQGILNIGFTVLDGSMHSMPLYTHNASAVGY  162



>ref|XP_003555498.1| PREDICTED: uncharacterized protein LOC100812185 [Glycine max]
Length=642

 Score =   190 bits (482),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 114/157 (73%), Gaps = 6/157 (4%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P  + NMRTY  +W++P RK +T +D+EG +NP WNDKFVF+VD
Sbjct  7    PFQLLELNVISAQDLAPLGR-NMRTYAVSWVHPDRKLSTRVDSEGHTNPTWNDKFVFRVD  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--LGTRFAAVQV  540
            E FL  +TSAI  EIY + W  D  +GTVR+LVGNL PPPS P H+    LG RF A+QV
Sbjct  66   EEFLYSDTSAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPSKPFHNNRTPLGMRFIALQV  125

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL---DRYAAGY  438
            RRPSGRPQGILNIG  VLD S RS PL   +  A GY
Sbjct  126  RRPSGRPQGILNIGFTVLDSSMRSMPLYTHNASAVGY  162



>ref|XP_010667096.1| PREDICTED: uncharacterized protein LOC104884184 [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score =   186 bits (472),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 112/156 (72%), Gaps = 5/156 (3%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLEI IIS QD+  K   +M+TY  AW++P RK TT +D+ GG+NP WNDKFVF+VD
Sbjct  3    PFQLLEINIISGQDIH-KVSRSMKTYAVAWVHPDRKLTTRVDSNGGTNPTWNDKFVFRVD  61

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
              FL+ +TSAI  EIY + W  D  +GTVR+LVGNLIPP +   +  ++G RF A+QVRR
Sbjct  62   NRFLQSDTSAIMIEIYALHWFRDVHVGTVRVLVGNLIPPQTRSFNQNHIGMRFVALQVRR  121

Query  533  PSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
            PSGRPQGILN+GV VLD + RS PL R     A GY
Sbjct  122  PSGRPQGILNVGVTVLDSTMRSMPLYRQLSTSAVGY  157



>ref|XP_003590735.1| RNA-binding protein 12B [Medicago truncatula]
 gb|AES60986.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=682

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 115/157 (73%), Gaps = 6/157 (4%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL    + NMRTY  AW++P RK +T +DT+G +NP WNDKFVF+VD
Sbjct  7    PFQLLELNVISAQDLASLGR-NMRTYAVAWVHPDRKLSTRVDTQGHTNPTWNDKFVFRVD  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--LGTRFAAVQV  540
            E FL  +TSAI  E+Y + W  D  +GTVR+LVGNLIPPP+ P H+    +G RF A+QV
Sbjct  66   EEFLYSDTSAIMVEVYALHWFKDIHVGTVRVLVGNLIPPPTRPFHNDRAPMGMRFVALQV  125

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTP---LDRYAAGY  438
            RRPSGRPQGILNIGV VLD S RS P   L+  A GY
Sbjct  126  RRPSGRPQGILNIGVTVLDSSMRSMPLYTLNASAVGY  162



>ref|XP_006420366.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
 gb|ESR33606.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
Length=497

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL P ++ +MR Y  AW++P RK +T +D  G +NP WNDKFVF+VD
Sbjct  8    PFQLLELNIISAQDLAPVSR-SMRAYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNH--HQNLGTRFAAVQV  540
            E FL  +TSA+  EI+ + W  D  +GTVR+LVGNLIPPP+   H  H++ G RF A+QV
Sbjct  67   EDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQV  126

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL  459
            RRPSGRPQGILNIGVA+LD S RS PL
Sbjct  127  RRPSGRPQGILNIGVALLDSSMRSMPL  153



>emb|CBI23723.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+  +P +LLEI +ISAQDL P  + +MRTY  AW++P RK +T +D+ G ++P WNDKF
Sbjct  1    MSRLRPLQLLEINLISAQDLAPVGR-SMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF+VD+ FLR +TSA+  +IY   W  D  +GTVR+LVGNLIPP   P H   +G RF A
Sbjct  60   VFRVDDEFLRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPPSVRPGHRTQMGMRFMA  119

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRY  450
            +QVRR SGRPQG+LNIGVA+LD S RS PL ++
Sbjct  120  LQVRRSSGRPQGLLNIGVALLDSSMRSMPLYKF  152



>ref|XP_009357966.1| PREDICTED: uncharacterized protein LOC103948651 [Pyrus x bretschneideri]
Length=533

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P ++ +MRTY  AW++P RK +T +DT G +NP WNDKFVF+VD
Sbjct  8    PFQLLELNVISAQDLAPISR-SMRTYAVAWVHPDRKLSTRVDTLGHNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-NLGTRFAAVQVR  537
            E FL  +TSA+  EIY + W  D  +GTVR+LVGNLI  P  P+HH   +G RF A+QVR
Sbjct  67   EDFLHDDTSAVMIEIYVLHWFKDVHVGTVRVLVGNLIQTPMRPHHHHPQVGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILNIGVA+L  S RS PL
Sbjct  127  RPSGRPQGILNIGVALLHSSMRSMPL  152



>ref|XP_010105208.1| hypothetical protein L484_011265 [Morus notabilis]
 gb|EXC04073.1| hypothetical protein L484_011265 [Morus notabilis]
Length=589

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 117/170 (69%), Gaps = 14/170 (8%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            MA   PF+LLE+ +ISAQDL P ++ +MRTY  AW++P RK +T +DT G +NP WNDKF
Sbjct  1    MAILNPFQLLELNVISAQDLAPVSR-SMRTYAVAWVHPDRKLSTRVDTYGHTNPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPP---------NHH  576
            VF+VDE FL  +TSAI  EIY + W  D  +GTVR+LVGNLIPPP            N++
Sbjct  60   VFRVDEDFLHTDTSAIMIEIYALHWFKDVHVGTVRILVGNLIPPPRAGSSFGHGHSHNNY  119

Query  575  QNLGTRFAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
              LG RF A+QVRRPSGRPQGILNIGVA+L  + RS PL  +    A GY
Sbjct  120  NQLGMRFVALQVRRPSGRPQGILNIGVAILHSAMRSMPLYSHLSNSAVGY  169



>ref|XP_002282144.1| PREDICTED: uncharacterized protein LOC100256206 [Vitis vinifera]
Length=494

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+  +P +LLEI +ISAQDL P  + +MRTY  AW++P RK +T +D+ G ++P WNDKF
Sbjct  1    MSRLRPLQLLEINLISAQDLAPVGR-SMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF+VD+ FLR +TSA+  +IY   W  D  +GTVR+LVGNLIPP   P H   +G RF A
Sbjct  60   VFRVDDEFLRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPPSVRPGHRTQMGMRFMA  119

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +QVRR SGRPQG+LNIGVA+LD S RS PL
Sbjct  120  LQVRRSSGRPQGLLNIGVALLDSSMRSMPL  149



>emb|CAN83108.1| hypothetical protein VITISV_026570 [Vitis vinifera]
Length=494

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+  +P +LLEI +ISAQDL P  + +MRTY  AW++P RK +T +D+ G ++P WNDKF
Sbjct  1    MSRLRPLQLLEINLISAQDLAPVGR-SMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF+VD+ FLR +TSA+  +IY   W  D  +GTVR+LVGNLIPP   P H   +G RF A
Sbjct  60   VFRVDDEFLRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPPSVRPGHRTQMGMRFMA  119

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +QVRR SGRPQG+LNIGVA+LD S RS PL
Sbjct  120  LQVRRSSGRPQGLLNIGVALLDSSMRSMPL  149



>ref|XP_004495257.1| PREDICTED: proteoglycan 4-like [Cicer arietinum]
Length=713

 Score =   186 bits (471),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 113/157 (72%), Gaps = 6/157 (4%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL    + NMRTY  AW++P RK +T +DT+G +NP WNDKFVF+VD
Sbjct  7    PFQLLELNVISAQDLASVGR-NMRTYAVAWVHPDRKLSTRVDTQGHTNPTWNDKFVFRVD  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--LGTRFAAVQV  540
            + FL  +TSA   EIY + W  D  +GTVR+LVGNLI PPS P H  N  +G RF A+QV
Sbjct  66   DEFLYNDTSAFMIEIYALHWFKDIHVGTVRVLVGNLITPPSRPFHKDNAPIGMRFVALQV  125

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL---DRYAAGY  438
            RRPSGRPQGILNIGV VLD S RS PL   +  A GY
Sbjct  126  RRPSGRPQGILNIGVTVLDSSMRSMPLYTHNASAVGY  162



>ref|XP_007035276.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOY06202.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=480

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 109/148 (74%), Gaps = 3/148 (2%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDLEP ++  MRTY  AW++P RK +T +D  G +NP WNDKFVF+VD
Sbjct  9    PFQLLELNVISAQDLEPVSRRKMRTYAVAWVHPQRKLSTRIDNLGHTNPTWNDKFVFRVD  68

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPP-SPPNHHQ--NLGTRFAAVQ  543
            + FL  +TSA+  E+Y + W  D  +GTVR++VGNLI PP S P H     +G RF A+Q
Sbjct  69   DEFLHGDTSAVMIELYAVHWFRDIHVGTVRVIVGNLISPPTSRPRHRHEVQIGMRFVALQ  128

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            V RPSGRPQGILNIGVA+LD S RS PL
Sbjct  129  VWRPSGRPQGILNIGVALLDSSMRSMPL  156



>ref|XP_008340669.1| PREDICTED: uncharacterized protein LOC103403599 [Malus domestica]
Length=533

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P ++ +MRTY  AW++P RK +T +DT G +NP WNDKFVF+VD
Sbjct  8    PFQLLELNVISAQDLAPISR-SMRTYAIAWVHPDRKLSTRVDTSGHNNPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPP-NHHQNLGTRFAAVQVR  537
            E FL  +TSA+  EIY + W  D  +GTVR+LVGNLI   + P +HH  +G RF A+QVR
Sbjct  67   EDFLHDDTSAVMIEIYVLHWFKDVHVGTVRVLVGNLIQTSTRPYHHHPQVGMRFVALQVR  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILNIGVA+L  S RS PL
Sbjct  127  RPSGRPQGILNIGVALLHSSMRSMPL  152



>ref|XP_008460692.1| PREDICTED: uncharacterized protein LOC103499460 [Cucumis melo]
Length=561

 Score =   183 bits (465),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 113/155 (73%), Gaps = 8/155 (5%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   PF+LLE+ +ISAQDL P ++ +MRTY  AW++P RK +T +DT G +NP WNDKF
Sbjct  1    MSILNPFQLLELNVISAQDLAPVSR-SMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-----NLG  564
            VF+VD+ FL  +TSA+  EIY + W  D  +GTVR+LVGNLI  P+PP  HQ      +G
Sbjct  60   VFRVDDEFLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLI--PTPPRLHQFSQQPQVG  117

Query  563  TRFAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
             RF A+QVRRPSGRPQGILNIGVA+L  S RS PL
Sbjct  118  MRFVALQVRRPSGRPQGILNIGVALLHSSMRSMPL  152



>ref|XP_004173200.1| PREDICTED: uncharacterized LOC101215059 [Cucumis sativus]
Length=533

 Score =   182 bits (462),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 111/150 (74%), Gaps = 8/150 (5%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P ++ +MRTY  AW++P RK +T +DT G +NP WNDKFVF+VD
Sbjct  6    PFQLLELNVISAQDLAPVSR-SMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVD  64

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-----NLGTRFAA  549
            + FL  +TSA+  EIY + W  D  +GTVR+LVGNLI  P+PP  HQ      +G RF A
Sbjct  65   DEFLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLI--PTPPRLHQFSQQPQVGMRFVA  122

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +QVRRPSGRPQGILNIGVA+L  S RS PL
Sbjct  123  LQVRRPSGRPQGILNIGVALLHSSMRSMPL  152



>ref|XP_004147189.1| PREDICTED: uncharacterized protein LOC101215059 [Cucumis sativus]
 gb|KGN61560.1| hypothetical protein Csa_2G171820 [Cucumis sativus]
Length=561

 Score =   182 bits (463),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 111/150 (74%), Gaps = 8/150 (5%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P ++ +MRTY  AW++P RK +T +DT G +NP WNDKFVF+VD
Sbjct  6    PFQLLELNVISAQDLAPVSR-SMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVD  64

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQ-----NLGTRFAA  549
            + FL  +TSA+  EIY + W  D  +GTVR+LVGNLI  P+PP  HQ      +G RF A
Sbjct  65   DEFLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLI--PTPPRLHQFSQQPQVGMRFVA  122

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +QVRRPSGRPQGILNIGVA+L  S RS PL
Sbjct  123  LQVRRPSGRPQGILNIGVALLHSSMRSMPL  152



>ref|XP_002528347.1| hypothetical protein RCOM_1217340 [Ricinus communis]
 gb|EEF34019.1| hypothetical protein RCOM_1217340 [Ricinus communis]
Length=472

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 105/149 (70%), Gaps = 5/149 (3%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +IS QDL  +    MRTY  AW++P RK +T +D +G +NP WNDKFVF+VD
Sbjct  9    PFQLLELNVISGQDL-AQVSRKMRTYAVAWVHPDRKLSTRVDAQGHNNPTWNDKFVFRVD  67

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPP----SPPNHHQNLGTRFAAV  546
            + FL  ETSAI  EIY + W  D  +GTVR++VGNLIPP         HH  LG RF A+
Sbjct  68   DEFLYGETSAIMIEIYALHWFRDVHVGTVRVIVGNLIPPAQLYRQHQQHHVQLGMRFVAL  127

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            QVRR SGRPQGILNIGVA+LD S RS PL
Sbjct  128  QVRRHSGRPQGILNIGVALLDTSMRSMPL  156



>gb|KDP33324.1| hypothetical protein JCGZ_12873 [Jatropha curcas]
Length=446

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            +PF+LLE+ +IS QDL  +    MRTY  AW++P RK +T LD    +NP WNDKFVF+V
Sbjct  7    QPFQLLELNVISGQDL-AQVSRKMRTYAVAWVHPERKLSTRLDIYSHNNPTWNDKFVFRV  65

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---LGTRFAAV  546
            D+ FL +ETSAI  EIY ++W  D  +GTVR++VGNLIPP     H ++   LG RF A+
Sbjct  66   DDEFLYRETSAIMVEIYAVSWFRDIHVGTVRVIVGNLIPPAEHKKHQKHGVQLGMRFVAL  125

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            QVRR SGRPQGILNIGVA LD S++S PL
Sbjct  126  QVRRRSGRPQGILNIGVAFLDASRKSMPL  154



>gb|KFK31057.1| hypothetical protein AALP_AA6G062700 [Arabis alpina]
Length=367

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V E
Sbjct  7    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYSGGANPTWNDKFVFRVSE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GT+R+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVIEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGMLDGSMRSMPLYTNMDSSAVGY  168



>ref|XP_002521996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40400.1| conserved hypothetical protein [Ricinus communis]
Length=380

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = -3

Query  902  NTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            N  PF+LLEI +ISAQDL P +K +MRTY   W++P RK TT +D  G +NP WN+KFVF
Sbjct  4    NAHPFQLLEINVISAQDLAPVSK-SMRTYAVVWVHPERKLTTRVDQNGHTNPQWNEKFVF  62

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
            +VD+ FL  ETS+I  EIY   WL D  IG+VR+L+ NL P P+    + N   RF A+Q
Sbjct  63   RVDDTFLNSETSSIMIEIYAAAWLRDVQIGSVRVLISNLFPSPT----NNNSKMRFVALQ  118

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +RRPSGRPQGILN+GV +LD + RS PL
Sbjct  119  IRRPSGRPQGILNMGVQLLDNTMRSMPL  146



>ref|XP_010025828.1| PREDICTED: uncharacterized protein LOC104416088 [Eucalyptus grandis]
 gb|KCW57326.1| hypothetical protein EUGRSUZ_H00125 [Eucalyptus grandis]
Length=155

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 100/148 (68%), Gaps = 2/148 (1%)
 Frame = -3

Query  899  TKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFK  720
              P  LL+I IISAQDL      +MRTY  AW++P RK +T +DT G  NP WNDKFVF 
Sbjct  6    VNPSPLLKIDIISAQDLA-SVSHSMRTYAVAWVHPDRKFSTRVDTRGQCNPTWNDKFVFC  64

Query  719  VDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-PPNHHQNLGTRFAAVQ  543
            VD+ FLR+ETSA+  EIY + W  D LIGTVR+LV N  PP S P    Q +G R  A+Q
Sbjct  65   VDQEFLRRETSAVMVEIYAVHWFRDVLIGTVRVLVSNFAPPSSWPFRRKQLIGMRVVALQ  124

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            VRRPSGRPQGILN+G  +LD S  S PL
Sbjct  125  VRRPSGRPQGILNVGGTLLDSSMGSKPL  152



>ref|XP_006293875.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
 gb|EOA26773.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
Length=597

 Score =   175 bits (443),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V E
Sbjct  7    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGY  168



>ref|NP_180890.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAB80650.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08815.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=602

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 108/163 (66%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG NP WNDKFVF+V E
Sbjct  7    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYTGGGNPTWNDKFVFRVSE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNL--------GTRF  555
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNEEYRRTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGY  168



>ref|XP_002881275.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57534.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=595

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V E
Sbjct  7    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GT+R+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGY  168



>ref|XP_006410470.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
 gb|ESQ51923.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
Length=597

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V E
Sbjct  7    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GT+R+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGY  168



>ref|XP_010413889.1| PREDICTED: uncharacterized protein LOC104700118 [Camelina sativa]
Length=596

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG NP WNDKFVF+V+E
Sbjct  7    FQLLELNIISAQDLAPLSR-KMKTYAVAWVHSERKLTTRVDYSGGVNPTWNDKFVFRVNE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGY  168



>ref|XP_010469493.1| PREDICTED: uncharacterized protein LOC104749540 [Camelina sativa]
Length=596

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG NP WNDKFVF+V+E
Sbjct  7    FQLLELNIISAQDLAPLSR-KMKTYAVAWVHSERKLTTRVDYTGGVNPTWNDKFVFRVNE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGY  168



>ref|XP_010509905.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Camelina 
sativa]
Length=596

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG NP WNDKFVF+V+E
Sbjct  7    FQLLELNIISAQDLAPLSR-KMKTYAVAWVHSERKLTTRVDYTGGVNPTWNDKFVFRVNE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGY  168



>emb|CDY37732.1| BnaA04g19360D [Brassica napus]
Length=611

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ +ISAQDL P ++  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V E
Sbjct  7    FQLLELNLISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSLPLYTNMDSSAVGY  168



>ref|XP_009141305.1| PREDICTED: uncharacterized protein LOC103865261 [Brassica rapa]
Length=611

 Score =   173 bits (438),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ +ISAQDL P ++  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V E
Sbjct  7    FQLLELNLISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSLPLYTNMDSSAVGY  168



>ref|XP_009119477.1| PREDICTED: uncharacterized protein LOC103844449 [Brassica rapa]
Length=561

 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 108/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D   G+NP WNDKFVF+VDE
Sbjct  8    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYHRTPPQGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV VLDGS RS PL    D  A GY
Sbjct  127  FVALQVRRASGRPQGILNIGVGVLDGSMRSMPLYTHMDSSAVGY  170



>emb|CDY53195.1| BnaAnng12200D [Brassica napus]
Length=593

 Score =   172 bits (437),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 109/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVAR-KMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV VLDGS RS PL    D  A GY
Sbjct  127  FVALQVRRTSGRPQGILNIGVGVLDGSMRSMPLYTHMDSSAVGY  170



>ref|XP_009118638.1| PREDICTED: uncharacterized protein LOC103843645 [Brassica rapa]
Length=593

 Score =   172 bits (437),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 109/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVAR-KMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV VLDGS RS PL    D  A GY
Sbjct  127  FVALQVRRTSGRPQGILNIGVGVLDGSMRSMPLYTHMDSSAVGY  170



>ref|XP_006303752.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
 gb|EOA36650.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
Length=600

 Score =   172 bits (436),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 109/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+   +TY  AW++P RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVAR-KTKTYAVAWVHPERKLTTRVDYNGGTNPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   DFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  127  FVALQVRRSSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGY  170



>emb|CDP04278.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 105/145 (72%), Gaps = 3/145 (2%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ +ISAQDL P ++ N+RTY  AW+NP RK  T +D +G +NP WNDKFVF+VD
Sbjct  5    PFQLLELNVISAQDLAPVSQ-NLRTYAVAWMNPERKLRTRVDQQGKTNPTWNDKFVFRVD  63

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            E FL  ETS++  E+Y I WL D+ +G+VR+L+ NLI  P       N   RF A+Q+RR
Sbjct  64   EKFLDSETSSVMIEVYAIGWLRDTPVGSVRVLISNLI--PQNVRKTNNSQRRFVALQIRR  121

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSGRPQGILN+GV +LD + +S PL
Sbjct  122  PSGRPQGILNMGVTLLDNNMKSMPL  146



>emb|CDY59181.1| BnaC08g50140D [Brassica napus]
Length=593

 Score =   172 bits (436),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 109/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVAR-KMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV VLDGS RS PL    D  A GY
Sbjct  127  FVALQVRRTSGRPQGILNIGVGVLDGSMRSMPLYTHMDSSAVGY  170



