BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23754_g1_i3 len=1824 path=[2889:0-1090 3978:1091-1187
5774:1188-1204 5791:1205-1246 2151:1247-1335 2240:1336-1358
2263:1359-1388 5832:1389-1396 2301:1397-1454 841:1455-1483
870:1484-1823]

Length=1824
                                                                      Score     E

ref|XP_009758588.1|  PREDICTED: serine carboxypeptidase-like            649   0.0      
ref|XP_009617667.1|  PREDICTED: serine carboxypeptidase-like            649   0.0      
ref|XP_006347201.1|  PREDICTED: serine carboxypeptidase 3-like          647   0.0      
ref|XP_009592158.1|  PREDICTED: serine carboxypeptidase-like            647   0.0      
ref|XP_009785283.1|  PREDICTED: serine carboxypeptidase-like            644   0.0      
ref|XP_004241292.1|  PREDICTED: serine carboxypeptidase-like            640   0.0      
ref|XP_006424468.1|  hypothetical protein CICLE_v10028234mg             637   0.0      
ref|XP_006488020.1|  PREDICTED: serine carboxypeptidase-like 48-l...    636   0.0      
emb|CDP07044.1|  unnamed protein product                                635   0.0      
ref|XP_011089952.1|  PREDICTED: serine carboxypeptidase-like            635   0.0      
gb|KDO60255.1|  hypothetical protein CISIN_1g010473mg                   634   0.0      
ref|XP_010689129.1|  PREDICTED: serine carboxypeptidase-like            632   0.0      
ref|XP_004240682.1|  PREDICTED: serine carboxypeptidase-like            631   0.0      
ref|XP_006343737.1|  PREDICTED: serine carboxypeptidase-like 48-like    630   0.0      
ref|XP_009607096.1|  PREDICTED: serine carboxypeptidase-like            630   0.0      
gb|KDO60256.1|  hypothetical protein CISIN_1g010473mg                   629   0.0      
gb|ABQ65860.1|  serine carboxypeptidase III                             628   0.0      
ref|XP_009775797.1|  PREDICTED: serine carboxypeptidase-like            626   0.0      
gb|KHG01758.1|  Serine carboxypeptidase-like 48                         626   0.0      
ref|XP_010031406.1|  PREDICTED: serine carboxypeptidase-like            625   0.0      
ref|XP_004250970.1|  PREDICTED: serine carboxypeptidase-like            622   0.0      
gb|EYU37039.1|  hypothetical protein MIMGU_mgv1a025090mg                619   0.0      
ref|XP_006349013.1|  PREDICTED: serine carboxypeptidase-like 48-like    617   0.0      
ref|XP_011028255.1|  PREDICTED: serine carboxypeptidase-like            616   0.0      
ref|XP_010111833.1|  Serine carboxypeptidase-like 48                    616   0.0      
ref|XP_003534860.1|  PREDICTED: serine carboxypeptidase-like 49-like    615   0.0      
ref|XP_002523707.1|  Serine carboxypeptidase, putative                  615   0.0      Ricinus communis
ref|XP_010034179.1|  PREDICTED: serine carboxypeptidase-like            614   0.0      
ref|XP_006436507.1|  hypothetical protein CICLE_v10031297mg             613   0.0      
ref|XP_006384950.1|  serine carboxypeptidase family protein             613   0.0      
gb|KHG17096.1|  Serine carboxypeptidase-like 48                         613   0.0      
ref|XP_004292565.1|  PREDICTED: serine carboxypeptidase-like 48-like    613   0.0      
ref|XP_007138863.1|  hypothetical protein PHAVU_009G243900g             613   0.0      
ref|XP_009356926.1|  PREDICTED: serine carboxypeptidase-like            613   0.0      
gb|KDP43980.1|  hypothetical protein JCGZ_05447                         612   0.0      
ref|XP_010067346.1|  PREDICTED: serine carboxypeptidase-like            612   0.0      
gb|AAL67992.1|  putative serine carboxypeptidase precursor              611   0.0      Gossypium hirsutum [American cotton]
ref|XP_007016860.1|  Serine carboxypeptidase-like 48                    608   0.0      
ref|XP_006488021.1|  PREDICTED: serine carboxypeptidase-like 48-l...    608   0.0      
ref|XP_003546386.1|  PREDICTED: serine carboxypeptidase-like 49-like    607   0.0      
ref|XP_010541311.1|  PREDICTED: serine carboxypeptidase-like 48         605   0.0      
ref|XP_007150149.1|  hypothetical protein PHAVU_005G131000g             605   0.0      
ref|XP_003543449.1|  PREDICTED: serine carboxypeptidase-like 48-like    604   0.0      
gb|KHN21489.1|  Serine carboxypeptidase-like 48                         603   0.0      
ref|XP_002529593.1|  Serine carboxypeptidase, putative                  604   0.0      Ricinus communis
ref|XP_008385518.1|  PREDICTED: serine carboxypeptidase-like            604   0.0      
gb|KHN47738.1|  Serine carboxypeptidase-like 49                         603   0.0      
ref|XP_006342273.1|  PREDICTED: serine carboxypeptidase-like 48-like    603   0.0      
gb|AFK46969.1|  unknown                                                 603   0.0      
ref|XP_008226415.1|  PREDICTED: serine carboxypeptidase-like            603   0.0      
ref|XP_008363544.1|  PREDICTED: serine carboxypeptidase-like            603   0.0      
ref|XP_008233268.1|  PREDICTED: serine carboxypeptidase-like            602   0.0      
emb|CDO99792.1|  unnamed protein product                                602   0.0      
ref|XP_007207364.1|  hypothetical protein PRUPE_ppa004507mg             602   0.0      
ref|XP_007220656.1|  hypothetical protein PRUPE_ppa003691mg             603   0.0      
ref|XP_009368926.1|  PREDICTED: serine carboxypeptidase-like            601   0.0      
dbj|BAE48666.1|  Serine carboxypeptidase                                600   0.0      Prunus mume [ume]
gb|AAL15270.1|  AT3g45010/F14D17_80                                     600   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132322.1|  hypothetical protein PHAVU_011G085000g             599   0.0      
ref|XP_003539193.1|  PREDICTED: serine carboxypeptidase-like 48-like    599   0.0      
ref|XP_007010003.1|  Serine carboxypeptidase-like 49                    599   0.0      
ref|XP_004240167.1|  PREDICTED: serine carboxypeptidase-like            598   0.0      
ref|XP_011084286.1|  PREDICTED: serine carboxypeptidase-like            598   0.0      
ref|XP_003540200.1|  PREDICTED: serine carboxypeptidase-like 48-like    598   0.0      
emb|CAC86383.1|  carboxypeptidase type III                              598   0.0      Theobroma cacao [chocolate]
ref|XP_010535623.1|  PREDICTED: serine carboxypeptidase-like 48 i...    598   0.0      
gb|KDP30482.1|  hypothetical protein JCGZ_16161                         598   0.0      
ref|NP_190087.1|  serine carboxypeptidase-like 48                       598   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345743.1|  PREDICTED: serine carboxypeptidase-like            598   0.0      
ref|XP_009335971.1|  PREDICTED: serine carboxypeptidase-like            598   0.0      
emb|CDP07043.1|  unnamed protein product                                598   0.0      
ref|XP_008344883.1|  PREDICTED: serine carboxypeptidase-like            598   0.0      
ref|XP_010483821.1|  PREDICTED: serine carboxypeptidase-like 49         597   0.0      
ref|XP_002316392.2|  Serine carboxypeptidase precursor family pro...    597   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_187652.1|  serine carboxypeptidase-like 49                       596   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAB04606.1|  carboxypeptidase Y-like protein                         597   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307353.1|  PREDICTED: serine carboxypeptidase-like 49-like    595   0.0      
ref|XP_006407571.1|  hypothetical protein EUTSA_v10020509mg             596   0.0      
ref|XP_011031665.1|  PREDICTED: serine carboxypeptidase-like            595   0.0      
ref|XP_003536330.1|  PREDICTED: serine carboxypeptidase-like 49-like    594   0.0      
ref|XP_002311071.2|  Serine carboxypeptidase precursor family pro...    594   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003597272.1|  Serine carboxypeptidase                            594   0.0      
ref|XP_011089190.1|  PREDICTED: serine carboxypeptidase-like            593   0.0      
ref|XP_011024373.1|  PREDICTED: serine carboxypeptidase-like            593   0.0      
ref|XP_010464713.1|  PREDICTED: serine carboxypeptidase-like 49         593   0.0      
emb|CDY09183.1|  BnaA02g06090D                                          593   0.0      
ref|XP_009395427.1|  PREDICTED: serine carboxypeptidase-like            593   0.0      
ref|XP_003535900.1|  PREDICTED: serine carboxypeptidase-like 49-l...    592   0.0      
ref|XP_004163685.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    592   0.0      
ref|XP_004147293.1|  PREDICTED: serine carboxypeptidase-like 48-like    592   0.0      
ref|XP_010486643.1|  PREDICTED: serine carboxypeptidase-like 49         592   0.0      
ref|XP_006290935.1|  hypothetical protein CARUB_v10017048mg             591   0.0      
gb|KFK38420.1|  hypothetical protein AALP_AA3G110900                    590   0.0      
ref|XP_011094551.1|  PREDICTED: serine carboxypeptidase-like            593   0.0      
ref|XP_010103537.1|  Serine carboxypeptidase-like 49                    590   0.0      
ref|XP_010243256.1|  PREDICTED: serine carboxypeptidase-like            590   0.0      
ref|XP_002273251.1|  PREDICTED: serine carboxypeptidase-like isof...    590   0.0      Vitis vinifera
ref|XP_010543556.1|  PREDICTED: serine carboxypeptidase-like 49         590   0.0      
ref|XP_008463013.1|  PREDICTED: serine carboxypeptidase-like            589   0.0      
ref|XP_002875707.1|  hypothetical protein ARALYDRAFT_484895             589   0.0      
ref|XP_006400808.1|  hypothetical protein EUTSA_v10013297mg             589   0.0      
ref|XP_004164209.1|  PREDICTED: serine carboxypeptidase-like 49-like    589   0.0      
ref|XP_009150318.1|  PREDICTED: serine carboxypeptidase-like 48         588   0.0      
ref|XP_010503154.1|  PREDICTED: serine carboxypeptidase-like 48         588   0.0      
emb|CDX99171.1|  BnaA06g18620D                                          588   0.0      
ref|XP_010918615.1|  PREDICTED: serine carboxypeptidase-like            588   0.0      
ref|XP_006419082.1|  hypothetical protein EUTSA_v10002473mg             589   0.0      
ref|XP_009135107.1|  PREDICTED: serine carboxypeptidase-like 49         588   0.0      
ref|XP_008456530.1|  PREDICTED: serine carboxypeptidase-like            588   0.0      
dbj|BAJ34078.1|  unnamed protein product                                587   0.0      
ref|XP_010535625.1|  PREDICTED: serine carboxypeptidase-like 48 i...    587   0.0      
emb|CDY31020.1|  BnaC03g55150D                                          587   0.0      
ref|XP_002273281.1|  PREDICTED: serine carboxypeptidase-like            587   0.0      Vitis vinifera
ref|XP_006299685.1|  hypothetical protein CARUB_v10015873mg             587   0.0      
ref|NP_197689.1|  serine carboxypeptidase-like 47                       586   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHN06879.1|  Serine carboxypeptidase-like 49                         585   0.0      
ref|XP_004150367.1|  PREDICTED: serine carboxypeptidase-like 49-like    585   0.0      
ref|XP_002872027.1|  hypothetical protein ARALYDRAFT_489152             585   0.0      
ref|XP_009131902.1|  PREDICTED: serine carboxypeptidase-like 47         585   0.0      
ref|XP_010906753.1|  PREDICTED: serine carboxypeptidase-like            585   0.0      
ref|XP_007145525.1|  hypothetical protein PHAVU_007G245800g             585   0.0      
emb|CBI17153.3|  unnamed protein product                                583   0.0      
ref|XP_004496230.1|  PREDICTED: serine carboxypeptidase-like 49-like    584   0.0      
emb|CDP07045.1|  unnamed protein product                                583   0.0      
emb|CDY00669.1|  BnaC03g36530D                                          585   0.0      
ref|XP_010514837.1|  PREDICTED: serine carboxypeptidase-like 48         584   0.0      
ref|XP_006851290.1|  hypothetical protein AMTR_s00050p00101210          583   0.0      
gb|AAD42963.2|AF141384_1  serine carboxypeptidase precursor             583   0.0      Matricaria chamomilla
ref|XP_010425935.1|  PREDICTED: serine carboxypeptidase-like 48         584   0.0      
ref|XP_007143762.1|  hypothetical protein PHAVU_007G099400g             583   0.0      
ref|XP_002462855.1|  hypothetical protein SORBIDRAFT_02g033170          583   0.0      Sorghum bicolor [broomcorn]
ref|XP_003538168.1|  PREDICTED: serine carboxypeptidase-like 48-like    582   0.0      
gb|KEH43478.1|  serine carboxypeptidase-like protein                    582   0.0      
ref|XP_004487064.1|  PREDICTED: serine carboxypeptidase-like 48-like    582   0.0      
gb|KDO60257.1|  hypothetical protein CISIN_1g010473mg                   582   0.0      
ref|XP_009126578.1|  PREDICTED: serine carboxypeptidase-like 47         582   0.0      
ref|XP_002453162.1|  hypothetical protein SORBIDRAFT_04g001030          581   0.0      Sorghum bicolor [broomcorn]
ref|XP_002266451.1|  PREDICTED: serine carboxypeptidase-like            581   0.0      Vitis vinifera
ref|NP_001045667.1|  Os02g0114200                                       580   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008805718.1|  PREDICTED: serine carboxypeptidase-like            580   0.0      
ref|XP_002884793.1|  predicted protein                                  581   0.0      
ref|XP_004514874.1|  PREDICTED: serine carboxypeptidase-like 49-like    578   0.0      
emb|CDX73927.1|  BnaA03g31200D                                          579   0.0      
ref|XP_006648225.1|  PREDICTED: serine carboxypeptidase 3-like          577   0.0      
ref|XP_010267214.1|  PREDICTED: serine carboxypeptidase-like            577   0.0      
ref|XP_009617439.1|  PREDICTED: serine carboxypeptidase-like            577   0.0      
ref|XP_009382132.1|  PREDICTED: serine carboxypeptidase-like            577   0.0      
ref|XP_008784499.1|  PREDICTED: serine carboxypeptidase-like isof...    576   0.0      
gb|KFK33913.1|  serine carboxypeptidase                                 576   0.0      
ref|NP_001141041.1|  uncharacterized protein LOC100273121 precursor     576   0.0      Zea mays [maize]
ref|XP_010920652.1|  PREDICTED: serine carboxypeptidase-like            576   0.0      
ref|XP_004952145.1|  PREDICTED: serine carboxypeptidase 3-like is...    573   0.0      
ref|XP_010681991.1|  PREDICTED: serine carboxypeptidase-like            573   0.0      
ref|XP_004957681.1|  PREDICTED: serine carboxypeptidase-like            573   0.0      
gb|KEH29967.1|  serine carboxypeptidase-like protein                    572   0.0      
ref|XP_007132319.1|  hypothetical protein PHAVU_011G084700g             573   0.0      
ref|XP_009380664.1|  PREDICTED: serine carboxypeptidase-like            572   0.0      
ref|XP_009146842.1|  PREDICTED: serine carboxypeptidase-like 49 i...    572   0.0      
dbj|BAK05932.1|  predicted protein                                      570   0.0      
sp|P21529.2|CBP3_HORVU  RecName: Full=Serine carboxypeptidase 3; ...    570   0.0      Hordeum vulgare [barley]
ref|XP_006361688.1|  PREDICTED: serine carboxypeptidase-like 49-like    569   0.0      
gb|KEH29968.1|  serine carboxypeptidase-like protein                    569   0.0      
ref|XP_004952144.1|  PREDICTED: serine carboxypeptidase 3-like is...    569   0.0      
ref|NP_001146351.1|  uncharacterized protein LOC100279929 precursor     568   0.0      Zea mays [maize]
ref|XP_004250045.1|  PREDICTED: serine carboxypeptidase-like            567   0.0      
ref|XP_003570803.1|  PREDICTED: serine carboxypeptidase 3               567   0.0      
ref|XP_003560222.1|  PREDICTED: serine carboxypeptidase-like            567   0.0      
ref|XP_006400807.1|  hypothetical protein EUTSA_v10015901mg             567   0.0      
sp|P11515.1|CBP3_WHEAT  RecName: Full=Serine carboxypeptidase 3; ...    566   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_007132321.1|  hypothetical protein PHAVU_011G084900g             564   0.0      
gb|EAZ03855.1|  hypothetical protein OsI_25989                          564   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006657694.1|  PREDICTED: serine carboxypeptidase-like            562   0.0      
gb|KCW50683.1|  hypothetical protein EUGRSUZ_J00369                     560   0.0      
gb|KCW50685.1|  hypothetical protein EUGRSUZ_J003712                    556   0.0      
ref|NP_001059634.1|  Os07g0479300                                       561   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT06979.1|  Serine carboxypeptidase 3                               561   0.0      
ref|XP_010421096.1|  PREDICTED: serine carboxypeptidase-like 47         560   0.0      
ref|XP_010658339.1|  PREDICTED: serine carboxypeptidase-like isof...    556   0.0      
ref|XP_010493406.1|  PREDICTED: serine carboxypeptidase-like 47         556   0.0      
gb|KHN38716.1|  Serine carboxypeptidase-like 49                         555   0.0      
ref|XP_010658340.1|  PREDICTED: serine carboxypeptidase-like isof...    555   0.0      
ref|XP_010658342.1|  PREDICTED: serine carboxypeptidase-like isof...    555   0.0      
ref|XP_004506061.1|  PREDICTED: serine carboxypeptidase-like 48-l...    555   0.0      
gb|KEH41429.1|  serine carboxypeptidase-like protein                    555   0.0      
sp|P52712.2|CBPX_ORYSJ  RecName: Full=Serine carboxypeptidase-lik...    552   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDY00930.1|  BnaC05g42700D                                          555   0.0      
emb|CDY08605.1|  BnaA05g28410D                                          555   0.0      
dbj|BAA04511.1|  serine carboxypeptidase-like protein                   550   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008784501.1|  PREDICTED: serine carboxypeptidase-like isof...    552   0.0      
ref|XP_006289997.1|  hypothetical protein CARUB_v10003627mg             551   0.0      
ref|XP_004506060.1|  PREDICTED: serine carboxypeptidase-like 48-l...    550   0.0      
gb|EYU37040.1|  hypothetical protein MIMGU_mgv1a024049mg                548   0.0      
gb|KEH29969.1|  serine carboxypeptidase-like protein                    548   0.0      
ref|XP_004506096.1|  PREDICTED: serine carboxypeptidase-like 48-like    548   0.0      
ref|XP_002960122.1|  serine carboxypeptidase-like enzyme                545   0.0      
ref|XP_006400806.1|  hypothetical protein EUTSA_v10013304mg             544   0.0      
ref|XP_002984019.1|  serine carboxypeptidase-like enzyme                544   0.0      
ref|XP_010658343.1|  PREDICTED: serine carboxypeptidase-like isof...    541   0.0      
gb|AES67521.2|  serine carboxypeptidase-like protein                    543   0.0      
emb|CDY56704.1|  BnaC01g38630D                                          545   0.0      
ref|XP_010535626.1|  PREDICTED: serine carboxypeptidase-like 48 i...    539   0.0      
gb|ACF85628.1|  unknown                                                 531   0.0      Zea mays [maize]
ref|XP_003597270.1|  Serine carboxypeptidase                            534   0.0      
gb|KGN64810.1|  Serine carboxypeptidase                                 531   4e-180   
gb|EMS57267.1|  Serine carboxypeptidase-like protein                    531   9e-180   
ref|XP_010651777.1|  PREDICTED: serine carboxypeptidase 3 isoform X2    525   5e-179   
ref|XP_006407570.1|  hypothetical protein EUTSA_v10020509mg             528   8e-179   
ref|XP_006407572.1|  hypothetical protein EUTSA_v10020509mg             523   3e-178   
gb|EMT11612.1|  Serine carboxypeptidase-like protein                    520   2e-175   
ref|XP_001772397.1|  predicted protein                                  520   3e-175   
ref|XP_006588979.1|  PREDICTED: serine carboxypeptidase-like 49-l...    514   7e-174   
emb|CDX71025.1|  BnaC03g11090D                                          509   2e-172   
emb|CDX88772.1|  BnaA03g08770D                                          509   2e-171   
gb|ABR16556.1|  unknown                                                 502   4e-170   Picea sitchensis
ref|XP_003597268.1|  Serine carboxypeptidase                            507   4e-170   
ref|XP_002521640.1|  Serine carboxypeptidase, putative                  499   4e-168   Ricinus communis
gb|EPS70311.1|  hypothetical protein M569_04452                         497   2e-167   
gb|AFK43520.1|  unknown                                                 487   2e-163   
gb|KEH29964.1|  serine carboxypeptidase-like protein                    485   5e-162   
gb|KCW50687.1|  hypothetical protein EUGRSUZ_J00372                     478   2e-160   
gb|AES67519.2|  serine carboxypeptidase-like protein                    476   1e-158   
ref|XP_004506097.1|  PREDICTED: serine carboxypeptidase-like 48-like    471   1e-156   
emb|CDY26973.1|  BnaC09g36100D                                          462   3e-154   
emb|CAB71127.1|  serine carboxipeptidase                                459   9e-154   Cicer arietinum [garbanzo]
emb|CDY50329.1|  BnaA10g13620D                                          452   4e-150   
ref|XP_010034181.1|  PREDICTED: serine carboxypeptidase-like            450   8e-149   
ref|XP_001786217.1|  predicted protein                                  444   3e-147   
gb|EYU39639.1|  hypothetical protein MIMGU_mgv1a0046372mg               436   1e-144   
gb|KCW50691.1|  hypothetical protein EUGRSUZ_J00375                     435   1e-142   
gb|KCW50689.1|  hypothetical protein EUGRSUZ_J003742                    416   2e-137   
ref|XP_001763185.1|  predicted protein                                  419   5e-136   
ref|XP_009121241.1|  PREDICTED: serine carboxypeptidase-like 47         393   3e-128   
ref|XP_001695303.1|  predicted protein                                  387   4e-123   Chlamydomonas reinhardtii
gb|AAA92064.1|  serine carboxypeptidase                                 376   2e-122   Vigna radiata [mung bean]
ref|XP_002499869.1|  predicted protein                                  377   8e-121   Micromonas commoda
ref|XP_003055284.1|  predicted protein                                  372   5e-118   
ref|XP_005645486.1|  peptidase S10, serine carboxypeptidase             369   8e-117   
ref|XP_002945957.1|  hypothetical protein VOLCADRAFT_102913             368   3e-115   
sp|Q41005.1|CBPX_PEA  RecName: Full=Serine carboxypeptidase-like        355   3e-114   Pisum sativum [garden pea]
ref|XP_001422089.1|  predicted protein                                  361   1e-113   Ostreococcus lucimarinus CCE9901
ref|XP_003560223.2|  PREDICTED: serine carboxypeptidase-like            352   3e-113   
ref|XP_005844152.1|  hypothetical protein CHLNCDRAFT_32614              350   2e-110   
ref|XP_008799516.1|  PREDICTED: serine carboxypeptidase 3-like          344   5e-110   
gb|EFW45577.2|  serine carboxypeptidase                                 350   5e-110   
gb|KDO35820.1|  hypothetical protein CISIN_1g038976mg                   338   7e-109   
ref|XP_005771165.1|  hypothetical protein EMIHUDRAFT_424894             346   8e-109   
ref|XP_009774966.1|  PREDICTED: serine carboxypeptidase-like 49         336   5e-107   
gb|EJY70217.1|  Serine carboxypeptidase family protein                  341   6e-107   
ref|XP_004363289.1|  serine carboxypeptidase                            340   2e-106   
ref|XP_007512042.1|  predicted protein                                  342   1e-105   
gb|EYU39638.1|  hypothetical protein MIMGU_mgv1a0046372mg               331   2e-105   
gb|AIG55528.1|  secreted protein                                        337   8e-105   
ref|XP_009035935.1|  hypothetical protein AURANDRAFT_58883              334   4e-104   
emb|CBN76803.1|  Serine Carboxypeptidase                                334   8e-104   
gb|AIG56099.1|  secreted protein                                        335   9e-104   
ref|XP_001019007.1|  Serine carboxypeptidase family protein             331   2e-103   Tetrahymena thermophila
emb|CDW86360.1|  serine carboxypeptidase family protein                 331   5e-103   
gb|AAO74600.1|  serine carboxypeptidase precursor                       331   1e-102   Trypanosoma cruzi
ref|XP_003874059.1|  putative serine carboxypeptidase (CBP1)            330   2e-102   
ref|XP_009306248.1|  putative serine carboxypeptidase (CBP1), put...    329   7e-102   
ref|XP_008614092.1|  hypothetical protein SDRG_09908                    329   1e-101   
emb|CCI44408.1|  unnamed protein product                                327   2e-101   
gb|ADN79130.1|  serine carboxypeptidase                                 328   2e-101   
gb|ETI35910.1|  hypothetical protein F443_17870                         329   3e-101   
gb|KFM23919.1|  Serine carboxypeptidase-like 49                         326   6e-101   
gb|KDO33082.1|  hypothetical protein SPRG_01896                         327   8e-101   
gb|ADN79132.1|  serine carboxypeptidase                                 326   9e-101   
gb|ETO64622.1|  hypothetical protein F444_17906                         327   9e-101   
ref|XP_008896402.1|  hypothetical protein PPTG_04260                    327   9e-101   
ref|XP_009525970.1|  hypothetical protein PHYSODRAFT_544689             325   1e-100   
ref|XP_008612376.1|  hypothetical protein SDRG_08278                    326   1e-100   
emb|CCC51045.1|  putative serine carboxypeptidase (CBP1)                325   1e-100   
gb|EKG00766.1|  serine carboxypeptidase (CBP1), putative,serine p...    325   2e-100   
gb|AGN32976.1|  serine carboxypeptidase precursor                       325   2e-100   
ref|XP_803003.1|  serine carboxypeptidase (CBP1)                        327   2e-100   Trypanosoma cruzi strain CL Brener
ref|XP_009822236.1|  hypothetical protein H257_00972                    326   2e-100   
ref|XP_817768.1|  serine carboxypeptidase (CBP1)                        325   2e-100   Trypanosoma cruzi strain CL Brener
ref|XP_003084075.1|  Serine carboxypeptidases (lysosomal cathepsi...    327   3e-100   
emb|CBH15057.1|  serine carboxypeptidase III precursor, putative        324   3e-100   Trypanosoma brucei gambiense DAL972
ref|XP_008861319.1|  hypothetical protein H310_00346                    325   4e-100   
gb|EAR98760.2|  serine carboxypeptidase family protein                  322   7e-100   
ref|XP_001019005.1|  Serine carboxypeptidase family protein             323   1e-99    
ref|XP_002908112.1|  serine protease family S10, putative               323   2e-99    
ref|XP_004336027.1|  serine carboxypeptidase (CBP1), putative           322   2e-99    
gb|ETI45962.1|  hypothetical protein F443_09601                         323   3e-99    
dbj|GAM27668.1|  hypothetical protein SAMD00019534_108440               321   3e-99    
gb|ETP43878.1|  hypothetical protein F442_09507                         323   3e-99    
gb|ETM45792.1|  hypothetical protein L914_09258                         323   3e-99    
gb|ETL92484.1|  hypothetical protein L917_09233                         323   3e-99    
gb|ETO74657.1|  hypothetical protein F444_09663                         323   3e-99    
ref|XP_008906515.1|  hypothetical protein PPTG_12069                    323   3e-99    
gb|ETK85961.1|  hypothetical protein L915_09396                         323   3e-99    
gb|KDO17762.1|  hypothetical protein SPRG_16804                         323   4e-99    
ref|XP_001464861.1|  putative serine carboxypeptidase (CBP1)            322   4e-99    
gb|KDO32675.1|  hypothetical protein SPRG_02375                         322   6e-99    
ref|XP_003860059.1|  serine carboxypeptidase (CBP1), putative           321   6e-99    
ref|XP_822362.1|  serine carboxypeptidase III precursor                 321   8e-99    
ref|XP_822363.1|  serine carboxypeptidase III precursor                 320   1e-98    
ref|XP_002786655.1|  Serine carboxypeptidase, putative                  321   2e-98    
emb|CBH15055.1|  serine carboxypeptidase III precursor, putative        320   2e-98    
ref|XP_001019018.1|  Serine carboxypeptidase family protein             317   4e-98    
gb|EWM30038.1|  serine protease family                                  322   5e-98    
ref|XP_003389312.1|  PREDICTED: serine carboxypeptidase S10 famil...    316   2e-97    
ref|XP_001682451.1|  putative serine carboxypeptidase (CBP1)            317   2e-97    
ref|WP_028830922.1|  hypothetical protein                               317   2e-97    
gb|EKF29556.1|  serine carboxypeptidase (CBP1), putative,serine p...    318   1e-96    
emb|CBH15060.1|  serine carboxypeptidase III precursor, putative        314   3e-96    
emb|CCC93297.1|  putative serine carboxypeptidase III precursor         315   4e-96    
ref|XP_822361.1|  serine carboxypeptidase III precursor                 314   4e-96    
ref|XP_002905123.1|  serine protease family S10, putative               315   5e-96    
gb|KDO32674.1|  hypothetical protein SPRG_02374                         313   5e-96    
ref|XP_003389311.1|  PREDICTED: serine carboxypeptidase S10 famil...    312   2e-95    
ref|XP_005836393.1|  hypothetical protein GUITHDRAFT_85780              312   3e-95    
gb|KFK27622.1|  hypothetical protein AALP_AA8G407400                    303   5e-95    
ref|XP_008614093.1|  hypothetical protein SDRG_09909                    311   6e-95    
ref|XP_001019030.1|  Serine carboxypeptidase family protein             309   9e-95    
gb|ACJ85699.1|  unknown                                                 303   1e-94    
gb|EPY37773.1|  serine carboxypeptidase (CBP1)                          310   3e-94    
gb|EPY43687.1|  serine carboxypeptidase (CBP1)                          309   4e-94    
gb|ACU18836.1|  unknown                                                 301   5e-94    
ref|XP_002786656.1|  conserved hypothetical protein                     308   1e-93    
ref|XP_009837674.1|  hypothetical protein H257_12226                    309   1e-93    
ref|XP_001563975.1|  putative serine carboxypeptidase (CBP1)            306   3e-93    
ref|XP_010697903.1|  serine carboxypeptidase (CBP1), putative           306   5e-93    
ref|XP_008611456.1|  hypothetical protein SDRG_07403                    307   5e-93    
ref|XP_009521306.1|  hypothetical protein PHYSODRAFT_478999             306   9e-93    
gb|KDO21362.1|  hypothetical protein SPRG_13675                         306   2e-92    
gb|ETP05722.1|  hypothetical protein F441_17745                         305   3e-92    
gb|ETP33859.1|  hypothetical protein F442_17736                         305   3e-92    
ref|XP_001019021.1|  Serine carboxypeptidase family protein             301   4e-92    
gb|ETI35911.1|  hypothetical protein F443_17871                         304   6e-92    
gb|EPS62211.1|  hypothetical protein M569_12581                         295   7e-92    
emb|CCC93327.1|  putative serine carboxypeptidase III precursor         302   1e-91    
gb|ETL29540.1|  hypothetical protein L916_17300                         304   1e-91    
gb|ETO64634.1|  hypothetical protein F444_17917                         303   1e-91    
ref|XP_002905113.1|  serine protease family S10, putative               303   1e-91    
gb|ETK76102.1|  hypothetical protein L915_17407                         303   2e-91    
gb|ETL82766.1|  hypothetical protein L917_17131                         303   2e-91    
ref|XP_008896403.1|  hypothetical protein PPTG_04261                    302   3e-91    
gb|EAR98286.2|  serine carboxypeptidase family protein                  299   4e-91    
gb|ETI35922.1|  hypothetical protein F443_17881                         302   6e-91    
ref|XP_008896412.1|  hypothetical protein PPTG_04272                    302   7e-91    
ref|XP_001018531.1|  Serine carboxypeptidase family protein             300   8e-91    
gb|KIE02402.1|  carboxypeptidase Y precursor                            300   9e-91    
gb|ETM36006.1|  hypothetical protein L914_17198                         301   2e-90    
gb|ETP05733.1|  hypothetical protein F441_17755                         301   2e-90    
ref|XP_004993485.1|  serine carboxypeptidase CBP1                       298   3e-90    
ref|XP_004036721.1|  serine carboxypeptidase family protein, puta...    295   5e-90    
ref|XP_002905122.1|  serine protease family S10, putative               298   8e-90    
gb|KFG78851.1|  carboxypeptidase Y precursor                            298   1e-89    
ref|XP_001019006.1|  Serine carboxypeptidase family protein             295   2e-89    
ref|XP_009521305.1|  hypothetical protein PHYSODRAFT_555569             296   4e-89    
gb|EXV01401.1|  peptidase S10 family protein                            296   4e-89    
gb|KID87338.1|  carboxypeptidase Y precursor                            296   6e-89    
ref|XP_009521295.1|  hypothetical protein PHYSODRAFT_555553             296   6e-89    
gb|EWM30035.1|  serine carboxypeptidase                                 295   9e-89    
gb|KDD72851.1|  serine carboxypeptidase                                 292   1e-88    
ref|XP_007810620.1|  carboxypeptidase Y precursor                       295   1e-88    
gb|KID76498.1|  carboxypeptidase Y precursor                            295   1e-88    
ref|XP_001748887.1|  hypothetical protein                               293   3e-88    
ref|XP_008869492.1|  hypothetical protein H310_06273                    294   3e-88    
gb|KHN99363.1|  carboxypeptidase Y precursor                            292   1e-87    
ref|XP_004361668.1|  peptidase S10 family protein                       290   2e-87    
ref|XP_008871130.1|  hypothetical protein H310_07524                    291   4e-87    
gb|AAQ76845.1|  serine carboxypeptidase CBP1                            286   7e-87    
gb|EIE76220.1|  hypothetical protein RO3G_00924                         290   1e-86    
ref|XP_009831058.1|  hypothetical protein H257_07284                    289   2e-86    
ref|XP_003387315.1|  PREDICTED: serine carboxypeptidase-like 49-like    286   4e-86    
ref|XP_007818986.1|  carboxypeptidase Y precursor                       288   6e-86    
ref|XP_002297156.1|  serine carboxypeptidase                            285   8e-86    
gb|EFA80920.1|  peptidase S10 family protein                            285   1e-85    
ref|XP_009831068.1|  hypothetical protein H257_07294                    287   1e-85    
ref|XP_005855029.1|  cathepsin A (carboxypeptidase C)                   297   1e-85    
emb|CCA25925.1|  serine protease family S10 putative                    298   2e-85    
ref|XP_004342296.1|  carboxypeptidase Ylike protein                     285   3e-85    
ref|XP_002179064.1|  predicted protein                                  284   3e-85    
gb|EIE84575.1|  hypothetical protein RO3G_09285                         286   5e-85    
ref|XP_009831066.1|  hypothetical protein H257_07292                    283   6e-84    
gb|EPB84036.1|  hypothetical protein HMPREF1544_09235                   283   1e-83    
ref|XP_008344885.1|  PREDICTED: serine carboxypeptidase-like 48         273   2e-83    
gb|KFH62546.1|  carboxypeptidase C                                      282   2e-83    
emb|CEG70790.1|  hypothetical protein RMATCC62417_06621                 280   9e-83    
gb|EPY26810.1|  cathepsin A (carboxypeptidase C)                        279   1e-82    
ref|XP_629909.1|  peptidase S10 family protein                          276   2e-82    
gb|EPY26053.1|  serine carboxypeptidase III precursor                   279   2e-82    
ref|XP_001031128.1|  Serine carboxypeptidase family protein             276   2e-82    
emb|CEJ01507.1|  hypothetical protein RMCBS344292_15531                 279   4e-82    
gb|EAR83465.2|  serine carboxypeptidase family protein                  277   4e-82    
emb|CEJ04255.1|  hypothetical protein RMCBS344292_18222                 278   6e-82    
ref|XP_009843291.1|  hypothetical protein H257_16537                    277   1e-81    
gb|KGQ06561.1|  Carboxypeptidase Y A                                    275   4e-81    
ref|XP_002550839.1|  carboxypeptidase Y precursor                       276   7e-81    
gb|KDB17426.1|  carboxypeptidase Y precursor                            273   2e-80    
gb|EMG47549.1|  Carboxypeptidase Y                                      275   2e-80    
ref|XP_002543504.1|  carboxypeptidase Y                                 274   5e-80    
ref|XP_001031130.1|  Serine carboxypeptidase family protein             270   5e-80    
gb|EAR83467.2|  serine carboxypeptidase family protein                  270   7e-80    
gb|KGQ82278.1|  carboxypeptidase Y                                      273   8e-80    
ref|XP_711661.1|  potential serine carboxypeptidase                     271   1e-79    
gb|KGQ84848.1|  carboxypeptidase Y                                      272   2e-79    
gb|EEQ47110.1|  carboxypeptidase Y precursor                            272   3e-79    
gb|KGU24089.1|  carboxypeptidase Y                                      272   3e-79    
ref|XP_003071060.1|  carboxypeptidase Y, putative                       272   3e-79    
ref|XP_711679.1|  potential serine carboxypeptidase                     272   3e-79    
gb|ESA20444.1|  hypothetical protein GLOINDRAFT_343633                  271   4e-79    
gb|KDE04494.1|  hypothetical protein MVLG_05060                         270   5e-79    
ref|XP_001249044.1|  carboxypeptidase Y precursor                       271   6e-79    
ref|XP_007834809.1|  Carboxypeptidase Y                                 271   6e-79    
ref|XP_002421512.1|  carboxypeptidase yscY, putative; proteinase ...    271   9e-79    
ref|XP_003854848.1|  cpy like protein carboxypeptidase                  271   1e-78    
gb|ETK76095.1|  hypothetical protein L915_17401                         269   1e-78    
sp|P30574.2|CBPY_CANAX  RecName: Full=Carboxypeptidase Y; AltName...    270   1e-78    
gb|EME47015.1|  hypothetical protein DOTSEDRAFT_69109                   270   1e-78    
ref|XP_003843060.1|  similar to carboxypeptidase Y                      270   2e-78    
gb|ETL29533.1|  hypothetical protein L916_17294                         268   2e-78    
gb|ETI35915.1|  hypothetical protein F443_17875                         268   2e-78    
emb|CDS13932.1|  hypothetical protein LRAMOSA06105                      269   3e-78    
ref|XP_458246.2|  DEHA2C13112p                                          269   4e-78    
emb|CDH59771.1|  carboxypeptidase y precursor                           269   4e-78    
ref|XP_001483195.1|  hypothetical protein PGUG_05150                    269   4e-78    
gb|ETL82759.1|  hypothetical protein L917_17125                         267   4e-78    
gb|ETO64627.1|  hypothetical protein F444_17911                         267   5e-78    
gb|KDO20630.1|  hypothetical protein SPRG_12987                         268   5e-78    
gb|KHN95149.1|  carboxypeptidase Y precursor                            268   9e-78    
gb|ETP33851.1|  hypothetical protein F442_17729                         266   1e-77    
ref|XP_008896407.1|  hypothetical protein PPTG_04265                    266   2e-77    
gb|ETO64626.1|  hypothetical protein F444_17910                         266   2e-77    
gb|ETI35914.1|  hypothetical protein F443_17874                         266   2e-77    
ref|XP_003173424.1|  carboxypeptidase Y                                 267   2e-77    
ref|XP_008871116.1|  hypothetical protein H310_07516                    266   2e-77    
ref|XP_002845130.1|  carboxypeptidase Y                                 267   2e-77    
gb|EDK41052.2|  hypothetical protein PGUG_05150                         266   3e-77    
ref|XP_502558.1|  YALI0D08052p                                          264   3e-77    
gb|ETM35998.1|  hypothetical protein L914_17191                         265   3e-77    
ref|XP_006676646.1|  hypothetical protein BATDEDRAFT_22843              266   4e-77    
gb|KFG81819.1|  carboxypeptidase Y precursor                            266   4e-77    
ref|XP_003348887.1|  hypothetical protein SMAC_01911                    266   5e-77    
ref|XP_001013293.2|  Serine carboxypeptidase family protein             263   5e-77    
ref|XP_009851242.1|  carboxypeptidase Y precursor                       266   5e-77    
ref|XP_008610460.1|  hypothetical protein SDRG_06459                    265   6e-77    
dbj|GAM42553.1|  Prc1 homolog                                           266   8e-77    
gb|ETL29532.1|  hypothetical protein L916_17293                         264   8e-77    
ref|XP_007821955.1|  carboxypeptidase Y precursor                       266   9e-77    
emb|CDS14537.1|  hypothetical protein LRAMOSA06706                      265   9e-77    
gb|KID80084.1|  carboxypeptidase Y precursor                            265   1e-76    
gb|EJK62148.1|  hypothetical protein THAOC_17255                        267   1e-76    
ref|XP_956796.1|  carboxypeptidase Y precursor                          265   1e-76    
ref|XP_002145840.1|  carboxypeptidase CpyA/Prc1, putative               265   1e-76    
tpg|DAA62687.1|  TPA: hypothetical protein ZEAMMB73_228197              256   2e-76    
gb|KDB13454.1|  carboxypeptidase Y precursor                            265   2e-76    
emb|CEJ90372.1|  hypothetical protein VHEMI06161                        265   2e-76    
ref|XP_002617532.1|  hypothetical protein CLUG_02976                    264   3e-76    
ref|XP_003012231.1|  carboxypeptidase S1, putative                      264   3e-76    
gb|EGD97772.1|  serine carboxypeptidase                                 264   3e-76    
emb|CDH51290.1|  carboxypeptidase y                                     265   3e-76    
ref|XP_002478104.1|  carboxypeptidase CpyA/Prc1, putative               264   3e-76    
gb|EPB87726.1|  hypothetical protein HMPREF1544_05507                   261   3e-76    
gb|EAR93048.3|  serine carboxypeptidase family protein                  263   3e-76    
ref|XP_003017935.1|  carboxypeptidase S1, putative                      264   3e-76    
sp|A5YCB8.1|CBPYA_TRITO  RecName: Full=Carboxypeptidase Y homolog...    264   3e-76    
ref|XP_006671615.1|  carboxypeptidase Y                                 262   4e-76    
gb|KFX44144.1|  Carboxypeptidase Y like A                               264   4e-76    
gb|ETL82758.1|  hypothetical protein L917_17124                         262   4e-76    
sp|B8XGR4.1|CBPYA_TRIEQ  RecName: Full=Carboxypeptidase Y homolog...    264   4e-76    
emb|CBQ72117.1|  related to carboxypeptidase                            265   5e-76    
ref|XP_007922724.1|  hypothetical protein MYCFIDRAFT_72243              263   5e-76    
ref|XP_002620806.1|  carboxypeptidase Y                                 263   5e-76    
gb|KID91117.1|  carboxypeptidase Y precursor                            263   7e-76    
ref|XP_001031129.1|  Serine carboxypeptidase family protein             259   7e-76    
gb|EDP55428.1|  carboxypeptidase CpyA/Prc1, putative                    263   7e-76    
ref|XP_003231165.1|  serine carboxypeptidase                            263   7e-76    
sp|C5GEU5.1|CBPYA_AJEDR  RecName: Full=Carboxypeptidase Y homolog...    263   8e-76    
ref|XP_751230.1|  carboxypeptidase CpyA/Prc1                            263   8e-76    
sp|Q5J6J0.1|CBPYA_TRIRU  RecName: Full=Carboxypeptidase Y homolog...    263   8e-76    
gb|ETK76094.1|  hypothetical protein L915_17400                         261   8e-76    
gb|EST07828.1|  serine carboxypeptidase                                 264   9e-76    
ref|XP_001268408.1|  carboxypeptidase CpyA/Prc1, putative               263   1e-75    
gb|EAR93047.2|  serine carboxypeptidase family protein                  260   1e-75    
gb|AIG55394.1|  secreted protein                                        259   1e-75    
gb|EPY38014.1|  cathepsin A (carboxypeptidase C)                        258   1e-75    
dbj|GAD95686.1|  carboxypeptidase CpyA/Prc1, putative                   262   2e-75    
gb|ENH64569.1|  Carboxypeptidase Y like protein A                       262   2e-75    
ref|XP_008602128.1|  carboxypeptidase Y                                 271   2e-75    
emb|CCE45358.1|  hypothetical protein CPAR2_703710                      262   2e-75    
ref|XP_003172000.1|  carboxypeptidase Y                                 261   2e-75    
gb|KGQ08099.1|  Carboxypeptidase Y A                                    262   2e-75    
gb|EMT65499.1|  Carboxypeptidase Y like protein A                       261   2e-75    
emb|CDS13741.1|  hypothetical protein LRAMOSA05915                      260   3e-75    
ref|XP_001258493.1|  carboxypeptidase CpyA/Prc1, putative               261   3e-75    
gb|EMF15806.1|  Peptidase_S10-domain-containing protein                 261   3e-75    
ref|XP_387071.1|  hypothetical protein FG06895.1                        261   4e-75    
gb|EGU80915.1|  hypothetical protein FOXB_08579                         261   4e-75    
gb|EYE97129.1|  hypothetical protein EURHEDRAFT_410168                  261   4e-75    
ref|XP_009521299.1|  hypothetical protein PHYSODRAFT_555555             258   4e-75    
ref|XP_663046.1|  hypothetical protein AN5442.2                         261   5e-75    
emb|CCX30417.1|  Similar to Carboxypeptidase Y homolog A; acc. no...    260   6e-75    
ref|XP_001908036.1|  hypothetical protein                               261   6e-75    
ref|XP_007812480.1|  carboxypeptidase Y precursor                       261   7e-75    
gb|KGK37810.1|  hypothetical protein JL09_g3045                         260   8e-75    
ref|XP_009521301.1|  hypothetical protein PHYSODRAFT_555560             258   8e-75    



>ref|XP_009758588.1| PREDICTED: serine carboxypeptidase-like [Nicotiana sylvestris]
Length=501

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/479 (66%), Positives = 374/479 (78%), Gaps = 10/479 (2%)
 Frame = -2

Query  1736  PAGQANGEDNSMANSKR----RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLK  1569
             PA  +N +D  + +S +     AEK I QLNLFP HD+N+      V     RL EKK  
Sbjct  20    PALSSNNDDEFVLSSPKFPVPMAEKFINQLNLFPKHDINKFEPGKSVATTEQRLFEKKFN  79

Query  1568  LNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSL  1389
             L+ LGDSGATV+DLG HAGYYRLP+T DARMFYFFFESRS+++DPVVIWLTGGPGCSS L
Sbjct  80    LSYLGDSGATVQDLGHHAGYYRLPHTKDARMFYFFFESRSSQNDPVVIWLTGGPGCSSEL  139

Query  1388  ALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSND  1209
             A+FYENGPF IADN SL WND+GWDK SNLIYVDQPTGTGFSYSS E+D R DE GVSND
Sbjct  140   AVFYENGPFNIADNMSLVWNDFGWDKVSNLIYVDQPTGTGFSYSSDEDDIRHDERGVSND  199

Query  1208  LYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGN  1029
             LY FLQ FFKAHP+Y K++F++TGESYAGHYIPA  +R++QGNK KEG HINLKG  IGN
Sbjct  200   LYDFLQAFFKAHPQYEKNDFYITGESYAGHYIPAFASRVHQGNKNKEGTHINLKGFVIGN  259

Query  1028  GLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNS  855
             GLT+P IQY AY D+ALD  LI K+ ++ + +  P CQ+A+R C ++GGSAC  + LV  
Sbjct  260   GLTNPEIQYKAYTDYALDMRLIKKADYNAIDKSYPKCQQAIRLCGTDGGSACMAAYLV--  317

Query  854   RCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSC  675
              C  ++++IM+ + D NYYD+RK C  G LCYDFS  ET LN + VK ALGVG ID+VSC
Sbjct  318   -CTSIFNKIMDVVGDKNYYDVRKTC-AGDLCYDFSKMETLLNDEQVKHALGVGGIDFVSC  375

Query  674   STTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKG  495
             S+TVY+ M  D  +NL  GIP LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK 
Sbjct  376   SSTVYQAMQLDWMRNLEAGIPPLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWTGQKD  435

Query  494   FGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             FGAA +V F+V G+EKGIQK++GPLTFLKVHDAGH+VPMDQPKA+LEML+RWM G+L K
Sbjct  436   FGAARSVPFTVDGEEKGIQKNHGPLTFLKVHDAGHMVPMDQPKAALEMLQRWMQGKLSK  494



>ref|XP_009617667.1| PREDICTED: serine carboxypeptidase-like [Nicotiana tomentosiformis]
Length=505

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/458 (67%), Positives = 370/458 (81%), Gaps = 7/458 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTP-RLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             AEK+IRQLNLFP HD+N+ +      A T  RL EKKL L+ +G+SG+TV+DLG HAGYY
Sbjct  45    AEKLIRQLNLFPKHDINKAAATGDSAAVTEQRLFEKKLNLSYVGNSGSTVQDLGHHAGYY  104