>emb|CDY18242.1| BnaC05g02650D [Brassica napus]
Length=410

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 101/144 (70%), Gaps = 9/144 (6%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D   G+NP WNDKFVF+VDE
Sbjct  8    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP        +   RF A+QVRR 
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPP--------SRRMRFVALQVRRA  118

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            SGRPQGILNIGV VLDGS RS PL
Sbjct  119  SGRPQGILNIGVGVLDGSMRSMPL  142



>ref|XP_010264865.1| PREDICTED: uncharacterized protein LOC104602763 [Nelumbo nucifera]
Length=418

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 103/145 (71%), Gaps = 2/145 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLEI +ISAQDL P  + +M TY  AW++P RK +T +DT G  +P WNDKFVF+VD
Sbjct  8    PFQLLEINVISAQDLAPVTR-SMHTYAVAWVDPERKLSTCVDTHGHVDPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            + FL  +TSA+  +I+ +    D  +GTVR+LVGNL  P S    HQ  G RF A+QVRR
Sbjct  67   DEFLHSDTSAVMIKIFALRPFRDVHVGTVRVLVGNLF-PLSSLRSHQRSGMRFVALQVRR  125

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSGRPQGILNIG A+LD S RS PL
Sbjct  126  PSGRPQGILNIGAALLDKSMRSMPL  150



>ref|XP_009143873.1| PREDICTED: uncharacterized protein LOC103867544 [Brassica rapa]
Length=561

 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 105/152 (69%), Gaps = 9/152 (6%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQ+L P ++  M+TY  AW++  RK TT +D  G +NP WNDKFVF+V E
Sbjct  7    FQLLELNIISAQELAPVSR-KMKTYAVAWVHSQRKLTTRVDYTGAANPTWNDKFVFRVSE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GT+R+L+ NLIPP   P +  N        LG RF
Sbjct  66   DFLYADTSAVVVEIYTLHWFRDVHVGTIRVLISNLIPPNRRPGYRSNEEYRHTPPLGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
             A+QVRRPSGRPQGILNIGV +LDGS RS PL
Sbjct  126  VALQVRRPSGRPQGILNIGVGILDGSMRSLPL  157



>ref|XP_006358324.1| PREDICTED: uncharacterized protein LOC102592049 [Solanum tuberosum]
Length=353

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 3/142 (2%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            +LEIT+ISAQDL P  K ++RTY   W+NP RK+TT +D  G +NP WNDKF F+VD+ F
Sbjct  37   ILEITLISAQDLSPVCK-SLRTYALTWVNPNRKRTTRVDNHGHNNPNWNDKFSFRVDDEF  95

Query  704  LRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSG  525
            L  ++SAI  EIY ++W  D L+GTV++++ NL+ P    N   N   +F A+Q+RRPSG
Sbjct  96   LSSDSSAIHVEIYTVSWFRDILVGTVKVILNNLVNPFE--NTSSNQSKKFVALQIRRPSG  153

Query  524  RPQGILNIGVAVLDGSKRSTPL  459
             PQGILN+GVAV+D SKRS PL
Sbjct  154  NPQGILNMGVAVIDKSKRSMPL  175



>ref|XP_010475114.1| PREDICTED: uncharacterized protein LOC104754591 [Camelina sativa]
Length=600

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 108/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+   +TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVAR-KTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  N          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  127  FVALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGY  170



>gb|KDP23730.1| hypothetical protein JCGZ_23563 [Jatropha curcas]
Length=375

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 104/148 (70%), Gaps = 6/148 (4%)
 Frame = -3

Query  902  NTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            N   F+LLEI +ISAQDL   +K +MRTY   W++P RK TT +D  G +NP WN+KFVF
Sbjct  4    NAHLFQLLEINVISAQDLATVSK-SMRTYAVVWVHPERKLTTRIDQNGHTNPQWNEKFVF  62

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
            +VD+AFL  ETSAI  EIY   WL D  IG+VR+LV NL      P+++ N   RF A+Q
Sbjct  63   RVDDAFLDSETSAIMIEIYAAAWLRDVQIGSVRVLVSNLF-----PSNNNNSKMRFVALQ  117

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +RRPSGRPQGILN+GV +LD + RS PL
Sbjct  118  IRRPSGRPQGILNMGVQLLDNTMRSMPL  145



>ref|XP_004494967.1| PREDICTED: uncharacterized protein LOC101508328 [Cicer arietinum]
Length=373

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            ++++ P++LLEI+IISAQDL P AK +++ Y  AW++P RK  T +D  G +NP WN+KF
Sbjct  4    LSSSSPYQLLEISIISAQDLPPVAK-SIKAYAVAWLHPERKLATQIDQVGHTNPTWNEKF  62

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF+VD+ FL  E S I  +IY  TW+ D LIGTV +LVGNL+PP +   + +    RF A
Sbjct  63   VFRVDDEFLNSENSVIMIDIYNSTWIRDVLIGTVGVLVGNLLPPGTRTGNRKP-KLRFVA  121

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +Q+R+PSGRPQGILNIGV VLD + RS PL
Sbjct  122  LQIRKPSGRPQGILNIGVTVLDSTMRSMPL  151



>ref|XP_003556915.1| PREDICTED: uncharacterized protein LOC100779058 [Glycine max]
Length=449

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 107/146 (73%), Gaps = 3/146 (2%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            ++LLE+ +ISAQDL P  + +MRTY  AWI+P RK +T +D++GG+NP WNDKFVF+VDE
Sbjct  8    YQLLELNVISAQDLAPVGR-SMRTYAIAWIDPDRKLSTRVDSQGGTNPTWNDKFVFRVDE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPP--NHHQNLGTRFAAVQVR  537
             FL  E S I  +IY + W  D  +G+ ++L G+L PPP+ P  N +++ G +F  +QV+
Sbjct  67   DFLYDEESVITIDIYALHWFRDIHVGSAQVLSGDLFPPPTQPQKNTYKSTGMQFMGLQVQ  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRP+GILNIG A++D S RS PL
Sbjct  127  RPSGRPKGILNIGAAIIDSSMRSMPL  152



>emb|CDY23753.1| BnaC04g43690D [Brassica napus]
Length=610

 Score =   169 bits (429),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 108/163 (66%), Gaps = 13/163 (8%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ +ISAQDL P ++  M+TY  AW++  RK TT +D  G +NP WNDKFVF+V E
Sbjct  7    FQLLELNLISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYTGEANPTWNDKFVFRVSE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN--------LGTRF  555
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  N         G RF
Sbjct  66   DFLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRF  125

Query  554  AAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
             A+QVRRPSGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  IALQVRRPSGRPQGILNIGVGILDGSMRSLPLYTNMDSSAVGY  168



>gb|KFK42792.1| hypothetical protein AALP_AA1G039700 [Arabis alpina]
Length=572

 Score =   169 bits (428),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG NP WNDKFVF+V+E
Sbjct  7    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYNGGPNPTWNDKFVFRVNE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  66   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPDRRPGYRTSNNEYRRTPPQGMR  125

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  FVALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGY  169



>ref|XP_010556931.1| PREDICTED: uncharacterized protein LOC104826097 [Tarenaya hassleriana]
Length=585

 Score =   169 bits (428),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 107/165 (65%), Gaps = 15/165 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW+N  R+  T +D  GGSNP WNDKFVF+V+E
Sbjct  7    FQLLELNIISAQDLAPVSR-KMKTYAIAWVNSERRLATRVDYSGGSNPTWNDKFVFRVNE  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN----------LGT  561
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +              G 
Sbjct  66   EFLYADTSAVMIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTGNNEYRRSTPPPGM  125

Query  560  RFAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            RF A+QVRR SGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  RFVALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGY  170



>ref|XP_006418119.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
 gb|ESQ36472.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
Length=595

 Score =   169 bits (428),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 109/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  127  FVALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGY  170



>ref|XP_010483923.1| PREDICTED: uncharacterized protein LOC104762347 [Camelina sativa]
Length=601

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+   +TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVAR-KTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  127  FVALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGY  170



>ref|XP_011038591.1| PREDICTED: uncharacterized protein LOC105135426 [Populus euphratica]
Length=367

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 10/160 (6%)
 Frame = -3

Query  902  NTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            N  PF+LLEI +IS QDL P +K +MRTY   W++P RK +T +D  G +NP WN+KFVF
Sbjct  4    NAHPFQLLEINVISGQDLAPVSK-SMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVF  62

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
            +VDE F+  E S+I  E+Y   WL D  IG+V +L+ NL      P+H+ N    F A+Q
Sbjct  63   RVDEIFINAENSSIMIEVYAAAWLRDVQIGSVNVLISNLF-----PSHNNNNKMHFVALQ  117

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTP----LDRYAAGYD  435
            VRRPSGRPQGILN+GV +LD + RS P    L   AAG+D
Sbjct  118  VRRPSGRPQGILNLGVQLLDTTMRSMPLYTELSVSAAGFD  157



>ref|XP_011069440.1| PREDICTED: uncharacterized protein LOC105155266 [Sesamum indicum]
Length=404

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F LLEI++ISAQDL P +K +M+TY  AWINP +K TT  D +G  NPMWNDKFVF++  
Sbjct  32   FYLLEISLISAQDLAPISK-SMQTYAMAWINPNKKHTTRTDQQGNKNPMWNDKFVFRLTN  90

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
              L  ET+ +  EIY ++W  D L+G VR+L+ +LI P           TRF A+QVRRP
Sbjct  91   ELLHSETATVTVEIYTVSWFRDVLVGMVRVLISDLITPLIRTLQTNTKNTRFVALQVRRP  150

Query  530  SGRPQGILNIGVAVLDGSKRSTPLDRYAA  444
            SG PQGILN+G+++LD + RS PL  YAA
Sbjct  151  SGTPQGILNMGISLLDSTMRSMPLKNYAA  179



>ref|XP_009625035.1| PREDICTED: uncharacterized protein LOC104115988 [Nicotiana tomentosiformis]
Length=406

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            +LEIT+ISAQDL P  K ++RTY   W+NP RK+TT +D +G SNP WNDKF F+VD+ F
Sbjct  43   ILEITLISAQDLSPVCK-SLRTYALTWVNPNRKRTTRVDNQGHSNPTWNDKFSFRVDDEF  101

Query  704  LRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSG  525
            L  E+SA+  EIY ++W  D L+GTV++L+ NLI P        +   +F A+Q+RRPSG
Sbjct  102  LNSESSAVHVEIYTVSWFRDILVGTVKVLLNNLINP-------YDRSKKFVALQIRRPSG  154

Query  524  RPQGILNIGVAVLDGSKRSTPL  459
             PQGILN+GVA++D SKRS PL
Sbjct  155  NPQGILNLGVALIDKSKRSMPL  176



>ref|XP_010457504.1| PREDICTED: uncharacterized protein LOC104738975 [Camelina sativa]
Length=600

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+   +TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVAR-KTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  127  FVALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGY  170



>ref|XP_002889512.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65771.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   167 bits (424),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 108/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+   +TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVAR-KTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV ++DGS RS PL    D  A GY
Sbjct  127  FVALQVRRTSGRPQGILNIGVGLIDGSMRSMPLYTHMDSSAVGY  170



>ref|XP_009792812.1| PREDICTED: uncharacterized protein LOC104239795 [Nicotiana sylvestris]
Length=404

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            +LEIT+ISAQDL P  K ++RTY   W+NP RK+TT +D +G SNP WNDKF F+VD+ F
Sbjct  41   ILEITLISAQDLSPVCK-SLRTYALTWVNPNRKRTTRVDNQGHSNPTWNDKFSFRVDDEF  99

Query  704  LRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSG  525
            L  E+SA+  EIY ++W  D L+GTV++L+ NLI P        +   +F A+Q+RRPSG
Sbjct  100  LNSESSAVHVEIYTVSWFRDILVGTVKVLLNNLINP-------FDRSKKFVALQIRRPSG  152

Query  524  RPQGILNIGVAVLDGSKRSTPL  459
             PQGILN+GVA++D SKRS PL
Sbjct  153  NPQGILNLGVALIDKSKRSMPL  174



>ref|NP_171948.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE27711.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=601

 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 108/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+   +TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  8    FQLLELNIISAQDLAPVAR-KTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV ++DGS RS PL    D  A GY
Sbjct  127  FVALQVRRTSGRPQGILNIGVGLIDGSMRSMPLYTHMDSSAVGY  170



>gb|AAB80639.1| Contains similarity to Glycine SRC2 (gb|AB000130) [Arabidopsis 
thaliana]
Length=578

 Score =   167 bits (423),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 108/164 (66%), Gaps = 14/164 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P A+   +TY  AW++  RK TT +D  GG+NP WNDKFVF+V+E
Sbjct  5    FQLLELNIISAQDLAPVAR-KTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNE  63

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  64   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMR  123

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+QVRR SGRPQGILNIGV ++DGS RS PL    D  A GY
Sbjct  124  FVALQVRRTSGRPQGILNIGVGLIDGSMRSMPLYTHMDSSAVGY  167



>ref|XP_002319115.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
 gb|EEE95038.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
Length=383

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 102/148 (69%), Gaps = 6/148 (4%)
 Frame = -3

Query  902  NTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            N  PF+LLEI +IS QDL P +K +MRTY   W++P RK +T +D  G +NP WN+KFVF
Sbjct  4    NAHPFQLLEINVISGQDLAPVSK-SMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVF  62

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
            +VD+ F+  E S+I  E+Y   WL D  IG+V +L+ NL      P+H+ N   RF A+Q
Sbjct  63   RVDDTFINAENSSIMIEVYAAAWLRDVQIGSVNVLISNLF-----PSHNNNNKMRFVALQ  117

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            VRRPSGRPQGILN+GV +LD + RS PL
Sbjct  118  VRRPSGRPQGILNLGVQLLDTTMRSMPL  145



>ref|XP_002325345.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
 gb|EEE99726.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
Length=364

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 101/148 (68%), Gaps = 6/148 (4%)
 Frame = -3

Query  902  NTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            N  PF+LLEI +IS QDL P +K +MRTY  AW++P RK +T +D  G  NP WN+KFVF
Sbjct  4    NAHPFQLLEINVISGQDLAPVSK-SMRTYAVAWVHPGRKLSTKVDQNGHINPQWNEKFVF  62

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
            +VD+ F+  E S+I  EIY   WL D  IG+VR+L+ NL P  +  N       RF A+Q
Sbjct  63   RVDDTFINAENSSIMIEIYAAAWLRDVQIGSVRVLISNLFPSNNNNNK-----MRFVALQ  117

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            VRRPSGRPQGILN+GV VLD + RS PL
Sbjct  118  VRRPSGRPQGILNMGVQVLDSTMRSMPL  145



>ref|XP_004239688.1| PREDICTED: putative uncharacterized protein DDB_G0267840 [Solanum 
lycopersicum]
Length=415

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            +LEIT+ISAQDL P +K ++RTY   WINP RK++T +D EG +NP WNDKF FKV+E F
Sbjct  33   ILEITLISAQDLAPISK-SLRTYALTWINPNRKRSTKIDNEGHNNPTWNDKFSFKVNEEF  91

Query  704  LRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSG  525
            L  E SA+  EIY ++W  D L+GT+ + + NLI P     +  N G RF A+Q+RRPSG
Sbjct  92   LYSENSAVHVEIYTVSWFRDVLVGTINVQLNNLINPYVNFQNSSN-GKRFVALQIRRPSG  150

Query  524  RPQGILNIGVAVLDGSKRSTPL  459
             PQGILN+GVA+++ S RS PL
Sbjct  151  NPQGILNMGVAIIESSMRSMPL  172



>ref|XP_004497792.1| PREDICTED: uncharacterized protein LOC101505544 [Cicer arietinum]
Length=451

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 104/147 (71%), Gaps = 5/147 (3%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            ++LLE+ +ISAQDL P  + +MRTY  AW++P RK +T +D+ GG NP WNDKFVF+VD+
Sbjct  8    YQLLELNVISAQDLAPVGR-SMRTYAVAWVDPDRKLSTRVDSHGGINPAWNDKFVFRVDD  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNL---GTRFAAVQV  540
             FL  E S I  +IY + W  D  +GT  +L  ++I PPS P+H++N    G RF  +QV
Sbjct  67   DFLNDENSIITIDIYALHWFKDIHVGTALVLADDII-PPSRPSHNKNYKPPGMRFVGLQV  125

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL  459
            RRPSGRP+GILN+GV V+D S RS PL
Sbjct  126  RRPSGRPKGILNVGVVVIDSSMRSMPL  152



>ref|XP_006345991.1| PREDICTED: uncharacterized protein LOC102591105, partial [Solanum 
tuberosum]
Length=373

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -3

Query  902  NTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            N     +LEIT+ISAQDL P +K ++RTY   WINP RK++T +D +G +NP WNDKF F
Sbjct  26   NNNNSHILEITLISAQDLAPVSK-SLRTYALTWINPNRKRSTKVDNDGHNNPTWNDKFSF  84

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
            KV+E FL  E SA+  EIY ++W  D L+GT+ + + NLI P     +  N G RF A+Q
Sbjct  85   KVNEEFLYSENSAVHVEIYTVSWFRDVLVGTINVQLNNLINPCVNFQNSLN-GKRFVALQ  143

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +RRPSG PQGILN+GVA+++ S RS PL
Sbjct  144  IRRPSGNPQGILNMGVAIIESSMRSMPL  171



>ref|XP_004242771.1| PREDICTED: formin-J [Solanum lycopersicum]
Length=370

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 104/142 (73%), Gaps = 4/142 (3%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            +LEIT+ISAQDL P  K ++RTY   W+NP RK+TT +D  G +NP WNDKF F+VD+ F
Sbjct  35   ILEITLISAQDLSPVCK-SLRTYALTWVNPNRKRTTRIDNHGHNNPNWNDKFSFRVDDEF  93

Query  704  LRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSG  525
            L  ++SAI  EIY ++W  D L+GTV++++ NL+   +P  +  N   +F A+Q+RRPSG
Sbjct  94   LISDSSAIHVEIYTVSWFRDILVGTVKVILNNLV---NPFENTSNSSKKFVALQIRRPSG  150

Query  524  RPQGILNIGVAVLDGSKRSTPL  459
             PQGILN+GV+++D SKRS PL
Sbjct  151  NPQGILNMGVSLIDKSKRSMPL  172



>ref|XP_010522448.1| PREDICTED: uncharacterized protein LOC104801063 [Tarenaya hassleriana]
Length=580

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 109/165 (66%), Gaps = 15/165 (9%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL   ++  M+TY  AW++  RK TT +D  GGSNP WNDKFVF+V++
Sbjct  7    FQLLELNIISAQDLAHVSR-KMKTYAIAWVHSERKLTTRVDYSGGSNPTWNDKFVFRVND  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPP------NHHQNL----GT  561
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P      N ++      G 
Sbjct  66   EFLYADTSAVMIEIYALHWFRDVHVGTVRVLISNLIPPSHRPGFRTGNNEYRRSTLPPGM  125

Query  560  RFAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            RF A+QVRR SGRPQGILNIGV +LDGS RS PL    D  A GY
Sbjct  126  RFVALQVRRTSGRPQGILNIGVGLLDGSMRSMPLYTHMDSSAVGY  170



>gb|KCW60206.1| hypothetical protein EUGRSUZ_H02915 [Eucalyptus grandis]
Length=452

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 7/158 (4%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL   A+  MRTY  AW++P RK +T +D+ G ++P WNDKFVF+VD
Sbjct  8    PFQLLELNIISAQDLAMVAR-TMRTYAVAWVHPDRKLSTRVDSNGRNSPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLI-PPPSPPNHHQ-NLGTRFAAVQV  540
            E FLR +TS +  EIY + W  D L+G VR+LVG+L+ P P P  H Q ++G RF A+QV
Sbjct  67   EEFLRSDTSGVMIEIYAVHWFKDVLVGRVRVLVGHLVTPQPHPFRHQQHHVGMRFVALQV  126

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTP----LDRYAAGY  438
            RRPSGRPQGILNIGVAVLD S RS P    L+  A GY
Sbjct  127  RRPSGRPQGILNIGVAVLDSSMRSMPLYMQLNASAVGY  164



>ref|XP_011077059.1| PREDICTED: uncharacterized protein LOC105161156 [Sesamum indicum]
Length=397

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 103/145 (71%), Gaps = 4/145 (3%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            P++LLE+ IISAQDL   ++ N+RTY T WINP RK  T +D +G +NP WNDKF+F+VD
Sbjct  5    PYQLLELAIISAQDLASVSR-NLRTYATTWINPNRKLKTRVDNQGLNNPTWNDKFIFRVD  63

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            + FL   TS++  EIY   WL D+ +G+V +L+ NLIPP       +    RF A+Q+RR
Sbjct  64   DKFLNSATSSVMIEIYAQGWLRDTPVGSVSVLISNLIPPSV---RQEGSSRRFVALQIRR  120