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP+T DARMFYFFFESRS K+DPVVIWLTGGPGCSS LA+FYENGPF IADN SL WND
Sbjct  105   RLPHTKDARMFYFFFESRSRKNDPVVIWLTGGPGCSSELAVFYENGPFKIADNMSLVWND  164

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDK SNLIYVDQPTGTGFSYSS+++D R DE GVSNDLY FLQ FFKAHP+YAK++F+
Sbjct  165   FGWDKVSNLIYVDQPTGTGFSYSSNDDDIRHDERGVSNDLYDFLQAFFKAHPQYAKNDFY  224

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGNK KEGI++NLKG AIGNGLTDP IQY AY D+ALD  L
Sbjct  225   ITGESYAGHYIPAFASRVHQGNKNKEGIYVNLKGFAIGNGLTDPEIQYKAYTDYALDMKL  284

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDI  792
             I KS ++ + +  P CQ A++ C  +GG+AC  + LV   C  ++++IM+   D NYYD+
Sbjct  285   IKKSDYNAIEKSYPKCQLAIKLCGKDGGTACMAAYLV---CTSIFNKIMDIAGDKNYYDV  341

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK+C  G LCYDFS  ETFLN + VK ALGVGDI++VSCS+ VY+ M  D  +NL  GIP
Sbjct  342   RKRC-EGDLCYDFSKMETFLNDQQVKKALGVGDIEFVSCSSEVYQAMQLDWMRNLELGIP  400

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             SLL+DGI LLVY GEYDLICNWLGN RWV A++W GQK FG A +V+F+V G EKG+QK+
Sbjct  401   SLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMKWTGQKAFGKATSVSFAVDGVEKGVQKN  460

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             YGPLTFLKVHDAGH+VPMDQPKA++EML+RWM  +L K
Sbjct  461   YGPLTFLKVHDAGHMVPMDQPKAAMEMLQRWMQDKLSK  498



>ref|XP_006347201.1| PREDICTED: serine carboxypeptidase 3-like [Solanum tuberosum]
Length=500

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/478 (64%), Positives = 375/478 (78%), Gaps = 6/478 (1%)
 Frame = -2

Query  1739  SPAGQANGEDNSMANSKR----RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKL  1572
             S   ++N  DN ++++++     AEK+IRQLNLFP H++N+ +  S   A    L EKKL
Sbjct  18    SSTAKSNDADNFLSSAQKFPITMAEKLIRQLNLFPKHEINKATEDSAA-ATEQGLFEKKL  76

Query  1571  KLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSS  1392
              L+ +GDSGATV++LG HAGYYRLP+T DARMFYFFFESRS K+DPVVIWLTGGPGCSS 
Sbjct  77    NLSYIGDSGATVQNLGHHAGYYRLPHTKDARMFYFFFESRSRKNDPVVIWLTGGPGCSSE  136

Query  1391  LALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSN  1212
             LA+FYENGPF IADN SL WND+GWDK SNLIYVDQPTGTGFSYSSSE+D R DE GVSN
Sbjct  137   LAVFYENGPFKIADNMSLVWNDFGWDKVSNLIYVDQPTGTGFSYSSSEDDIRHDERGVSN  196

Query  1211  DLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIG  1032
             DL+ FLQ FFKAHP+YAK++F++TGESYAGHYIPA  +R++QGNK KEGI+INLKG AIG
Sbjct  197   DLFDFLQVFFKAHPQYAKNDFYITGESYAGHYIPAFASRVHQGNKNKEGIYINLKGFAIG  256

Query  1031  NGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSR  852
             NGLTDP IQY AY DFALD  LI+KS ++ + +  P CQ+A++ C  +            
Sbjct  257   NGLTDPEIQYKAYSDFALDMKLINKSDYNTIEKTYPQCQQAIKLCGKDRSGVACMAAYLV  316

Query  851   CQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCS  672
             C  ++++IM  + D NYYD+RK+CV G LCYDFS  ETFLN + V+ ALGVGDI++VSCS
Sbjct  317   CTSIFNKIMNIVGDKNYYDLRKRCV-GDLCYDFSKMETFLNDQKVRQALGVGDIEFVSCS  375

Query  671   TTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGF  492
             + VY+ M  D  KNL  GIPSLL+DGI LL+Y GEYDLICNWLGN RWV A++W GQ  F
Sbjct  376   SEVYQAMQLDWMKNLEVGIPSLLEDGIKLLIYAGEYDLICNWLGNSRWVHAMKWSGQNAF  435

Query  491   GAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             G AP V+F+V G EKG++K++GPLTFLKVHDAGH+VPMDQPKA+LEML+RWM  +L K
Sbjct  436   GKAPLVSFTVDGVEKGVEKNHGPLTFLKVHDAGHMVPMDQPKAALEMLQRWMQNKLTK  493



>ref|XP_009592158.1| PREDICTED: serine carboxypeptidase-like [Nicotiana tomentosiformis]
Length=501

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/479 (65%), Positives = 375/479 (78%), Gaps = 10/479 (2%)
 Frame = -2

Query  1736  PAGQANGEDNSMANSKR----RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLK  1569
             PA  +N +D  + +S +     AEK+I QLNLFP HD+N+      V     RL EKK  
Sbjct  20    PALSSNNDDEFVLSSTKFPVPMAEKLINQLNLFPKHDINKVEPGKSVATTEQRLFEKKFN  79

Query  1568  LNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSL  1389
             L+ LGDSGATV+DLG HAGYY LP+T DARMFYFFFESRS+++DPVVIWLTGGPGCSS L
Sbjct  80    LSYLGDSGATVQDLGHHAGYYSLPHTKDARMFYFFFESRSSQNDPVVIWLTGGPGCSSEL  139

Query  1388  ALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSND  1209
             A+FYENGPF IADN SL WND+GWDK SNLIYVDQPTGTGFSYSS E+D R DE GVS+D
Sbjct  140   AVFYENGPFNIADNMSLVWNDFGWDKVSNLIYVDQPTGTGFSYSSDEDDIRHDERGVSSD  199

Query  1208  LYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGN  1029
             LY FLQ FFKAHP+Y K++F++TGESYAGHYIPA  +R++QGNK KEGI INLKG AIGN
Sbjct  200   LYDFLQAFFKAHPQYEKNDFYITGESYAGHYIPAFASRVHQGNKNKEGIQINLKGFAIGN  259

Query  1028  GLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNS  855
             GLT+P IQY AY D+ALD  LI K+ ++ + +  P CQ+A+R C ++GGSAC  + LV  
Sbjct  260   GLTNPEIQYKAYTDYALDMRLIKKADYNAIDKSYPKCQQAIRLCGTDGGSACMAAYLV--  317

Query  854   RCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSC  675
              C  ++++IM+ + D NYYD+RK C  G LCYDFS  ET LN + VK ALGVG ID+VSC
Sbjct  318   -CTSIFNKIMDVVGDKNYYDVRKTC-DGDLCYDFSKMETLLNDEQVKHALGVGGIDFVSC  375

Query  674   STTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKG  495
             S+TVY+ M  D  +NL  GIP LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK 
Sbjct  376   SSTVYQAMQLDWMRNLEAGIPPLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKD  435

Query  494   FGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             FGAA +V F+V G+EKGIQK++GPLTFLKVHDAGH+VPMDQPKA+LEML+RWM G+L K
Sbjct  436   FGAARSVPFTVDGEEKGIQKNHGPLTFLKVHDAGHMVPMDQPKAALEMLQRWMQGKLSK  494



>ref|XP_009785283.1| PREDICTED: serine carboxypeptidase-like [Nicotiana sylvestris]
Length=498

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/457 (67%), Positives = 366/457 (80%), Gaps = 9/457 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYR  1503
             AEK+IRQLNLFP HD+N+ +     E    R  E+KL L+ +G+SG+TV+DLG HAGYYR
Sbjct  42    AEKLIRQLNLFPKHDINKAAATGDSEQ---RHFERKLNLSYVGNSGSTVQDLGHHAGYYR  98

Query  1502  LPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDY  1323
             LP+T DARMFYFFFESRS K+DPVVIWLTGGPGCSS LA+FYENGPF IADN SL WND+
Sbjct  99    LPHTKDARMFYFFFESRSRKNDPVVIWLTGGPGCSSELAVFYENGPFKIADNMSLVWNDF  158

Query  1322  GWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFV  1143
             GWDK SNLIYVDQPTGTGFSYSS+++D R DE GVSNDLY FLQ FFKAHP+YAK++F++
Sbjct  159   GWDKVSNLIYVDQPTGTGFSYSSNDDDIRHDERGVSNDLYDFLQAFFKAHPQYAKNDFYI  218

Query  1142  TGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLI  963
             TGESYAGHYIPA  +R++QGNK KEGI++NLKG AIGNGLTDP IQY AY D+ALD  LI
Sbjct  219   TGESYAGHYIPAFASRVHQGNKNKEGIYVNLKGFAIGNGLTDPEIQYKAYTDYALDMKLI  278

Query  962   SKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDIR  789
              KS ++ + +  P CQ A++ C  +GG+AC  + LV   C  ++++IM+   D NYYD+R
Sbjct  279   KKSDYNAIEKSYPKCQLAIKLCGKDGGTACMAAYLV---CTSIFNKIMDIAGDKNYYDVR  335

Query  788   KKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPS  609
             K+C  G LCYDFS  ETFLN + VK ALGVGDI++VSCS+ VY+ M  D  +NL  GIPS
Sbjct  336   KRC-EGDLCYDFSKMETFLNDQQVKKALGVGDIEFVSCSSEVYQAMQLDWMRNLEEGIPS  394

Query  608   LLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSY  429
             LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK FG A  V+F+V G EKG+QK+Y
Sbjct  395   LLEDGIKLLVYAGEYDLICNWLGNSRWVHAMKWSGQKAFGKATQVSFAVDGVEKGVQKNY  454

Query  428   GPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             GPLTFLKVHDAGH+VPMDQPKA+LEML RWM  +L K
Sbjct  455   GPLTFLKVHDAGHMVPMDQPKAALEMLHRWMQDKLSK  491



>ref|XP_004241292.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/476 (64%), Positives = 373/476 (78%), Gaps = 8/476 (2%)
 Frame = -2

Query  1733  AGQANGEDNSMANSKR----RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL  1566
             + ++N  DN ++++++     AEK+IRQLNLFP H++N+ +  S  +     L EKKL L
Sbjct  16    SAKSNDADNFLSSTQKFPITMAEKLIRQLNLFPKHEINKATDDSATQQG---LFEKKLNL  72

Query  1565  NLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLA  1386
             + +GDSGATV++LG HAGYYRLP+T DARMFYFFFESRS K+DPVVIWLTGGPGCSS LA
Sbjct  73    SYIGDSGATVQNLGHHAGYYRLPHTKDARMFYFFFESRSRKNDPVVIWLTGGPGCSSELA  132

Query  1385  LFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDL  1206
             +FYENGPF IADN SL WN++GWDK SNLIYVDQPTGTGFSYSSSE+D R DE GVSNDL
Sbjct  133   VFYENGPFKIADNMSLVWNNFGWDKVSNLIYVDQPTGTGFSYSSSEDDIRHDERGVSNDL  192

Query  1205  YAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNG  1026
             Y FLQ FFKAHP+YAK++F++TGESYAGHYIPA  +R++QGNK KEGI++NLKG AIGNG
Sbjct  193   YDFLQVFFKAHPQYAKNDFYITGESYAGHYIPAFASRVHQGNKNKEGIYVNLKGFAIGNG  252

Query  1025  LTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQ  846
             LTDP IQY AY DFALD  LI+KS ++ + +  P CQ+A++ C  +            C 
Sbjct  253   LTDPEIQYKAYTDFALDMKLINKSDYNTIEKTYPQCQQAIKLCGKDRSGVACMAAYLVCT  312

Query  845   PLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTT  666
              ++++IM  + D NYYD+RK+C  G LCYDFS  ETFLN + V+ ALGVGDI++VSCS+ 
Sbjct  313   SIFNKIMNIVGDKNYYDLRKRC-EGDLCYDFSKMETFLNDQKVRQALGVGDIEFVSCSSQ  371

Query  665   VYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGA  486
             VY+ M  D  KNL  GIPSLL+DGI LLVY GEYDLICNWLGN RWV A++W GQ  FG 
Sbjct  372   VYQAMQLDWMKNLEVGIPSLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMKWSGQNAFGK  431

Query  485   APNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             AP V+F+V G EKG++K++GPLTFLKVHDAGH+VPMDQP A+LEML+RWM  +L K
Sbjct  432   APLVSFTVDGVEKGVEKNHGPLTFLKVHDAGHMVPMDQPNAALEMLQRWMQNKLTK  487



>ref|XP_006424468.1| hypothetical protein CICLE_v10028234mg [Citrus clementina]
 gb|ESR37708.1| hypothetical protein CICLE_v10028234mg [Citrus clementina]
Length=508

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/456 (65%), Positives = 362/456 (79%), Gaps = 2/456 (0%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K +AEK+IR LNLFP   +N  +         P+LVEK+L LN LGD G +V++ G HAG
Sbjct  43    KLQAEKLIRGLNLFPKSSVNTAAAGDHASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAG  102

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY LP++  ARMFYFFFESR+NKSDPVVIWLTGGPGCSS LALFYENGPF+IA+N SL W
Sbjct  103   YYTLPHSQSARMFYFFFESRNNKSDPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVW  162

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDKASNL++VDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  HP+YAK++
Sbjct  163   NDYGWDKASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQAFFAEHPQYAKND  222

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R+++GNK+K+GIHINLKG AIGNGLTDP IQY  Y ++AL+ 
Sbjct  223   FYITGESYAGHYIPAFASRVHKGNKEKQGIHINLKGFAIGNGLTDPAIQYKEYTEYALNM  282

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI +S ++ + +LIP C+ A++ C S+GG ACS    + C  ++++I+    D+NYYDI
Sbjct  283   RLIKQSDYESINKLIPTCEHAIKTCESDGGDACSSSY-AVCNSIFNKILGIAGDVNYYDI  341

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKC  G LCYDFSN E FLN KSV++ALGVGDID+VSCS+TVYE M  D  +N   GIP
Sbjct  342   RKKC-EGDLCYDFSNMERFLNEKSVREALGVGDIDFVSCSSTVYEAMLMDWMRNFEVGIP  400

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK FGAA  V F V G E G  KS
Sbjct  401   TLLEDGIRVLIYAGEYDLICNWLGNSKWVHAMEWSGQKDFGAAATVPFKVDGAETGQIKS  460

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLKVHDAGH+VPMDQPKASL+ML+ WMHG+L
Sbjct  461   HGPLTFLKVHDAGHMVPMDQPKASLQMLQSWMHGKL  496



>ref|XP_006488020.1| PREDICTED: serine carboxypeptidase-like 48-like isoform X1 [Citrus 
sinensis]
Length=508

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/456 (65%), Positives = 361/456 (79%), Gaps = 2/456 (0%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             KR+AEK+IR LNLFP   +N  +         P+LVEK+L LN LGD G +V++ G HAG
Sbjct  43    KRQAEKLIRGLNLFPKSSVNTAAAGDHASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAG  102

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY LP++  ARMFYFFFESR+NKSDPVVIWLTGGPGCSS LALFYENGPF+IA+N SL W
Sbjct  103   YYTLPHSQSARMFYFFFESRNNKSDPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVW  162

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDKASNL++VDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  HP+YAK++
Sbjct  163   NDYGWDKASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQAFFAEHPQYAKND  222

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R+++GNK K+GIHINLKG AIGNGLTDP IQY  Y ++AL+ 
Sbjct  223   FYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPAIQYKEYTEYALNM  282

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI +S ++ + +LIP C+ A++ C S+GG ACS    + C  ++++I+    D+NYYDI
Sbjct  283   RLIKQSDYESINKLIPTCEHAIKTCESDGGDACSSSY-AVCNSIFNKILGIAGDVNYYDI  341

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKC  G LCYDFSN E FLN KSV++ALGVGDID+VSCS+TVYE M  D  +N   GIP
Sbjct  342   RKKC-EGDLCYDFSNMERFLNEKSVREALGVGDIDFVSCSSTVYEAMLMDWMRNFEVGIP  400

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK FGAA  V F V G E G  KS
Sbjct  401   TLLEDGIRVLIYAGEYDLICNWLGNSKWVHAMEWSGQKDFGAAATVPFKVDGAETGQIKS  460

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  461   HGPLTFLKVHDAGHMVPMDQPKASLQMLQSWMQGKL  496



>emb|CDP07044.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/474 (64%), Positives = 377/474 (80%), Gaps = 8/474 (2%)
 Frame = -2

Query  1727  QANGEDNSMANS------KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL  1566
             +A G D+++  S      K++AEK+IR+LNLFP HD+N  +G++   A    +VEK+L L
Sbjct  28    RATGNDHNLLPSSTLNFPKKQAEKLIRELNLFPEHDININTGNNSAAAAATSVVEKRLNL  87

Query  1565  NLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLA  1386
              +LGDSGATV+DLG HAGY+RLPNT  ARMFYFFFESR +K+DPVVIWLTGGPGC   LA
Sbjct  88    PVLGDSGATVQDLGHHAGYFRLPNTKAARMFYFFFESRKDKTDPVVIWLTGGPGCGCELA  147

Query  1385  LFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDL  1206
             LFYENGPF IA+N SL WN++GWDK SNLIYVDQPTGTGFSYSSSEED R DE GVSNDL
Sbjct  148   LFYENGPFKIANNLSLVWNNFGWDKVSNLIYVDQPTGTGFSYSSSEEDVRHDEFGVSNDL  207

Query  1205  YAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNG  1026
             Y FLQ FFK HP+YAK+ F++TGESYAGHYIPAL +R+ QGNK KEG +INLKGLAIGNG
Sbjct  208   YNFLQAFFKQHPEYAKNNFYITGESYAGHYIPALASRVLQGNKNKEGTYINLKGLAIGNG  267

Query  1025  LTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQ  846
             LT+PGIQY AYPD+ALD  +IS+S ++ L + +  C +A++ C +NG ++C       C+
Sbjct  268   LTNPGIQYKAYPDYALDMKVISQSDYNTLQKSVADCDKALKPCGTNGENSCVTAFQV-CE  326

Query  845   PLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTT  666
              +++ I+     LNYYDIRK+C  G LCYDFSN E FL+ +SVK ALGVG+I++VSCSTT
Sbjct  327   SIFNDILSIAFGLNYYDIRKEC-EGDLCYDFSNVEHFLSQQSVKSALGVGNIEFVSCSTT  385

Query  665   VYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGA  486
             V++ M +DI +NL  G+P+LL+ GINLLVY GEYDLICNWLGN RWV+A++W GQK + A
Sbjct  386   VHQDMITDIMRNLEVGVPALLEAGINLLVYAGEYDLICNWLGNSRWVEAMEWSGQKNYLA  445

Query  485   APNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             AP V F+V G E G+QK YGPL FLKVH+AGHLVPMDQP+A+L+M++RW+ G+L
Sbjct  446   APTVPFTVDGSEAGLQKKYGPLIFLKVHNAGHLVPMDQPEAALDMIQRWLQGKL  499



>ref|XP_011089952.1| PREDICTED: serine carboxypeptidase-like [Sesamum indicum]
Length=510

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/456 (65%), Positives = 369/456 (81%), Gaps = 3/456 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             + +AE++IR LNLFP +++N  +G      ++ R+VEK+ K   LGDSGA+V+DLG HAG
Sbjct  46    RTQAERLIRALNLFPKNEVNHHAGKDHGFGES-RIVEKQFKFPFLGDSGASVQDLGHHAG  104

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YYRL ++ DARMFYFFFESR++++DPVVIWLTGGPGCSS LALFYENGPF+I +N SL W
Sbjct  105   YYRLQHSKDARMFYFFFESRNSRTDPVVIWLTGGPGCSSELALFYENGPFHITNNLSLTW  164

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             ND+GWDK SNLIYVDQPTGTGFSYSS ++D R +E+GVSNDLY FLQ FFK HP+YAK++
Sbjct  165   NDFGWDKVSNLIYVDQPTGTGFSYSSDDDDIRHNEEGVSNDLYDFLQAFFKEHPQYAKND  224

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA   R++QGNK+KEGIHINLKG AIGNGLT+P IQY AY D+ALD 
Sbjct  225   FYITGESYAGHYIPAFAARVHQGNKRKEGIHINLKGFAIGNGLTNPEIQYQAYTDYALDM  284

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI+KS ++ +   +  CQ+A++ C +NGGS+C       C  ++++I+      NYYDI
Sbjct  285   KLITKSDYNSMKTSVSRCQQAIKLCGANGGSSCV-AAYMVCNVVFNKIVRISGGKNYYDI  343

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK+C  G+LCYDFS+ E FLN KSV+DALGVGDID+VSCS+TVYE M +D+ +NL  GIP
Sbjct  344   RKEC-EGNLCYDFSSVEDFLNLKSVRDALGVGDIDFVSCSSTVYEAMVADMMRNLEVGIP  402

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI LLVY GEYDLICNW+GN RWV A++W G+K F AAP + FSV G E G+QK 
Sbjct  403   ALLEDGIKLLVYAGEYDLICNWIGNSRWVHAMEWSGRKEFVAAPTIPFSVDGLEAGMQKG  462

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLKVH+AGH+VPMDQPKASLEMLRRWM G+L
Sbjct  463   HGPLTFLKVHNAGHMVPMDQPKASLEMLRRWMQGKL  498



>gb|KDO60255.1| hypothetical protein CISIN_1g010473mg [Citrus sinensis]
Length=508

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/456 (64%), Positives = 361/456 (79%), Gaps = 2/456 (0%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K +AEK+IR LNLFP   +N  +         P+LVEK+L LN LGD G +V++ G HAG
Sbjct  43    KLQAEKLIRGLNLFPKSSVNTAAAGDHASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAG  102

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY LP++  ARMFYFFFESR+NKSDPVVIWLTGGPGCSS LALFYENGPF+IA+N SL W
Sbjct  103   YYTLPHSQSARMFYFFFESRNNKSDPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVW  162

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDKASNL++VDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  HP+YAK++
Sbjct  163   NDYGWDKASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQAFFAEHPQYAKND  222

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R+++GNK+K+GIHINLKG AIGNGLTDP IQY  Y ++AL+ 
Sbjct  223   FYITGESYAGHYIPAFASRVHKGNKEKQGIHINLKGFAIGNGLTDPAIQYKEYTEYALNM  282

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI +S ++ + +LIP C+ A++ C S+GG ACS    + C  ++++I+    D+NYYDI
Sbjct  283   RLIKQSDYESINKLIPTCEHAIKTCESDGGDACSSSY-AVCNSIFNKILGIAGDVNYYDI  341

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKC  G LCYDFSN E FLN KSV++ALGVGDID+VSCS+TVYE M  D  +N   GIP
Sbjct  342   RKKC-EGDLCYDFSNMERFLNEKSVREALGVGDIDFVSCSSTVYEAMLMDWMRNFEVGIP  400

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK FGAA  V F V G E G  KS
Sbjct  401   TLLEDGIRVLIYAGEYDLICNWLGNSKWVHAMEWSGQKDFGAAATVPFKVDGAETGQIKS  460

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  461   HGPLTFLKVHDAGHMVPMDQPKASLQMLQSWMQGKL  496



>ref|XP_010689129.1| PREDICTED: serine carboxypeptidase-like [Beta vulgaris subsp. 
vulgaris]
Length=517

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/462 (65%), Positives = 363/462 (79%), Gaps = 8/462 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGH-----SPVEADTPRLVEKKLKLNLLG-DSGATVED  1530
             K +AE++IR LNLFP H  N    +     + +  D   LVEK+ K++ LG D G +VED
Sbjct  46    KLQAERLIRHLNLFPKHPFNNRVENENENEAGLSVDGSGLVEKRFKISELGGDPGTSVED  105

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYYRLP++ DARMFYFFFESRS+K+DP+VIWLTGGPGCSS LALFYENGPF IA+
Sbjct  106   LGHHAGYYRLPHSKDARMFYFFFESRSSKNDPIVIWLTGGPGCSSELALFYENGPFQIAN  165

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WND+GWDKASNLIYVDQP GTGFSY+S   D R DE+GVSNDLY FLQ FFKAHP
Sbjct  166   NMSLMWNDFGWDKASNLIYVDQPVGTGFSYTSDTTDIRHDENGVSNDLYDFLQAFFKAHP  225

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             +YAK++F++TGESYAGHYIPA   R++ GNK +EG+HINLKG AIGNGLT P IQY AYP
Sbjct  226   QYAKNDFYITGESYAGHYIPAFAARVHNGNKAQEGLHINLKGFAIGNGLTHPEIQYKAYP  285

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVD  810
             D+ALDN +I KS H  ++++IP C++A++QC ++G  AC     + C  ++++IM++  +
Sbjct  286   DYALDNGIIKKSDHKRISKMIPACEQAIKQCGTDGKDACLSAYFA-CTDIFNKIMDQAGE  344

Query  809   LNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKN  630
             +NYYDIRKKC   +LCYDFSN ET LN KSV+ ALGVGD+D+VSCST VYE M  D  +N
Sbjct  345   INYYDIRKKC-ETNLCYDFSNMETLLNQKSVRKALGVGDVDFVSCSTEVYEAMQMDWMRN  403

Query  629   LAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKE  450
             L  GIP+LL+DG+ LLVY GEYDLICNWLGN RWV A++W GQK F AA  V+FSV GKE
Sbjct  404   LEVGIPALLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFTAASTVSFSVDGKE  463

Query  449   KGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G  KS+GPL FLKVHDAGH+VPMDQPKA+LEML++W  G L
Sbjct  464   AGQLKSHGPLAFLKVHDAGHMVPMDQPKAALEMLKQWTQGTL  505



>ref|XP_004240682.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/475 (64%), Positives = 368/475 (77%), Gaps = 10/475 (2%)
 Frame = -2

Query  1724  ANGEDNSMANSKR----RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLL  1557
             +N ED  M +S +     AEK+I+Q NLFP HD+N+ S           L EK+  L+ L
Sbjct  27    SNNEDEFMVSSVKFPVPMAEKLIKQFNLFPKHDINKASSSPLAATHQQTLFEKRFNLSYL  86

Query  1556  GDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFY  1377
             GDSGATV+DLG HAGYY LP+T DARMFYFFFESRS+++DPVVIWLTGGPGCSS LA+FY
Sbjct  87    GDSGATVQDLGHHAGYYILPHTKDARMFYFFFESRSSQNDPVVIWLTGGPGCSSELAVFY  146

Query  1376  ENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAF  1197
             ENGPF IADN SL WND+GWDK SNLIYVDQP GTGFSYSS ++D R DE GVSNDLY F
Sbjct  147   ENGPFNIADNMSLVWNDFGWDKVSNLIYVDQPIGTGFSYSSDDDDIRHDERGVSNDLYDF  206

Query  1196  LQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTD  1017
             LQ FFKAHP+Y  ++F++TGESYAGHYIPA  +R++QGNK KEGI INLKG AIGNGLT+
Sbjct  207   LQAFFKAHPQYVNNDFYITGESYAGHYIPAFASRVHQGNKNKEGIQINLKGFAIGNGLTN  266

Query  1016  PGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQP  843
             P IQY AY D+ALD  LI +S ++ + +  P CQ+A++ C ++GGSAC  + LV   C  
Sbjct  267   PEIQYKAYTDYALDMRLIKQSDYNVIDKSYPKCQQAIKLCGTDGGSACMAAYLV---CTS  323

Query  842   LYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTV  663
             ++++IM  + + NYYD+RK C  G LCYDFSN E  LN + VK ALGVGDI++VSCS+TV
Sbjct  324   IFNKIMNVVGNKNYYDVRKTC-DGDLCYDFSNMENLLNDEKVKHALGVGDIEFVSCSSTV  382

Query  662   YEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAA  483
             Y+ M  D  +NL  GIP LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK FGAA
Sbjct  383   YQAMQLDWMRNLEAGIPPLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFGAA  442

Query  482   PNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
              +V F V G+EKGI+K++G LTFL+VHDAGH+VPMDQPKA+LEML+RWM G+L K
Sbjct  443   RSVPFIVDGEEKGIEKNHGTLTFLRVHDAGHMVPMDQPKAALEMLQRWMQGKLSK  497



>ref|XP_006343737.1| PREDICTED: serine carboxypeptidase-like 48-like [Solanum tuberosum]
Length=504

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/474 (64%), Positives = 372/474 (78%), Gaps = 10/474 (2%)
 Frame = -2

Query  1721  NGEDNSMANSKR----RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLG  1554
             + ED  M +S +     AEK+I+QLNLFP HD+N+ S           L EK+  L+ LG
Sbjct  28    HNEDEFMLSSAKFPVPMAEKLIKQLNLFPKHDINKASSSPLAATHQQTLFEKRFNLSYLG  87

Query  1553  DSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYE  1374
             DSGATV+DLG HAGYYRLP+T DARMFYFFFESRS+++DPVVIWLTGGPGCSS LA+FYE
Sbjct  88    DSGATVQDLGHHAGYYRLPHTKDARMFYFFFESRSSQNDPVVIWLTGGPGCSSELAVFYE  147

Query  1373  NGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFL  1194
             NGPF IADN SL WN++GWDK SNLIYVDQPTGTGFSY+S ++D R DE GVSNDLY FL
Sbjct  148   NGPFNIADNMSLVWNNFGWDKISNLIYVDQPTGTGFSYTSDDDDIRHDERGVSNDLYDFL  207

Query  1193  QEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDP  1014
             Q FFKAHP+Y K++F++TGESYAGHYIPA  +R++QGNK K+GI INLKG AIGNGLT+P
Sbjct  208   QAFFKAHPQYVKNDFYITGESYAGHYIPAFASRVHQGNKNKDGIPINLKGFAIGNGLTNP  267

Query  1013  GIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPL  840
              IQY AY D+ALD  LI +S ++ + +  P CQ+A++ C ++GGSAC  + LV   C  +
Sbjct  268   EIQYKAYTDYALDMRLIKQSDYNVIDKSYPKCQQAIKLCGTDGGSACMAAYLV---CTSI  324

Query  839   YDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVY  660
             +++IM  + + NYYD+RK C  G LCYDFSN E  LN + VK ALGVGDI++VSCS+TVY
Sbjct  325   FNKIMNVVGNKNYYDVRKTC-DGDLCYDFSNMENLLNDEQVKHALGVGDIEFVSCSSTVY  383

Query  659   EVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAP  480
             + M  D  +NL  GIP LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F AA 
Sbjct  384   QAMQLDWMRNLEAGIPPLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFRAAR  443

Query  479   NVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             +V F+V G+EKGI+K++GP+TFL+VHDAGH+VPMDQPKA+LEML+RWM G+L K
Sbjct  444   SVPFTVDGEEKGIEKNHGPVTFLRVHDAGHMVPMDQPKAALEMLQRWMQGKLSK  497



>ref|XP_009607096.1| PREDICTED: serine carboxypeptidase-like [Nicotiana tomentosiformis]
Length=502

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/450 (68%), Positives = 356/450 (79%), Gaps = 4/450 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVE-ADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             AEK IRQLNLFP HD+N  S    +  A+  RL EKKL L  LGDSGATV+DLG HAGY+
Sbjct  48    AEKFIRQLNLFPKHDINIISSKDNIALANEERLFEKKLNLPYLGDSGATVQDLGHHAGYF  107

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RL +T  ARMFYFFFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL WND
Sbjct  108   RLAHTKAARMFYFFFESRSNKNDPVVIWLTGGPGCSSELALFYENGPFKLSNNMSLVWND  167

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDK SNLIYVDQPTGTGFSYS+ + D R +E GVSNDLY FLQEFFKAHP Y  ++F+
Sbjct  168   FGWDKVSNLIYVDQPTGTGFSYSTDDSDIRRNETGVSNDLYDFLQEFFKAHPDYVNNDFY  227

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R+NQGNK KEGI+INLKG AIGNGLT+P IQY AY D+ALD  L
Sbjct  228   ITGESYAGHYIPAFASRVNQGNKNKEGININLKGFAIGNGLTNPEIQYKAYTDYALDMKL  287

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I+++ +D + +L P CQ+ +R C +    AC D     C  ++  IM+ + D NYYDIRK
Sbjct  288   INQTDYDAINELYPQCQQEIRLCGNGSDDACLDGF-GHCTNIFSSIMDVVGDKNYYDIRK  346

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPGIPS  609
              C  GSLCYDFS  ET+LN   VK ALGV   ID+VSCS+TVY+ M +D  KNL  GIP 
Sbjct  347   IC-QGSLCYDFSGMETYLNDDQVKQALGVPNSIDFVSCSSTVYQAMEADWMKNLEVGIPQ  405

Query  608   LLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSY  429
             LL+DGINLL+Y GEYDLICNWLGN  WV A++W GQK FGAAP+V+F+V G+EKGIQKSY
Sbjct  406   LLEDGINLLIYAGEYDLICNWLGNSNWVHAVEWSGQKDFGAAPSVSFTVDGEEKGIQKSY  465

Query  428   GPLTFLKVHDAGHLVPMDQPKASLEMLRRW  339
             GPLTFLKVHDAGH+VPMDQPKA+LEML+RW
Sbjct  466   GPLTFLKVHDAGHMVPMDQPKAALEMLQRW  495



>gb|KDO60256.1| hypothetical protein CISIN_1g010473mg [Citrus sinensis]
Length=509

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/457 (64%), Positives = 361/457 (79%), Gaps = 3/457 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K +AEK+IR LNLFP   +N  +         P+LVEK+L LN LGD G +V++ G HAG
Sbjct  43    KLQAEKLIRGLNLFPKSSVNTAAAGDHASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAG  102

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY LP++  ARMFYFFFESR+NKSDPVVIWLTGGPGCSS LALFYENGPF+IA+N SL W
Sbjct  103   YYTLPHSQSARMFYFFFESRNNKSDPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVW  162

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDKASNL++VDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  HP+YAK++
Sbjct  163   NDYGWDKASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQAFFAEHPQYAKND  222

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R+++GNK+K+GIHINLKG AIGNGLTDP IQY  Y ++AL+ 
Sbjct  223   FYITGESYAGHYIPAFASRVHKGNKEKQGIHINLKGFAIGNGLTDPAIQYKEYTEYALNM  282

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI +S ++ + +LIP C+ A++ C S+GG ACS    + C  ++++I+    D+NYYDI
Sbjct  283   RLIKQSDYESINKLIPTCEHAIKTCESDGGDACSSSY-AVCNSIFNKILGIAGDVNYYDI  341

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKC  G LCYDFSN E FLN KSV++ALGVGDID+VSCS+TVYE M  D  +N   GIP
Sbjct  342   RKKC-EGDLCYDFSNMERFLNEKSVREALGVGDIDFVSCSSTVYEAMLMDWMRNFEVGIP  400

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK FGAA  V F V G E G  KS
Sbjct  401   TLLEDGIRVLIYAGEYDLICNWLGNSKWVHAMEWSGQKDFGAAATVPFKVDGAETGQIKS  460

Query  431   YGPLTFLK-VHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLK VHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  461   HGPLTFLKQVHDAGHMVPMDQPKASLQMLQSWMQGKL  497



>gb|ABQ65860.1| serine carboxypeptidase III [Nicotiana tabacum]
Length=502

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/450 (67%), Positives = 355/450 (79%), Gaps = 4/450 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVE-ADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             AEK IRQLNLFP HD+N  S    +  A+  RL EKKL L  LGDSGATV+DLG HAGY+
Sbjct  48    AEKFIRQLNLFPKHDINIISSKDNIALANEERLFEKKLNLPYLGDSGATVQDLGHHAGYF  107

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RL +T  ARMFYF FESRSNK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL WND
Sbjct  108   RLAHTKAARMFYFLFESRSNKNDPVVIWLTGGPGCSSELALFYENGPFKLSNNMSLVWND  167

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDK SNLIYVDQPTGTGFSYS+ + D R +E GVSNDLY FLQEFFKAHP Y  ++F+
Sbjct  168   FGWDKVSNLIYVDQPTGTGFSYSTDDSDIRRNETGVSNDLYDFLQEFFKAHPDYVNNDFY  227

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R+NQGNK KEGI+INLKG AIGNGLT+P IQY AY D+ALD  L
Sbjct  228   ITGESYAGHYIPAFASRVNQGNKNKEGININLKGFAIGNGLTNPEIQYKAYTDYALDMKL  287

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I+++ +D + +L P CQ+ +R C +    AC D     C  ++  IM+ + D NYYDIRK
Sbjct  288   INQTDYDAINELYPQCQQEIRLCGNGSDDACLDGF-GHCTNIFSSIMDVVGDKNYYDIRK  346

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPGIPS  609
              C  GSLCYDFS  ET+LN   VK ALGV   ID+VSCS+TVY+ M +D  KNL  GIP 
Sbjct  347   IC-QGSLCYDFSGMETYLNDDQVKQALGVPTSIDFVSCSSTVYQAMEADWMKNLEVGIPQ  405

Query  608   LLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSY  429
             LL+DGINLL+Y GEYDLICNWLGN  WV A++W GQK FGAAP+V+F+V G+EKGIQKSY
Sbjct  406   LLEDGINLLIYAGEYDLICNWLGNSNWVHAVEWSGQKDFGAAPSVSFTVDGEEKGIQKSY  465

Query  428   GPLTFLKVHDAGHLVPMDQPKASLEMLRRW  339
             GPLTFLKVHDAGH+VPMDQPKA+LEML+RW
Sbjct  466   GPLTFLKVHDAGHMVPMDQPKAALEMLQRW  495



>ref|XP_009775797.1| PREDICTED: serine carboxypeptidase-like [Nicotiana sylvestris]
 gb|ABQ65859.1| serine carboxypeptidase III [Nicotiana tabacum]
Length=502

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/450 (67%), Positives = 357/450 (79%), Gaps = 4/450 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVE-ADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             AEK IRQLNLFP H++N  S +  +  A+  RL EKKL L  LGDSGATV+DLG HAGY+
Sbjct  48    AEKFIRQLNLFPKHNINIISSNDNIALANEERLFEKKLNLPYLGDSGATVQDLGHHAGYF  107

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RL +T  ARMFYFFFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF ++DN SL WND
Sbjct  108   RLAHTKAARMFYFFFESRSNKNDPVVIWLTGGPGCSSELALFYENGPFKLSDNMSLVWND  167

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDK SNLIYVDQPTGTGFSYS+ + D R +E GVSNDLY FLQEFFKAHP Y  ++F+
Sbjct  168   FGWDKVSNLIYVDQPTGTGFSYSTDDSDVRHNETGVSNDLYDFLQEFFKAHPDYVNNDFY  227

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R+NQGNK KEGI+INLKG AIGNGLT+P IQY AY D+ALD  L
Sbjct  228   ITGESYAGHYIPAFASRVNQGNKNKEGININLKGFAIGNGLTNPEIQYKAYTDYALDMKL  287

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I+++ +D + +L P CQ+ +R C      AC +    RC  +++ IM+ + D NYYDIRK
Sbjct  288   INQTDYDAINELYPQCQQEIRLCGKGSDDACLNAF-GRCTNIFNSIMDVVGDKNYYDIRK  346

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPGIPS  609
              C  G+LCYDFS  ET+LN   VK ALGV   ID+VSCS+TVY+ M +D  KNL  GIPS
Sbjct  347   IC-EGNLCYDFSGMETYLNDDQVKQALGVPNSIDFVSCSSTVYQAMETDWMKNLEVGIPS  405

Query  608   LLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSY  429
             LL+DG+NLL+Y GEYDLICNWLGN  WV A++W GQ  F AAP+V+F+V G+EKGIQKSY
Sbjct  406   LLEDGVNLLIYAGEYDLICNWLGNSNWVHAVEWSGQNNFAAAPSVSFTVDGEEKGIQKSY  465

Query  428   GPLTFLKVHDAGHLVPMDQPKASLEMLRRW  339
             GPLTFLKV+DAGH+VPMDQPKA+LEML+RW
Sbjct  466   GPLTFLKVNDAGHMVPMDQPKAALEMLQRW  495



>gb|KHG01758.1| Serine carboxypeptidase-like 48 [Gossypium arboreum]
Length=503

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/473 (61%), Positives = 368/473 (78%), Gaps = 4/473 (1%)
 Frame = -2

Query  1742  SSPAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLN  1563
             + P      +  S + +K +AEK+IR LNLFP   +N G     VE  T ++VEK+ +  
Sbjct  23    AKPISHWKNQSPSSSQAKLQAEKLIRGLNLFPKDAINAGDNAPAVE--TSKIVEKQFRFP  80

Query  1562  LLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLAL  1383
             +LG+ G ++++ G HAGYY+LP+ V ARMFY FFESR++K DPVVIWLTGGPGCSS LAL
Sbjct  81    VLGEPGPSIQEFGHHAGYYKLPHAVSARMFYLFFESRNSKKDPVVIWLTGGPGCSSELAL  140

Query  1382  FYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLY  1203
             FYENGPF++  N SL WNDYGWDKASN+++VDQPTGTGFSY+S E D R +E GVSNDLY
Sbjct  141   FYENGPFHLTKNLSLVWNDYGWDKASNILFVDQPTGTGFSYTSDENDLRHNETGVSNDLY  200

Query  1202  AFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGL  1023
              FLQEFFK HP+Y +++F++TGESYAGHYIPA   R++QGNK KEGIH+NLKG AIGNGL
Sbjct  201   DFLQEFFKQHPEYVENDFYITGESYAGHYIPAFAVRVHQGNKAKEGIHVNLKGFAIGNGL  260

Query  1022  TDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQP  843
             TDP IQY AYPD+AL+ ++I++S + ++ +L+P C +A+++C S GG AC D  ++ C  
Sbjct  261   TDPEIQYQAYPDYALNTSIITQSDYVDIKKLVPSCVQAIKRCGSKGGDACVDSFDT-CNT  319

Query  842   LYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTV  663
             L+D+I+    ++NYYDIRK+C  G LCYDFS  ETFLN K+V+DALGVG+ID+VSCST V
Sbjct  320   LFDQILSIAGNINYYDIRKEC-EGELCYDFSAVETFLNQKTVRDALGVGNIDFVSCSTEV  378

Query  662   YEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAA  483
             Y+ M +D  +NL  GIP+LL+DGI +L+Y GEYDLICNWLGN  WV A++W GQK FGAA
Sbjct  379   YDAMITDWMRNLEVGIPALLEDGIKVLIYAGEYDLICNWLGNSNWVHAMKWSGQKEFGAA  438

Query  482   PNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             P V+F V G E G  KS+GPL FLKVH+AGH+VPMDQPKASL+ML+ WM G+L
Sbjct  439   PTVSFMVDGVEAGQLKSHGPLAFLKVHNAGHMVPMDQPKASLQMLQNWMQGKL  491



>ref|XP_010031406.1| PREDICTED: serine carboxypeptidase-like [Eucalyptus grandis]
 gb|KCW50697.1| hypothetical protein EUGRSUZ_J00381 [Eucalyptus grandis]
Length=510

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/461 (64%), Positives = 360/461 (78%), Gaps = 9/461 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP---RLVEKKLKLNLLGDSGATVEDLGQ  1521
             + +AEK+IR  NLFP   +N G+G     A      ++VE +LKL LLG+SG++++DLG 
Sbjct  42    RTQAEKLIRGFNLFPRESVNIGAGDVDSAASLASGGKIVESRLKLPLLGNSGSSIQDLGH  101

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYYRLP++  ARMFYFFFESRS+  DPVVIWLTGGPGCSS LALFYENGPF+IA+N S
Sbjct  102   HAGYYRLPHSHAARMFYFFFESRSSADDPVVIWLTGGPGCSSELALFYENGPFHIANNLS  161

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WNDYGWDK SNLI+VDQPTGTGFSYSS + D R DE GVSNDLY FLQ FF AHP+ A
Sbjct  162   LVWNDYGWDKVSNLIFVDQPTGTGFSYSSVDSDIRHDEQGVSNDLYDFLQAFFAAHPQLA  221

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPA   R++QGNK K+GI INLKG AIGNGLT+P IQY AY D+A
Sbjct  222   KNDFYITGESYAGHYIPAFAARVHQGNKAKDGIQINLKGFAIGNGLTNPEIQYEAYTDYA  281

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNS--RCQPLYDRIMEKLVDL  807
             L+  LI++S HD +  ++P C++ ++QC + GG+AC   VNS   C  ++++IM+   D+
Sbjct  282   LNMKLITQSDHDNINAMLPDCKQGIKQCAAEGGNAC---VNSYEDCTSIFNKIMDIAGDI  338

Query  806   NYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNL  627
             NYYDIRK C  G LCYDFSN ETFLN KSV+DALGVG ID+VSCS+TVYE M +D  KNL
Sbjct  339   NYYDIRKSC-EGDLCYDFSNLETFLNQKSVRDALGVGTIDFVSCSSTVYEAMLTDWMKNL  397

Query  626   APGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEK  447
               GIP+LL+DG+ +L+Y GEYDLICNWLGN  WV A+ W GQK F  +  V F V G E 
Sbjct  398   EAGIPALLEDGLKVLIYAGEYDLICNWLGNSNWVHAMGWSGQKQFVTSATVPFVVNGAEA  457

Query  446   GIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             G+ KSYGPLTFLKVH+AGH+VPMDQPKASL+ML+ WM G++
Sbjct  458   GLMKSYGPLTFLKVHNAGHMVPMDQPKASLQMLKSWMAGKV  498



>ref|XP_004250970.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=499

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/454 (66%), Positives = 354/454 (78%), Gaps = 5/454 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYR  1503
              EK+IRQLNLFP HD+N  S       +  +L EKKL L+ LGDSGATV+DLG HAGY+ 
Sbjct  50    GEKLIRQLNLFPKHDINIVSSKDNNYEN--KLFEKKLDLSYLGDSGATVQDLGHHAGYFP  107

Query  1502  LPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDY  1323
             L NT  ARMFYFFFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF I+ N SL WND+
Sbjct  108   LINTKSARMFYFFFESRSNKNDPVVIWLTGGPGCSSELALFYENGPFKISKNMSLVWNDF  167

Query  1322  GWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFV  1143
             GWDK SNLIYVDQPTGTGFSY+S E D R +E GVSNDLY FLQ FF AHP+Y  ++F++
Sbjct  168   GWDKVSNLIYVDQPTGTGFSYTSDESDIRHNETGVSNDLYDFLQAFFNAHPEYVNNDFYI  227

Query  1142  TGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLI  963
             TGESYAGHYIPA  +R++QGN KKEGIHINLKG AIGNGLT+P IQY AY D++LD  LI
Sbjct  228   TGESYAGHYIPAFASRVHQGNIKKEGIHINLKGFAIGNGLTNPEIQYKAYTDYSLDMKLI  287

Query  962   SKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKK  783
             +++ +D + QL P CQ+ ++ C S    AC    N  C  +++ IM+   D+NYYDIRK 
Sbjct  288   NQTDYDYINQLYPTCQQEIKLCASGSEDACMKGFND-CNLIFNSIMDIAGDINYYDIRKT  346

Query  782   CVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             C  GSLCYDFS  ET+LN   VK+ALGV   ID+VSCS++VY+ M  D  KNL  GIP L
Sbjct  347   C-NGSLCYDFSRMETYLNDDQVKEALGVPTSIDFVSCSSSVYQAMRMDWMKNLEVGIPQL  405

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DGINLL+Y GEYDLICNWLGN  WV A++W GQKGF AAP+V+F+V G+EKG+QK YG
Sbjct  406   LEDGINLLIYAGEYDLICNWLGNSNWVHAVEWSGQKGFEAAPSVSFTVDGEEKGVQKKYG  465

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PL FLKVHDAGH+VPMDQPKA+LEML+RW HG L
Sbjct  466   PLIFLKVHDAGHMVPMDQPKAALEMLQRWTHGNL  499



>gb|EYU37039.1| hypothetical protein MIMGU_mgv1a025090mg [Erythranthe guttata]
Length=485

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/456 (65%), Positives = 357/456 (78%), Gaps = 12/456 (3%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K +AEK IR LNLFP H++N  +G +       ++VEK+LK  +LGDSG +V+DLG HAG
Sbjct  32    KTQAEKQIRALNLFPKHEVNHHAGLN-YSLGASQIVEKRLKFPVLGDSGTSVQDLGHHAG  90

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY+LP+T DARMFYFFFESR++ +DPVVIWLTGGPGCSS LALFYENGPF+I  N SL W
Sbjct  91    YYKLPHTKDARMFYFFFESRNSTADPVVIWLTGGPGCSSELALFYENGPFHITSNLSLTW  150

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             ND+GWDK         PTGTGFSYSS ++D R +E+GVSNDLY FLQ FFK HP+Y K++
Sbjct  151   NDFGWDK---------PTGTGFSYSSDDDDLRHNEEGVSNDLYDFLQAFFKEHPQYLKND  201