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSGRPQGILN+GV++LD + +S PL
Sbjct  121  PSGRPQGILNMGVSLLDNTMKSMPL  145



>ref|XP_007145354.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
 gb|ESW17348.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
Length=438

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 104/147 (71%), Gaps = 4/147 (3%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ +ISAQDL P  + +MRTY  AWI+P RK +T +D+ GG+NP WNDKFVF++D+
Sbjct  8    FQLLELHVISAQDLAPAGR-SMRTYAVAWIDPDRKLSTRVDSHGGTNPTWNDKFVFRMDQ  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPP---PSPPNHHQNLGTRFAAVQV  540
             FL  ++S I  +IY + W  D  +GT  +L  +L PP   P  PN +++ G RF  +QV
Sbjct  67   DFLYDDSSVITIDIYALHWFRDIHVGTAEVLSTDLFPPSSQPQQPNAYKSTGMRFLGLQV  126

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +RPSGRP+GILN+G A++D S RS PL
Sbjct  127  QRPSGRPKGILNVGAAIIDSSMRSMPL  153



>ref|XP_003590193.1| hypothetical protein MTR_1g045780 [Medicago truncatula]
 gb|AES60444.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=459

 Score =   162 bits (410),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 103/146 (71%), Gaps = 3/146 (2%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            ++LLE+ +ISAQDL    + +MRTY  AW++P RK +T +D++ G+NP WNDKFVF+VDE
Sbjct  8    YQLLELNVISAQDLAEVGR-SMRTYAVAWVDPDRKLSTRVDSQSGTNPAWNDKFVFRVDE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPP--PSPPNHHQNLGTRFAAVQVR  537
             FL  E S I  +IY I W  D  +GT  +L  ++IPP  PS  N+++  G +F  +QV 
Sbjct  67   DFLYDENSTITIDIYAIHWFKDIHVGTAHVLADDIIPPSRPSHSNNYKPQGMQFVGLQVH  126

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRP+GILN+GVAV+D S RS PL
Sbjct  127  RPSGRPKGILNVGVAVIDSSMRSMPL  152



>ref|XP_010026783.1| PREDICTED: protein bunched, class 2/F/G isoform-like [Eucalyptus 
grandis]
Length=456

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 7/158 (4%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL   A+  MRTY  AW++P RK +T +D+ G ++P WNDKFVF+VD
Sbjct  8    PFQLLELNIISAQDLAMVAR-TMRTYAVAWVHPDRKLSTRVDSNGRNSPTWNDKFVFRVD  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLI-PPPSPPNHHQ-NLGTRFAAVQV  540
            E FLR +TS +  EIY + W  D L+G VR+LVG+L+ P P P  H Q ++G RF A+QV
Sbjct  67   EEFLRSDTSGVMIEIYAVHWFKDVLVGRVRVLVGHLVTPQPHPFRHQQHHVGMRFVALQV  126

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTP----LDRYAAGY  438
            RRPSGRPQGILNIGVAVLD S RS P    L+  A GY
Sbjct  127  RRPSGRPQGILNIGVAVLDSSMRSMPLYMQLNASAVGY  164



>ref|XP_008366882.1| PREDICTED: uncharacterized protein LOC103430513 [Malus domestica]
Length=395

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 97/144 (67%), Gaps = 10/144 (7%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLEI +ISAQDL P +K  MRT+  AW+NP RK TT +D  G +NP WN+KFVF+VDE
Sbjct  9    FQLLEINLISAQDLTPASKA-MRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDE  67

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FLR +TS I  EIY   WL D LIGT  ++V NL               RF A+Q+RRP
Sbjct  68   DFLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL---------QNKSKMRFMAIQLRRP  118

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            SGRPQGILNIG+ +LD + RS PL
Sbjct  119  SGRPQGILNIGLGLLDSTMRSMPL  142



>gb|EYU39518.1| hypothetical protein MIMGU_mgv1a007478mg [Erythranthe guttata]
Length=406

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 101/148 (68%), Gaps = 2/148 (1%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            P  LLEI++ISAQDL P  K +MRTY  AW+NP RK TT  D  G ++P WNDK  F+VD
Sbjct  28   PLHLLEISLISAQDLTPITK-SMRTYAIAWVNPNRKLTTRTDQHGNTHPTWNDKLTFRVD  86

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSP-PNHHQNLGTRFAAVQVR  537
              FL  + +AI  EIY ++W  D L+GTVR+L+ +L+ PPS  P        RF A+QVR
Sbjct  87   SQFLASDDAAITVEIYTVSWFRDVLVGTVRVLISDLMSPPSGVPLQSLPKNMRFVALQVR  146

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPLDR  453
            RPSG PQGILN+GV++LD S +S PL R
Sbjct  147  RPSGAPQGILNMGVSLLDTSMQSMPLQR  174



>ref|XP_009795461.1| PREDICTED: uncharacterized protein LOC104242159 [Nicotiana sylvestris]
Length=395

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 104/142 (73%), Gaps = 5/142 (4%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            +LEI++ISAQDL P +K ++RTY  AWINP +K++T +D EG +NP WNDKF FKV++ F
Sbjct  37   ILEISLISAQDLAPVSK-SLRTYALAWINPNKKRSTRIDNEGHNNPTWNDKFSFKVNDEF  95

Query  704  LRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSG  525
            L  ETSA+  EIY ++W  D L+GTV +L+ NLI P      + + G RF A+Q+RRPSG
Sbjct  96   LYSETSAVHVEIYTVSWFRDVLVGTVHVLLNNLINPFI----NNSNGKRFVALQIRRPSG  151

Query  524  RPQGILNIGVAVLDGSKRSTPL  459
             PQGILN+GV+++  S RS PL
Sbjct  152  NPQGILNMGVSLIHSSMRSMPL  173



>gb|KCW57325.1| hypothetical protein EUGRSUZ_H00124 [Eucalyptus grandis]
Length=153

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 99/146 (68%), Gaps = 3/146 (2%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F LLE+ IISAQDL P ++  MRTY   W++P  K  T +D  G  +P WND+FVF+V+E
Sbjct  9    FHLLEVDIISAQDLAPVSRY-MRTYAVVWVHPDGKLPTRVDACGRCDPTWNDRFVFRVNE  67

Query  710  AFLRQETSAIEFEIYKITWL-GDSLIGTVRLLVGNLIPPPSPP-NHHQNLGTRFAAVQVR  537
             FLR++TSA+  EIY +  L  D  +GTVR+LV N  P PS      Q+ G    A+QVR
Sbjct  68   EFLRRDTSAVMIEIYAVRRLFKDVRVGTVRVLVSNFFPRPSRSFRREQHSGRHVMALQVR  127

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            RPSGRPQGILN+GVA+LD S RS P+
Sbjct  128  RPSGRPQGILNVGVALLDSSTRSKPM  153



>ref|XP_008370760.1| PREDICTED: uncharacterized protein LOC103434221 [Malus domestica]
 ref|XP_008370902.1| PREDICTED: uncharacterized protein LOC103434347 [Malus domestica]
Length=402

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 96/144 (67%), Gaps = 10/144 (7%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLEI +ISAQDL P +K  MRT+  AW+NP RK TT  D  G +NP WN+KFVF+VD+
Sbjct  9    FQLLEINLISAQDLTPASKA-MRTFAVAWVNPKRKLTTRFDQTGHTNPTWNEKFVFRVDD  67

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FLR +TS I  EIY   WL D LIGT  ++V NL               RF A+Q+RRP
Sbjct  68   DFLRHDTSKIMIEIYASAWLRDVLIGTAAVVVNNL---------QNKSKMRFMAIQLRRP  118

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            SGRPQGILNIG+ +LD + RS PL
Sbjct  119  SGRPQGILNIGLGLLDSTMRSMPL  142



>ref|XP_006437469.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
 ref|XP_006484674.1| PREDICTED: haze protective factor 1-like [Citrus sinensis]
 gb|ESR50709.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
Length=393

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            P R+LEI+I+S  DL   +K +M+TY+ AW++P RK TT +D  G +NP WN+KFVF+VD
Sbjct  4    PPRVLEISIVSGHDLALVSK-SMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFVFRVD  62

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            + FL  ETSAI  EIY   WL D+LIG+VR+L+ +L        H+ +  TR+ A+QVRR
Sbjct  63   DRFLTDETSAIMIEIYAAAWLKDALIGSVRVLISHLF---GTLTHNSSSSTRYVALQVRR  119

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSGRPQGILN+G+ +LD + RS PL
Sbjct  120  PSGRPQGILNLGITLLDNTMRSMPL  144



>ref|XP_009343786.1| PREDICTED: uncharacterized protein LOC103935702 [Pyrus x bretschneideri]
Length=402

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 96/144 (67%), Gaps = 10/144 (7%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLEI +ISAQDL P +K  MRT+  AW+NP RK TT  D  G +NP WN+KFVF+VD+
Sbjct  9    FQLLEINLISAQDLTPASKA-MRTFAVAWVNPKRKLTTRFDQTGHTNPTWNEKFVFRVDD  67

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FLR +TS I  EIY   WL D LIGT  ++V NL               RF A+Q+RRP
Sbjct  68   DFLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL---------QNKSKMRFMAIQLRRP  118

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            SGRPQGILNIG+ +LD + RS PL
Sbjct  119  SGRPQGILNIGLGLLDSTMRSMPL  142



>gb|KDO53064.1| hypothetical protein CISIN_1g035970mg, partial [Citrus sinensis]
Length=377

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            P R+LEI+I+S  DL   +K +M+TY+ AW++P RK TT +D  G +NP WN+KFVF+VD
Sbjct  4    PPRVLEISIVSGHDLALVSK-SMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFVFRVD  62

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            + FL  ETSAI  EIY   WL D+LIG+VR+L+ +L        H+ +  TR+ A+QVRR
Sbjct  63   DRFLTDETSAIMIEIYAAAWLKDALIGSVRVLISHLF---GTLTHNSSSSTRYVALQVRR  119

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSGRPQGILN+G+ +LD + RS PL
Sbjct  120  PSGRPQGILNLGITLLDNTMRSMPL  144



>ref|XP_008388740.1| PREDICTED: uncharacterized protein LOC103451084 [Malus domestica]
Length=395

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 96/144 (67%), Gaps = 10/144 (7%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLEI +ISAQDL P +K  MRT+  AW+NP RK TT +D  G +NP WN+KFVF+VDE
Sbjct  9    FQLLEINLISAQDLTPASKA-MRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDE  67

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FLR +TS I  EIY   WL D LIGT  ++V NL               RF A+Q+RRP
Sbjct  68   DFLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL---------QNKSKMRFMAIQLRRP  118

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            SGRP GILNIG+ +LD + RS PL
Sbjct  119  SGRPXGILNIGLGLLDSTMRSMPL  142



>ref|XP_010674263.1| PREDICTED: uncharacterized protein LOC104890461 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 106/148 (72%), Gaps = 7/148 (5%)
 Frame = -3

Query  899  TKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFK  720
            T+PF+LL I IISA+DL P +K +M TY   W+NP RK TT +D +G + P WNDKFVF+
Sbjct  2    TEPFQLLHINIISARDLAPVSK-SMNTYVVGWVNPNRKLTTRVDHKGNNCPEWNDKFVFR  60

Query  719  VDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFA-AVQ  543
            V   FL  ++S ++ EIY   WL D+LIG+VR+ + NLI     P  +QN  TR + A+Q
Sbjct  61   VTPKFLNSDSSIVDIEIYSQAWLRDALIGSVRVSIANLI-----PTGYQNGSTRRSVALQ  115

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +RRPSGRPQGILN+ V+VLDGS++S PL
Sbjct  116  IRRPSGRPQGILNVVVSVLDGSRQSMPL  143



>ref|XP_003590980.1| hypothetical protein MTR_1g080360 [Medicago truncatula]
 gb|AES61231.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=375

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 99/145 (68%), Gaps = 7/145 (5%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLEI +ISAQDL P +K +++ Y  AW+NP RK TT  D  G +NP WN+KFVF+VD
Sbjct  7    PFQLLEINVISAQDLAPVSK-SIKAYAVAWLNPERKLTTQADPHGHNNPTWNEKFVFRVD  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            + FL  E S I  EIY   WL D LIGTV + + NL+P       ++    RF A+QVRR
Sbjct  66   DDFLLSEESVIMIEIYASAWLRDVLIGTVAVHLNNLLP------RNRKSKIRFVALQVRR  119

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSGRPQGILNIGV V+D + RS P+
Sbjct  120  PSGRPQGILNIGVNVVDATMRSMPM  144



>ref|XP_009591729.1| PREDICTED: uncharacterized protein LOC104088710 [Nicotiana tomentosiformis]
Length=399

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 103/142 (73%), Gaps = 6/142 (4%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            ++EI++ISAQDL P +K ++RTY   WINP +K++T +D EG +NP WNDKF FKV++ F
Sbjct  39   IIEISLISAQDLAPVSK-SLRTYALTWINPNKKRSTRIDNEGHNNPSWNDKFSFKVNDEF  97

Query  704  LRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSG  525
            L  ETSA+  EIY ++W  D L+GTV +L+ NLI P    N     G RF A+Q+RRPSG
Sbjct  98   LYSETSAVHVEIYTVSWFRDVLVGTVHVLLNNLINPFVNSN-----GKRFVALQIRRPSG  152

Query  524  RPQGILNIGVAVLDGSKRSTPL  459
             PQGILN+GV++++ S +S PL
Sbjct  153  NPQGILNMGVSLINSSMKSMPL  174



>ref|XP_009379739.1| PREDICTED: uncharacterized protein LOC103968123 [Pyrus x bretschneideri]
Length=395

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 97/144 (67%), Gaps = 10/144 (7%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLEI +ISAQ+L P +K  MRT+  AW+NP RK TT +D  G +NP WN+KFVF+VD+
Sbjct  9    FQLLEINLISAQELTPASKA-MRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDD  67

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FLR +TS I  EIY   WL D LIGT  ++V NL               RF A+Q+RRP
Sbjct  68   DFLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL---------QNKSKMRFMAIQLRRP  118

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            SGRPQGILNIG+ +LD + RS PL
Sbjct  119  SGRPQGILNIGLGLLDSTMRSMPL  142



>ref|XP_007205372.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
 gb|EMJ06571.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
Length=375

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 10/144 (7%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLEI +ISAQDL P +K +MRT+  AW+NP RK TT +D  G +NP WN+KFVF+VD+
Sbjct  10   FQLLEINLISAQDLYPASK-SMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDD  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL+ +TS I  EIY   WL D LIGT  ++V NL               RF A+Q+RRP
Sbjct  69   EFLKDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL---------QNKSKMRFMAIQLRRP  119

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            SGRPQGILNIG+ +LD + RS PL
Sbjct  120  SGRPQGILNIGLGLLDNTMRSMPL  143



>ref|XP_008218351.1| PREDICTED: uncharacterized protein LOC103318712 [Prunus mume]
Length=417

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 10/144 (7%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLEI +ISAQDL P +K +MRT+  AW+NP RK TT +D  G +NP WN+KFVF+VD+
Sbjct  10   FQLLEINLISAQDLYPASK-SMRTFAVAWVNPKRKLTTRVDQNGHTNPTWNEKFVFRVDD  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL+ +TS I  EIY   WL D LIGT  ++V NL               RF A+Q+RRP
Sbjct  69   EFLKDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL---------QNKSKMRFMAIQLRRP  119

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            SGRPQGILNIG+ +LD + RS PL
Sbjct  120  SGRPQGILNIGLGLLDNTMRSMPL  143



>emb|CDP04279.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 104/146 (71%), Gaps = 7/146 (5%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F +L I++ISAQDL P +K +MRTY   WI+P+RK TT +D +  +NP+WN++F F+VD 
Sbjct  26   FYVLNISLISAQDLAPISK-SMRTYAVTWIHPSRKLTTSVDQQRHTNPLWNERFAFRVDS  84

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  + +AI  EIY ++W  D L+GTVR+L+ +LI  P   NH     TR+ A+Q+RRP
Sbjct  85   EFLSSDQAAITVEIYTVSWFRDLLVGTVRVLISDLI-TPCARNH-----TRYLALQIRRP  138

Query  530  SGRPQGILNIGVAVLDGSKRSTPLDR  453
            SG PQG+LN+GVA++D + RS PL R
Sbjct  139  SGNPQGMLNMGVALMDAANRSMPLRR  164



>gb|KHN31488.1| hypothetical protein glysoja_035595, partial [Glycine soja]
Length=241

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 7/142 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            LLEI +ISAQDL   +K ++R Y  AW++P RK  T +D EG +NP WN+KFVF+VD++F
Sbjct  1    LLEINVISAQDLAQVSK-SVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFRVDDSF  59

Query  704  LRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSG  525
            L  + S I  EIY   WL   LIGTV + + NL+PP   P        RF A+Q+RRPSG
Sbjct  60   LNSDNSVIMIEIYSHAWLRHVLIGTVAVQLTNLLPPNRKPK------LRFVALQIRRPSG  113

Query  524  RPQGILNIGVAVLDGSKRSTPL  459
            RPQGILNIGV +LD + RS PL
Sbjct  114  RPQGILNIGVNLLDSTMRSMPL  135



>ref|XP_004495587.1| PREDICTED: uncharacterized protein LOC101488962 [Cicer arietinum]
Length=363

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 101/145 (70%), Gaps = 5/145 (3%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF LLEI IISAQDL P +K +++ Y  AW++P RK TT +D    +NP WN+KFVF+VD
Sbjct  7    PFHLLEINIISAQDLSPVSK-SIKAYAVAWLDPQRKLTTQIDPHAHNNPTWNEKFVFRVD  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            + FL+ E SAI  EIY   WL D LIGTV + + NL+P      +++    RF A+QVRR
Sbjct  66   DDFLQSEDSAIVIEIYSSAWLRDILIGTVAVNLNNLLPRL----YNRKSKIRFVALQVRR  121

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSGRPQGILNIGV ++D + RS P+
Sbjct  122  PSGRPQGILNIGVNLVDATMRSMPM  146



>ref|XP_011036375.1| PREDICTED: uncharacterized protein LOC105133911 [Populus euphratica]
Length=382

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 97/142 (68%), Gaps = 6/142 (4%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            LLEI +IS QDL P +K +MRTY  AW++P RK +T +D  G  NP WN+KFVF+VD+ F
Sbjct  28   LLEINVISGQDLAPVSK-SMRTYAVAWVHPGRKLSTKVDQNGHINPQWNEKFVFRVDDTF  86

Query  704  LRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSG  525
            +  E S+I  EIY   WL D  IG+VR+L+ NL P  +  N       RF A+QVRRPSG
Sbjct  87   INAENSSIMIEIYAAAWLRDVQIGSVRVLISNLFPSNNNNNK-----MRFVALQVRRPSG  141

Query  524  RPQGILNIGVAVLDGSKRSTPL  459
            RPQGILN+GV VLD + RS PL
Sbjct  142  RPQGILNMGVQVLDSTMRSMPL  163



>ref|XP_004304780.1| PREDICTED: uncharacterized protein LOC101296310 [Fragaria vesca 
subsp. vesca]
Length=457

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 103/163 (63%), Gaps = 15/163 (9%)
 Frame = -3

Query  932  HTHIYIIKMANTKP-----FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILD  768
            H+ +     A  KP     F+LLEI +ISAQDL   +K +MRT+  AW+NP RK TT +D
Sbjct  20   HSSVSATATAMPKPPHMSSFQLLEINLISAQDLTAASK-SMRTFAVAWVNPKRKLTTRVD  78

Query  767  TEGGSNPMWNDKFVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSP  588
              G +NP WN+KFVF+V E FL+ +TS I  EIY   WL D L+GT  ++V NL      
Sbjct  79   QNGHTNPTWNEKFVFRVGEDFLKDDTSKIMIEIYASAWLRDVLVGTAAIVVSNL------  132

Query  587  PNHHQNLGTRFAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
                 N   RF A+Q+RRPSGRPQGILN+G+ +LD + RS PL
Sbjct  133  ---QNNSKMRFVAIQLRRPSGRPQGILNVGLGLLDNTMRSMPL  172



>gb|KEH24577.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=389

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 103/150 (69%), Gaps = 2/150 (1%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            ++++ P++LLEI IISAQDL   AK +++ Y  AW++P RK  T +D  G +NP WN+KF
Sbjct  4    LSSSSPYQLLEINIISAQDLSGVAK-SVKAYAVAWLHPERKLATQIDQVGHTNPTWNEKF  62

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF+VD  FL  E+S I  EIY   WL D LIGTV +LV NL+P  +   + +    RF  
Sbjct  63   VFRVDNEFLNSESSVIMIEIYNSAWLRDILIGTVVVLVNNLLPTVTLSGNRKP-KLRFVG  121

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            +Q+RRPSGRPQGILNIGV +LD + RS PL
Sbjct  122  LQIRRPSGRPQGILNIGVTLLDSTMRSMPL  151



>ref|XP_011077131.1| PREDICTED: uncharacterized protein LOC105161211 [Sesamum indicum]
Length=377