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R+NQGNK KEG+HINLKG AIGNGLTDP IQYPAY D+ALDN
Sbjct  202   FYITGESYAGHYIPAFASRVNQGNKNKEGLHINLKGFAIGNGLTDPEIQYPAYIDYALDN  261

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI +S ++ L Q +  CQ+A++ C +NGGS+C+    + C  ++  I+E    LNYYDI
Sbjct  262   KLIQRSDYNGLKQAVSDCQQAIKLCGANGGSSCTSAYMA-CNTIFSSIVEHSRGLNYYDI  320

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK+C G SLCYDFSN E FLN KSV++ALGVGDID+VSCST VYE M +D  +NL  GIP
Sbjct  321   RKQCEG-SLCYDFSNMENFLNQKSVREALGVGDIDFVSCSTAVYEAMITDWMRNLEVGIP  379

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             SLL++GI +L+Y GEYDLICNWLGN RWV A++W GQK F AAP   F V G E G+QK 
Sbjct  380   SLLENGIEVLIYAGEYDLICNWLGNSRWVHAMEWSGQKKFVAAPTGPFLVDGVEAGLQKG  439

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              GPLTFLKVH+AGH+VPMDQPKASLEML+RWM G+L
Sbjct  440   NGPLTFLKVHNAGHMVPMDQPKASLEMLQRWMQGKL  475



>ref|XP_006349013.1| PREDICTED: serine carboxypeptidase-like 48-like [Solanum tuberosum]
Length=502

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/455 (65%), Positives = 355/455 (78%), Gaps = 4/455 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLN-RGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
              EK+IRQLNLFP HD+N   S  + V     +L EKKL L+ LGDSG+TV+DLG HAGY+
Sbjct  50    GEKLIRQLNLFPKHDINIVSSKDNSVNNYENKLFEKKLDLSYLGDSGSTVQDLGHHAGYF  109

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
              L +T  ARMFYFFFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF I++N SL WND
Sbjct  110   PLVHTKAARMFYFFFESRSNKNDPVVIWLTGGPGCSSELALFYENGPFKISNNLSLVWND  169

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDK SNLIYVDQPTGTGFSY+S + D R +E GVSNDLY FLQ FF AHP+Y  ++F+
Sbjct  170   FGWDKVSNLIYVDQPTGTGFSYTSDQSDIRHNETGVSNDLYDFLQAFFNAHPEYVNNDFY  229

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGN KKEGIHINLKG AIGNGLT+P IQY AY D++LD  L
Sbjct  230   ITGESYAGHYIPAFASRVHQGNIKKEGIHINLKGFAIGNGLTNPEIQYKAYTDYSLDMKL  289

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I+++ +D + +L P CQ+ ++ C S    AC     S C  ++D I++   D+NYYDIRK
Sbjct  290   INQTDYDHINKLYPKCQQEIKLCGSGSEDACMKGF-SDCTLIFDNILDIAGDINYYDIRK  348

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPGIPS  609
              C  GSLCYDFS  ET+LN   VK+ALGV   ID+VSCS++VY  M  D  KNL  GIP 
Sbjct  349   TC-NGSLCYDFSRMETYLNDNQVKEALGVPTGIDFVSCSSSVYRAMMKDWMKNLEVGIPQ  407

Query  608   LLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSY  429
             LL+DGINLL+Y GEYDLICNW+GN  WV A++W GQKGF AAP+V+F+V G+EKG+QK Y
Sbjct  408   LLEDGINLLIYAGEYDLICNWIGNSNWVHAVEWSGQKGFEAAPSVSFTVDGEEKGVQKKY  467

Query  428   GPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             GPL FLKVHDAGH+VPMDQPKA+LEML+RW HG L
Sbjct  468   GPLMFLKVHDAGHMVPMDQPKAALEMLQRWTHGNL  502



>ref|XP_011028255.1| PREDICTED: serine carboxypeptidase-like [Populus euphratica]
 ref|XP_011012692.1| PREDICTED: serine carboxypeptidase-like [Populus euphratica]
Length=508

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/458 (63%), Positives = 360/458 (79%), Gaps = 4/458 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGS--GHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQH  1518
             + +AE  IR LNLFP H +N  +   +  +   +P +VEK+ + +LLG+ G +V++ G +
Sbjct  41    RLQAETQIRGLNLFPKHAINVPAFDDNELLGTSSPSIVEKQFQFHLLGNPGPSVQEFGHY  100

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYYRL +T  ARMFY+FFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF IA+N SL
Sbjct  101   AGYYRLSHTKAARMFYYFFESRTNKNDPVVIWLTGGPGCSSELALFYENGPFNIANNLSL  160

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WNDYGWDKASN+I+VDQPTGTGFSY++ E D R DE GVSNDLY FLQ FFK HP+  K
Sbjct  161   SWNDYGWDKASNIIFVDQPTGTGFSYTTEETDIRHDETGVSNDLYDFLQAFFKEHPQLTK  220

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R++QGNKKKEGIHINLKG AIGNGLT P +QY AY D+AL
Sbjct  221   NDFYITGESYAGHYIPALASRVHQGNKKKEGIHINLKGFAIGNGLTQPDVQYKAYTDYAL  280

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             DN LI K  +D + ++IPGC+ A++ C ++G S C D  +  C  ++  I++   ++NYY
Sbjct  281   DNKLIEKPDYDSINEMIPGCERAIKVCGTDGVSTCEDAFDV-CNNIFQSILQVAGNINYY  339

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRK C  GSLCYDFSN ETFLN K+V+DALGVGDI++VSCS+ VY+ M+ D  +NLA G
Sbjct  340   DIRKTC-EGSLCYDFSNMETFLNQKTVRDALGVGDIEFVSCSSVVYDAMTRDWMRNLAVG  398

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             +P+LL+DGI +L+Y GE DLICNWLGN RWV  L W GQK FGAAP V F V G+E G  
Sbjct  399   VPALLEDGIKVLIYAGEEDLICNWLGNSRWVNGLAWSGQKDFGAAPTVPFIVEGREAGQL  458

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KS+GPL+FLKVH+AGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  459   KSHGPLSFLKVHNAGHMVPMDQPKAALQMLKSWMQGKL  496



>ref|XP_010111833.1| Serine carboxypeptidase-like 48 [Morus notabilis]
 gb|EXC31798.1| Serine carboxypeptidase-like 48 [Morus notabilis]
Length=517

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/460 (63%), Positives = 361/460 (78%), Gaps = 6/460 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K +A+K+I +LNLFP  D+N  +          ++VEK+ +L + G+SGA+V++LG HAG
Sbjct  52    KLQAQKLITELNLFPDDDINVAAHAFRNLQPEKKIVEKRFELPVAGNSGASVKELGHHAG  111

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YYRLP++  ARMFY FFESR++K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL W
Sbjct  112   YYRLPHSKAARMFYLFFESRNSKKDPVVIWLTGGPGCSSELAVFYENGPFQIANNLSLVW  171

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             ND+GWDKASNL+YVDQPTGTGFSY+S E D R DE+GVSNDLY FLQ FF  HP+YAK++
Sbjct  172   NDFGWDKASNLLYVDQPTGTGFSYTSDENDIRHDEEGVSNDLYDFLQAFFTEHPQYAKND  231

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R++QGNK KEG+HIN KG AIGNGLT+P IQY AY D+ALD 
Sbjct  232   FYITGESYAGHYIPAFASRVHQGNKAKEGMHINFKGFAIGNGLTNPEIQYKAYTDYALDM  291

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSR--CQPLYDRIMEKLVDLNYY  798
              LI ++ +DE+ +++P C++A++ C ++GG  C   VNS   C  +++ IM+ + D NYY
Sbjct  292   KLIKQADYDEINKMLPACEQAIKICGADGGDGC---VNSYLICNNIFNSIMDVVDDTNYY  348

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             D+RKKC  G LCYDFSN E FLN KSV+DALGVGDID+VSCS+TVYE M  D  +NL  G
Sbjct  349   DVRKKC-EGDLCYDFSNMERFLNLKSVRDALGVGDIDFVSCSSTVYEAMVVDWMRNLEVG  407

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGI +L+Y GEYDLICNWLGN RWV A++W GQK F A+    F V G E G+ 
Sbjct  408   IPALLEDGIKVLIYAGEYDLICNWLGNSRWVHAMEWSGQKNFVASSTKPFVVDGTEAGLL  467

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             KS+GPLTFL+VHD+GH+VPMDQPKASLEMLR WM  +L K
Sbjct  468   KSHGPLTFLRVHDSGHMVPMDQPKASLEMLRSWMQRKLTK  507



>ref|XP_003534860.1| PREDICTED: serine carboxypeptidase-like 49-like [Glycine max]
 gb|KHN26598.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=497

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/458 (64%), Positives = 349/458 (76%), Gaps = 6/458 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP-RLVEKKLKLNLLGDSGATVEDLGQHA  1515
             K RAEK+IR LNL P   +N   G        P  +VEKK   + LGDSG ++EDLG HA
Sbjct  43    KSRAEKLIRSLNLSPKDPVNIVKGDDLANGFVPGNIVEKKF--SFLGDSGPSIEDLGHHA  100

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY LPN+  ARMFYFFFESRSNK DPVVIWLTGGPGC   LALFYENGPF+IA+N SL 
Sbjct  101   GYYSLPNSKAARMFYFFFESRSNKDDPVVIWLTGGPGCGGELALFYENGPFHIANNLSLV  160

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WND+GWD+ASN+++VDQPTGTGFSYSS   D R DE G+SNDLY FLQEFFKAHP++ K+
Sbjct  161   WNDFGWDQASNILFVDQPTGTGFSYSSDASDIRNDEVGISNDLYDFLQEFFKAHPEFVKN  220

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHY+PAL +R+NQGNK+ EGIHINLKG AIGNGLT+P IQY AYPDFALD
Sbjct  221   DFYITGESYAGHYVPALASRVNQGNKENEGIHINLKGFAIGNGLTNPAIQYQAYPDFALD  280

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
             N +I+K+ HD+++Q IP C++A + C + GG +C    N  C  +++ IM    D+NYYD
Sbjct  281   NGIITKAEHDQISQSIPDCEQAAKTCETQGGQSCETAFN-ICDSIFNSIMTIAGDINYYD  339

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVG-DIDWVSCSTTVYEVMSSDIFKNLAPG  618
             IRKKCV G LCYD  + ET LN ++VK ALGV  D+ +VSCSTTVY  M  D  KNL  G
Sbjct  340   IRKKCV-GELCYDLKDVETLLNLQNVKSALGVAEDLTYVSCSTTVYNAMGQDWMKNLEVG  398

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IPSLL+DGI LLVY GE DLICNWLGN RWV A++W GQK FG +P V F V G E G  
Sbjct  399   IPSLLEDGIKLLVYAGEEDLICNWLGNSRWVYAMEWSGQKAFGTSPTVKFVVDGAEAGSL  458

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              SYGPL+FLKV++AGHLVPMDQPKA+L+M + WM G L
Sbjct  459   NSYGPLSFLKVYEAGHLVPMDQPKAALQMFKSWMGGNL  496



>ref|XP_002523707.1| Serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF38647.1| Serine carboxypeptidase, putative [Ricinus communis]
Length=506

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/498 (59%), Positives = 375/498 (75%), Gaps = 7/498 (1%)
 Frame = -2

Query  1817  TTKHYTFLSSQQRIMWPFllvlvlVSSPAGQANGEDNSMANSKRRAEKMIRQLNLFPLHD  1638
             +T  YTFLS     +    + +   SS A  ++ +  +  + K +AE++IR  NL P H 
Sbjct  5     STFSYTFLS-----LIILFISISPFSSYAASSHHDQTANNSPKLQAERLIRGFNLSPKHS  59

Query  1637  LNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFE  1458
             +N          ++P LVEK L LNLLGDSG +V+D G HAGY++LP+T  ARMFYFFFE
Sbjct  60    INLPKIADDSLENSPDLVEKPLNLNLLGDSGPSVQDFGHHAGYFKLPHTKAARMFYFFFE  119

Query  1457  SRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPT  1278
             SR+NK+DPVVIWLTGGPGCSS LALFYENGP+++++N SL WNDYGWDKASNLI+VDQPT
Sbjct  120   SRNNKNDPVVIWLTGGPGCSSELALFYENGPYHLSNNMSLAWNDYGWDKASNLIFVDQPT  179

Query  1277  GTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGT  1098
             GTGFSY++ + D R DE+GVSNDLY FLQ FFK HP+  K++F++TGESYAGHYIPA  +
Sbjct  180   GTGFSYTTDQSDLRHDENGVSNDLYDFLQAFFKQHPQLVKNDFYITGESYAGHYIPAFAS  239

Query  1097  RINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGC  918
             R++ GNK KEGIHINLKG AIGNGLTDPGIQY AY D+AL+N+LI +S ++ + +++P C
Sbjct  240   RVHSGNKNKEGIHINLKGFAIGNGLTDPGIQYKAYTDYALENDLIEESDYERINEMMPSC  299

Query  917   QEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAET  738
              +A++ C + G S C     S C  +++ IM+ + ++NYYDIRKKC  G LCYDFS+ ET
Sbjct  300   DQAIKACGTKGESTCESAY-SVCNNIFNEIMDVVGNVNYYDIRKKC-EGQLCYDFSDMET  357

Query  737   FLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDL  558
             FLN K V+D+LGVG+ ++VSCST VY+ M  D  +NL  GIP+LL+DGI +L+Y GE DL
Sbjct  358   FLNEKVVRDSLGVGNREFVSCSTEVYDAMIKDWMRNLEAGIPALLEDGIKVLIYAGEEDL  417

Query  557   ICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPM  378
             ICNWLGN RWV A+QW GQK F AA +V F V G E G  KS+GPLTFLKV++AGH+VPM
Sbjct  418   ICNWLGNSRWVHAMQWTGQKDFEAASSVPFKVEGAEAGQLKSHGPLTFLKVNEAGHMVPM  477

Query  377   DQPKASLEMLRRWMHGQL  324
             DQPKA+L+ML  WM G+L
Sbjct  478   DQPKAALQMLTSWMQGKL  495



>ref|XP_010034179.1| PREDICTED: serine carboxypeptidase-like [Eucalyptus grandis]
Length=503

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/457 (62%), Positives = 360/457 (79%), Gaps = 6/457 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN---RGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             +AE +I+ LNL P   +N   R    S + +D  ++VE + +L +LGDSG++V+DLG HA
Sbjct  39    QAEMLIKGLNLHPKEAVNIRTRDKDSSSLASDG-KIVEMRFELPVLGDSGSSVQDLGHHA  97

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY LP++  ARMFYFFFESR++ +DPVVIWLTGGPGCSSSLALFYENGPF+IA+N SL 
Sbjct  98    GYYPLPHSYAARMFYFFFESRNSANDPVVIWLTGGPGCSSSLALFYENGPFHIANNLSLV  157

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWD+ASNLI+VDQPTGTGFSYS+ E D R DE GVSNDLY FLQ FF AHP+  K+
Sbjct  158   WNDYGWDQASNLIFVDQPTGTGFSYSTDERDIRHDEQGVSNDLYDFLQAFFAAHPQLVKN  217

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA   R+ QGNK KEGIHIN KG AIGNGLT+P IQY AY D+AL+
Sbjct  218   DFYITGESYAGHYIPAFAARVQQGNKAKEGIHINFKGFAIGNGLTNPEIQYEAYTDYALN  277

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
               LI++S HD +  ++P C++ ++QC++ GG AC +L ++ C  ++++I+    ++NYYD
Sbjct  278   MKLITESDHDNINTMLPECKQGIKQCDTKGGDAC-ELASTDCNSIFNKILNIAGNINYYD  336

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IRK C  G LCYDFSN ET LN K V+DALGVGDI++VSCS+TV   MS D  KNLA GI
Sbjct  337   IRKSC-EGPLCYDFSNVETLLNQKKVRDALGVGDIEFVSCSSTVSNAMSQDRMKNLAEGI  395

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DG+ +L+Y GEYDLICNWLGN RWV A++W GQK FG +P V F V G E G+ K
Sbjct  396   PALLEDGLKVLIYAGEYDLICNWLGNSRWVNAMRWSGQKQFGTSPTVPFVVAGAEAGLMK  455

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             S+GPLTFLK+H+AGH+VPMDQPKA+L+ML+ WM G++
Sbjct  456   SHGPLTFLKLHNAGHMVPMDQPKAALQMLKSWMAGKV  492



>ref|XP_006436507.1| hypothetical protein CICLE_v10031297mg [Citrus clementina]
 ref|XP_006485587.1| PREDICTED: serine carboxypeptidase-like 49-like [Citrus sinensis]
 gb|ESR49747.1| hypothetical protein CICLE_v10031297mg [Citrus clementina]
Length=506

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/459 (63%), Positives = 361/459 (79%), Gaps = 9/459 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGH--SPVEADT-PRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             +AEK+IRQLNLFP  D+N   G   +P+ A T  R+VEK++ L      G +VEDLG HA
Sbjct  38    QAEKLIRQLNLFPKEDVNLVDGRQSAPLLAGTGKRIVEKRINLLRESGGGVSVEDLGHHA  97

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY+LP++ DA+MFYFFFESR++K DPVVIWLTGGPGCSS LA+FYENGPF IADN SL 
Sbjct  98    GYYKLPHSHDAKMFYFFFESRNSKKDPVVIWLTGGPGCSSELAVFYENGPFSIADNMSLV  157

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN++GWDKASNL+YVDQPTGTGFSY+S + D R +E+GVSNDLY FLQ FF+ HPK A++
Sbjct  158   WNEHGWDKASNLLYVDQPTGTGFSYTSDKRDIRHNENGVSNDLYDFLQAFFEEHPKLAEN  217

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA   R++ GNK KEGIHINLKG AIGNGLTDPG+QY AYPD+ALD
Sbjct  218   DFYITGESYAGHYIPAFAARVHNGNKAKEGIHINLKGFAIGNGLTDPGVQYKAYPDYALD  277

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
               +I+KS ++ ++++IP C+ A++ C ++G  +C  S  V   C  ++  I+    D+NY
Sbjct  278   MGIINKSQYNRISKIIPVCELAIKLCGTDGTLSCLASYFV---CNSVFSSIIAIAGDINY  334

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKCV GSLCYDFSN E FLN KSV++A+GVGDI++VSCS TVY+ M  D  +NL  
Sbjct  335   YDIRKKCV-GSLCYDFSNMEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEV  393

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP LL+DG+ LLVY GEYDLICNWLGN RWV A++W GQK F A+P + F V G E G+
Sbjct  394   GIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGV  453

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K+ GPL+FLKVHD+GH+VPMDQPKA+L MLRRWM G L
Sbjct  454   LKTNGPLSFLKVHDSGHMVPMDQPKAALAMLRRWMEGSL  492



>ref|XP_006384950.1| serine carboxypeptidase family protein [Populus trichocarpa]
 gb|ERP62747.1| serine carboxypeptidase family protein [Populus trichocarpa]
Length=508

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/458 (62%), Positives = 358/458 (78%), Gaps = 4/458 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGS--GHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQH  1518
             +  AE  IR LNLFP H +N  +   +  +   +P +VEK+ + +LLG+ G +V++ G +
Sbjct  41    RLHAETQIRGLNLFPKHAINVPAFDDNELLGTSSPSIVEKQFQFHLLGNPGPSVQEFGHY  100

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYYRL +T  ARMFY+FFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF IA+N SL
Sbjct  101   AGYYRLSHTKAARMFYYFFESRTNKNDPVVIWLTGGPGCSSELALFYENGPFNIANNLSL  160

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WNDYGWDKASN+I+VDQPTGTGFSY++ E D R DE GVSNDLY FLQ FFK HP+  K
Sbjct  161   SWNDYGWDKASNIIFVDQPTGTGFSYTTEETDIRHDETGVSNDLYDFLQAFFKEHPQLTK  220

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R++QGNKKKEGIHINLKG AIGNGLT P +QY AY D+AL
Sbjct  221   NDFYITGESYAGHYIPALASRVHQGNKKKEGIHINLKGFAIGNGLTQPDVQYKAYTDYAL  280

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             DN LI K  +D + ++IP C+ A++ C ++G S C D  +  C  ++  I++   ++NYY
Sbjct  281   DNKLIEKPDYDSINEMIPDCERAIKVCGTDGVSTCEDAFDV-CNNIFQSILQVAGNINYY  339

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRK C  GSLCYDFSN ETFLN K+V+DALGVGDI++VSCS+ VY+ M+ D  +NLA G
Sbjct  340   DIRKTC-EGSLCYDFSNMETFLNQKTVRDALGVGDIEFVSCSSVVYDAMTRDWMRNLAVG  398

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             +P+LL+DGI +L+Y GE DLICNWLGN RWV  L W GQK FGAAP V F V G+E G  
Sbjct  399   VPALLEDGIKVLIYAGEEDLICNWLGNSRWVNGLAWSGQKDFGAAPTVPFVVEGREAGQL  458

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KS+GPL+FLKVH+AGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  459   KSHGPLSFLKVHNAGHMVPMDQPKAALQMLKSWMQGKL  496



>gb|KHG17096.1| Serine carboxypeptidase-like 48 [Gossypium arboreum]
Length=504

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/462 (61%), Positives = 361/462 (78%), Gaps = 3/462 (1%)
 Frame = -2

Query  1709  NSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVED  1530
             +S   +K +AEK+IR LNLFP H  N G     +  +  ++VEK+ K  ++   G ++++
Sbjct  34    HSSPTAKIQAEKLIRGLNLFPRHAANEGVNED-LTNEPSKIVEKQFKFPVIDAPGPSIQN  92

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
                HAGYY+LP++  ARMFYFFFESR+++ DPVVIWLTGGPGCSS LALFYENGPF++A 
Sbjct  93    FAHHAGYYKLPHSKSARMFYFFFESRNSEKDPVVIWLTGGPGCSSELALFYENGPFHLAK  152

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WNDYGWDKASN+++VDQP GTGFSY+S + D R DE+GVSNDLY FLQ FFK HP
Sbjct  153   NLSLLWNDYGWDKASNILFVDQPIGTGFSYTSDDTDIRHDENGVSNDLYDFLQAFFKQHP  212

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             +Y K++F++TGESYAGHYIPA   R++QGNK K+GIHINLKG AIGNGLT+P IQY AYP
Sbjct  213   QYVKNDFYITGESYAGHYIPAFAVRVHQGNKAKQGIHINLKGFAIGNGLTNPEIQYQAYP  272

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVD  810
             DFAL+++LIS+S +  + +L+P C +A++ C S+GG AC D     C  ++++I+     
Sbjct  273   DFALNSSLISQSDYVNIKKLVPSCVQAIKSCGSDGGDACVDSY-EICNNVFNQILRIAGT  331

Query  809   LNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKN  630
             +NYYDIRK+C  G +CYDFS+ ETFLN KSV++ALGVGDID+VSCS+ VYE M  D  +N
Sbjct  332   VNYYDIRKQC-EGDMCYDFSDVETFLNLKSVREALGVGDIDFVSCSSVVYEAMLMDWMRN  390

Query  629   LAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKE  450
                GIPSLL+DGI +L+Y GEYDLICNWLGN +WV A+ W GQKGFG++P V F V G E
Sbjct  391   FEVGIPSLLEDGIKVLIYAGEYDLICNWLGNSKWVHAMTWSGQKGFGSSPIVPFVVDGVE  450

Query  449   KGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G  K++GPLTFLKVHDAGH+VPMDQPKASL+ML++WMHG++
Sbjct  451   AGKLKTHGPLTFLKVHDAGHMVPMDQPKASLQMLQKWMHGEI  492



>ref|XP_004292565.1| PREDICTED: serine carboxypeptidase-like 48-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/457 (63%), Positives = 353/457 (77%), Gaps = 4/457 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDS-GATVEDLGQHA  1515
             K +AEK+IR LNLFP  ++N G+ ++    D P+LVEK+ K+     + G T+ +LG HA
Sbjct  44    KLQAEKLIRDLNLFPNDEINTGAYYNS-SLDAPKLVEKRFKMPYFAAANGTTIAELGHHA  102

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYYRLPN+  ARMFY FFESR+NK+DPVVIWLTGGPGCSS LA+FYENGPF+I +N SL 
Sbjct  103   GYYRLPNSHAARMFYLFFESRTNKNDPVVIWLTGGPGCSSELAVFYENGPFHIVNNLSLT  162

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWDKASNL+YVDQPTGTGFSYSS   D R DE+GVSNDLY FLQ FF  HP++ K+
Sbjct  163   WNDYGWDKASNLLYVDQPTGTGFSYSSDSRDIRHDEEGVSNDLYDFLQGFFTQHPQFVKN  222