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -3

Query  878  EITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAFLR  699
            ++++ISAQDL P  K +MRTY  AWINP RK TT  D +G ++P WN+KF F+VD   L 
Sbjct  35   DVSLISAQDLSPVCK-SMRTYAVAWINPNRKLTTRTDQQGHTHPTWNEKFSFRVDTKSLI  93

Query  698  QETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSP-PNHHQNLGTRFAAVQVRRPSGR  522
             E SA+  EIY ++W  D L+GTVR+L+ +L+ PPS  P  +    TRF A+QVRRPSG 
Sbjct  94   SENSAMTVEIYTVSWFRDVLVGTVRVLISDLLAPPSGIPLQNLPRSTRFIALQVRRPSGA  153

Query  521  PQGILNIGVAVLDGSKRSTPLDRYAAGY  438
            PQGILN+GV++LD + RS PL+  A  +
Sbjct  154  PQGILNMGVSLLDTTMRSMPLNPIADNF  181



>ref|XP_006577748.1| PREDICTED: uncharacterized protein LOC102667983 [Glycine max]
Length=373

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 99/145 (68%), Gaps = 7/145 (5%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            P++LLEI +ISAQDL   +K ++R Y  AW++P RK  T +D EG +NP WN+KFVF+VD
Sbjct  7    PYQLLEINVISAQDLAQVSK-SVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFRVD  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            ++FL  + S I  EIY   WL   LIGTV + + NL+PP   P        RF A+Q+RR
Sbjct  66   DSFLNSDNSVIMIEIYSHAWLRHVLIGTVAVQLTNLLPPNRKPK------LRFVALQIRR  119

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSGRPQGILNIGV +LD + RS PL
Sbjct  120  PSGRPQGILNIGVNLLDSTMRSMPL  144



>ref|XP_003535375.1| PREDICTED: uncharacterized protein LOC100795448 [Glycine max]
Length=373

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 8/156 (5%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL P +K +++ Y  AW+NP RK TT +D  G +NP WN+KFVF+VD
Sbjct  7    PFQLLELNIISAQDLAPVSK-SIKAYAVAWLNPERKLTTQIDPNGQNNPTWNEKFVFRVD  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            + FL  + S I  EIY   WL D LIGTV +L  NL+P      + +    RF A+QVRR
Sbjct  66   DDFLTSDESLIIIEIYASAWLRDILIGTVTVLASNLLPRSI---NTRKSKIRFVALQVRR  122

Query  533  PSGRPQGILNIGVAVLDGSKRSTP----LDRYAAGY  438
            PSGRPQGILNIGV ++D + RS P    L   A GY
Sbjct  123  PSGRPQGILNIGVNLVDSTMRSMPMYSELSASAVGY  158



>ref|XP_007132356.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
 gb|ESW04350.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
Length=385

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL P +K +++ Y  AW++P RK TT +D +G +NP WN+KFVF++D
Sbjct  7    PFQLLEVNIISAQDLAPVSK-SIKAYAVAWLDPERKLTTQIDPDGHNNPTWNEKFVFRID  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            E FL  + S +  EIY  TWL D L+GTV +L+ NL+    P + ++    RF A+QVRR
Sbjct  66   EDFLYADDSVVMIEIYASTWLRDILVGTVGVLLSNLL----PRSINRTSKIRFIALQVRR  121

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSG PQGILNIGV ++D ++RS P+
Sbjct  122  PSGHPQGILNIGVNLVDPTRRSMPM  146



>gb|AFK13837.1| C2 domain-containing protein SRC2 [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 7/142 (5%)
 Frame = -3

Query  899  TKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFK  720
            T+PF+LL I IISA+DL P +K +M TY   W+NP RK TT +D +G + P WNDKFVF+
Sbjct  2    TEPFQLLHINIISARDLAPVSK-SMNTYVVGWVNPYRKLTTRVDHKGNNCPEWNDKFVFR  60

Query  719  VDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFA-AVQ  543
            V   FL  ++S ++ EIY   WL D+LIG+VR+ + NLI     P  +QN  TR + A+Q
Sbjct  61   VTPKFLNSDSSIVDIEIYSQAWLRDALIGSVRVSIANLI-----PTGYQNGSTRRSVALQ  115

Query  542  VRRPSGRPQGILNIGVAVLDGS  477
            +RRPSGRPQGILN+ V+VLDG+
Sbjct  116  IRRPSGRPQGILNVVVSVLDGT  137



>gb|EYU32591.1| hypothetical protein MIMGU_mgv1a006056mg [Erythranthe guttata]
Length=459

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 101/159 (64%), Gaps = 26/159 (16%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            KPF+LLEI IIS QDL+P  K  MRTY  AW+NP RK ++                   V
Sbjct  7    KPFQLLEINIISGQDLQPVLK-KMRTYARAWVNPGRKLSS-------------------V  46

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPP--SPPNHHQNLGTRFAAVQ  543
            D+ FL ++TSA+  EIY   W  D ++GTVR+LVGNLIPPP  +  N    +G RF A+Q
Sbjct  47   DDDFLGEDTSAVMIEIYAAHWFRDVIVGTVRVLVGNLIPPPLMTRRNGGGPIGMRFVALQ  106

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPLDRY----AAGY  438
            VRRPSGRPQGILNIGVA+LDGS RS PL R     A GY
Sbjct  107  VRRPSGRPQGILNIGVALLDGSMRSMPLYRQLSASAVGY  145



>ref|XP_007147205.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
 gb|ESW19199.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
Length=371

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 97/150 (65%), Gaps = 7/150 (5%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+    ++LLEI ++SAQDL P+    +R Y   W++P RK TT +D EG +NP WN+KF
Sbjct  1    MSQVAGYQLLEINVMSAQDL-PRVSKPVRAYAVGWLHPDRKLTTQVDQEGHTNPTWNEKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF+VD+ FL  + + I  EIY   WL   LIGTV +LV +L+P    P        RF A
Sbjct  60   VFRVDDQFLDSDDAVITIEIYTQAWLSPVLIGTVGILVSDLLPTNRKPK------LRFVA  113

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            VQ+RRPSGR QGILNIGV +LD + RS PL
Sbjct  114  VQIRRPSGRTQGILNIGVTLLDSTMRSMPL  143



>ref|XP_007132355.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
 gb|ESW04349.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
Length=385

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 103/145 (71%), Gaps = 5/145 (3%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF+LLE+ IISAQDL P +K +++ Y  AW++P RK TT +  +G +NP WN+KFVF++D
Sbjct  7    PFQLLEVNIISAQDLAPVSK-SIKAYAVAWLDPERKLTTQIHPDGHNNPTWNEKFVFRID  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            E FL  + S +  EIY  TWL D L+GTV +L+ NL+    P + ++    RF A+QVRR
Sbjct  66   EDFLYADDSVVMIEIYASTWLRDILVGTVGVLLSNLL----PRSINRTSKIRFIALQVRR  121

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
            PSG PQGILNIGV ++D ++RS P+
Sbjct  122  PSGHPQGILNIGVNLVDPTRRSMPM  146



>gb|KCW85316.1| hypothetical protein EUGRSUZ_B02156 [Eucalyptus grandis]
Length=352

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEA  708
            RLLE+ +ISAQDL P +K +MRTY  AW++P RK TT +D +G +NP WN+KFVF+V++ 
Sbjct  9    RLLELNLISAQDLAPVSK-SMRTYAVAWVHPDRKLTTRVDEKGHANPNWNEKFVFRVNDV  67

Query  707  FLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPS  528
             L  +T  I  EIY +TWL   L+GTVR L+ +LI PPS     +N   RF  +QV RPS
Sbjct  68   SLETDTCVITIEIYALTWLRVVLVGTVRALLSSLI-PPSTRTRTKNTPMRFMTLQVLRPS  126

Query  527  GRPQGILNIGVAVLDGSKRSTPLD  456
            GRPQG +N GV++++ S RS PL+
Sbjct  127  GRPQGAINFGVSLINSSMRSMPLN  150



>ref|XP_010043310.1| PREDICTED: uncharacterized protein LOC104432551 [Eucalyptus grandis]
Length=355

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEA  708
            RLLE+ +ISAQDL P +K +MRTY  AW++P RK TT +D +G +NP WN+KFVF+V++ 
Sbjct  9    RLLELNLISAQDLAPVSK-SMRTYAVAWVHPDRKLTTRVDEKGHANPNWNEKFVFRVNDV  67

Query  707  FLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPS  528
             L  +T  I  EIY +TWL   L+GTVR L+ +LI PPS     +N   RF  +QV RPS
Sbjct  68   SLETDTCVITIEIYALTWLRVVLVGTVRALLSSLI-PPSTRTRTKNTPMRFMTLQVLRPS  126

Query  527  GRPQGILNIGVAVLDGSKRSTPLD  456
            GRPQG +N GV++++ S RS PL+
Sbjct  127  GRPQGAINFGVSLINSSMRSMPLN  150



>emb|CDX89815.1| BnaA10g02670D [Brassica napus]
Length=498

 Score =   149 bits (376),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 100/164 (61%), Gaps = 23/164 (14%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            F+LLE+ IISAQDL P ++  M+TY  AW++  RK TT +D   G+NP WNDKFVF+VDE
Sbjct  8    FQLLELNIISAQDLAPVSR-KMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDE  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN---------LGTR  558
             FL  +TSA+  EIY + W  D  +GTVR+L+ NLIPP   P +  +          G R
Sbjct  67   EFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPQGMR  126

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL----DRYAAGY  438
            F A+         QGILNIGV VLDGS RS PL    D  A GY
Sbjct  127  FVAL---------QGILNIGVGVLDGSMRSMPLYTHMDSSAVGY  161



>ref|XP_008441789.1| PREDICTED: uncharacterized protein LOC103485843 [Cucumis melo]
Length=361

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF++LE++++SA DL   +K  MRT+  AWINP RK TT +D  G +NP WN+KFVFKVD
Sbjct  5    PFQVLELSLLSANDLASVSK-TMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKVD  63

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            +  L   TS +  EIY    L D L+GTV  +V NLIP  SP ++      RF  +QVRR
Sbjct  64   DDLLEDPTSTVTIEIYSSALLRDILVGTVTEVVSNLIPQSSPKSNM-----RFLTLQVRR  118

Query  533  PSGRPQGILNIGVAVLDGSKRSTPLD  456
            PSGRP+G + +GV +LD +KRS PL+
Sbjct  119  PSGRPKGTVKVGVTLLDSAKRSMPLE  144



>ref|XP_004155136.1| PREDICTED: uncharacterized protein LOC101227028 [Cucumis sativus]
Length=360

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 98/147 (67%), Gaps = 6/147 (4%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            +PF++LE++++SA DL   +K  MRT+  AWINP RK TT +D  G +NP WN+KFVFKV
Sbjct  4    QPFQVLELSLLSANDLASVSK-TMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKV  62

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            D+  L   TS +  EIY    L D LIGTV  +V NLIP  S  ++      RF  +QVR
Sbjct  63   DDDLLEDPTSTVTIEIYSSALLRDILIGTVTEVVSNLIPQSSSKSNM-----RFLTLQVR  117

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPLD  456
            RPSGRP+G + +GV +LD +KRS PL+
Sbjct  118  RPSGRPKGTVKVGVTLLDSAKRSMPLE  144



>ref|XP_004152866.1| PREDICTED: uncharacterized protein LOC101218582 [Cucumis sativus]
 gb|KGN61292.1| hypothetical protein Csa_2G076000 [Cucumis sativus]
Length=360

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 98/147 (67%), Gaps = 6/147 (4%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            +PF++LE++++SA DL   +K  MRT+  AWINP RK TT +D  G +NP WN+KFVFKV
Sbjct  4    QPFQVLELSLLSANDLASVSK-TMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKV  62

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            D+  L   TS +  EIY    L D L+GTV  +V NLIP  S  ++      RF  +QVR
Sbjct  63   DDDLLEDPTSTVTIEIYSSALLRDILVGTVTEVVSNLIPQSSSKSNM-----RFLTLQVR  117

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPLD  456
            RPSGRP+G + +GV +LD +KRS PL+
Sbjct  118  RPSGRPKGTVKVGVTLLDSAKRSMPLE  144



>ref|XP_007051663.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOX95820.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=266

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 91/138 (66%), Gaps = 4/138 (3%)
 Frame = -3

Query  884  LLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEIT+ISAQ L EP  K+  M+TY  AWI+ + K  T +D  GG NP WNDKF+FKV  
Sbjct  6    VLEITLISAQGLKEPSGKLRRMQTYALAWIDSSVKLRTCVDRVGGENPTWNDKFLFKVSS  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS I  EI+ +  L DSL+GTVR LV N +P  S  N  +     F AVQ+RRP
Sbjct  66   EFLSSETSGISVEIFAVGVLRDSLVGTVRFLVSNFLPSGSAFNAAKT--HSFNAVQIRRP  123

Query  530  SGRPQGILNIGVAVLDGS  477
            SGR QG+LNIG  VLDG+
Sbjct  124  SGRFQGVLNIGATVLDGA  141



>emb|CDX81442.1| BnaC09g08530D [Brassica napus]
Length=408

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILEMNIISAQELAPVARC-MKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S        G RF  
Sbjct  60   VFRLDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS--------GMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>emb|CDY37207.1| BnaA09g08280D [Brassica napus]
Length=407

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILEMNIISAQELAPVARC-MKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S        G RF  
Sbjct  60   VFRLDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS--------GMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>ref|XP_009112245.1| PREDICTED: uncharacterized protein LOC103837642 [Brassica rapa]
Length=407

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILEMNIISAQELAPVARC-MKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S        G RF  
Sbjct  60   VFRLDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS--------GMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>ref|XP_010533203.1| PREDICTED: uncharacterized protein LOC104809022 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010533204.1| PREDICTED: uncharacterized protein LOC104809022 isoform X2 [Tarenaya 
hassleriana]
Length=431

 Score =   139 bits (351),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 96/145 (66%), Gaps = 9/145 (6%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            P ++LE+ IISAQDL P A+  M+TY  AW++P RK TT +D  GG++P WNDKFVF++D
Sbjct  6    PSQILELNIISAQDLAPVARY-MKTYAIAWLDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            E  L  ETS +  EIY + W  D  +GTV+ LV +L+      NH   +  RF  ++V R
Sbjct  65   EESLYDETSLVVIEIYALHWFKDIHVGTVQALVSDLV------NHVSAM--RFVTLEVLR  116

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL  459
             SGRP G+LNI V ++D S++S PL
Sbjct  117  ASGRPHGLLNIAVGLIDSSRQSVPL  141



>emb|CDY37206.1| BnaA09g08270D [Brassica napus]
Length=407

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILEMNIISAQELAPVARC-MKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S        G RF  
Sbjct  60   VFRLDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS--------GMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>emb|CDY42921.1| BnaC05g47300D [Brassica napus]
Length=377

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P +K NM+TY+ AWIN  P RK TT +D    SNP+WN+KFVF+VD+
Sbjct  10   VLEINLISAQDLAPISK-NMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVDD  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + S+I  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|XP_006297897.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
 gb|EOA30795.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
Length=382

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 97/149 (65%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPVSR-NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + SAI  EIY   W  D+L+GTV +L+ +L  P S          +N   R   +
Sbjct  69   KILDFDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDCGGRNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|XP_006842598.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
 gb|ERN04273.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
Length=355

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 95/148 (64%), Gaps = 8/148 (5%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
              LLE+ IISAQD+ P A   M  Y  AW++   K +T  D +G + P WNDKF+F+V E
Sbjct  20   LHLLELNIISAQDIHP-ATQAMHPYAVAWVHRDHKLSTRTDPQGHTEPTWNDKFIFRVTE  78

Query  710  AFLRQETSAIEFEIY---KITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNL-GTRFAAVQ  543
             FLR +T+A+  +I+         D LIGTVR+LVGNL+   S  +H     G RF A+Q
Sbjct  79   TFLRSDTAAVTIQIFTHRPCCVFPDPLIGTVRVLVGNLL---SAQSHAPGYSGMRFTALQ  135

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            VRRPSGRPQGILN+G+ +LD + RS PL
Sbjct  136  VRRPSGRPQGILNLGITLLDPALRSMPL  163



>ref|XP_010488836.1| PREDICTED: uncharacterized protein LOC104766620 [Camelina sativa]
Length=403

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILELNIISAQELAPVARC-MKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLDEEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS--------AMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>ref|NP_178968.1| C2 domain-containing protein [Arabidopsis thaliana]
 gb|AAD28670.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15260.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAC43170.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63412.1| At2g13350 [Arabidopsis thaliana]
 gb|AEC06226.1| C2 domain-containing protein [Arabidopsis thaliana]
Length=401

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILELNIISAQELAPVARC-MKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLDEEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS--------AMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>emb|CDY49343.1| BnaA05g33050D [Brassica napus]
Length=384

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P +K NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+VD+
Sbjct  10   VLEINLISAQDLAPISK-NMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDD  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + S+I  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|XP_010518533.1| PREDICTED: uncharacterized protein LOC104793798 [Camelina sativa]
Length=404

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILELNIISAQELAPVARC-MKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLDEEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS--------AMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>ref|XP_010467176.1| PREDICTED: uncharacterized protein LOC104747266 [Camelina sativa]
Length=404

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILELNIISAQELAPVARC-MKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLDEEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS--------AMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>ref|XP_002885870.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62129.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILELNIISAQELAPVARC-MKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLDEEALYDATSIVVIEIYALHWFKDIHVGTVQTLISDLVSPSS--------AMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>ref|XP_009123999.1| PREDICTED: uncharacterized protein LOC103848923 [Brassica rapa]
Length=384

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P +K NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+VD+
Sbjct  10   VLEINLISAQDLAPISK-NMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDD  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + S+I  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|XP_010485810.1| PREDICTED: putative lysozyme-like protein [Camelina sativa]
Length=391

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPVSR-NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + SAI  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILDADASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|XP_010102203.1| hypothetical protein L484_024484 [Morus notabilis]
 gb|EXB93146.1| hypothetical protein L484_024484 [Morus notabilis]
Length=377

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 102/154 (66%), Gaps = 5/154 (3%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEA  708
            RLLE+ ++SA+DL   +K +M+T+  AWI+  RK  T  D  G +NP WN+KF F+VD+ 
Sbjct  10   RLLELNLLSARDLATVSK-SMKTFAVAWIDQDRKLETRNDQTGQNNPAWNEKFAFRVDDD  68

Query  707  FLRQETSAIEFEIYKITWLGD-SLIGTVRLLVGNLIPPPSPPNHHQNLGT-RFAAVQVRR  534
            FL  E+S I  EI  +T  G+  L+GTV +LV +L P  S     ++    RF  +Q+RR
Sbjct  69   FLVSESSTITIEIRALTRRGNVVLVGTVSVLVASLFPRSSTSFQKRSFSKMRFLTLQIRR  128

Query  533  PSGRPQGILNIGVAVLDGSKRSTPL--DRYAAGY  438
            P GRPQG+L++GVA+LDG++RS PL  D  A+GY
Sbjct  129  PCGRPQGVLDVGVALLDGTRRSMPLSSDVSASGY  162



>ref|XP_010463915.1| PREDICTED: uncharacterized protein LOC104744544 [Camelina sativa]
Length=392

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPVSR-NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + SAI  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILDADASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>gb|KFK39933.1| hypothetical protein AALP_AA3G308600 [Arabis alpina]
Length=401

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILELNIISAQELAPVARC-MKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF+++E  L  E S +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLEEEALYDERSIVVIEIYALHWFKDIHVGTVQALISDLVTPSS--------AMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>gb|AAF26778.1|AC016829_2 hypothetical protein [Arabidopsis thaliana]
Length=353

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPVSR-NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + SAI  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>gb|KFK37859.1| hypothetical protein AALP_AA3G038400 [Arabis alpina]
Length=387

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 98/149 (66%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPISR-NMKTYSVAWINTDPMRKLTTRVDQNNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT-----RFAAV  546
              L  + SAI  EIY   W  D+L+GTV +L+ +L  P S      ++G      R   +
Sbjct  69   KILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDVGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|XP_002884443.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60702.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPVSR-NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + SAI  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|XP_006409691.1| hypothetical protein EUTSA_v10022712mg [Eutrema salsugineum]
 gb|ESQ51144.1| hypothetical protein EUTSA_v10022712mg [Eutrema salsugineum]
Length=400

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 94/150 (63%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK  T +D  GG++P WNDKF
Sbjct  1    MSFLAPSQILELNIISAQELAPVARC-MKTYAIAWIDPERKLMTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLDEEALYHGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS--------AMRFIT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V V+D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGVIDNSGQSMPL  141



>gb|ABK28543.1| unknown [Arabidopsis thaliana]
Length=354

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPVSR-NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + SAI  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|XP_006408192.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
 gb|ESQ49645.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
Length=392

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPISR-NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + SAI  E+Y   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILDVDASAIVIEVYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|NP_566225.4| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
 gb|AEE74070.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
Length=391

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPVSR-NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + SAI  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>gb|AAM67146.1| unknown [Arabidopsis thaliana]
Length=391

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL P ++ NM+TY+ AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLAPVSR-NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L  + SAI  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +G+A+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGIALLDGGQRSMPL  157



>ref|XP_006842901.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
 gb|ERN04576.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
Length=404

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 94/141 (67%), Gaps = 11/141 (8%)
 Frame = -3

Query  899  TKPFRLLEITIISAQDLEPKAKMN--MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFV  726
            ++ ++LLE+ +ISAQDL+P    N  + TY  AW++P +K  T +DT G  NP WNDKF+
Sbjct  13   SEKYQLLEVNLISAQDLKPIIHSNKTIHTYAVAWVDPRKKLRTRVDTLGRENPTWNDKFI  72

Query  725  FKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAV  546
            F VD++FL  E+SAI  EI+ + +L D L GTVR LV +L+         +  G  FAA+
Sbjct  73   FTVDQSFLSGESSAISIEIFYVRYLRDVLAGTVRALVADLM---------KGGGLSFAAL  123

Query  545  QVRRPSGRPQGILNIGVAVLD  483
            QVRRPSGR  G+LN+G+ VLD
Sbjct  124  QVRRPSGRFHGVLNLGLIVLD  144



>emb|CDX92066.1| BnaC03g33680D [Brassica napus]
Length=383

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL   +K NM+TY+ AWIN  P RK TT +D    SNP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLSLVSK-NMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L+ + SAI  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KTLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>ref|XP_009377282.1| PREDICTED: BON1-associated protein 2 [Pyrus x bretschneideri]
Length=223

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 95/153 (62%), Gaps = 12/153 (8%)
 Frame = -3

Query  884  LLEITIISAQDLEP--KAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL+P   A   M+TY  AW++ A K  + +D  GG NP WND+F+FKV  
Sbjct  14   VLEINLISAQDLKPPSAALRRMQTYALAWVDSAHKIRSRVDKIGGENPTWNDRFLFKVPS  73

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSP-PNHHQNLGTRFAAVQVRR  534
            AFL  ETS +  +IY +    D L+GTVRLL+ N +   S  P+        F A+Q+RR
Sbjct  74   AFLSSETSQVSIQIYAVGCFSDHLVGTVRLLINNFLDVASKVPS--------FTAIQIRR  125

Query  533  PSGRPQGILNIGVAVLDGSKRSTPLDRYAA-GY  438
            PSGR QG+LN+   V+DGS  +  +  ++A GY
Sbjct  126  PSGRFQGVLNVAAMVIDGSYLAPAVSEWSAVGY  158



>ref|XP_010936043.1| PREDICTED: uncharacterized protein LOC105055767 [Elaeis guineensis]
Length=280

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 92/147 (63%), Gaps = 14/147 (10%)
 Frame = -3

Query  905  ANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFV  726
            A+  P  LLE+T+ISAQDL P     MR Y TAW++P +K +T  D  G + P WNDK V
Sbjct  15   ASAVPCHLLELTVISAQDLFPATARAMRAYATAWVHPDKKLSTRTDRAGHTEPTWNDKLV  74

Query  725  FKVDEAFLRQETSAIEFEIYKITW-----LGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT  561
            F+VD+AFL   TSAI  +I+ +       L D  +GTVR+L+  L P P           
Sbjct  75   FRVDDAFLLSVTSAITVDIFAVRHRLSPRLQDPHLGTVRVLLSALRPDPG--------AR  126

Query  560  RFAAVQVRRP-SGRPQGILNIGVAVLD  483
            RFAA+QVRRP S RPQGILN+GVA+LD
Sbjct  127  RFAALQVRRPNSLRPQGILNVGVALLD  153



>ref|XP_009136211.1| PREDICTED: uncharacterized protein LOC103860372 [Brassica rapa]
 emb|CDX93113.1| BnaA03g38350D [Brassica napus]
Length=404

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 94/150 (63%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ +ISAQ+L P A+  M+TY  AWI+P  K TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILELNVISAQELAPVARC-MKTYAIAWIDPECKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDPSS--------AMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>emb|CDX74193.1| BnaA03g28540D [Brassica napus]
Length=387

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL   +K NM+TY+ AWIN  P RK TT +D    SNP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLSLVSK-NMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT-----RFAAV  546
              L+ + SAI  EIY   W  D+L+GTV +L+ +L  P S        G      R   +
Sbjct  69   KTLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDEGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG +RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGQRSMPL  157



>emb|CDX89605.1| BnaC03g45190D [Brassica napus]
Length=406

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 94/150 (63%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ +ISAQ+L P A+  M+TY  AWI+P  K TT +D  GG++P WNDKF
Sbjct  1    MSFLAPCQILELNVISAQELAPVARC-MKTYAIAWIDPECKLTTRVDNTGGTSPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE  L   TS +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDPSS--------AMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S +S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGQSMPL  141



>ref|XP_009420756.1| PREDICTED: uncharacterized protein LOC104000435 [Musa acuminata 
subsp. malaccensis]
Length=266

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 98/150 (65%), Gaps = 14/150 (9%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF LLEITIISAQ L P A  ++ TY +AW++P  K  T +D  G ++P WNDKF+F+VD
Sbjct  20   PFHLLEITIISAQGLYP-ATRSINTYASAWVDPKHKLCTRVDRAGHADPTWNDKFIFRVD  78

Query  713  EAFLRQETSAIEFEIY----KITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAV  546
            +AFLR +T+ ++  ++    +++ L D L+GTVR+++ +L P P           RF A+
Sbjct  79   DAFLRSDTACVDVHLHAARSRLSPLPDHLLGTVRVVLSSLSPAPGV--------RRFVAL  130

Query  545  QVRRPSG-RPQGILNIGVAVLDGSKRSTPL  459
             VRRPS  RP GILN+ VA+L+   RS PL
Sbjct  131  LVRRPSSLRPHGILNLSVAILEPHVRSMPL  160



>ref|XP_010557577.1| PREDICTED: uncharacterized protein LOC104826528 [Tarenaya hassleriana]
Length=446

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 94/146 (64%), Gaps = 8/146 (5%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            P ++LE+ IISAQDL P A+  M+TY  AW++P  K TT +D  GG+NP WNDKFVF++D
Sbjct  8    PSQILELNIISAQDLAPVARY-MKTYAVAWLDPQHKLTTRVDNTGGTNPTWNDKFVFRLD  66

Query  713  EAFLRQETSAIE-FEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            +  L   TS+I   EIY + W  D  IGTV+ L+ +L+ P S P        RF  ++V 
Sbjct  67   KEALYYGTSSIMVIEIYALHWFKDIHIGTVQALITDLLSPTSLP------AMRFVTLEVL  120

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL  459
            R SGRP G+LNI V ++D S+ S PL
Sbjct  121  RASGRPHGLLNIAVGLIDSSRPSMPL  146



>ref|XP_004133823.1| PREDICTED: uncharacterized protein LOC101212280 [Cucumis sativus]
 ref|XP_004155854.1| PREDICTED: uncharacterized protein LOC101225970 [Cucumis sativus]
 gb|KGN56448.1| hypothetical protein Csa_3G119780 [Cucumis sativus]
Length=279

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = -3

Query  893  PFRLLEITIISAQDLE-PKAKMNMR-TYTTAWINPARKQTTILDTEGGSNPMWNDKFVFK  720
            P  +LEI +ISAQDL+ P    N + TY  AW++P+ +  T LDT GG NP WNDKF+F+
Sbjct  16   PMHVLEINLISAQDLKIPSNHFNPKHTYAVAWVHPSHRLRTRLDTIGGENPTWNDKFLFR  75

Query  719  VDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQV  540
            V   FL +ETS +  EIY +    D+L+GTVR L+GN+I P     +  +    F AVQV
Sbjct  76   VSPEFLARETSGVSIEIYSLGRFCDTLVGTVRFLIGNVIAP-----NDCSTTPSFTAVQV  130

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPLDRYAAGY  438
            RRPSGR  G+LN+ V V   S  ++     A GY
Sbjct  131  RRPSGRFHGVLNVAVMVNGNSDFASLNGVSAIGY  164



>ref|XP_006300066.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
 gb|EOA32964.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
Length=404

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 92/150 (61%), Gaps = 9/150 (6%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKF  729
            M+   P ++LE+ IISAQ+L P A+  M+TY  AWI+P RK  T +D  GG+ P WNDKF
Sbjct  1    MSFLAPCQILELNIISAQELAPVARC-MKTYAIAWIDPERKLMTRVDNTGGTTPTWNDKF  59

Query  728  VFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            VF++DE     +T+ +  EIY + W  D  +GTV+ L+ +L+ P S          RF  
Sbjct  60   VFRLDEETTYDDTTIVVIEIYALHWFKDIHVGTVQALISDLVSPSS--------AMRFVT  111

Query  548  VQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            ++V R SGRP G+LNI V ++D S  S PL
Sbjct  112  LEVLRASGRPHGLLNIAVGLIDNSGHSMPL  141



>ref|XP_009134757.1| PREDICTED: uncharacterized protein LOC103859027 [Brassica rapa]
Length=397

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 95/149 (64%), Gaps = 8/149 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL   +K NM+TY+ AWIN  P RK TT +D    SNP+WN+KFVF+V++
Sbjct  10   VLEINLISAQDLSLVSK-NMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPS-----PPNHHQNLGTRFAAV  546
              L+ + SAI  EIY   W  D+L+GTV +L+ +L  P S           N   R   +
Sbjct  69   KTLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTL  128

Query  545  QVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            Q+RRPSGR QG L +GVA+LDG  RS PL
Sbjct  129  QIRRPSGRLQGFLRLGVALLDGGLRSMPL  157



>ref|XP_008796382.1| PREDICTED: uncharacterized protein LOC103711856 [Phoenix dactylifera]
Length=282

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 91/148 (61%), Gaps = 14/148 (9%)
 Frame = -3

Query  905  ANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFV  726
            A+  P  LLE+T+ISAQDL P    +MR Y TAW++P RK  T  D  G ++P WNDK V
Sbjct  15   ASAVPCHLLELTVISAQDLFPATARSMRAYATAWVHPDRKLLTRTDRAGRTDPTWNDKLV  74

Query  725  FKVDEAFLRQETSAIEFEIYKIT-----WLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT  561
            F+VD AFL   TSA+  +I+         L D  +GTVR+L+    P P           
Sbjct  75   FRVDAAFLLSVTSAVTVDIFAARRRLSPRLRDPHLGTVRVLLSAFRPEPG--------SR  126

Query  560  RFAAVQVRRP-SGRPQGILNIGVAVLDG  480
            RFAA+QVRRP S RPQGILN+G+A+LDG
Sbjct  127  RFAALQVRRPNSLRPQGILNVGIALLDG  154



>ref|XP_002511946.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50615.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 93/152 (61%), Gaps = 5/152 (3%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAK--MNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQDL+P +     M+TY   W++   K  T +D  GG NP WNDKF+FKV 
Sbjct  5    KILEINLISAQDLKPPSASLRQMQTYAVVWLDSTAKLRTRIDRVGGENPTWNDKFLFKVT  64

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
               L +ETS + FEIY +    D LIGTVR L+ + IP PSP    +       A+Q++R
Sbjct  65   PEILSRETSGVSFEIYAVGCFRDPLIGTVRFLI-STIPLPSPIKPTRT--PSCIALQIQR  121

Query  533  PSGRPQGILNIGVAVLDGSKRSTPLDRYAAGY  438
            PSGR QG+LNIG  V+DGS  +T     A GY
Sbjct  122  PSGRFQGVLNIGAMVIDGSDFATLNGASAIGY  153



>gb|EYU39778.1| hypothetical protein MIMGU_mgv1a009123mg [Erythranthe guttata]
Length=352

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 93/148 (63%), Gaps = 6/148 (4%)
 Frame = -3

Query  899  TKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFK  720
            T   +LLEI++ISAQDL P +K +M TY   WI P +K TT  D  G  NP WNDK VF 
Sbjct  23   TAASQLLEISLISAQDLAPVSK-SMHTYGVVWIRPNKKHTTRTDNHGQRNPKWNDKCVFS  81

Query  719  VDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQV  540
            +D      + + +  EIY ++W  D ++G VR+ V +LI   +P    +N  TRF A+Q+
Sbjct  82   LDNPPENNDAT-VTVEIYTVSWFRDVIVGMVRVRVADLI---TPLTRTRNKNTRFVALQI  137

Query  539  RRPSGRPQGILNIGVAVLD-GSKRSTPL  459
            RRPSG PQGILN+GVA+ D  + RS PL
Sbjct  138  RRPSGSPQGILNMGVALSDTAAMRSMPL  165



>ref|XP_009401202.1| PREDICTED: uncharacterized protein LOC103985274 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 14/150 (9%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF LLEITIISAQ+L P A+  ++TY +AW++P  K  T +D  G ++P WNDK VF+VD
Sbjct  26   PFHLLEITIISAQELYPAARC-LKTYASAWVDPEHKLYTRVDRAGHADPTWNDKLVFRVD  84

Query  713  EAFLRQETSAIEFEIY----KITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAV  546
            ++FLR + +A+   ++    + + L D L+GTVR+++  L P   P         R  A+
Sbjct  85   DSFLRSDMAAVTVHLHATRGRFSPLPDHLLGTVRVVLSALGPAAGP--------RRCVAL  136

Query  545  QVRRPSG-RPQGILNIGVAVLDGSKRSTPL  459
            QVRRPS  RP GI+N+GVA+LD   ++ PL
Sbjct  137  QVRRPSSLRPHGIINLGVAILDSFAKNMPL  166



>ref|XP_008437926.1| PREDICTED: uncharacterized protein LOC103483209 [Cucumis melo]
 gb|ADN34173.1| c2 domain-containing protein [Cucumis melo subsp. melo]
Length=279

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 95/154 (62%), Gaps = 7/154 (5%)
 Frame = -3

Query  893  PFRLLEITIISAQDLE-PKAKMNMR-TYTTAWINPARKQTTILDTEGGSNPMWNDKFVFK  720
            P  +LEI +ISAQDL+ P    N + TY  AWI+P+ +  T LDT GG NP WNDKF+F+
Sbjct  16   PMPVLEINLISAQDLKVPSNPFNPKHTYAVAWIHPSHRLRTRLDTIGGENPTWNDKFLFR  75

Query  719  VDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQV  540
            V   FL +ETS +  EIY +    D+L+GTVR L+GN++      ++  +    F AVQV
Sbjct  76   VSPEFLARETSGVSIEIYSLGRFCDTLVGTVRFLIGNVV-----ASNDCSATPAFTAVQV  130

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPLDRYAAGY  438
            RRPSGR  G+LNIGV V   S  ++     A GY
Sbjct  131  RRPSGRFHGVLNIGVMVNGNSDFASLNGVSAIGY  164



>ref|XP_010251574.1| PREDICTED: uncharacterized protein LOC104593437 [Nelumbo nucifera]
Length=269

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 94/153 (61%), Gaps = 13/153 (8%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAK--MNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            LLEI +ISAQ L+P +     M+TY  AWI+ A K  T +D  G  NP WNDKF+F+V  
Sbjct  7    LLEINLISAQGLKPPSANLRRMQTYAVAWIDSAIKLRTRVDRVGCENPTWNDKFIFRVSS  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
            AFL  +TSA+  EIY + +L D+LIGTVR L+GN +   +P          F+A+Q+RRP
Sbjct  67   AFLSTDTSAVSVEIYVVGYLKDTLIGTVRFLIGNCLSSSAPT---------FSALQIRRP  117

Query  530  -SGRPQGILNIGVAVLDGSKRSTPLDRYAA-GY  438
             SGR  G+LNIG  V+        L+ ++A GY
Sbjct  118  SSGRFHGVLNIGAMVIKNRTDFAALNGFSAIGY  150



>ref|XP_008801291.1| PREDICTED: uncharacterized protein LOC103715451 [Phoenix dactylifera]
Length=337

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 94/153 (61%), Gaps = 15/153 (10%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            LLE+T++SAQDL   ++ +MRTY  AWI PA K  T LD  G + P WNDKFVF+VD+A 
Sbjct  23   LLEVTVVSAQDLFANSR-SMRTYAVAWIEPAHKLRTRLDAAGHTEPTWNDKFVFRVDDAV  81

Query  704  LRQETSAIEFEIY----KITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            LR +T+A+   IY    +     D LIGT R L+  L P         +  TRF AV VR
Sbjct  82   LRSDTAAVTVNIYAARPRFLPASDILIGTARALLSALRP---------STATRFVAVLVR  132

Query  536  RP-SGRPQGILNIGVAVLDGSKRSTPLDRYAAG  441
            RP S RPQGILNIGV++LD   RS P+    AG
Sbjct  133  RPQSLRPQGILNIGVSLLDAYVRSLPIFAELAG  165



>ref|XP_009625033.1| PREDICTED: uncharacterized protein LOC104115986 [Nicotiana tomentosiformis]
Length=397

 Score =   130 bits (328),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 96/151 (64%), Gaps = 9/151 (6%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            PF++LEI +ISAQDL P +KM +RT+  A+I+P  + TT +D  G +NP WN K VF+VD
Sbjct  6    PFKILEINVISAQDLPPVSKM-LRTFAVAYIHPDHRLTTRVDHNGKTNPTWNYKMVFRVD  64

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            + FL  E++++ FEIY + WL D  IGT  L++ +  PP S     +N   R   + +RR
Sbjct  65   DKFLNSESASVTFEIYNVAWLRDLPIGTTHLMINSFFPPLSS----KNPTMRSTTLHIRR  120

Query  533  PSGRPQGILNIGVAVLDGSKRSTPLDRYAAG  441
            PSG  QG+L++ V ++D S    PL+   +G
Sbjct  121  PSGHLQGLLHVSVQLIDTS----PLEILPSG  147



>gb|EPS68074.1| hypothetical protein M569_06693, partial [Genlisea aurea]
Length=233

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 88/139 (63%), Gaps = 6/139 (4%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAK--MNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            R+LEIT+ISAQ ++P +     ++TY   W+NPA K  T +D+ GG NP WNDKF+F+V 
Sbjct  4    RILEITLISAQGIKPPSGNLRRLQTYAVTWVNPATKLRTRVDSMGGENPTWNDKFLFRVC  63

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT----RFAAV  546
              F+  +TSA+  EI+ + ++ D LIGTVR L+ +    P      +  GT     F AV
Sbjct  64   NDFISGDTSAVSVEIFAVGYIKDFLIGTVRFLLSSCFKRPGSVELSREEGTIGTPAFTAV  123

Query  545  QVRRPSGRPQGILNIGVAV  489
            Q+RRPSGR QG+LNI  AV
Sbjct  124  QIRRPSGRFQGVLNIAAAV  142



>ref|XP_007030351.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY10853.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=370

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 92/143 (64%), Gaps = 2/143 (1%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEA  708
            R+LEI +ISA+DL P +K NM+TY  AW+ P  K  T +D  G ++P WN+KF+F++D+ 
Sbjct  9    RILEINLISAEDLAPVSK-NMKTYAVAWVQPDHKLATGIDQTGRTDPSWNEKFMFRLDDK  67

Query  707  FLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNL-GTRFAAVQVRRP  531
            FL  E +AI  EIY   W+ D LIG V +L+ ++    S  +   N   TR   +Q+RRP
Sbjct  68   FLNSEDAAIVVEIYAAAWVKDVLIGYVNVLIKDIFHLRSIADAKINYSATRTVTLQIRRP  127

Query  530  SGRPQGILNIGVAVLDGSKRSTP  462
            SGRPQGILN+ V +LD +  S P
Sbjct  128  SGRPQGILNMEVILLDSTTPSVP  150



>ref|XP_010549648.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104820763 
[Tarenaya hassleriana]
Length=397

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 93/144 (65%), Gaps = 3/144 (2%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL   ++ NM+TY  AWIN  P RK TT +D    +NP+WN+KFVF+V++
Sbjct  10   VLEINVISAQDLASVSR-NMKTYAVAWINTDPMRKLTTPVDQTNRANPIWNEKFVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
              L+ + SAI  EIY   W  D+L+G+V +L+ +L  P S        G     + +RRP
Sbjct  69   KILKVDASAIVIEIYAAAWAKDALVGSVNVLLSDLFAPWSGFADGDGGGNNNXPLHIRRP  128

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            SGR QG L +GVA+LDG +RS PL
Sbjct  129  SGRLQGFLRLGVALLDGMQRSMPL  152



>ref|XP_008362824.1| PREDICTED: uncharacterized protein LOC103426513 [Malus domestica]
 ref|XP_008362377.1| PREDICTED: uncharacterized protein LOC103426067 [Malus domestica]
Length=270

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 87/139 (63%), Gaps = 11/139 (8%)
 Frame = -3

Query  884  LLEITIISAQDLEP--KAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQ L+P   A   M+TY  AW++ A K  + +D  GG NP WND+F+FKV  
Sbjct  14   VLEINLISAQGLKPPSAALRRMQTYALAWVDSAHKIRSRVDKIGGENPTWNDRFLFKVPS  73