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA  +R+++GNK KEGIHIN KGLAIGNGLT+P  QY AYPD+AL 
Sbjct  223   DFYITGESYAGHYIPAFASRVHKGNKDKEGIHINFKGLAIGNGLTNPSFQYKAYPDYALQ  282

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
               LI K+ +D +T+ IP C++A++ C   GG  C D   S C  ++  IM+ + D NYYD
Sbjct  283   MGLIKKADYDRITESIPACEQAIKTCGPTGGRPCVD-AYSVCNNIFSEIMDIIGDKNYYD  341

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IRK+CV G LCYDFSN ETFLN K V++ALGVG I++VSCS+TVYE M SD  +NL  GI
Sbjct  342   IRKQCV-GDLCYDFSNMETFLNMKLVREALGVGSINFVSCSSTVYEAMLSDWMRNLEVGI  400

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DGI +LVY GEYDLICNWLGN  WV A++W GQK F  +  V F VGG E G+ K
Sbjct  401   PALLEDGIKVLVYAGEYDLICNWLGNSNWVHAMEWSGQKAFEESLTVPFKVGGAEAGLLK  460

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             S+GPL FLKVH+AGH+VPMDQPKA+L+ML  WM G L
Sbjct  461   SHGPLAFLKVHNAGHMVPMDQPKAALQMLTNWMQGNL  497



>ref|XP_007138863.1| hypothetical protein PHAVU_009G243900g [Phaseolus vulgaris]
 gb|ESW10857.1| hypothetical protein PHAVU_009G243900g [Phaseolus vulgaris]
Length=498

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/460 (63%), Positives = 359/460 (78%), Gaps = 6/460 (1%)
 Frame = -2

Query  1700  ANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQ  1521
             ANS   A+K+IR  NLFP + +N      P    + R+VEKK   + L DS  +++DLG 
Sbjct  38    ANSHSPAQKLIRSFNLFPKYPINT-VKDDPQAFVSGRIVEKKF--SFLADSEPSIQDLGH  94

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY LP++  ARMFYFFFESR++K DPVVIWLTGGPGC S LALFYENGPF+IA+N S
Sbjct  95    HAGYYSLPSSKAARMFYFFFESRNSKDDPVVIWLTGGPGCGSELALFYENGPFHIANNLS  154

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WNDYGWD+ASN+++VDQPTGTGFSY+S + D R DE GVSNDLY FLQEFFKAHP++ 
Sbjct  155   LLWNDYGWDQASNILFVDQPTGTGFSYTSDDSDIRHDETGVSNDLYDFLQEFFKAHPEFV  214

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHY+PAL +R+NQGNK+ +GIHINLKG AIGNGLT+P IQ+ AYPDFA
Sbjct  215   KNDFYITGESYAGHYVPALASRVNQGNKENQGIHINLKGFAIGNGLTNPAIQFQAYPDFA  274

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNY  801
             LDN +I ++ H+++++LIPGC++A + C + GG +C + +N  C  ++D I+    D+NY
Sbjct  275   LDNGIIKEAEHEDISKLIPGCEQAAKTCETQGGRSCDNALN-ICMNIFDNILSIAGDINY  333

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVG-DIDWVSCSTTVYEVMSSDIFKNLA  624
             YDIRKKC+ G LCY+FSN ET LN + VK ALGVG D+D+VSCS TVY  M  D  KNL 
Sbjct  334   YDIRKKCL-GDLCYNFSNVETLLNLQKVKSALGVGSDLDYVSCSATVYNAMIQDWMKNLE  392

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI +LVY GEYDLICNWLGN RWV A++W GQK FG +P V F V G + G
Sbjct  393   VGIPALLEDGIKVLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFGTSPTVKFVVEGVDAG  452

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
                SYGPL+FLKV+ AGH+VPMDQPKASLEML+ WM G+L
Sbjct  453   SLNSYGPLSFLKVYGAGHMVPMDQPKASLEMLKSWMGGKL  492



>ref|XP_009356926.1| PREDICTED: serine carboxypeptidase-like [Pyrus x bretschneideri]
Length=519

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/477 (61%), Positives = 367/477 (77%), Gaps = 7/477 (1%)
 Frame = -2

Query  1739  SPAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP---RLVEKKLK  1569
             +PA +     +   ++KR+AEK IR LNLFP HD+N       ++A++    ++VEK+ +
Sbjct  28    NPASEGGRLPSPTLSAKRQAEKFIRALNLFPKHDINTLPHRPLLDAESAAGAKIVEKQFQ  87

Query  1568  LNLLGDS-GATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSS  1392
             +  L  + G +VE+LG HAGYYRLP++  ARMFY FFESR+NKS+PVVIWLTGGPGCSS 
Sbjct  88    MPFLDAALGPSVEELGHHAGYYRLPHSNAARMFYLFFESRTNKSNPVVIWLTGGPGCSSE  147

Query  1391  LALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSN  1212
             LALFYENGPF I  N SL WNDYGWDKASN+++VDQP GTGFSYS++ +D R +E+GVSN
Sbjct  148   LALFYENGPFRIQKNLSLTWNDYGWDKASNILFVDQPVGTGFSYSTNSDDIRHNEEGVSN  207

Query  1211  DLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIG  1032
             DLY FLQEFF  HP++AK++F++TGESYAGHY+PAL +R+++GNK KEG HINLKG AIG
Sbjct  208   DLYDFLQEFFTQHPQFAKNDFYITGESYAGHYVPALASRVHKGNKAKEGTHINLKGFAIG  267

Query  1031  NGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQC-NSNGGSACSDLVNS  855
             NGLT+P IQY AY D+AL+  LI+K  +D ++Q+IP C+E+ + C  S  G AC D   S
Sbjct  268   NGLTNPEIQYKAYSDYALEMKLITKPDYDSISQIIPDCEESAKTCAASTTGDACEDSF-S  326

Query  854   RCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSC  675
              C  + ++IM +L D N+YDIRKKC  GS CYDFSN ETFLN + V+DALGVGDI++VSC
Sbjct  327   ICNSIVNQIMHRLGDTNHYDIRKKC-EGSFCYDFSNMETFLNKQPVRDALGVGDIEFVSC  385

Query  674   STTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKG  495
             STTVY+ M +D  +NL  GIP+LL+DGI LLVY GEYD ICNWLGN +WV A++W GQK 
Sbjct  386   STTVYDAMQNDWMRNLEVGIPALLEDGIKLLVYAGEYDFICNWLGNSKWVHAMEWSGQKA  445

Query  494   FGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             FGAA  V F V G + G+ KS+GPL FLKVHDAGH+VPMDQP+A+L+ML  WM G L
Sbjct  446   FGAAETVPFKVAGADAGLLKSHGPLAFLKVHDAGHMVPMDQPEAALQMLTNWMQGNL  502



>gb|KDP43980.1| hypothetical protein JCGZ_05447 [Jatropha curcas]
Length=500

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/463 (63%), Positives = 365/463 (79%), Gaps = 14/463 (3%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADT----PRLVEKKLKLNLLGDSG--ATVED  1530
             K +AE  IR  NLFP H +N      P+  ++    P +VEK LKLNLLGDSG   +V+D
Sbjct  33    KLQAEHFIRGFNLFPKHSINL-----PINDESSVTVPEIVEKPLKLNLLGDSGLGPSVQD  87

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIA  1353
             LG HAGYY+LP+T  ARMFYF FESR++K+D PVVIWLTGGPGCSS LALFYENGPF IA
Sbjct  88    LGHHAGYYKLPHTKAARMFYFLFESRNSKNDDPVVIWLTGGPGCSSELALFYENGPFQIA  147

Query  1352  DNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAH  1173
             +N SL WNDYGWDKASNLI+VDQPTGTGFS+++ + D R DE GVSNDLY FLQ FFK H
Sbjct  148   NNLSLSWNDYGWDKASNLIFVDQPTGTGFSFTTDDNDIRHDEVGVSNDLYDFLQAFFKQH  207

Query  1172  PKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAY  993
             P+  K++F++TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLT+PGIQY AY
Sbjct  208   PELVKNDFYITGESYAGHYIPAFAARVHRGNKNKEGIHINLKGFAIGNGLTNPGIQYKAY  267

Query  992   PDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLV  813
              D+ALDN+LI +S ++ + ++IP C++A + C +NGG +C     S C  +++ I++   
Sbjct  268   TDYALDNSLIQQSDYERINKMIPECEQATKACGTNGGYSCESAF-SVCNDIFNAILQVAG  326

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
             D+NYYDIRK C  G LCYDFSN ETFLN K+V+DALGVG++++VSCS+ VY+ M +D  +
Sbjct  327   DINYYDIRKTC-DGQLCYDFSNLETFLNKKTVRDALGVGELEFVSCSSEVYDAMVTDWMR  385

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP+LL+DGI +L+Y GE DLICNWLGN RWVQA++W GQK FGA+P+V F V G+
Sbjct  386   NLEVGIPALLEDGIKVLIYAGEKDLICNWLGNSRWVQAMEWSGQKEFGASPDVPFIVEGE  445

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G  KS+GPLTFLKVH+AGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  446   EAGQLKSHGPLTFLKVHEAGHMVPMDQPKAALQMLKSWMQGKL  488



>ref|XP_010067346.1| PREDICTED: serine carboxypeptidase-like [Eucalyptus grandis]
 gb|KCW65461.1| hypothetical protein EUGRSUZ_G02873 [Eucalyptus grandis]
Length=508

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/458 (64%), Positives = 353/458 (77%), Gaps = 8/458 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEA-DTPRLVEKKLKLNLLG-DSGATVEDLGQHAG  1512
              AE+MIRQLNLFP  D+N G G     A    R+VEK+ +   LG +SG  VEDLG  AG
Sbjct  41    HAEQMIRQLNLFPKEDVNVGRGGVAGSALGEKRIVEKRFRFPNLGLESGVPVEDLGHRAG  100

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY+L ++ DARMFYFFFESR+N++DPVVIWLTGGPGCSS LA+FYENGPF IADN SL W
Sbjct  101   YYKLEHSHDARMFYFFFESRNNENDPVVIWLTGGPGCSSELAMFYENGPFAIADNMSLVW  160

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             N++GWDKASNL+YVDQP GTGFSY+S   D R +EDGVS+DLY FLQ FF  HP++AK++
Sbjct  161   NEHGWDKASNLLYVDQPVGTGFSYTSDRRDIRHNEDGVSDDLYDFLQAFFAEHPQFAKND  220

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA   R++QGNK KEGIHINLKG AIGNGLTDP IQY AY D+ALD 
Sbjct  221   FYITGESYAGHYIPAFAARVHQGNKAKEGIHINLKGFAIGNGLTDPAIQYKAYTDYALDM  280

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYY  798
              +I KS +D + +++P C+ A++ C ++G  +C  S  V   C  ++  IM    D NYY
Sbjct  281   GIIKKSQYDRINKILPVCEMAIKLCGTDGTVSCMASYFV---CNTIFSSIMALAGDTNYY  337

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKC  GSLCYDFSN E FLN K V+DALGVG++D+VSCS TVY+ M  D  +NL  G
Sbjct  338   DIRKKC-EGSLCYDFSNMEKFLNQKPVRDALGVGEMDFVSCSPTVYQAMLVDWMRNLEVG  396

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F  +P V+F V G E G+ 
Sbjct  397   IPTLLEDGIQLLVYAGEYDLICNWLGNSRWVHAMEWSGQKKFVNSPEVSFEVDGSEAGVL  456

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KS+GPL+FLKVHDAGH+VPMDQPKASLEMLRRW  G+L
Sbjct  457   KSHGPLSFLKVHDAGHMVPMDQPKASLEMLRRWTQGKL  494



>gb|AAL67992.1| putative serine carboxypeptidase precursor [Gossypium hirsutum]
Length=507

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/457 (64%), Positives = 350/457 (77%), Gaps = 7/457 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLG-DSGATVEDLGQHAGY  1509
              A+K+IR+LNLFP  ++N    H     + P+LVEK+ K   L    G + EDLG HAGY
Sbjct  42    HAKKLIRELNLFPKGEVNVVDEHRVSLPEGPKLVEKRFKFPTLEVPGGVSFEDLGHHAGY  101

Query  1508  YRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWN  1329
             Y+LPN+ DARMFYFFFESR++K DPVVIWLTGGPGCSS LALFYENGPF IADN SL WN
Sbjct  102   YKLPNSHDARMFYFFFESRNSKKDPVVIWLTGGPGCSSELALFYENGPFTIADNMSLVWN  161

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEF  1149
             +YGWDKASNL+YVDQP GTGFSYSS + D R +ED VSNDLY FLQ FF  HP++AK++F
Sbjct  162   EYGWDKASNLLYVDQPIGTGFSYSSDQRDIRHNEDEVSNDLYDFLQAFFAEHPEFAKNDF  221

Query  1148  FVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNN  969
             F+TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDP IQY AY D+ALD  
Sbjct  222   FITGESYAGHYIPAFAARVHRGNKAKEGIHINLKGFAIGNGLTDPAIQYKAYTDYALDMG  281

Query  968   LISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYD  795
             +I KS HD + +L+P C+ A++ C ++G  +C  S  V   C  +++ IM    D NYYD
Sbjct  282   VIKKSDHDRINKLVPVCEMAIKLCGTDGTISCMASYFV---CNNIFNGIMALAGDTNYYD  338

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             +RKKC  GSLCYDFSN E+FLN KSV+DALGVG+ID+VSCS TVY+ M  D  +NL  GI
Sbjct  339   VRKKC-EGSLCYDFSNMESFLNKKSVRDALGVGNIDFVSCSPTVYQAMLVDWMRNLEVGI  397

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F A+P V F V G E G+ K
Sbjct  398   PVLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFVASPEVPFIVDGAEAGVLK  457

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             ++G L FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  458   THGALGFLKVHDAGHMVPMDQPKAALEMLKRWTKGTL  494



>ref|XP_007016860.1| Serine carboxypeptidase-like 48 [Theobroma cacao]
 gb|EOY34479.1| Serine carboxypeptidase-like 48 [Theobroma cacao]
Length=503

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/457 (62%), Positives = 359/457 (79%), Gaps = 4/457 (1%)
 Frame = -2

Query  1694  SKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             +K++AEK+IR LNL P   +N G     VE  T ++VEK+    +LG  G ++++ G HA
Sbjct  43    AKQQAEKLIRGLNLSPQGGVNAGFDDLAVE--TSKIVEKQFSFPVLGAPGPSIQEFGHHA  100

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY+L +   ARMFYFFFESR++K+DPVVIWLTGGPGCSS LALFYENGPF+IA N SL 
Sbjct  101   GYYKLAHAKAARMFYFFFESRNSKNDPVVIWLTGGPGCSSELALFYENGPFHIAKNLSLL  160

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWDK SN++YVDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FFK HP+Y K+
Sbjct  161   WNDYGWDKTSNILYVDQPTGTGFSYTSDDDDIRHDENGVSNDLYDFLQAFFKEHPQYVKN  220

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA   R++QGNK KEGIH+NLKG AIGNGLT+P IQY AYPD+AL+
Sbjct  221   DFYITGESYAGHYIPAFAARVHQGNKAKEGIHVNLKGFAIGNGLTNPEIQYQAYPDYALN  280

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
              +LI++S +  + +L+P C +A+++C S+GG+AC  +  S C  L+++I+    ++NYYD
Sbjct  281   TSLITQSEYVRIKKLVPTCVQAIKRCGSSGGNACV-MSFSICNNLFNQILSIAGNVNYYD  339

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IRK C  G LCYDFS+ ETFLN  SV+DALGVG++D+VSCS+ VY+ M  D  KNL  GI
Sbjct  340   IRKNC-EGDLCYDFSDMETFLNLTSVRDALGVGEMDFVSCSSVVYDAMIMDWMKNLEVGI  398

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DGI +L+Y GEYDLICNWLGN  WV A+ W GQK FGAAP V F V G E G  K
Sbjct  399   PALLEDGIKVLIYAGEYDLICNWLGNSNWVHAMTWSGQKEFGAAPTVPFVVDGAEAGQLK  458

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             S+GPLTFLKVHDAGH+VPMDQPKASL++L+ WM G+L
Sbjct  459   SHGPLTFLKVHDAGHMVPMDQPKASLQILQNWMQGKL  495



>ref|XP_006488021.1| PREDICTED: serine carboxypeptidase-like 48-like isoform X2 [Citrus 
sinensis]
Length=499

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/456 (63%), Positives = 352/456 (77%), Gaps = 11/456 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             KR+AEK+IR LNLFP   +N  +         P+LVEK+L LN LGD G +V++ G HAG
Sbjct  43    KRQAEKLIRGLNLFPKSSVNTAAAGDHASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAG  102

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY LP++  AR         +NKSDPVVIWLTGGPGCSS LALFYENGPF+IA+N SL W
Sbjct  103   YYTLPHSQSAR---------NNKSDPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVW  153

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDKASNL++VDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  HP+YAK++
Sbjct  154   NDYGWDKASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQAFFAEHPQYAKND  213

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R+++GNK K+GIHINLKG AIGNGLTDP IQY  Y ++AL+ 
Sbjct  214   FYITGESYAGHYIPAFASRVHKGNKAKQGIHINLKGFAIGNGLTDPAIQYKEYTEYALNM  273

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI +S ++ + +LIP C+ A++ C S+GG ACS    + C  ++++I+    D+NYYDI
Sbjct  274   RLIKQSDYESINKLIPTCEHAIKTCESDGGDACSSSY-AVCNSIFNKILGIAGDVNYYDI  332

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKC  G LCYDFSN E FLN KSV++ALGVGDID+VSCS+TVYE M  D  +N   GIP
Sbjct  333   RKKC-EGDLCYDFSNMERFLNEKSVREALGVGDIDFVSCSSTVYEAMLMDWMRNFEVGIP  391

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK FGAA  V F V G E G  KS
Sbjct  392   TLLEDGIRVLIYAGEYDLICNWLGNSKWVHAMEWSGQKDFGAAATVPFKVDGAETGQIKS  451

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  452   HGPLTFLKVHDAGHMVPMDQPKASLQMLQSWMQGKL  487



>ref|XP_003546386.1| PREDICTED: serine carboxypeptidase-like 49-like [Glycine max]
Length=493

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/458 (62%), Positives = 356/458 (78%), Gaps = 6/458 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEA-DTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             K RAEK+IR LNLFP + +N   G     A  +  +VEKK   + LGDSG ++EDLG HA
Sbjct  39    KSRAEKLIRSLNLFPKNPINIVKGDGLANAFVSGNIVEKKF--SFLGDSGPSIEDLGHHA  96

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GY+ LPN+  ARMFYFFFESR+NK DPVVIWLTGGPGC   LALFYENGPF+I +N SL 
Sbjct  97    GYFSLPNSKAARMFYFFFESRNNKDDPVVIWLTGGPGCGGELALFYENGPFHIGNNLSLI  156

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWD+ASN+++VDQPTGTGFSYS    D R DE G+SNDLY FLQEFFKAHP++ K+
Sbjct  157   WNDYGWDQASNILFVDQPTGTGFSYSFDASDIRHDEAGISNDLYDFLQEFFKAHPQFVKN  216

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHY PAL +R+NQGNK+ +GIHINLKG AIGNGLT+P IQYPAYPD+AL+
Sbjct  217   DFYITGESYAGHYAPALASRVNQGNKENQGIHINLKGFAIGNGLTNPAIQYPAYPDYALE  276

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
             N +I+K+ HD++++ IP C++A + C++ GG +C ++  + C  +++ IM    D+NYYD
Sbjct  277   NGVITKAEHDQISKSIPDCEQAAKTCDNKGGQSC-EIAFNICDGIFNSIMSIAGDINYYD  335

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             IRKKCV G LCYDF + +T LN + VK ALGV  D+ +VSCS+TVY+ M+ D+ KNL  G
Sbjct  336   IRKKCV-GELCYDFKSVDTLLNLQKVKSALGVAADLQFVSCSSTVYDAMAQDLMKNLDVG  394

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGI LLVY GE DL CNWLGN RWV A++W GQK FG +P V F V G E G  
Sbjct  395   IPALLEDGIKLLVYAGEEDLRCNWLGNSRWVYAMEWSGQKAFGTSPTVKFVVDGAEAGSL  454

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              SYGPL+FLKV++AGHLVPMDQPKA+L+ML+ WM G L
Sbjct  455   NSYGPLSFLKVYEAGHLVPMDQPKAALQMLKNWMGGSL  492



>ref|XP_010541311.1| PREDICTED: serine carboxypeptidase-like 48 [Tarenaya hassleriana]
Length=508

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/460 (62%), Positives = 355/460 (77%), Gaps = 8/460 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLL---GDSGA-TVEDLG  1524
             K  AE++IR  NL P HD+N  +G +P   D  RLVE++     +   G+SG  +V++ G
Sbjct  43    KLSAERLIRSFNLLPKHDVNIVAGDTP---DGTRLVERQFNFPAVLSGGESGGPSVKEFG  99

Query  1523  QHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQ  1344
              HAGYYRLP++  ARMFYFFFESRS+K+DPVVIWLTGGPGCSS LALFYENGPF I++N 
Sbjct  100   HHAGYYRLPHSKAARMFYFFFESRSSKTDPVVIWLTGGPGCSSELALFYENGPFTISNNL  159

Query  1343  SLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKY  1164
             SL WND+GWDKASNLIYVDQP GTGFSYSS + D R DEDGVSNDLY FLQ FFK HP++
Sbjct  160   SLSWNDFGWDKASNLIYVDQPIGTGFSYSSDKRDLRHDEDGVSNDLYDFLQAFFKEHPQF  219

Query  1163  AKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDF  984
             AK++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P +QY AYPD+
Sbjct  220   AKNDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEVQYSAYPDY  279

Query  983   ALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLN  804
             ALD  LI++S H+ + +  P CQ A+++C+ +GG          C  ++ +IM+    +N
Sbjct  280   ALDMKLITESEHETIKKQYPACQHAIKECSMDGGEDACGSAYYVCNDIFQKIMQIAGSVN  339

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  GSLCYDFSN E FLN KSV+ ALGVGDI++VSCS+ VY+ M  D  +NL 
Sbjct  340   YYDVRKQC-EGSLCYDFSNMEAFLNQKSVRSALGVGDIEFVSCSSAVYDAMQMDWMRNLE  398

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI  LVY GEYDLICNWLGN +WV A++W GQ+ F +A  + F V G + G
Sbjct  399   AGIPTLLEDGIKALVYAGEYDLICNWLGNSKWVHAMEWSGQRDFVSASTIPFLVDGTQAG  458

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K++GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  459   LMKNHGPLTFLKVHDAGHMVPMDQPKASLQMLQNWMEGKL  498



>ref|XP_007150149.1| hypothetical protein PHAVU_005G131000g [Phaseolus vulgaris]
 gb|ESW22143.1| hypothetical protein PHAVU_005G131000g [Phaseolus vulgaris]
Length=506

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/453 (64%), Positives = 346/453 (76%), Gaps = 4/453 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYR  1503
             AEK+IR  NLFP   +N     S + A    +VEKKL    L   G++VE+LG HAGYY 
Sbjct  46    AEKLIRGFNLFPKDPINTLESDSLLVAG--NIVEKKLTFPSLVAPGSSVEELGHHAGYYS  103

Query  1502  LPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDY  1323
             LP +  ARMFYFFFESRS K DPVVIWLTGGPGCSS LALFYENGPF +  N SL WNDY
Sbjct  104   LPRSKAARMFYFFFESRSRKDDPVVIWLTGGPGCSSELALFYENGPFQLTKNLSLVWNDY  163

Query  1322  GWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFV  1143
             GWDKASN+I+VDQPTGTGFSY+S E D R DE+GVSNDLY FLQ FFK HP++ K++F++
Sbjct  164   GWDKASNIIFVDQPTGTGFSYTSDESDIRHDEEGVSNDLYDFLQAFFKEHPQFTKNDFYI  223

Query  1142  TGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLI  963
             TGESYAGHYIPAL +R++QGNK KEGIHINLKG AIGNGLT+P IQY AY D+ALD  LI
Sbjct  224   TGESYAGHYIPALASRVHQGNKAKEGIHINLKGFAIGNGLTNPEIQYQAYTDYALDRGLI  283

Query  962   SKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKK  783
              K+ ++ + +L+P C++A+  C + GG  C   +   C  +++RIM    D+NYYDIRKK
Sbjct  284   EKADYNSINKLLPSCKQAIEACGTEGGETCETSL-YVCNRIFNRIMNIAGDVNYYDIRKK  342

Query  782   CVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLL  603
             CV G LCYDFS  E FLN K+V+DALGVG++D+VSCS+TVY  M  D  KNL  GIP+LL
Sbjct  343   CV-GDLCYDFSEMEEFLNKKTVRDALGVGELDFVSCSSTVYSAMMQDWMKNLEAGIPALL  401

Query  602   QDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGP  423
             +DGI +LVY GE DLICNWLGN RWVQA++W GQK FGA+  V F V G E G+ KS+GP
Sbjct  402   EDGIKVLVYAGEEDLICNWLGNSRWVQAMEWSGQKEFGASGTVPFLVDGAEAGLLKSHGP  461

Query  422   LTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             L FLKV++AGH+VPMDQPKA+L MLR WM G+L
Sbjct  462   LAFLKVYEAGHMVPMDQPKAALTMLRSWMQGKL  494



>ref|XP_003543449.1| PREDICTED: serine carboxypeptidase-like 48-like [Glycine max]
Length=506

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/454 (63%), Positives = 350/454 (77%), Gaps = 4/454 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQHAGYY  1506
             AEK+IR LNLFP   +N    + P+   +  +VEK+     L   S +++E+LG HAGYY
Sbjct  44    AEKLIRGLNLFPKDPINTLKKNDPLFV-SGSIVEKRFTFPTLAASSESSIEELGHHAGYY  102

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP +  ARMFYFFFESRS+K+DPVVIWLTGGPGCSS LALFYENGPF +  N SL WND
Sbjct  103   RLPRSKAARMFYFFFESRSSKNDPVVIWLTGGPGCSSELALFYENGPFQLTKNLSLVWND  162

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             YGWDKASN+I+VDQPTGTGFSY+S E D R DE+GVSNDLY FLQ FFK HP++ K++F+
Sbjct  163   YGWDKASNIIFVDQPTGTGFSYTSDESDIRHDEEGVSNDLYDFLQAFFKEHPQFTKNDFY  222

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPAL +R++QGNK KEGIHINLKG AIGNGLT+P IQY AY D+ALD  L
Sbjct  223   ITGESYAGHYIPALASRVHQGNKAKEGIHINLKGFAIGNGLTNPEIQYQAYTDYALDRGL  282

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I K+ ++ + +LIP C++A+  C + GG  C   +   C  +++RIM    D+NYYDIRK
Sbjct  283   IKKAEYNSINKLIPPCKQAIEACGTEGGETCVSSLYV-CNKIFNRIMTIADDVNYYDIRK  341

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             KCV G LCYDFS  E FLN K+V+DALGVGD+D+VSCS+TVY  M  D  +NL  GIP+L
Sbjct  342   KCV-GVLCYDFSVMEDFLNEKTVRDALGVGDLDFVSCSSTVYSAMMQDWMRNLEVGIPTL  400

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L++GI +LVY GE DLICNWLGN RWVQA++W GQK FGA+  V F V G E G  KS+G
Sbjct  401   LEEGIKVLVYAGEEDLICNWLGNSRWVQAMEWSGQKQFGASGTVPFLVDGAEAGTLKSHG  460

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PL FLKV++AGH+VPMDQPKA+LEMLR WM G+L
Sbjct  461   PLAFLKVYEAGHMVPMDQPKAALEMLRSWMQGKL  494



>gb|KHN21489.1| Serine carboxypeptidase-like 48 [Glycine soja]
Length=492

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/454 (63%), Positives = 350/454 (77%), Gaps = 4/454 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQHAGYY  1506
             AEK+IR LNLFP   +N    + P+   +  +VEK+     L   S +++E+LG HAGYY
Sbjct  30    AEKLIRGLNLFPKDPINTLKKNDPLFV-SGSIVEKRFTFPTLAASSESSIEELGHHAGYY  88

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP +  ARMFYFFFESRS+K+DPVVIWLTGGPGCSS LALFYENGPF +  N SL WND
Sbjct  89    RLPRSKAARMFYFFFESRSSKNDPVVIWLTGGPGCSSELALFYENGPFQLTKNLSLVWND  148

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             YGWDKASN+I+VDQPTGTGFSY+S E D R DE+GVSNDLY FLQ FFK HP++ K++F+
Sbjct  149   YGWDKASNIIFVDQPTGTGFSYTSDESDIRHDEEGVSNDLYDFLQAFFKEHPQFTKNDFY  208

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPAL +R++QGNK KEGIHINLKG AIGNGLT+P IQY AY D+ALD  L
Sbjct  209   ITGESYAGHYIPALASRVHQGNKAKEGIHINLKGFAIGNGLTNPEIQYQAYTDYALDRGL  268

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I K+ ++ + +LIP C++A+  C + GG  C   +   C  +++RIM    D+NYYDIRK
Sbjct  269   IKKAEYNSINKLIPPCKQAIEACGTEGGETCVSSLYV-CNKIFNRIMTIADDVNYYDIRK  327

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             KCV G LCYDFS  E FLN K+V+DALGVGD+D+VSCS+TVY  M  D  +NL  GIP+L
Sbjct  328   KCV-GVLCYDFSVMEDFLNEKTVRDALGVGDLDFVSCSSTVYSAMMQDWMRNLEVGIPTL  386

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L++GI +LVY GE DLICNWLGN RWVQA++W GQK FGA+  V F V G E G  KS+G
Sbjct  387   LEEGIKVLVYAGEEDLICNWLGNSRWVQAMEWSGQKQFGASGTVPFLVDGAEAGTLKSHG  446

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PL FLKV++AGH+VPMDQPKA+LEMLR WM G+L
Sbjct  447   PLAFLKVYEAGHMVPMDQPKAALEMLRSWMQGKL  480



>ref|XP_002529593.1| Serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF32785.1| Serine carboxypeptidase, putative [Ricinus communis]
Length=509

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/463 (63%), Positives = 352/463 (76%), Gaps = 13/463 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN----RGSGHSPVEADTPRLVEKKLKL-NLLGDSGA-TVEDLG  1524
             +AEK+IR+LNL P  D+N    R  G         R+VEK++K  N+ GD GA +VEDLG
Sbjct  37    QAEKLIRELNLLPEKDVNVIDRRDDGVYDGVDGGGRIVEKRIKFPNVEGDYGAVSVEDLG  96

Query  1523  QHAGYYRLPNTVDARMFYFFFESRSNK-SDPVVIWLTGGPGCSSSLALFYENGPFYIADN  1347
              HAGYY++ N+  ARMFY FFESR+ K  DPVVIWLTGGPGCSS LA+FYENGPF IADN
Sbjct  97    HHAGYYKIANSHSARMFYLFFESRNKKKEDPVVIWLTGGPGCSSELAMFYENGPFAIADN  156

Query  1346  QSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPK  1167
              SL WN YGWDKASNL+YVDQP GTGFSYSS   D R +E+GVSNDLY FLQ FF  HP+
Sbjct  157   MSLVWNPYGWDKASNLLYVDQPIGTGFSYSSDRRDIRHNEEGVSNDLYDFLQAFFVEHPE  216

Query  1166  YAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPD  987
               K++F++TGESYAGHYIPA   R++ GNK KEGIHINLKG AIGNGLTDP IQY AY D
Sbjct  217   LVKNDFYITGESYAGHYIPAFAARVHSGNKAKEGIHINLKGFAIGNGLTDPAIQYKAYTD  276

Query  986   FALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLV  813
             +ALD  LI+K+ +  + ++IP C+ A++ C ++G  +C  S  V   C  ++  IM +  
Sbjct  277   YALDMGLITKTDYARIGKVIPVCEMAIKLCGTDGTLSCMASYFV---CNTIFSSIMARAG  333

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
             D+N+YDIRKKCV GSLCYDFSN E FLN KSV+DALGVGDID+VSCS TVY+ M  D  +
Sbjct  334   DINHYDIRKKCV-GSLCYDFSNMEKFLNQKSVRDALGVGDIDFVSCSPTVYQAMLMDWMR  392

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK FGA+P V F+V   
Sbjct  393   NLEAGIPALLEDGIQLLVYAGEYDLICNWLGNSRWVHAMEWSGQKAFGASPEVPFTVDNS  452

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G+ +SYGPL FLKVHDAGH+VPMDQPKA+LEML+RW  G+L
Sbjct  453   EAGVLRSYGPLAFLKVHDAGHMVPMDQPKAALEMLKRWTQGKL  495



>ref|XP_008385518.1| PREDICTED: serine carboxypeptidase-like [Malus domestica]
Length=522

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/464 (62%), Positives = 361/464 (78%), Gaps = 9/464 (2%)
 Frame = -2

Query  1697  NSKRRAEKMIRQLNLFPLHDLNRGSGHSPV---EADT-PRLVEKKLKLNLLGDS-GATVE  1533
             ++KR+AEK IR LNLFP  D+N    H P+   E+D   ++VEK+ ++  L  + G +V+
Sbjct  45    SAKRQAEKFIRALNLFPKDDINTLP-HRPLLDAESDAGAKIVEKQFQMPFLDAALGPSVK  103

Query  1532  DLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIA  1353
             +LG HAGYYRLP +  A MFY FFESR+NK++PVVIWLTGGPGCSS LALFYENGPF I 
Sbjct  104   ELGHHAGYYRLPRSNAASMFYLFFESRTNKNNPVVIWLTGGPGCSSELALFYENGPFRIQ  163

Query  1352  DNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAH  1173
              N SL WNDYGWDKASN+++VDQP GTGFSY+++  D R DE+GVSNDLY FLQEFF  H
Sbjct  164   KNLSLTWNDYGWDKASNILFVDQPVGTGFSYTTNSADIRHDEEGVSNDLYDFLQEFFTQH  223

Query  1172  PKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAY  993
             P++AK++F++TGESYAGHY+PAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY
Sbjct  224   PQFAKNDFYITGESYAGHYVPALASRVHKGNKAKEGTHINLKGFAIGNGLTNPEIQYKAY  283

Query  992   PDFALDNNLISKSFHDELTQLIPGCQEAVRQC-NSNGGSACSDLVNSRCQPLYDRIMEKL  816
              D+AL+  LI+K  +D ++Q+IP C+E+ + C  S  G AC + + S C  + ++IM+ +
Sbjct  284   SDYALEMKLITKPDYDSISQIIPDCEESAKACAASTSGDACENSL-SICNSIVNQIMQII  342

Query  815   VDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIF  636
              D N+YDIRKKC  GSLCYDFSN ETFLN + V+DALGVGDI++VSCSTTVY+ M +D  
Sbjct  343   SDTNHYDIRKKC-EGSLCYDFSNMETFLNKQPVRDALGVGDIEFVSCSTTVYDAMQNDWM  401

Query  635   KNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGG  456
             +NL  GIP+LL+DGI LLVY GEYD ICNWLGN +WV A++W GQK FGAA  V F V G
Sbjct  402   RNLEVGIPALLEDGIKLLVYAGEYDFICNWLGNSKWVHAMEWSGQKAFGAAQTVPFKVAG  461

Query  455   KEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              E G+ KS+GPL FLKVHDAGH+VPMDQP+A+L+ML  WM G +
Sbjct  462   AEAGLLKSHGPLAFLKVHDAGHMVPMDQPEAALQMLTNWMQGNM  505



>gb|KHN47738.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=493

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/458 (62%), Positives = 355/458 (78%), Gaps = 6/458 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEA-DTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             K RAEK+IR LNLFP + +N   G     A  +  +VEKK   + LGDSG ++EDLG HA
Sbjct  39    KSRAEKLIRSLNLFPKNPINIVKGDGLANAFVSGNIVEKKF--SFLGDSGPSIEDLGHHA  96

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GY+ LPN+  ARMFYFFFESR+NK DPVVIWLTGGPGC   LALFYENGPF+I +N SL 
Sbjct  97    GYFSLPNSKAARMFYFFFESRNNKDDPVVIWLTGGPGCGGELALFYENGPFHIGNNLSLI  156

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWD+ASN+++VDQPTGTGFSYS    D R DE  +SNDLY FLQEFFKAHP++ K+
Sbjct  157   WNDYGWDQASNILFVDQPTGTGFSYSFDASDIRHDEACISNDLYDFLQEFFKAHPQFVKN  216

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHY PAL +R+NQGNK+ +GIHINLKG AIGNGLT+P IQYPAYPD+AL+
Sbjct  217   DFYITGESYAGHYAPALASRVNQGNKENQGIHINLKGFAIGNGLTNPAIQYPAYPDYALE  276

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
             N +I+K+ HD++++ IP C++A + C++ GG +C ++  + C  +++ IM    D+NYYD
Sbjct  277   NGVITKAEHDQISKSIPDCEQAAKTCDNKGGQSC-EIAFNICDGIFNSIMSIAGDINYYD  335

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             IRKKCV G LCYDF + +T LN + VK ALGV  D+ +VSCS+TVY+ M+ D+ KNL  G
Sbjct  336   IRKKCV-GELCYDFKSVDTLLNLQKVKSALGVAADLQFVSCSSTVYDAMAQDLMKNLDVG  394

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGI LLVY GE DL CNWLGN RWV A++W GQK FG +P V F V G E G  
Sbjct  395   IPALLEDGIKLLVYAGEEDLRCNWLGNSRWVYAMEWSGQKAFGTSPTVKFVVDGAEAGSL  454

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              SYGPL+FLKV++AGHLVPMDQPKA+L+ML+ WM G L
Sbjct  455   NSYGPLSFLKVYEAGHLVPMDQPKAALQMLKNWMGGSL  492



>ref|XP_006342273.1| PREDICTED: serine carboxypeptidase-like 48-like [Solanum tuberosum]
Length=494

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/456 (61%), Positives = 351/456 (77%), Gaps = 2/456 (0%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K  AEK IRQLNLFP HD+N         AD  RL EKKL L+ LG SGATV+DLG HAG
Sbjct  38    KTMAEKFIRQLNLFPKHDINIIVSSKDQIADQHRLFEKKLNLSYLGYSGATVQDLGHHAG  97

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY L ++  ARMFYFFFESRSNK+DPVV+WLTGGPGCSS LALFYENGPF I+ N SL W
Sbjct  98    YYHLLHSKAARMFYFFFESRSNKNDPVVMWLTGGPGCSSELALFYENGPFQISHNMSLVW  157

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             N++GWDK SNLIY+DQPTGTGFSY+S   D R +E  +SNDLY F+Q FF  HP+Y  ++
Sbjct  158   NEFGWDKVSNLIYIDQPTGTGFSYTSDNRDIRHNETDISNDLYDFIQAFFDTHPEYVNND  217

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R++QGNKKKEGIHINLKG AIGNG+T+P IQ+ +Y D+ALD 
Sbjct  218   FYITGESYAGHYIPAFASRVHQGNKKKEGIHINLKGFAIGNGMTNPEIQFKSYTDYALDM  277

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI+++ ++ + +L P CQ+ ++ C + G  AC       C  ++  IM+ + D NYYDI
Sbjct  278   KLINQTDYNNINKLYPKCQQQIKSCGNGGEDACL-YAFQDCTNIFSNIMDIVGDKNYYDI  336

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK C  G+LCYDFS  ET+LN   VK ALGVGDI++VSCS+ V + + +D+ K+   GIP
Sbjct  337   RKTC-EGNLCYDFSRMETYLNDNQVKRALGVGDIEFVSCSSIVKQALGTDMMKSFVVGIP  395

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
              LL+DGINLL+Y GEYDL+CNWLGN  WV A++W G++ FGAAP++ F+V G++KG+QK+
Sbjct  396   PLLEDGINLLIYAGEYDLMCNWLGNSNWVHAMEWSGKRDFGAAPSINFTVDGEDKGVQKN  455

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLKVHDAGH+VPMDQPKA+L ML+RW  G+L
Sbjct  456   HGPLTFLKVHDAGHMVPMDQPKAALAMLQRWTQGKL  491



>gb|AFK46969.1| unknown [Lotus japonicus]
Length=498

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/456 (63%), Positives = 351/456 (77%), Gaps = 4/456 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K +AE++IR  NLFP   +N        E    ++VEKK   + LGDSG +VE+LG HAG
Sbjct  46    KLQAERLIRSFNLFPRDTVNIRLDDENDEFIPGKIVEKKF--SFLGDSGPSVEELGHHAG  103

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY LP++  ARMFY FFESR++K DPVVIWLTGGPGC S LALFYENGPF+I  N SL W
Sbjct  104   YYSLPHSKAARMFYLFFESRNSKDDPVVIWLTGGPGCGSELALFYENGPFHITSNLSLVW  163

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDKASN+++VDQPTGTGFSY+S + D R DE GVSNDLY FLQEFFKAHP++ K++
Sbjct  164   NDYGWDKASNILFVDQPTGTGFSYTSDDADIRHDEIGVSNDLYDFLQEFFKAHPQFVKND  223

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPAL +R++QGNK+K+GI+INLKG AIGNGLT+  IQYPAY DFALDN
Sbjct  224   FYITGESYAGHYIPALASRVHQGNKEKQGIYINLKGFAIGNGLTNLEIQYPAYTDFALDN  283

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI+K+  +E+ +++P C +A + CN+ GG +C D     CQ ++D I+    D+NYYDI
Sbjct  284   GLITKAEQEEINKIVPNCVQAAKTCNTEGGESC-DSAFGVCQEIFDDILSITGDINYYDI  342

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKC  G LCYDFSN ET +N K+V+DALGVG++++VSCS  V+  MS D  KNL  GIP
Sbjct  343   RKKC-EGPLCYDFSNLETLMNEKTVRDALGVGNLEFVSCSRRVHAAMSQDWVKNLEVGIP  401

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             SLL+DGI  LVY GEYDLICNWLGN RWV A++W GQK FG +P V F V G E G   S
Sbjct  402   SLLEDGIKALVYAGEYDLICNWLGNSRWVHAMEWSGQKEFGESPTVKFFVDGAEAGSLNS  461

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             YGPL+FLKV+ AGH+VPMDQPKA+L+ML  WM G+L
Sbjct  462   YGPLSFLKVNGAGHMVPMDQPKAALQMLTSWMEGKL  497



>ref|XP_008226415.1| PREDICTED: serine carboxypeptidase-like [Prunus mume]
Length=506

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/475 (60%), Positives = 361/475 (76%), Gaps = 5/475 (1%)
 Frame = -2

Query  1739  SPAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEAD--TPRLVEKKLKL  1566
             S A   NG     +  K +AEK IR LNLFP  ++N     + ++     P LVEK+ K+
Sbjct  22    SAAFPNNGPLQLSSTPKLQAEKFIRDLNLFPTDEINTVPHKTSLDEAFAGPMLVEKQFKM  81

Query  1565  NLLGD-SGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSL  1389
               LG  SG +V++LG HAGYYRLPN+  ARMFY FFESR++K++PVV+WLTGGPGC S +
Sbjct  82    PFLGAASGPSVQELGHHAGYYRLPNSKAARMFYLFFESRTDKNNPVVMWLTGGPGCGSEI  141

Query  1388  ALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSND  1209
             A+FYENGPF IA+N SL WNDYGWDKASNL++VDQP GTGFSY+S E D R DE+G+SND
Sbjct  142   AVFYENGPFQIANNLSLAWNDYGWDKASNLLFVDQPIGTGFSYTSDEGDIRHDEEGISND  201

Query  1208  LYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGN  1029
             LY FLQ FF  HP++AK++F++TGESYAGHYIPA G+RI++GNK KEG++IN KG AIGN
Sbjct  202   LYDFLQAFFAQHPQFAKNDFYITGESYAGHYIPAFGSRIHKGNKAKEGMYINFKGFAIGN  261

Query  1028  GLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRC  849
             GLT+P IQY AYPDFAL   LI K+ +D +++ IP C++A++ C S GG AC+      C
Sbjct  262   GLTNPEIQYKAYPDFALQTGLIKKADYDRISKTIPDCEQAIKTCGSEGGEACASSYEV-C  320

Query  848   QPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCST  669
               ++++I+  +   NYYDIRK+C  G +CYDFSN ETFL  K V+DALGVGDID+VSCS+
Sbjct  321   NSIFEKIINIIGGTNYYDIRKQCE-GDMCYDFSNMETFLKKKQVRDALGVGDIDFVSCSS  379

Query  668   TVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFG  489
             TVY+ M  D  +NL  GIP+LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK FG
Sbjct  380   TVYDAMLMDWMRNLEVGIPALLEDGIKVLLYAGEYDLICNWLGNSKWVHAMEWSGQKAFG  439

Query  488   AAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             A+  V F VG  E G+ KS+GPLTFLKVH+AGH+VPMDQP+A+L+ML  WM G+L
Sbjct  440   ASSTVPFKVGATEAGLLKSHGPLTFLKVHNAGHMVPMDQPEAALQMLTSWMQGKL  494



>ref|XP_008363544.1| PREDICTED: serine carboxypeptidase-like [Malus domestica]
Length=515

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/459 (62%), Positives = 350/459 (76%), Gaps = 9/459 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSG---HSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
              A+++IR  NLFP  D+N   G    +   AD PRLVEK  +L  L +SG +VEDLG HA
Sbjct  47    HAKQLIRAFNLFPEEDINIIDGPDSSTAAVADAPRLVEKPFRLPNLIESGVSVEDLGHHA  106

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GY+ + ++  A+MFY FFESR+NK DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL 
Sbjct  107   GYFNIEHSHAAKMFYLFFESRTNKKDPVVIWLTGGPGCSSELAVFYENGPFTIANNLSLV  166

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN+YGWDKASNL+YVDQP GTGFSYSS + D R  EDGVSNDLY FLQ FF  HP+ AK+
Sbjct  167   WNEYGWDKASNLLYVDQPIGTGFSYSSDKRDIRHSEDGVSNDLYDFLQAFFAEHPELAKN  226

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +FF+TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDP +QY AY DFALD
Sbjct  227   DFFITGESYAGHYIPAFAARVHKGNKAKEGIHINLKGFAIGNGLTDPAVQYKAYTDFALD  286

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
             N LI+ + ++ + +++P C+ A++ C ++G  +C  S  V   C  ++  IM K  ++NY
Sbjct  287   NGLITATEYNRINKVLPVCEMAIKLCGTDGTVSCMASYFV---CNTIFSSIMAKAGNINY  343

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKC  GSLCYDFSN E FLN K V+++LGVGDI++VSCS+TVY+ M  D  +NL  
Sbjct  344   YDIRKKC-EGSLCYDFSNMEKFLNQKPVRESLGVGDIEFVSCSSTVYQAMLVDWMRNLEV  402

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F  +P V F V   E G+
Sbjct  403   GIPTLLEDGIQLLVYAGEYDLICNWLGNSRWVHAMEWSGQKQFVTSPEVPFVVDNSEAGV  462

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K++GPL+FLKVHDAGH+VPMDQPKA+LEMLRRW  G +
Sbjct  463   LKNHGPLSFLKVHDAGHMVPMDQPKAALEMLRRWTRGSI  501



>ref|XP_008233268.1| PREDICTED: serine carboxypeptidase-like [Prunus mume]
Length=505

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/457 (62%), Positives = 349/457 (76%), Gaps = 7/457 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSG-HSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGY  1509
              A+++IR  NLFP  D+N   G  S +  D+PRLVEK+  L  L  SG ++EDL  HAGY
Sbjct  39    HAQELIRAFNLFPKEDINIIDGPDSSIFHDSPRLVEKRFNLPNLVGSGVSLEDLSHHAGY  98

Query  1508  YRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWN  1329
             +++ ++  ARMFY FFESR+NK DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL WN
Sbjct  99    FKIEHSHAARMFYLFFESRTNKKDPVVIWLTGGPGCSSELAVFYENGPFNIANNLSLVWN  158

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEF  1149
             +YGWDKASNL+YVDQP GTGFSYS+   D R  EDG+SNDLY FLQ FF  HP+ AK+EF
Sbjct  159   EYGWDKASNLLYVDQPIGTGFSYSTDRRDIRHSEDGISNDLYDFLQAFFAEHPELAKNEF  218

Query  1148  FVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNN  969
             ++TGESYAGHYIPA   R+++GNK KEG+HINLKGLAIGNGLT+P IQY AY DFALDN 
Sbjct  219   YITGESYAGHYIPAFAARVHRGNKAKEGVHINLKGLAIGNGLTEPAIQYKAYTDFALDNG  278

Query  968   LISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYD  795
             +I+K+ HD + +++P C+ A++ C ++G  +C  S  V   C  ++  I+ +  +LNYYD
Sbjct  279   IITKTDHDRINKVLPVCEMAIKLCGTDGTVSCMASYFV---CNTIFSSILARAGNLNYYD  335

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IRKKC  GS CYDFSN E FLN K V++ALGVGD+ +VSCS TVY+ M  D  +NL  GI
Sbjct  336   IRKKC-EGSFCYDFSNMEKFLNQKPVREALGVGDLSFVSCSPTVYQAMLVDWMRNLEVGI  394