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSP-PNHHQNLGTRFAAVQVRR  534
            AFL  ETS +  +IY +    D L+GTVRLL+ N +   S  P+        F A+Q+RR
Sbjct  74   AFLSSETSQVSIQIYAVGCFSDHLVGTVRLLINNFLDVASKVPS--------FTAIQIRR  125

Query  533  PSGRPQGILNIGVAVLDGS  477
            PSGR QG+LN+   V+DGS
Sbjct  126  PSGRFQGVLNVAAMVIDGS  144



>ref|XP_010558947.1| PREDICTED: uncharacterized protein LOC104827473 [Tarenaya hassleriana]
Length=396

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 97/147 (66%), Gaps = 6/147 (4%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWIN--PARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL   ++ NM+TY  AWIN  P RK TT +D    +NP+WN+K VF+V++
Sbjct  10   VLEINMISAQDLASVSR-NMKTYAVAWINTDPMRKLTTRVDQTNRANPIWNEKLVFRVND  68

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT---RFAAVQV  540
              L  + SAI  EIY   W  D+L+G++ +L+ +L  P S  NH    G    R   +Q+
Sbjct  69   KILNVDASAIVIEIYAAAWAKDALVGSINVLLSDLFAPWSGFNHGGGNGNNNMRLVTLQI  128

Query  539  RRPSGRPQGILNIGVAVLDGSKRSTPL  459
            RRPSGR QG+L +G+A+LDG++RS PL
Sbjct  129  RRPSGRLQGLLRLGIALLDGTQRSMPL  155



>ref|XP_010544424.1| PREDICTED: uncharacterized protein LOC104817045 [Tarenaya hassleriana]
Length=260

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 88/143 (62%), Gaps = 8/143 (6%)
 Frame = -3

Query  896  KPFRLLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            K   +L+I +ISAQ L EP  K+  M+TY   W++P+ K  T +D  G  NP+WNDKF+F
Sbjct  7    KETHVLQINLISAQGLKEPSGKLRRMQTYAVVWVDPSCKLRTRIDRIGAENPIWNDKFLF  66

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
            +V   FL +ETS +  EIY I +L D LIGTVR LV N +P  S             A+Q
Sbjct  67   QVSADFLSRETSGVSIEIYTIGYLRDHLIGTVRFLVSNFLPTVSLK------APSLLALQ  120

Query  542  VRRPSGRPQGILNIGVAVLDGSK  474
            +RRPSG+  G+LNIG  V+D S+
Sbjct  121  IRRPSGKFHGVLNIGAMVIDSSE  143



>gb|KDP28538.1| hypothetical protein JCGZ_14309 [Jatropha curcas]
Length=259

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 91/142 (64%), Gaps = 5/142 (4%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKAK--MNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            +  ++LEI +ISAQ L+P +     M+TY   WI+ + K  T +D  G  +P+WNDKF+F
Sbjct  2    EEMKILEINLISAQGLKPPSANIRRMQTYAVVWIDSSTKLRTRVDRVGSGDPIWNDKFLF  61

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
            KV   FL  ETS +  EIY + +L D+L+GTVRLL+ N+  P   PN      + F A+Q
Sbjct  62   KVSPEFLAGETSGVCVEIYAVGYLRDALLGTVRLLISNI--PLFLPNERMRTPS-FIALQ  118

Query  542  VRRPSGRPQGILNIGVAVLDGS  477
            +RRPSGR QG+LNIG  + DGS
Sbjct  119  IRRPSGRFQGLLNIGAVISDGS  140



>ref|XP_002276427.1| PREDICTED: uncharacterized protein LOC100258448 [Vitis vinifera]
Length=265

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 87/142 (61%), Gaps = 7/142 (5%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAK--MNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            +LLEI +ISAQ L+P +     M+TY  AWI+ A K  T +D  G  NP WNDKF+F+V 
Sbjct  4    QLLEIILISAQGLKPPSGNLRRMQTYAIAWIDSANKLRTQVDRVGAENPTWNDKFIFRVS  63

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTR---FAAVQ  543
              FL  +TSA+  EIY +  + D LIGTVR+L+ N +P        +N   R     AVQ
Sbjct  64   SDFLACDTSAVAVEIYAVGVIRDHLIGTVRILISNCLPAADL--RSRNFAARSPSLTAVQ  121

Query  542  VRRPSGRPQGILNIGVAVLDGS  477
            +RRPSGR  G+LN+  AV++ S
Sbjct  122  IRRPSGRFHGVLNVAAAVVNAS  143



>ref|XP_010920373.1| PREDICTED: CASP-like protein 4A1 [Elaeis guineensis]
Length=458

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 95/147 (65%), Gaps = 15/147 (10%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            LLE+T++SAQDL   ++ +MRTY  AWI+PA K  T LD  G + P WNDKFVF++D+A 
Sbjct  23   LLEVTVVSAQDLFANSR-SMRTYAVAWIDPAHKLRTRLDAAGHTEPTWNDKFVFRLDDAI  81

Query  704  LRQETSAIEFEIY----KITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            LR +T+A+   I+    +     D+LIGT R L+  L P         +  TRF AVQVR
Sbjct  82   LRSDTAAVTVNIFAARPRFLPGSDNLIGTARALLSTLRP---------STTTRFVAVQVR  132

Query  536  RP-SGRPQGILNIGVAVLDGSKRSTPL  459
            RP S RPQGILN+GV++LD   RS P+
Sbjct  133  RPQSLRPQGILNLGVSLLDAYVRSFPI  159



>ref|XP_011093241.1| PREDICTED: uncharacterized protein LOC105173247 [Sesamum indicum]
Length=262

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 90/143 (63%), Gaps = 5/143 (3%)
 Frame = -3

Query  887  RLLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +I+AQ L+ P A +  M+TY   W+NP +K  T LD+ GG NP WNDKF+F+V 
Sbjct  5    QILEINLITAQGLKTPSANLRRMQTYAVIWVNPGKKLRTRLDSLGGENPTWNDKFLFRVS  64

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIP---PPSPPNHHQNLGTRFAAVQ  543
              F+  +TSA+  EI+ + ++ D LIGTVR L+   +    P +         + F AVQ
Sbjct  65   NEFISGDTSAVSVEIFALGYIKDFLIGTVRFLLSTCLKRTIPIASAGGGSVGSSAFTAVQ  124

Query  542  VRRPSGRPQGILNIGVAVLDGSK  474
            +RRPSGR QG+LNI  AV D S+
Sbjct  125  IRRPSGRFQGVLNIATAVYDSSE  147



>ref|XP_002301388.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
 gb|EEE80661.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
Length=243

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 87/141 (62%), Gaps = 7/141 (5%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAK--MNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
             ++LEI +ISAQ L+P +     M+TY   WI+P+ K  T  D  G  NP WNDKF+FKV
Sbjct  3    MKVLEINLISAQGLKPPSANLRRMQTYAIVWIDPSTKLRTRTDRVGSENPTWNDKFLFKV  62

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNL-IPPPSPPNHHQNLGTRFAAVQV  540
               +L  ETS +  EIY I  + D+LIGTVR LVGNL +  PS      +      A+Q+
Sbjct  63   TPEYLSSETSGVSIEIYAIGCIRDALIGTVRFLVGNLRLSTPSAAITMPSC----IALQI  118

Query  539  RRPSGRPQGILNIGVAVLDGS  477
            RRPSGR  G++NIG  V+DGS
Sbjct  119  RRPSGRFHGVINIGANVIDGS  139



>ref|XP_010456220.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 87/142 (61%), Gaps = 8/142 (6%)
 Frame = -3

Query  884  LLEITIISAQDL-EPKAKM-NMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQDL EP  K+  ++TY + W++ + K  T +D  G  NP+WNDKFVF+V  
Sbjct  7    VLEINLISAQDLKEPTGKLRQLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVSP  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS +  EIY + +L D LIGTVR LV N +P  +             A+Q+RRP
Sbjct  67   EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKV------PSLVALQIRRP  120

Query  530  SGRPQGILNIGVAVLDGSKRST  465
            SG+  G+LNI   V+D S+  T
Sbjct  121  SGKFHGVLNIAAMVMDASELPT  142



>ref|XP_010262513.1| PREDICTED: uncharacterized protein LOC104601031 [Nelumbo nucifera]
Length=318

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 5/144 (3%)
 Frame = -3

Query  881  LEITIISAQDLEPKAKMNMRTYTTAWINPARK--QTTILDTEGGSNPMWNDKFVFKVDEA  708
            LEI +ISA DL P     MRTY  A ++  RK  Q+T +   G +NP WN KF+F VDE 
Sbjct  16   LEINVISALDLAPVTSA-MRTYAVACLDRERKCKQSTRIALIGHTNPTWNAKFIFPVDED  74

Query  707  FLRQETSAIEFEIYKITWL-GDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
            FL+  TS++  EIY + +L  + L+GTV +LV N I P S   H ++ G +   +QVRRP
Sbjct  75   FLKSYTSSVIIEIYALRYLFRNVLVGTVHVLVSNFIHPSSLQPHDRDYG-QLVCLQVRRP  133

Query  530  SGRPQGILNIGVAVLDGSKRSTPL  459
            S RPQG+LNI VA+LD S R  PL
Sbjct  134  SDRPQGLLNISVALLDNSVRIMPL  157



>ref|XP_008233233.1| PREDICTED: uncharacterized protein LOC103332288 [Prunus mume]
Length=273

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 10/154 (6%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKM--NMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
             R+LEI +ISAQ L+  A     M+TY  AW++ A K  + +D  G SNP WND+F+FKV
Sbjct  13   MRVLEIHLISAQGLKAPAGTLRRMQTYALAWVDSAHKLRSRVDKIGASNPTWNDRFLFKV  72

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
               FL  ETSA+  +IY +    D L+G+VR L+ N +      + H  + + F AVQ+R
Sbjct  73   PPGFLSSETSAVSVQIYAVGTFRDHLVGSVRFLINNFL------DVHSKMPS-FTAVQIR  125

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPLDRYAA-GY  438
            RPSGR  G+LN+G  V+DGS  +  ++  +A GY
Sbjct  126  RPSGRFYGVLNVGAMVIDGSDLAPAVNEMSAIGY  159



>ref|XP_011023248.1| PREDICTED: uncharacterized protein LOC105124808 [Populus euphratica]
Length=260

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 87/140 (62%), Gaps = 5/140 (4%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAK--MNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
             ++LE+ +ISAQ L+P +     M+TY   WI+P+ K  T  D  G  NP WNDKF+FKV
Sbjct  3    MKVLEVNLISAQGLKPPSANLRRMQTYAIVWIDPSTKLRTRTDRVGSENPTWNDKFLFKV  62

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
               +L  ETS +  +IY I  + D+LIGTVR LV NL  P S P     + +   A+Q+R
Sbjct  63   TPEYLSSETSGVSIQIYAIGCIRDALIGTVRFLVSNL--PLSTPRAAITMPS-CIALQIR  119

Query  536  RPSGRPQGILNIGVAVLDGS  477
            RPSGR  G++NIG  V+DGS
Sbjct  120  RPSGRFHGVINIGANVIDGS  139



>gb|KDO86360.1| hypothetical protein CISIN_1g047341mg [Citrus sinensis]
Length=254

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 14/155 (9%)
 Frame = -3

Query  887  RLLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L+ P +KM  M+TY   WI+ + K  T +D  G  +P+WN+KF+FKV 
Sbjct  4    QILEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVT  63

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNL---IPPPSPPNHHQNLGTRFAAVQ  543
              FL  ETSAI  EIY   +L D LIGTVR LV N+   +   +P          F A Q
Sbjct  64   PEFLSSETSAISVEIYASGYLRDYLIGTVRFLVSNISLSVATKTPS---------FTAFQ  114

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPLDRYAAGY  438
            +RRPSGR QG+L+IG  ++DGS      +  A GY
Sbjct  115  IRRPSGRFQGVLSIGSMLIDGSDLPAFDEVSAIGY  149



>ref|XP_006444911.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
 ref|XP_006491213.1| PREDICTED: BON1-associated protein 2-like [Citrus sinensis]
 gb|ESR58151.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
Length=254

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 14/155 (9%)
 Frame = -3

Query  887  RLLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L+ P +KM  M+TY   WI+ + K  T +D  G  +P+WN+KF+FKV 
Sbjct  4    QILEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVT  63

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNL---IPPPSPPNHHQNLGTRFAAVQ  543
              FL  ETSAI  EIY   +L D LIGTVR LV N+   +   +P          F A Q
Sbjct  64   PEFLSSETSAISVEIYASGYLRDYLIGTVRFLVSNISLSVATKTPS---------FTAFQ  114

Query  542  VRRPSGRPQGILNIGVAVLDGSKRSTPLDRYAAGY  438
            +RRPSGR QG+L+IG  ++DGS      +  A GY
Sbjct  115  IRRPSGRFQGVLSIGSMLIDGSDLPAFDEVSAIGY  149



>ref|XP_007218843.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
 gb|EMJ20042.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
Length=253

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 95/154 (62%), Gaps = 10/154 (6%)
 Frame = -3

Query  890  FRLLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
             R+LEI +ISAQ L+ P   +  M+TY  AW++ A K  + +D  G SNP WND+F+FKV
Sbjct  12   MRVLEIHLISAQGLKAPTGTLRRMQTYALAWVDSAHKLRSRVDKIGASNPTWNDRFLFKV  71

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
               FL  ETSA+  +IY +    D L+G+VR L+ N +      + H  + + F AVQ+R
Sbjct  72   PPGFLSSETSAVSVQIYTVGTFRDHLVGSVRFLINNFL------DVHSKMPS-FTAVQIR  124

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPLDRYAA-GY  438
            RPSGR  G+LN+G  V+DGS  +  ++  +A GY
Sbjct  125  RPSGRFYGVLNVGAMVIDGSDLAPAVNEMSAIGY  158



>ref|XP_010669605.1| PREDICTED: uncharacterized protein LOC104886787 [Beta vulgaris 
subsp. vulgaris]
Length=271

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 90/139 (65%), Gaps = 10/139 (7%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAK--MNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            LLEI +ISAQ+L+P +     ++TY  A+INP+RK  T +D  G  NP WNDKF+F++ +
Sbjct  20   LLEINLISAQNLKPPSTNLRRLQTYAVAYINPSRKLRTRVDRLGAENPTWNDKFIFRISD  79

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT-RFAAVQVRR  534
            AFL  +TS+   +I+ +  L D+++G+VR ++ N +   S       +G     AVQ+RR
Sbjct  80   AFLSSQTSSFTVDIFSVGVLKDAILGSVRFILSNCVTRNS-------IGLPSCVAVQIRR  132

Query  533  PSGRPQGILNIGVAVLDGS  477
            PSGR  G+LN+GV V+D S
Sbjct  133  PSGRFHGVLNVGVMVIDAS  151



>ref|XP_009111426.1| PREDICTED: uncharacterized protein LOC103836878 [Brassica rapa]
Length=256

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 86/139 (62%), Gaps = 8/139 (6%)
 Frame = -3

Query  884  LLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQ L EP  K+  ++TY + W++ + K  T +D  G  NP+WNDKFVF+V  
Sbjct  7    VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKLRTRIDRIGAENPIWNDKFVFQVSS  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS +  EIY + +L D LIGTVR LV N +P  +             A+Q+RRP
Sbjct  67   EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPS------LVALQIRRP  120

Query  530  SGRPQGILNIGVAVLDGSK  474
            SG+ +G+LNI   V+D S+
Sbjct  121  SGKFRGVLNIAAMVIDASE  139



>ref|XP_006289671.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
 gb|EOA22569.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
Length=244

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 8/140 (6%)
 Frame = -3

Query  887  RLLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ + EP  K+  ++TY + W++ + K  T +D  G  NP+WNDKFVF+V 
Sbjct  5    QVLEINLISAQGIKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  64

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
              FL  ETS +  EIY + +L D LIGTVR LV N +P  +             A+Q+RR
Sbjct  65   PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKV------PSLVALQIRR  118

Query  533  PSGRPQGILNIGVAVLDGSK  474
            PSG+  G+LNI   V+D S+
Sbjct  119  PSGKFHGVLNIAAMVMDASE  138



>ref|XP_009385178.1| PREDICTED: uncharacterized protein LOC103972545 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 15/146 (10%)
 Frame = -3

Query  881  LEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAFL  702
            LE+T+ISAQDL P A+ +MRTY  A+  P  +  T +D  G ++P WNDKFVF+VD+A L
Sbjct  41   LEVTVISAQDLYPAAR-SMRTYAVAYFRPDHRARTRIDASGHTDPTWNDKFVFRVDDAVL  99

Query  701  RQETSAIEFEIYK----ITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
              +TSAI  ++Y     +    D L+GT R L+  L P         +    +AA+Q+RR
Sbjct  100  HSDTSAITIDVYADRPGLLPGPDILLGTARALLSTLRP---------SSAIHYAALQIRR  150

Query  533  PSG-RPQGILNIGVAVLDGSKRSTPL  459
            P+  RPQGILN+GVA++D S R+ P+
Sbjct  151  PASLRPQGILNLGVALVDPSARTVPV  176



>ref|XP_006577334.1| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=208

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 87/142 (61%), Gaps = 7/142 (5%)
 Frame = -3

Query  896  KPFRLLEITIISAQDLEPKA--KMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVF  723
            K  ++LEI +ISAQ ++P +  +  ++TY   WI+PA K  T +D  GG NP WNDKF+F
Sbjct  6    KIHQVLEINLISAQGMKPPSSPRRRLQTYAVTWIDPATKLRTRVDKLGGHNPTWNDKFLF  65

Query  722  KVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQ  543
             V + FL  +TS++   IY +      L+GTVR L+ N+  P +      +    F+A Q
Sbjct  66   GVTKDFLAGDTSSVCVAIYAVGTFRHHLVGTVRFLISNMFSPDA-----DDATPCFSAFQ  120

Query  542  VRRPSGRPQGILNIGVAVLDGS  477
            +RRPSGR  G++NIG  V+DGS
Sbjct  121  IRRPSGRFHGVMNIGAMVMDGS  142



>ref|NP_192029.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 emb|CAB80929.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL87353.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45098.1| unknown protein [Arabidopsis thaliana]
 gb|AEE81993.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=250

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 8/140 (6%)
 Frame = -3

Query  887  RLLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L EP  K+  ++TY + W++ + K  T +D  G  NP+WNDKFVF+V 
Sbjct  5    QVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSSKLRTRIDRIGSENPIWNDKFVFQVS  64

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
              FL  ETS +  EIY + +L D LIGTVR LV N +P  +             A+Q+RR
Sbjct  65   PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPS------LVALQIRR  118

Query  533  PSGRPQGILNIGVAVLDGSK  474
            PSG+  G+LNI   V+D S+
Sbjct  119  PSGKFHGVLNIAAMVMDASE  138



>ref|XP_006396291.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
 gb|ESQ37744.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
Length=260

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 85/139 (61%), Gaps = 8/139 (6%)
 Frame = -3

Query  884  LLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LE+ +ISAQ L EP  K+  ++TY + W++ + K  T +D  G  NP+WNDKFVF+V  
Sbjct  13   VLELNLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVSS  72

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS +  EIY + +L D LIGTVR LV N +P  +             A+Q+RRP
Sbjct  73   DFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKV------PSLVALQIRRP  126

Query  530  SGRPQGILNIGVAVLDGSK  474
            SG+  G+LNI   V+D S+
Sbjct  127  SGKFHGVLNIAAMVIDASE  145



>ref|XP_010422779.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 85/139 (61%), Gaps = 8/139 (6%)
 Frame = -3

Query  884  LLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQ L EP  K+  ++TY + W++ + K  T +D  G  NP+WNDKFVF+V  
Sbjct  7    VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVSP  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS +  EIY + +L D LIGTVR LV N +P  +             A+Q+RRP
Sbjct  67   DFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKV------PSLVALQIRRP  120

Query  530  SGRPQGILNIGVAVLDGSK  474
            SG+  G+LNI   V+D S+
Sbjct  121  SGKFHGVLNIAAMVMDASE  139



>ref|XP_009406969.1| PREDICTED: uncharacterized protein LOC103989745 [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 93/158 (59%), Gaps = 14/158 (9%)
 Frame = -3

Query  932  HTHIYIIKMANTKPFRLLEITIISAQDLEPKAKMNMRTYTTAWINPARKQTTILDTEGGS  753
            H H   I       F LLEITIIS Q L P A  +++ Y +AW++P  K  T +D  G +
Sbjct  14   HHHSTTIGSPVAMHFHLLEITIISGQGLFP-ASRSLQAYASAWVDPKHKLYTRVDRAGVT  72

Query  752  NPMWNDKFVFKVDEAFLRQETSAIEFEIY----KITWLGDSLIGTVRLLVGNLIPPPSPP  585
            +P WNDKFVF+VD+AFLR ETSA+   ++    +++ L D L+GTVR+++  L   P   
Sbjct  73   DPTWNDKFVFRVDDAFLRSETSAVNVHLHAARGRLSPLRDHLLGTVRVVLSALRLAPG--  130

Query  584  NHHQNLGTRFAAVQVRRPSG-RPQGILNIGVAVLDGSK  474
                    R  A+QVRRPS   P GILN+GVA+ D  K
Sbjct  131  ------AGRCVALQVRRPSTLCPHGILNLGVALHDSDK  162



>ref|XP_011093070.1| PREDICTED: uncharacterized protein LOC105173112 [Sesamum indicum]
Length=258

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 84/140 (60%), Gaps = 2/140 (1%)
 Frame = -3

Query  890  FRLLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
             ++LEI +ISAQ L+ P   +  ++TY   WIN A K  T  D+ GG NP WNDKF+F+V
Sbjct  3    MQILEIDLISAQGLKTPSGNLRRLQTYAVTWINSAAKLRTCTDSLGGENPNWNDKFLFRV  62

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
               F+ +ETSA+  EI+ +  + D LIG+VR L+   +   +P          F AVQ+R
Sbjct  63   SNEFISRETSAVAVEIFVVGRIKDILIGSVRFLLSTCLKRATPLASGSTGTPVFTAVQIR  122

Query  536  RPSGRPQGILNIGVAVLDGS  477
            RPSGR QG+LNI  AV   S
Sbjct  123  RPSGRFQGVLNIAAAVYHSS  142



>gb|KDP30266.1| hypothetical protein JCGZ_17048 [Jatropha curcas]
Length=200

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 88/141 (62%), Gaps = 9/141 (6%)
 Frame = -3

Query  890  FRLLEITIISAQDLEP--KAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
             ++LEI +ISAQ L P   ++  M+TY    I+ + K  + +D +GG +P+W DKF+FKV
Sbjct  1    MKILEINLISAQGLNPPSSSRRRMQTYAVVSIDSSTKLRSRIDLDGGEDPIWGDKFLFKV  60

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT-RFAAVQV  540
               FL  ET+++  EI+ +  L D L+GTVRLL+ N+      P   Q + T  F A+Q+
Sbjct  61   TPEFLSGETTSVSVEIFAVGCLRDKLLGTVRLLISNI------PLFSQEMRTPSFVAMQI  114

Query  539  RRPSGRPQGILNIGVAVLDGS  477
            RRPSGR QG+LNIG  + D S
Sbjct  115  RRPSGRFQGLLNIGAIIHDAS  135



>ref|XP_010427687.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=256

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 84/139 (60%), Gaps = 8/139 (6%)
 Frame = -3

Query  884  LLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQ L EP  K+  ++TY + W+  + K  T +D  G  NP+WNDKFVF+V  
Sbjct  7    VLEINLISAQRLKEPTGKLRRLQTYASVWVESSNKLRTRIDRIGAENPIWNDKFVFQVSP  66

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS +  EIY + +L D LIGTVR LV N +P  +             A+Q+RRP
Sbjct  67   EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKV------PSLVALQIRRP  120

Query  530  SGRPQGILNIGVAVLDGSK  474
            SG+  G+LNI   V+D S+
Sbjct  121  SGKFHGVLNIAAMVMDASE  139



>gb|EAY87999.1| hypothetical protein OsI_09421 [Oryza sativa Indica Group]
Length=281

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRT-YTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
             +LLE+T+ISAQDL  +    +R  Y  AW + A K  T +D  GG++P WND+F+F+VD
Sbjct  23   LQLLEVTVISAQDLHRRLGRRVRAAYAVAWADVAHKLRTGVDLAGGADPTWNDRFLFRVD  82

Query  713  EAFLRQETSAIEFEIYK-ITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            EAFLR +T+A+  E+     + GD+++G  R++V   +   S  +     G + AA+Q+R
Sbjct  83   EAFLRSDTAAVTVEVRAPRRFGGDAVLGVTRIVVSTFVGSAS-SSARGTTGRQVAALQLR  141

Query  536  RP-SGRPQGILNIGVAVLDGSK-RSTPL  459
            RP S RPQGI+N+ VAVLD +  R+ PL
Sbjct  142  RPRSLRPQGIVNVAVAVLDATDARAVPL  169



>ref|XP_003553776.1| PREDICTED: uncharacterized protein LOC100793541 [Glycine max]
Length=260

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 85/139 (61%), Gaps = 7/139 (5%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKA--KMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L+P +  +  ++TY   WI+PA K  T +D  GG NP WNDKF+F+V 
Sbjct  9    QVLEINLISAQGLKPPSSPRRRLQTYAVTWIDPATKLRTRVDKLGGHNPTWNDKFLFRVT  68

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
              FL  +TS++   IY +    D L+GTVR L+ N+  P +           F+A Q+RR
Sbjct  69   PDFLAGDTSSVCVAIYAVGTFRDHLVGTVRFLISNMFSPDA-----DYATPCFSAFQIRR  123

Query  533  PSGRPQGILNIGVAVLDGS  477
            PSGR  G++NIG  V+D S
Sbjct  124  PSGRFHGVMNIGAMVMDSS  142



>ref|XP_006339653.1| PREDICTED: uncharacterized protein LOC102592387 [Solanum tuberosum]
Length=269

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 88/143 (62%), Gaps = 5/143 (3%)
 Frame = -3

Query  887  RLLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L+ P A +  M+TY   W++ + K  T +D  GG NP WNDKF+F+V 
Sbjct  6    QILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKLRTKIDHLGGENPTWNDKFLFRVS  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT-RFAAVQVR  537
              F+  ETS +  EIY + ++ D LIGTVRLL+ + +   +  NH     T  F AVQVR
Sbjct  66   PEFISGETSGVSVEIYAVGYIKDFLIGTVRLLISSCLKGIA--NHGITTATPAFTAVQVR  123

Query  536  RPSGRPQGILNIGVAVLDGSKRS  468
            RPSGR  G+LNI  AV   S  S
Sbjct  124  RPSGRFHGVLNIAAAVYCSSDFS  146



>gb|EYU38921.1| hypothetical protein MIMGU_mgv1a022778mg [Erythranthe guttata]
Length=242

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 86/139 (62%), Gaps = 8/139 (6%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAKMNMR---TYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKV  717
            ++LEI +ISAQ L+P +  N+R   TY   WI+PA K  T +D+ GG NP WNDKF+F+V
Sbjct  4    QILEINLISAQGLKPPS-ANLRRIQTYAITWIDPATKLRTHVDSVGGENPTWNDKFLFRV  62

Query  716  DEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT----RFAA  549
             + F+  +TSA+  EI+ + ++ D LIGTVR L+   +   + P      G+        
Sbjct  63   SDEFIAGDTSAVAVEIFAVGYIKDILIGTVRFLLSTCLKRAASPIDSAGEGSIGTPSCTG  122

Query  548  VQVRRPSGRPQGILNIGVA  492
            +Q+RRPSGR QG+LNI  A
Sbjct  123  LQIRRPSGRFQGVLNIAAA  141



>ref|XP_007147256.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
 gb|ESW19250.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
Length=249

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 89/149 (60%), Gaps = 13/149 (9%)
 Frame = -3

Query  908  MANTKPFRLLEITIISAQDLEPKA--KMNMRTYTTAWINPARKQTTILDTEGGSNPMWND  735
            M + K  ++LEI +ISAQ L+P +  +  ++TY   WI+P  K  T +D  GG NP WND
Sbjct  1    MPSPKTHQVLEINLISAQGLKPPSSPRRRLQTYAVTWIHPDTKLRTRVDKLGGHNPTWND  60

Query  734  KFVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLI---PPPSPPNHHQNLG  564
            KF+F+V   FL  +TS+I   IY +    D L+GT+R L+ N++      S P       
Sbjct  61   KFLFRVSPEFLSSDTSSICIAIYAVGTFRDHLVGTLRFLISNILSRDADESTPC------  114

Query  563  TRFAAVQVRRPSGRPQGILNIGVAVLDGS  477
              F+A Q+RRPSGR  G++NIG  V++GS
Sbjct  115  --FSAFQIRRPSGRFHGVMNIGAMVMEGS  141



>ref|XP_002872904.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49163.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 84/139 (60%), Gaps = 8/139 (6%)
 Frame = -3

Query  884  LLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQ L EP  K+  ++TY + W++ + K  T +D  G  NP+WNDKFVF+V  
Sbjct  6    VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGSENPIWNDKFVFQVSP  65

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS +  EIY + +L D  IGTVR LV N +P  +             A+Q+RRP
Sbjct  66   EFLSSETSGVSIEIYAVGYLRDHQIGTVRFLVSNFLPTAAVKV------PSLVALQIRRP  119

Query  530  SGRPQGILNIGVAVLDGSK  474
            SG+  G+LNI   V+D S+
Sbjct  120  SGKFHGVLNIAAMVMDASE  138



>ref|XP_010092894.1| hypothetical protein L484_022489 [Morus notabilis]
 gb|EXB52712.1| hypothetical protein L484_022489 [Morus notabilis]
Length=266

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 91/154 (59%), Gaps = 14/154 (9%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMN--MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQ L+P +  +  + TY   WI+   K  T +D  GG NP WND+F+F+V  
Sbjct  12   VLEINLISAQGLKPSSGSSRPVHTYALIWIDSTTKLRTGVDKVGGENPTWNDRFLFRVTP  71

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNL--IPPPSPPNHHQNLGTRFAAVQVR  537
             FL  +TS I  EIY +  + DSLIGTVRLL+GN   +   +P          F A+Q+R
Sbjct  72   EFLSGDTSGIYVEIYTVGRIRDSLIGTVRLLIGNFLDVRAKTPS---------FTALQIR  122

Query  536  RPSGRPQGILNIGVAVLDGSKRSTPL-DRYAAGY  438
            RPSGR  G+LN+G  V+ G+  +  L +R A  Y
Sbjct  123  RPSGRFHGVLNVGATVISGADFAIALSNRSAIAY  156



>ref|XP_009347863.1| PREDICTED: uncharacterized protein LOC103939495 [Pyrus x bretschneideri]
Length=271

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 84/139 (60%), Gaps = 11/139 (8%)
 Frame = -3

Query  884  LLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI ++SAQ L+ P   +  M+TY  AW++ A K  + LD  GG NP WND+ +FKV  
Sbjct  14   VLEINLVSAQGLKAPSVTLRRMQTYALAWVDSAHKIRSRLDKVGGENPTWNDRCLFKVPS  73

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSP-PNHHQNLGTRFAAVQVRR  534
             FL  ETS +  +IY +    D L+GTVR L+ N +   S  P+        F A+Q+RR
Sbjct  74   GFLSSETSQVSVQIYAVGCFRDHLVGTVRFLINNFLDVSSTIPS--------FTAIQIRR  125

Query  533  PSGRPQGILNIGVAVLDGS  477
            PSGR +G+LN+   V+DGS
Sbjct  126  PSGRFRGVLNVAALVIDGS  144



>emb|CDY48509.1| BnaA09g00140D [Brassica napus]
Length=1733

 Score =   120 bits (301),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 86/139 (62%), Gaps = 8/139 (6%)
 Frame = -3

Query  884   LLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
             +LEI +ISAQ L EP  K+  ++TY + W++ + K  T +D  G  NP+WNDKFVF+V  
Sbjct  1012  VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKLRTRIDRIGAENPIWNDKFVFQVSS  1071

Query  710   AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
              FL  ETS +  EIY + +L D LIGTVR LV N +P  +             A+Q+RRP
Sbjct  1072  EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEK------VPSLVALQIRRP  1125

Query  530   SGRPQGILNIGVAVLDGSK  474
             SG+ +G+LNI   V+D S+
Sbjct  1126  SGKFRGVLNIAAMVIDASE  1144



>ref|XP_004229965.1| PREDICTED: BON1-associated protein 2 [Solanum lycopersicum]
Length=270

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 87/143 (61%), Gaps = 5/143 (3%)
 Frame = -3

Query  887  RLLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L+ P A +  M+TY   W++ + K  T +D  GG NP WNDKF+F+V 
Sbjct  6    QILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKLRTKIDHLGGENPTWNDKFLFRVS  65

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT-RFAAVQVR  537
              F+  ETS +  EIY + ++ D LIGTVRLL+ + +   +   H     T  F AVQVR
Sbjct  66   PEFISGETSGVSVEIYAVGYIKDFLIGTVRLLISSCLKGIA--KHGITTATPAFNAVQVR  123

Query  536  RPSGRPQGILNIGVAVLDGSKRS  468
            RPSGR  G+LNI  AV   S  S
Sbjct  124  RPSGRFHGVLNIAAAVYSSSDFS  146



>emb|CDY07180.1| BnaCnng01950D [Brassica napus]
Length=1640

 Score =   120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 86/139 (62%), Gaps = 8/139 (6%)
 Frame = -3

Query  884   LLEITIISAQDL-EPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
             +LEI +ISAQ L EP  K+  ++TY + W++ + K  T +D  G  NP+WNDKFVF+V  
Sbjct  1016  VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSDKLRTRIDRIGAENPIWNDKFVFQVSS  1075

Query  710   AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
              FL  ETS +  EIY + +L D LIGTVR LV N +P  +             A+Q+RRP
Sbjct  1076  EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEK------VPSLVALQIRRP  1129

Query  530   SGRPQGILNIGVAVLDGSK  474
             SG+ +G+LNI   V+D S+
Sbjct  1130  SGKFRGVLNIAAMVIDASE  1148



>ref|XP_008679175.1| PREDICTED: uncharacterized protein LOC103654122 [Zea mays]
 gb|AFW64016.1| hypothetical protein ZEAMMB73_220242 [Zea mays]
Length=271

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 93/152 (61%), Gaps = 12/152 (8%)
 Frame = -3

Query  902  NTKPFRLLEITIISAQDLEPKAKMNMR-TYTTAWINPARKQTTILDTEGGSNPMWNDKFV  726
             + P  LLE+T+ISAQDL+ +        Y  AW +  +K  T +D  GG+ P WND+F+
Sbjct  11   GSSPSHLLEVTVISAQDLQRRRLGRRVRAYAVAWADARQKLRTGVDHAGGAAPTWNDRFL  70

Query  725  FKVDEAFLRQETSAIEFEIYKITWL-GDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAA  549
            F+VD AFLR ET+A+  E+     L GD+++G  R++V   + P          G + AA
Sbjct  71   FRVDGAFLRSETAAVTVEVRGAGVLGGDTVLGVTRIVVSTFVRPAG--------GAQVAA  122

Query  548  VQVRRP-SGRPQGILNIGVAVLDGSKRSTPLD  456
            +Q+RRP S RPQGI+N+ VA+LD + R+ PLD
Sbjct  123  LQLRRPRSLRPQGIVNVAVALLD-AARAPPLD  153



>ref|XP_009350266.1| PREDICTED: uncharacterized protein LOC103941795 [Pyrus x bretschneideri]
 ref|XP_009350267.1| PREDICTED: uncharacterized protein LOC103941796 [Pyrus x bretschneideri]
Length=271

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 84/139 (60%), Gaps = 11/139 (8%)
 Frame = -3

Query  884  LLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI ++SAQ L+ P   +  M+TY  AW++ A K  + +D  GG NP WND+ +FKV  
Sbjct  14   VLEINLVSAQGLKAPSVTLRRMQTYALAWVDSAHKIRSRVDKVGGENPTWNDRCLFKVPS  73

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSP-PNHHQNLGTRFAAVQVRR  534
             FL  ETS +  +IY +    D L+GTVR L+ N +   S  P+        F A+Q+RR
Sbjct  74   GFLSSETSQVSVQIYAVGCFRDHLVGTVRFLINNFLDVSSAIPS--------FTAIQIRR  125

Query  533  PSGRPQGILNIGVAVLDGS  477
            PSGR +G+LN+   V+DGS
Sbjct  126  PSGRFRGVLNVAALVIDGS  144



>ref|XP_009764572.1| PREDICTED: uncharacterized protein LOC104216252 [Nicotiana sylvestris]
Length=263

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 85/139 (61%), Gaps = 15/139 (11%)
 Frame = -3

Query  887  RLLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L+ P   +  M+TY   W+N + K  T +D  GG NP WNDKF+F+V 
Sbjct  7    QILEINLISAQSLKTPITNLRRMQTYALLWVNSSNKLRTKIDHFGGENPTWNDKFLFRVS  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGN----LIPPPSPPNHHQNLGTRFAAV  546
              F+  +TS +  EIY +  L D L+GTVRLL+ +    ++   +P          F AV
Sbjct  67   PKFISGDTSGVSVEIYAVGVLKDFLVGTVRLLLSSCFKGMVNTATPA---------FTAV  117

Query  545  QVRRPSGRPQGILNIGVAV  489
            Q+RRPSGR QG+LNIG AV
Sbjct  118  QIRRPSGRFQGVLNIGAAV  136



>emb|CDP08734.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 81/137 (59%), Gaps = 3/137 (2%)
 Frame = -3

Query  887  RLLEITIISAQDLE--PKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L+    ++  M TY  AW++P  K  T  D  G  NP WNDKF+F+V 
Sbjct  21   QILEINLISAQGLKTPSGSRRRMHTYALAWVDPTAKLRTRTDRVGAENPTWNDKFLFRVS  80

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT-RFAAVQVR  537
              FL  ETS +  EIY + ++ D LIGTVR L+ + +           +GT  F AVQ++
Sbjct  81   SRFLACETSGVTVEIYAVGYIRDYLIGTVRFLLSSCLGKFPSSADAIAIGTPAFTAVQIQ  140

Query  536  RPSGRPQGILNIGVAVL  486
            RPSGR  G+LNI  +V 
Sbjct  141  RPSGRFHGVLNIAASVC  157



>ref|XP_010055064.1| PREDICTED: uncharacterized protein LOC104443389 [Eucalyptus grandis]
 gb|KCW71540.1| hypothetical protein EUGRSUZ_E00081 [Eucalyptus grandis]
Length=267

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 91/152 (60%), Gaps = 6/152 (4%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMNMR---TYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            +LE+ +ISAQ+L+P    NMR   TY+  W++P+ K  T LD  G  NP WNDKF F+V 
Sbjct  11   ILELHLISAQNLKPPPA-NMRRTETYSLVWVDPSTKLRTRLDRVGSDNPTWNDKFFFRVG  69

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
              FL   TSA+  EIY + ++ D L+G+VRLL+  ++  P    + +     F AV +RR
Sbjct  70   PDFLSSHTSAVTVEIYAVGYIRDYLVGSVRLLLSTVLSWPDFVGNSKL--PYFTAVGIRR  127

Query  533  PSGRPQGILNIGVAVLDGSKRSTPLDRYAAGY  438
            PSG+  G+LNIG+ + +GS  +      A GY
Sbjct  128  PSGKIHGVLNIGIMLTNGSDFTALKGASAIGY  159



>ref|XP_004494776.1| PREDICTED: uncharacterized protein LOC101496947 [Cicer arietinum]
Length=260

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 81/138 (59%), Gaps = 7/138 (5%)
 Frame = -3

Query  884  LLEITIISAQDLEPKA--KMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQ L+P +  +   +TY   WI+ + K  T +D  GG NP WNDKF+F+V  
Sbjct  10   VLEINLISAQGLKPPSSPRRRFQTYALTWIDSSTKLRTQVDKIGGQNPTWNDKFLFRVTP  69

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS +   IY +    D ++GTVR L  N++      +   N    F+A Q+RR 
Sbjct  70   EFLASETSGVCVAIYAVGTFRDHIVGTVRFLTSNIL-----SSDGGNRTPCFSACQIRRE  124

Query  530  SGRPQGILNIGVAVLDGS  477
            SGR  G++NIG  V+DGS
Sbjct  125  SGRFHGVMNIGAMVIDGS  142



>ref|XP_010914471.1| PREDICTED: uncharacterized protein LOC105039856 [Elaeis guineensis]
Length=251

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 86/143 (60%), Gaps = 19/143 (13%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAKM-NMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LLEI +ISAQ L+P  ++ +++ Y  AW+ PA K  T++D  GG NP WNDKF+F+V  
Sbjct  4    QLLEINLISAQSLKPPFRLRHVQAYAVAWVEPAFKVRTLVDRTGGENPTWNDKFIFRVPS  63

Query  710  AFLRQE-TSAIEFEIYKITW--LGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTR-----F  555
             FL  + TS +  EIY      L D L+GTVRLLVGNL          + L  R     F
Sbjct  64   GFLANDSTSTVAVEIYAAAGRILPDPLLGTVRLLVGNL----------RLLSRRRDCPAF  113

Query  554  AAVQVRRPSGRPQGILNIGVAVL  486
             AV +RRPSGR  G+LN+G  +L
Sbjct  114  DAVGIRRPSGRFHGVLNVGATIL  136



>ref|XP_004308328.1| PREDICTED: uncharacterized protein LOC101301728 [Fragaria vesca 
subsp. vesca]
Length=293

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 91/162 (56%), Gaps = 12/162 (7%)
 Frame = -3

Query  911  KMANTKPFRLLEITIISAQDLEPKAKM--NMRTYTTAWINPARKQTTILDTEGGSNPMWN  738
            K+   +  ++LEI +IS Q L+P +     M+TY  AW+  + K  T +D  G  NP WN
Sbjct  3    KVGAVEKMQVLEINLISGQGLKPPSGTLRRMKTYAVAWVESSHKIRTRVDKVGAENPTWN  62

Query  737  DKFVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSP-PNHHQNLGT  561
            D+F+FKV   FL +ETS I  EIY +    D L+GTVRL++ N +   S  P+       
Sbjct  63   DRFLFKVSSEFLARETSGITIEIYAVGSFRDHLVGTVRLILSNFLDLDSKIPS-------  115

Query  560  RFAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPLDRYAA-GY  438
             F A+Q+RR SGR  G+LN+   V   S+ S  LD  +A GY
Sbjct  116  -FTALQIRRRSGRFHGVLNVAALVNHESEWSKELDDVSAIGY  156



>ref|XP_008798687.1| PREDICTED: uncharacterized protein LOC103713510 [Phoenix dactylifera]
Length=238

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 83/137 (61%), Gaps = 9/137 (7%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEA  708
            +LEI +ISAQ L+P   +  ++ Y  AW++PA K  T +D  GG NP WNDKF+F+V   
Sbjct  5    VLEINLISAQGLKPPFGLRRVQAYAVAWVDPAFKVRTRVDRTGGENPTWNDKFIFRVPAG  64

Query  707  FLRQE-TSAIEFEIYKIT-W-LGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            FL  + TSA+  EIY    W L D L+GTVRLLVGNL          +     F AV +R
Sbjct  65   FLADDSTSAVSIEIYAAAGWILPDPLLGTVRLLVGNLR-----LLSRRRACPAFDAVGIR  119

Query  536  RPSGRPQGILNIGVAVL  486
            RPSGR  GILN+G  +L
Sbjct  120  RPSGRFHGILNVGATLL  136



>emb|CDP17419.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 5/137 (4%)
 Frame = -3

Query  887  RLLEITIISAQDLE--PKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L+    ++  M+TY  AW++PA K  T  D  G  NP WN+ F+F+V 
Sbjct  20   QILEINLISAQGLKTPSGSRRRMQTYALAWVDPATKLRTRTDRVGAENPTWNELFLFRVS  79

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT-RFAAVQVR  537
              FL  E S +  EIY + ++ D LIGTVR L+ + +     P+    +GT  F AVQ+R
Sbjct  80   SHFLACEPSGVTVEIYAVGYIRDYLIGTVRFLLSSCL--GKFPSSADAIGTPAFTAVQIR  137

Query  536  RPSGRPQGILNIGVAVL  486
            RPSGR  G+LNI  +V 
Sbjct  138  RPSGRFHGVLNIAASVC  154



>ref|XP_008791481.1| PREDICTED: uncharacterized protein LOC103708363 [Phoenix dactylifera]
Length=244

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 86/153 (56%), Gaps = 23/153 (15%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            +  LEI +I AQ L+P A     + Y  AW++PA K  T +D  GG NP WNDKF+F V 
Sbjct  3    YHFLEINLICAQGLKPPAGFRRAQAYAVAWVDPAFKLRTRVDRTGGENPTWNDKFIFHVP  62

Query  713  EAFLRQE-TSAIEFEIYKIT-W-LGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTR-----  558
              FL  + +SA+  EIY    W L DSL+GTVRLLVGNL          + L  R     
Sbjct  63   AGFLADDSSSAVSVEIYATAGWILTDSLLGTVRLLVGNL----------RLLSRRDGCPV  112

Query  557  FAAVQVRRPSGRPQGILNIGVAVLDGSKRSTPL  459
            F AV +RRPSGR  G+LN+G  +L    R  PL
Sbjct  113  FDAVGIRRPSGRLHGVLNVGAMLL----RRVPL  141



>gb|AES82742.2| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=256

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 86/138 (62%), Gaps = 4/138 (3%)
 Frame = -3

Query  884  LLEITIISAQDLEPKA--KMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQ L+P +  + N +TY   WI+ + K  T +D  GG NP WNDKF+F++  
Sbjct  14   VLEINLISAQGLKPPSSPRRNFQTYALTWIDSSTKLRTRVDKIGGQNPTWNDKFLFRITP  73

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS +   IY +    D L+GTVR L+ N++   S  + ++     F+AVQ+RRP
Sbjct  74   EFLASETSGVSVAIYAVGTFRDHLVGTVRFLISNILSSSSADSGNRT--PCFSAVQIRRP  131

Query  530  SGRPQGILNIGVAVLDGS  477
            SG   GILNIG  V+DGS
Sbjct  132  SGSFCGILNIGAMVVDGS  149



>emb|CAN79006.1| hypothetical protein VITISV_040896 [Vitis vinifera]
Length=380

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 7/142 (5%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAK--MNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            +LLEI +IS QDL+P +     M+T    W++ A K  T +D  G  NP WNDKF+F+  
Sbjct  27   QLLEIILISTQDLKPPSGNLRRMQTCALVWVDSANKLRTQVDRVGVENPTWNDKFIFRAS  86

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTR---FAAVQ  543
              FL   TS +  EIY +  + D LIGTVR+L+ N +P     +  +N   R     AVQ
Sbjct  87   SDFLACATSIVAVEIYAVGVIRDHLIGTVRILISNCLPAADLRS--RNFAARSPSLTAVQ  144

Query  542  VRRPSGRPQGILNIGVAVLDGS  477
            +RRPSGR   +LN+  AV++ S
Sbjct  145  IRRPSGRFHSVLNVAAAVVNAS  166



>ref|XP_003626524.1| hypothetical protein MTR_7g116840 [Medicago truncatula]
Length=284

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 86/138 (62%), Gaps = 4/138 (3%)
 Frame = -3

Query  884  LLEITIISAQDLEPKA--KMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LEI +ISAQ L+P +  + N +TY   WI+ + K  T +D  GG NP WNDKF+F++  
Sbjct  14   VLEINLISAQGLKPPSSPRRNFQTYALTWIDSSTKLRTRVDKIGGQNPTWNDKFLFRITP  73

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP  531
             FL  ETS +   IY +    D L+GTVR L+ N++   S  + ++     F+AVQ+RRP
Sbjct  74   EFLASETSGVSVAIYAVGTFRDHLVGTVRFLISNILSSSSADSGNRT--PCFSAVQIRRP  131

Query  530  SGRPQGILNIGVAVLDGS  477
            SG   GILNIG  V+DGS
Sbjct  132  SGSFCGILNIGAMVVDGS  149



>ref|XP_010914657.1| PREDICTED: uncharacterized protein LOC105039993 [Elaeis guineensis]
Length=251

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 84/143 (59%), Gaps = 19/143 (13%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            +LLEI +ISAQ L+P   +  ++ Y  AW+ PA K  T++D  GG NP WNDKF+F+V  
Sbjct  4    QLLEINLISAQSLKPPFGLRRVQAYAVAWVEPAFKVRTLVDRTGGENPTWNDKFIFRVPS  63

Query  710  AFLRQET-SAIEFEIYKITW--LGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTR-----F  555
             FL  ++ S +  EIY      L D L+GTVRLLVGNL          + L  R     F
Sbjct  64   GFLANDSASTVAVEIYAAAGRILPDPLLGTVRLLVGNL----------RLLSRRRDCPAF  113

Query  554  AAVQVRRPSGRPQGILNIGVAVL  486
             AV +RRPSGR  G+LN+G  +L
Sbjct  114  DAVGIRRPSGRFHGVLNVGATLL  136



>ref|XP_003572941.1| PREDICTED: uncharacterized protein LOC100843074 [Brachypodium 
distachyon]
Length=278

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 92/153 (60%), Gaps = 8/153 (5%)
 Frame = -3

Query  899  TKPFRLLEITIISAQDLEPKAKMNMR----TYTTAWINPARKQTTILDTEGGSNPMWNDK  732
            + P  LLE+T+ISAQDL        R     Y  AW + ARK  T +D  GG++P WND+
Sbjct  10   SPPPHLLEVTVISAQDLHRGRLGLGRRRVRAYAMAWTDGARKLRTGVDLAGGADPTWNDR  69

Query  731  FVFKVDEAFLRQETSAIEFEIYKITWL--GDSLIGTVRLLVGNLIPPPSPPNHHQNLGTR  558
            F+F+VD  FLR ET+++  E+     L  GD+++G  R++V   +   S  +     G +
Sbjct  70   FLFRVDPGFLRSETASVAVEVRGARSLLGGDAVLGHTRIVVSAFV-SASRGDGRPIGGRQ  128

Query  557  FAAVQVRRP-SGRPQGILNIGVAVLDGSKRSTP  462
             AA+Q+RRP S RPQGI+N+ VA+LDG+  + P
Sbjct  129  VAALQLRRPRSLRPQGIVNVAVALLDGATHAVP  161



>ref|XP_009591358.1| PREDICTED: uncharacterized protein LOC104088405 [Nicotiana tomentosiformis]
Length=267

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 84/136 (62%), Gaps = 5/136 (4%)
 Frame = -3

Query  887  RLLEITIISAQDLE-PKAKMN-MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            ++LEI +ISAQ L+ P A    ++TY   +++ + K  T +D  GG NP WNDKF+F+V 
Sbjct  7    QILEINLISAQSLKTPIANFRRLQTYALIFVDSSNKLRTKIDHFGGENPTWNDKFLFRVS  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGT-RFAAVQVR  537
              F+  +TS +  EIY +  L D L+GTVRLL+ +        N   +  T  F AVQ+R
Sbjct  67   PKFISGDTSGVSVEIYAVGVLKDFLVGTVRLLLSSCF--KGMVNSGISTATPVFTAVQIR  124

Query  536  RPSGRPQGILNIGVAV  489
            RPSGR QG+LNIG AV
Sbjct  125  RPSGRFQGVLNIGAAV  140



>ref|XP_009400560.1| PREDICTED: uncharacterized protein LOC103984726 [Musa acuminata 
subsp. malaccensis]
Length=251

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 83/136 (61%), Gaps = 9/136 (7%)
 Frame = -3

Query  881  LEITIISAQDLEPKA-KMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAF  705
            LEI +ISAQ L+P      ++ Y   WI+ + K  T++D  GG NP WNDKF+F+V  +F
Sbjct  11   LEINLISAQGLQPPGGNRRLQAYAVIWIDSSIKLRTLVDRVGGENPTWNDKFLFRVHPSF  70

Query  704  LRQET-SAIEFEIYKIT--WLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
            L  ++  A   EIY     +L DSL+G+VR LVGNL       + H +    F AV +RR
Sbjct  71   LAYDSPCAYSVEIYAAGGWYLPDSLVGSVRFLVGNL----RLLSRHSDRPV-FDAVGIRR  125

Query  533  PSGRPQGILNIGVAVL  486
            PSGR QG+LN+G AVL
Sbjct  126  PSGRFQGVLNVGAAVL  141



>gb|ABK22654.1| unknown [Picea sitchensis]
Length=203

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 76/131 (58%), Gaps = 4/131 (3%)
 Frame = -3

Query  887  RLLEITIISAQDLEP-KAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDE  711
            R +E+ IISAQDLE  K    MR Y   +I+P  K +T +D  GG NP WN+  V + D+
Sbjct  16   RAIEVRIISAQDLEDVKLIGKMRCYAVLYIDPEHKASTRIDENGGINPFWNELLVLQADD  75

Query  710  AFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQN-LGTRFAAVQVRR  534
              L Q  +A+  +IY    + D L+GT R+L+  ++      N + N +G     V VRR
Sbjct  76   ELLSQNMAAVNVDIYARGHMRDKLVGTSRILISQVLKGGDAANLYDNPIGC--MPVLVRR  133

Query  533  PSGRPQGILNI  501
            PSGRPQGILNI
Sbjct  134  PSGRPQGILNI  144



>ref|NP_001048499.1| Os02g0815100 [Oryza sativa Japonica Group]
 dbj|BAD21672.1| C2 domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF10413.1| Os02g0815100 [Oryza sativa Japonica Group]
 dbj|BAG98521.1| unnamed protein product [Oryza sativa Japonica Group]
Length=285

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 91/148 (61%), Gaps = 5/148 (3%)
 Frame = -3

Query  890  FRLLEITIISAQDLEPKAKMNMRTYTTAWINPA-RKQTTILDTEGGSNPMWNDKFVFKVD  714
             +LLE+T+ISAQDL  +    +R         A  K  T +D  GG++P WND+F+F+V+
Sbjct  27   LQLLEVTVISAQDLHRRLGRRVRAAYAVAWADAAHKLRTGVDLAGGADPTWNDRFLFRVE  86

Query  713  EAFLRQETSAIEFEIYK-ITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVR  537
            EAFLR +T+A+  E+     + GD+++G  R++V   +   S  +     G + AA+Q+R
Sbjct  87   EAFLRSDTAAVTVEVRAPRRFGGDAVLGVTRIVVSTFVGSAS-SSARGTTGRQVAALQLR  145

Query  536  RP-SGRPQGILNIGVAVLDGSK-RSTPL  459
            RP S RPQGI+N+ VAVLD +  R+ PL
Sbjct  146  RPRSLRPQGIVNVAVAVLDATDARAVPL  173



>gb|AFG52315.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52316.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52319.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52325.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52327.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52330.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 2/123 (2%)
 Frame = -3

Query  860  AQDLEPKAKM-NMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAFLRQETSA  684
            A+DL+   ++  M+ Y  A+I+P  K +T +D +GG NP W+ K V   D+  L    +A
Sbjct  1    AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  683  IEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSGRPQGILN  504
            I  +IY  + + D L+GT R+LV +L+    P N   N   + +AVQVRRPSGRPQGILN
Sbjct  61   ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANPSDN-PIQCSAVQVRRPSGRPQGILN  119

Query  503  IGV  495
            I V
Sbjct  120  IWV  122



>gb|ABK23345.1| unknown [Picea sitchensis]
Length=194

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 67/109 (61%), Gaps = 1/109 (1%)
 Frame = -3

Query  827  MRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAFLRQETSAIEFEIYKITWLG  648
            MR Y  A+I+P +K +T +D +GG NP WN+K V   D+  L    +AI  EIY  + + 
Sbjct  1    MRCYAVAYIDPEQKASTRIDQDGGINPTWNEKLVLAADDELLSNVLAAITVEIYSYSHIR  60

Query  647  DSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSGRPQGILNI  501
            D L+GT R+L+ +L+    P N   N   +  AVQVRRPS RPQGILN+
Sbjct  61   DKLVGTARILISDLLKGGDPANPSDN-PIQCIAVQVRRPSSRPQGILNV  108



>gb|AFG52320.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52321.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52326.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 2/123 (2%)
 Frame = -3

Query  860  AQDLEPKAKM-NMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAFLRQETSA  684
            A+DL+   ++  M+ Y  A+I+P  K +T +D +GG NP W+ K V   D+  L    +A
Sbjct  1    AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  683  IEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSGRPQGILN  504
            I  +IY  + + D L+GT R+LV +L+    P N   N   + +AVQVRRPSGRPQGILN
Sbjct  61   ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANPFDN-PIQCSAVQVRRPSGRPQGILN  119

Query  503  IGV  495
            I V
Sbjct  120  IWV  122



>gb|AEW08214.1| hypothetical protein 2_3193_01, partial [Pinus radiata]
 gb|AFG52317.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52318.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52322.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52323.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52324.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52328.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52329.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52331.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52332.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%), Gaps = 2/123 (2%)
 Frame = -3

Query  860  AQDLEPKAKM-NMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAFLRQETSA  684
            A+DL+   ++  M+ Y  A+I+P  K +T +D +GG NP W+ K V   D+  L    +A
Sbjct  1    AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  683  IEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSGRPQGILN  504
            I  +IY  + + D L+GT R+LV +L+    P N   N   +  AVQVRRPSGRPQGILN
Sbjct  61   ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANPSDN-PIQCIAVQVRRPSGRPQGILN  119

Query  503  IGV  495
            I V
Sbjct  120  IWV  122



>ref|XP_007031704.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY02630.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=306

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 80/140 (57%), Gaps = 6/140 (4%)
 Frame = -3

Query  884  LLEITIISAQDLEPKAKM---NMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            +LE+  ISAQ L   + +   +++TY  AW++ + K  T +D  GG NP WNDKF+FKV 
Sbjct  7    VLELNFISAQGLVHPSLIPDRHLKTYAVAWVDSSTKLHTRVDRVGGENPTWNDKFLFKVS  66

Query  713  EAFLRQETSAIEFEIYKITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRR  534
              FL  +TS +  EIY      D LIG+VRLL+ N IP  S           FAA+ +  
Sbjct  67   PEFLFNKTSTVSVEIYAAGTFRDRLIGSVRLLIHNFIPTASAAAMKT---PAFAALLIHS  123

Query  533  PSGRPQGILNIGVAVLDGSK  474
            P G+  G LN+G  VLDGS+
Sbjct  124  PFGQFFGTLNVGGMVLDGSR  143



>ref|XP_010936622.1| PREDICTED: uncharacterized protein LOC105056210 [Elaeis guineensis]
Length=207

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 77/134 (57%), Gaps = 15/134 (11%)
 Frame = -3

Query  845  PKAKMNMRTYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAFLRQETSAIEFEIY  666
            PK+ +N  TYT AWI+PA K  T LD  G   P+WNDKFVF +D+A L  +T+ +   I+
Sbjct  20   PKSTLN-PTYTVAWIDPAHKLHTRLDAVGHIEPIWNDKFVFSLDDAILHSDTTTVTINIF  78

Query  665  ----KITWLGDSLIGTVRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRP-SGRPQGILNI  501
                +     ++LIGT R L+  L P         +  TRF  VQV RP S  PQGILN+
Sbjct  79   TARPRFLSGSNTLIGTARALLSALYP---------STTTRFITVQVHRPQSLCPQGILNL  129

Query  500  GVAVLDGSKRSTPL  459
             V++LD   RS P+
Sbjct  130  DVSLLDAYVRSFPI  143



>ref|XP_008365038.1| PREDICTED: uncharacterized protein LOC103428692 [Malus domestica]
Length=270

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 10/111 (9%)
 Frame = -3

Query  809  AWINPARKQTTILDTEGGSNPMWNDKFVFKVDEAFLRQETSAIEFEIYKITWLGDSLIGT  630
            AW++ A K  + +D  GG NP WND+F+FKV  AFL +ETS +  +IY +    D L+GT
Sbjct  27   AWVDSAHKIRSRVDKIGGENPTWNDRFLFKVPSAFLSRETSHVSIQIYAVGCFSDHLVGT  86

Query  629  VRLLVGNLIPPPSPPNHHQNLGTRFAAVQVRRPSGRPQGILNIGVAVLDGS  477
            VRLL+ N +          ++ ++  +    RPSGR QG+LN+   V+DGS
Sbjct  87   VRLLINNFL----------DVASKVPSAASVRPSGRFQGMLNMAAMVIDGS  127



>dbj|BAK03653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 90/152 (59%), Gaps = 12/152 (8%)
 Frame = -3

Query  893  PFRLLEITIISAQDLEPKAKMNMR--TYTTAWINPARKQTTILDTEGGSNPMWNDKFVFK  720
            P  LLE+T+ISAQDL  + +++ R   Y  AWI+ ARK  T +D  GG++P WND+F+F+
Sbjct  17   PLYLLEVTVISAQDLHRRRRLSHRVRAYAVAWIDGARKLRTEVDLAGGADPTWNDRFLFR  76

Query  719  VDEAFLRQETSAIEFEIYKITWLG-DSLIGTVRLLVGNLIPPPSPPN--------HHQNL  567
            VD  FL+ ET+A+  E+ +   LG D ++G   ++V   +   S                
Sbjct  77   VDAGFLKSETAAVVVEVRETRRLGSDVVLGRTGIVVSTFLRVHSSSRLTAAAPAVAAAPT  136

Query  566  GTRFAAVQVRRP-SGRPQGILNIGVAVLDGSK  474
            G + AA+Q+RRP S RPQG+LN+ V +L  ++
Sbjct  137  GRQVAALQLRRPRSLRPQGVLNVAVTLLGAAQ  168



>ref|XP_003569491.1| PREDICTED: uncharacterized protein LOC100842238 [Brachypodium 
distachyon]
Length=306

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 84/146 (58%), Gaps = 21/146 (14%)
 Frame = -3

Query  887  RLLEITIISAQDLEPKAKMNMR--TYTTAWINPARKQTTILDTEGGSNPMWNDKFVFKVD  714
            RLLE+TIISAQ L+P + +  R   Y  AW++ A +  T  D  GG +P W+++F+F+V 
Sbjct  17   RLLEVTIISAQGLKPPSGLRRRLQAYAVAWVDAAHRLQTQPDCSGGVDPAWHERFLFRVH  76

Query  713  EAFLRQET-SAIEFEIYKI---TWL--GDSLIGTVRLLVGNLI----PPPSPPNHHQNLG  564
            EA L +++ +A+  EIY      W   GDSLIG+ R L+G+      P  SP        
Sbjct  77   EAALAEDSRAAVTVEIYAAPNGAWHIGGDSLIGSARFLLGDNCLLSRPVGSP--------  128

Query  563  TRFAAVQVRRPSGRPQGILNIGVAVL  486
                AV VRRPSGR  G+LN+  +++
Sbjct  129  -AMFAVGVRRPSGRVHGLLNVAASLV  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2314958397494