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F ++P V F V   E GI K
Sbjct  395   PTLLEDGIQLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFVSSPEVPFVVDDSEAGILK  454

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +YGPL+FLKVHD+GH+VPMDQPKA+LEMLRRW  G L
Sbjct  455   NYGPLSFLKVHDSGHMVPMDQPKAALEMLRRWTQGTL  491



>emb|CDO99792.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/461 (62%), Positives = 352/461 (76%), Gaps = 12/461 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEA----DTPRLVEKKLKL-NLLGDSGATVEDLGQ  1521
              AEK+IRQLNLFP   +N    H P+ +    +  ++VEK LKL NL+ D   TV+DL  
Sbjct  39    HAEKLIRQLNLFPKQLINIAD-HDPLSSSPFPEAEKIVEKPLKLSNLVSDPSVTVQDLAH  97

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGY+++ ++  ARMFYFFF+SR++K DPVVIWLTGGPGCSS LALFYENGPF IA N S
Sbjct  98    HAGYFKIEHSHAARMFYFFFQSRNSKKDPVVIWLTGGPGCSSELALFYENGPFSIAKNLS  157

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WNDYGWDK SNL+YVDQP GTGFSYS+   D R +EDGVSNDLY FLQ FF  HP++A
Sbjct  158   LLWNDYGWDKVSNLLYVDQPIGTGFSYSTDRRDIRHNEDGVSNDLYDFLQAFFSKHPEFA  217

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPA   R++ GNK KEGIH+NLKG AIGNGLT+PGIQY AY D+A
Sbjct  218   KNDFYITGESYAGHYIPAFAARVHHGNKAKEGIHVNLKGFAIGNGLTEPGIQYGAYTDYA  277

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDL  807
             LD  +IS S HD + +++P C+ A++ C ++G  +C  S LV   C  ++  IM    D+
Sbjct  278   LDMGIISDSDHDRINKVLPVCETAIKLCGTDGTISCLASYLV---CNAIFSSIMAHAGDI  334

Query  806   NYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNL  627
             NYYDIRKKC  GSLCYDFSN + FLN K+V++ALGVGD+D+VSCS TVY+ M  D  +NL
Sbjct  335   NYYDIRKKC-EGSLCYDFSNLDNFLNQKTVRNALGVGDLDFVSCSPTVYQAMLVDWMRNL  393

Query  626   APGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEK  447
               GIP+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQ  F ++P V F V   E 
Sbjct  394   EAGIPALLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWSGQNEFKSSPEVPFVVDSSEA  453

Query  446   GIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             G+ KS+GPL+FLKVHDAGH+VPMDQP+A+LEML+RWM G L
Sbjct  454   GLLKSHGPLSFLKVHDAGHMVPMDQPQAALEMLKRWMKGSL  494



>ref|XP_007207364.1| hypothetical protein PRUPE_ppa004507mg [Prunus persica]
 gb|EMJ08563.1| hypothetical protein PRUPE_ppa004507mg [Prunus persica]
Length=506

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/475 (60%), Positives = 358/475 (75%), Gaps = 5/475 (1%)
 Frame = -2

Query  1739  SPAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEAD--TPRLVEKKLKL  1566
             S A   NG     +  K +AE  IR LNLFP+ ++N     + ++     P LVEK+ K+
Sbjct  22    SAAFPNNGPLQFSSTPKLQAENFIRDLNLFPIDEINTVPHKTSLDEAFAGPMLVEKQFKM  81

Query  1565  NLLGD-SGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSL  1389
               LG  SG +V++LG HAGYYRLPN+  ARMFY FFESR+NK+DPVV+WLTGGPGC S +
Sbjct  82    PFLGAASGPSVQELGHHAGYYRLPNSKAARMFYLFFESRTNKNDPVVMWLTGGPGCGSEI  141

Query  1388  ALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSND  1209
             A+FYENGPF IA+N SL WNDYGWDKASNL++VDQP GTGFSY+S E D R DE+G+SND
Sbjct  142   AVFYENGPFQIANNLSLAWNDYGWDKASNLLFVDQPIGTGFSYTSDEGDIRHDEEGISND  201

Query  1208  LYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGN  1029
             LY FLQ FF  HP++AK++F+VTGESYAGHYIPA  +R+++GNK KEG++IN KG AIGN
Sbjct  202   LYDFLQAFFAQHPQFAKNDFYVTGESYAGHYIPAFASRVHKGNKAKEGMYINFKGFAIGN  261

Query  1028  GLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRC  849
             GLT+P IQY AYPDFAL   LI K+ +D ++  IP C++A++ C S GG AC+      C
Sbjct  262   GLTNPEIQYKAYPDFALQTGLIKKADYDRISTTIPDCEQAIKTCGSEGGEACASSYEV-C  320

Query  848   QPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCST  669
               ++++I+  +   NYYDIRK+C  G +CYDFSN ETFLN K V+DALGVG ID+VSCS+
Sbjct  321   NSIFEKIINIIGSTNYYDIRKQC-EGDMCYDFSNMETFLNKKQVRDALGVGGIDFVSCSS  379

Query  668   TVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFG  489
             TVY+ M  D  +NL  GIP+LL+DGI +LVY GEYDLICNWLGN +WV A++W GQK FG
Sbjct  380   TVYDAMLMDWMRNLEVGIPALLEDGIKVLVYAGEYDLICNWLGNSKWVHAMEWSGQKAFG  439

Query  488   AAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             A+  V F VG  E G+ KS+GPLT LKVH+AGH+VPMDQP+A+L+ML  WM G+L
Sbjct  440   ASSTVPFKVGATEAGLLKSHGPLTLLKVHNAGHMVPMDQPEAALQMLTSWMQGKL  494



>ref|XP_007220656.1| hypothetical protein PRUPE_ppa003691mg [Prunus persica]
 gb|EMJ21855.1| hypothetical protein PRUPE_ppa003691mg [Prunus persica]
Length=555

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/457 (62%), Positives = 349/457 (76%), Gaps = 7/457 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSG-HSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGY  1509
              A+++IR  NLFP  D+N   G  S +  D+PRLVEK+  L  L  SG +VEDLG HAGY
Sbjct  89    HAQELIRAFNLFPKEDINIIDGPDSSIFHDSPRLVEKRFNLPNLVGSGVSVEDLGHHAGY  148

Query  1508  YRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWN  1329
             +++ ++  ARMFY FFESR+NK DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL WN
Sbjct  149   FKIEHSHAARMFYLFFESRTNKKDPVVIWLTGGPGCSSELAVFYENGPFNIANNLSLVWN  208

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEF  1149
             +YGWDKASNL+YVDQP GTGFSYS+   D R  EDG+SNDLY FLQ FF  HP+ AK++F
Sbjct  209   EYGWDKASNLLYVDQPIGTGFSYSTDRRDIRHSEDGISNDLYDFLQAFFAEHPELAKNDF  268

Query  1148  FVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNN  969
             ++TGESYAGHYIPA   R+++GNK KEG+HINLKG AIGNGLT+P IQY AY DFALDN 
Sbjct  269   YITGESYAGHYIPAFAARVHRGNKAKEGVHINLKGFAIGNGLTEPAIQYKAYTDFALDNG  328

Query  968   LISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYD  795
             +I+K+ HD + +++P C+ A++ C ++G  +C  S  V   C  ++  I+ +  +LNYYD
Sbjct  329   IITKTDHDRINKVLPVCEMAIKLCGTDGTVSCMASYFV---CNTIFSSILARAGNLNYYD  385

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IRKKC  GS CYDFSN E FLN K V++ALGVGD+ +VSCS TVY+ M  D  +NL  GI
Sbjct  386   IRKKC-EGSFCYDFSNMEKFLNQKPVREALGVGDLSFVSCSPTVYQAMLVDWMRNLEVGI  444

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F ++P V F V   E G+ K
Sbjct  445   PTLLEDGIQLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFVSSPEVPFVVDDSEAGVLK  504

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +YGPL+FLKVHD+GH+VPMDQPKA+LEMLRRW  G L
Sbjct  505   NYGPLSFLKVHDSGHMVPMDQPKAALEMLRRWTRGTL  541



>ref|XP_009368926.1| PREDICTED: serine carboxypeptidase-like [Pyrus x bretschneideri]
Length=515

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/459 (62%), Positives = 350/459 (76%), Gaps = 9/459 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSG---HSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
              A+++IR  NLFP  D+N   G    +   AD PR  EK L+L  L +SG +VEDLG HA
Sbjct  47    HAKQLIRAFNLFPEEDINIIDGPDSSTAAVADAPRRKEKPLRLPNLIESGVSVEDLGHHA  106

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GY+++ ++  A+MFY FFESR+NK DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL 
Sbjct  107   GYFKIEHSHAAKMFYLFFESRTNKKDPVVIWLTGGPGCSSELAVFYENGPFTIANNLSLV  166

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN+YGWDKASNL+YVDQP GTGFSYSS + D R  EDGVSNDLY FLQ FF  HP+ AK+
Sbjct  167   WNEYGWDKASNLLYVDQPIGTGFSYSSDKRDIRHSEDGVSNDLYDFLQAFFAEHPELAKN  226

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +FF+TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDP +QY AY DFALD
Sbjct  227   DFFITGESYAGHYIPAFAARVHKGNKAKEGIHINLKGFAIGNGLTDPAVQYKAYTDFALD  286

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
             N LI+ + ++ + +++P C+ A++ C ++G  +C  S  V   C  ++  IM K  ++NY
Sbjct  287   NGLITATEYNRINKVLPVCEMAIKLCGTDGTVSCMASYFV---CNTIFSSIMAKAGNINY  343

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIR+KC  GSLCYDFSN E FLN K V+++LGVGDI++VSCS+TVYE M  D  +NL  
Sbjct  344   YDIRQKC-EGSLCYDFSNMEKFLNLKPVRESLGVGDIEFVSCSSTVYEAMLVDWMRNLEV  402

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F  +P V F V   E G+
Sbjct  403   GIPTLLEDGIQLLVYAGEYDLICNWLGNSRWVHAMEWSGQKQFVTSPEVPFVVDNSEAGV  462

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K++GPL+FLKVHDAGH+VPMDQPKA+LEMLRRW  G +
Sbjct  463   LKNHGPLSFLKVHDAGHMVPMDQPKAALEMLRRWTRGSI  501



>dbj|BAE48666.1| Serine carboxypeptidase [Prunus mume]
Length=506

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/475 (60%), Positives = 360/475 (76%), Gaps = 5/475 (1%)
 Frame = -2

Query  1739  SPAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEAD--TPRLVEKKLKL  1566
             S A   NG     +  K +AEK IR LNLFP  ++N     + ++     P LVEK+ K+
Sbjct  22    SAAFPNNGPLQLSSTPKLQAEKFIRGLNLFPTDEINTVPHKTSLDEAFAGPMLVEKQFKM  81

Query  1565  NLLGD-SGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSL  1389
               LG  SG +V++LG HAGYYRLPN+  ARMFY FFESR++K++PVV+WLTGGPGC S +
Sbjct  82    PFLGAASGPSVQELGHHAGYYRLPNSKAARMFYLFFESRTDKNNPVVMWLTGGPGCGSEI  141

Query  1388  ALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSND  1209
             A+FYENGPF IA+N SL WNDYGWDKASNL++VDQP G GFSY+S E D R DE+G+SND
Sbjct  142   AVFYENGPFQIANNLSLAWNDYGWDKASNLLFVDQPIGNGFSYTSDEGDIRHDEEGISND  201

Query  1208  LYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGN  1029
             LY FLQ FF  HP++AK++F++TGESYAGHYIPA G+RI++GNK KEG++IN KG AIGN
Sbjct  202   LYDFLQAFFAQHPQFAKNDFYITGESYAGHYIPAFGSRIHKGNKAKEGMYINFKGFAIGN  261

Query  1028  GLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRC  849
             GLT+P IQY AYPDFAL   LI K+ +D +++ IP C++A++ C S GG AC+      C
Sbjct  262   GLTNPEIQYKAYPDFALQTGLIKKADYDRISKTIPDCEQAIKTCGSEGGEACASSYEV-C  320

Query  848   QPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCST  669
               ++++I+  +   NYYDIRK+C  G +CYDFSN ETFL  K V+DALGVGDID+VSCS+
Sbjct  321   NSIFEKIINIIGGTNYYDIRKQCE-GDMCYDFSNMETFLKKKQVRDALGVGDIDFVSCSS  379

Query  668   TVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFG  489
             TVY+ M  D  +NL  GIP+LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK FG
Sbjct  380   TVYDAMLMDWMRNLEVGIPALLEDGIKVLLYAGEYDLICNWLGNSKWVHAMEWSGQKAFG  439

Query  488   AAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             A+  V F VG  E G+ KS+GPLTFLKVH+AGH+VPMDQP+A+L+ML  WM G+L
Sbjct  440   ASSTVPFKVGATEAGLLKSHGPLTFLKVHNAGHMVPMDQPEAALQMLTSWMQGKL  494



>gb|AAL15270.1| AT3g45010/F14D17_80 [Arabidopsis thaliana]
Length=510

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/460 (62%), Positives = 355/460 (77%), Gaps = 12/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL----NLLGDSGA-TVEDLGQH  1518
             AE++I+  NL P  D+N         ++ PRLVE+   L    +  G  G+ +V+D G H
Sbjct  46    AERLIKGFNLMPTRDVNVIDEEG---SEAPRLVERAFDLPAAVDRRGSGGSPSVQDFGHH  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LPN+  ARMFYFFFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL
Sbjct  103   AGYYKLPNSKAARMFYFFFESRTNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN++GWDKASNLIYVDQP GTGFSY+S + D R DEDGVSNDLY FLQ FFK HP++ K
Sbjct  163   SWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEDGVSNDLYDFLQAFFKEHPQFVK  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGS--ACSDLVNSRCQPLYDRIMEKLVDLN  804
             D NLI++S HD L +    CQ+++++C+++GG   AC+    + C  ++ +IM+   ++N
Sbjct  283   DMNLITQSDHDNLNRYYATCQQSIKECSADGGEGDACASSY-TVCNNIFQKIMDIAGNVN  341

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  GSLCYDFSN E FLN KSV+ ALGVGDI++VSCST VYE M  D  +NL 
Sbjct  342   YYDVRKQC-EGSLCYDFSNMENFLNQKSVRKALGVGDIEFVSCSTAVYEAMQMDWMRNLE  400

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LLQDGI LLVY GEYDLICNWLGN +WV  ++W GQK F AA  V F VG KE G
Sbjct  401   VGIPALLQDGIKLLVYAGEYDLICNWLGNSKWVHEMEWSGQKEFVAAATVPFHVGNKEAG  460

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K+YG LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   LMKNYGSLTFLKVHDAGHMVPMDQPKAALQMLQNWMQGKL  500



>ref|XP_007132322.1| hypothetical protein PHAVU_011G085000g [Phaseolus vulgaris]
 gb|ESW04316.1| hypothetical protein PHAVU_011G085000g [Phaseolus vulgaris]
Length=496

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/456 (64%), Positives = 349/456 (77%), Gaps = 8/456 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTP-RLVEKKLKLNLLGDSGATVEDLGQHAGY  1509
             +AEK+IR LNLFP    N   G    E   P ++VEKK   + LGDSG +VEDLG HAGY
Sbjct  40    KAEKLIRSLNLFPKEPFNSIEGDH--EGFVPGKIVEKKF--SFLGDSGPSVEDLGHHAGY  95

Query  1508  YRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWN  1329
             Y LP++  ARMFYF FESRS+K DPVV+WLTGGPGC S LALFYENGPF+I +N SL WN
Sbjct  96    YSLPHSKAARMFYFLFESRSSKDDPVVVWLTGGPGCGSELALFYENGPFHITNNLSLTWN  155

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEF  1149
              YGWD+ASN+I+VDQPTGTGFSYSS   D R+DE GVS DLY FLQEFFK+HP+  K++F
Sbjct  156   QYGWDQASNIIFVDQPTGTGFSYSSDINDLRSDETGVSIDLYDFLQEFFKSHPELVKNDF  215

Query  1148  FVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNN  969
             ++TGESYAGHYIPA+ +RINQ NK K GIHINLKG+AIGNG T P IQY AYP FAL+N 
Sbjct  216   YITGESYAGHYIPAIASRINQQNKMKHGIHINLKGIAIGNGYTYPAIQYLAYPQFALENG  275

Query  968   LISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIR  789
             LI+K   D++++LIP C+EA + C S+GG  C +  +S C+ ++DRI+    D+NYYDIR
Sbjct  276   LITKKEADDISKLIPHCEEAAKICESHGGVTCENAYDS-CEEIFDRILTIDADINYYDIR  334

Query  788   KKCVGGSLCYDFSNAETFLNTKSVKDALGVGD-IDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             KKCV G+LCYDFSN E  LN ++VK ALGVG  + +VSCST VY+V+  D  KNLA GIP
Sbjct  335   KKCV-GALCYDFSNVEKLLNQENVKSALGVGKGLKFVSCSTAVYDVLRQDAIKNLAVGIP  393

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
              LL+DGI +LVY GE DLICNW+GNL WV A+ W GQK F A+P V F V G E G   S
Sbjct  394   GLLEDGIKVLVYAGEKDLICNWIGNLMWVHAMNWPGQKAFAASPTVKFVVDGAEAGSLNS  453

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPL+FLKVHDAGHLVPMDQPK +L+ML+ WM G+L
Sbjct  454   FGPLSFLKVHDAGHLVPMDQPKVALQMLKSWMGGKL  489



>ref|XP_003539193.1| PREDICTED: serine carboxypeptidase-like 48-like [Glycine max]
Length=498

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/458 (62%), Positives = 351/458 (77%), Gaps = 6/458 (1%)
 Frame = -2

Query  1694  SKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             ++ +AEK+IR LNL P   +N   G   V     ++VEKK   +L  DSG ++EDLG HA
Sbjct  41    TQSQAEKLIRSLNLLPKDSVNIVKGDH-VGFVPGKIVEKKF--SLFCDSGPSIEDLGHHA  97

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY LP++  ARMFYFFFESR+NK DPVVIWLTGGPGC S LALFYENGPF+IA+N SL 
Sbjct  98    GYYSLPHSKAARMFYFFFESRNNKDDPVVIWLTGGPGCGSELALFYENGPFHIANNLSLT  157

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWD+ASN+++VDQPTGTGFSYSS E D R DE G+SNDLY FLQEFFKAHP++ K+
Sbjct  158   WNDYGWDQASNILFVDQPTGTGFSYSSEESDIRHDETGISNDLYDFLQEFFKAHPEFVKN  217

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHY+PAL +R+NQGNK+ +GIHINLKG AIGNGLT+P IQY AYPDFALD
Sbjct  218   DFYITGESYAGHYVPALASRVNQGNKQNQGIHINLKGFAIGNGLTNPAIQYQAYPDFALD  277

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
             N +I+ + +D +++LIPGC++A + C + GG +C+  +   CQ ++  I++   ++NYYD
Sbjct  278   NGIITNAEYDNISKLIPGCEQAAKTCENQGGQSCATAL-YICQNIFSLILDYAGNINYYD  336

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             IRKKCV G LCYDF N E FLN K VK ALGV  D+ +V CSTTV+  M  D  +N+  G
Sbjct  337   IRKKCV-GELCYDFGNVEEFLNQKKVKSALGVRDDLQYVLCSTTVHAAMLQDWMRNMEVG  395

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IPSLL+DGI LLVY GE DLICNWLGN RW  A++W GQK FG +  V F V G E G  
Sbjct  396   IPSLLEDGIKLLVYAGEEDLICNWLGNSRWAHAMEWSGQKAFGTSSTVKFVVDGVEAGSL  455

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              SYGPL+FLKVH AGH+VPMDQPK +L+ML+ WM G+L
Sbjct  456   NSYGPLSFLKVHGAGHMVPMDQPKVALQMLKSWMGGKL  493



>ref|XP_007010003.1| Serine carboxypeptidase-like 49 [Theobroma cacao]
 gb|EOY18813.1| Serine carboxypeptidase-like 49 [Theobroma cacao]
Length=508

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/457 (63%), Positives = 345/457 (75%), Gaps = 7/457 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQHAGY  1509
              A+K+IR+LNLFP  ++N   G      +  RLVEK+ K  NL    G +VEDLG HAGY
Sbjct  43    HAKKLIRELNLFPKEEVNVVDGGQVSLPEDSRLVEKRFKFPNLAVPGGVSVEDLGHHAGY  102

Query  1508  YRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWN  1329
             Y+L N+ DARMFYFFFESR++K DPVVIWLTGGPGCSS LALFYENGPF IA+N SL WN
Sbjct  103   YKLANSHDARMFYFFFESRNSKKDPVVIWLTGGPGCSSELALFYENGPFTIAENMSLIWN  162

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEF  1149
              YGWD ASNL+YVDQP GTGFSYSS   D R +ED VSNDLY FLQ FF  HP++ K++F
Sbjct  163   QYGWDMASNLLYVDQPIGTGFSYSSDRRDIRHNEDEVSNDLYDFLQAFFAEHPEFEKNDF  222

Query  1148  FVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNN  969
             ++TGESYAGHYIPA   R++QGNK K+GIHINLKG AIGNGLTDP IQY AY D+ALD  
Sbjct  223   YITGESYAGHYIPAFAARVHQGNKAKDGIHINLKGFAIGNGLTDPAIQYKAYTDYALDMG  282

Query  968   LISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYD  795
             +I KS ++ + +L+P C+ A++ C ++G  +C  S  V   C  ++  IM    D NYYD
Sbjct  283   VIKKSDYNRINKLVPVCEMAIKLCGTDGTISCMASYFV---CNAIFTGIMALAGDTNYYD  339

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IR KC  GSLCYDFSN ETFLN +SV+DALGVG ID+VSCS TVY+ M  D  +NL  GI
Sbjct  340   IRTKC-EGSLCYDFSNMETFLNQESVRDALGVGSIDFVSCSPTVYQAMLVDWMRNLEVGI  398

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DG+ LLVY GEYDLICNWLGN RWV A++W GQK F A+P V F V G E G+ K
Sbjct  399   PALLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFVASPEVPFVVDGSEAGVLK  458

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             ++GPL FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  459   THGPLGFLKVHDAGHMVPMDQPKAALEMLKRWTKGTL  495



>ref|XP_004240167.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=491

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/456 (61%), Positives = 346/456 (76%), Gaps = 2/456 (0%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K  AEK I QLNLFP HD+N          D  RL EKKL L+ LG SGATV+DL  HAG
Sbjct  35    KTMAEKFISQLNLFPKHDINIIVSSKDQIVDQQRLFEKKLILSYLGHSGATVQDLAHHAG  94

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY L +T  ARMFYFFFESRSNK+DPVV+WLTGGPGCSS LALFYENGPF I+ N SL W
Sbjct  95    YYHLLHTKAARMFYFFFESRSNKNDPVVMWLTGGPGCSSELALFYENGPFQISHNMSLVW  154

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             N++GWDK SNLIY+DQPTGTGFSY+S   D R +E  +SNDLY F+Q FF AHP+Y  S+
Sbjct  155   NEFGWDKVSNLIYIDQPTGTGFSYTSDNRDIRHNETDISNDLYDFIQAFFNAHPEYVNSD  214

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R++QGNKKKEGIHINLKG AIGNG+T+P IQ+ +Y D+ALD 
Sbjct  215   FYITGESYAGHYIPAFASRVHQGNKKKEGIHINLKGFAIGNGMTNPEIQFKSYTDYALDM  274

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI+++ +  + +L P CQ+ +  C + G  AC       C  ++  IM+ + D NYYD 
Sbjct  275   KLINQTDYHNINKLYPKCQQQINSCGNGGEDACL-YAFQDCTNIFSSIMDIVGDKNYYDT  333

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK C  G+LCYDFS  ET+LN   VK ALGVGDI++VSCS+ V + + +D+ K+   GIP
Sbjct  334   RKTC-EGNLCYDFSRMETYLNDNQVKRALGVGDIEFVSCSSIVKQALGTDMMKSFVVGIP  392

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
              LL+DGINLL+Y GEYDL+CNWLGN  WV A++W G++ FGAAP++ F+V G++KG+QK+
Sbjct  393   PLLEDGINLLIYAGEYDLMCNWLGNSNWVHAMEWSGKREFGAAPSINFTVEGEDKGVQKN  452

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLKVHDAGH+VPMDQPKA+L ML+RW  G+L
Sbjct  453   HGPLTFLKVHDAGHMVPMDQPKAALAMLQRWTQGKL  488



>ref|XP_011084286.1| PREDICTED: serine carboxypeptidase-like [Sesamum indicum]
Length=503

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/454 (62%), Positives = 346/454 (76%), Gaps = 4/454 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQHAGYY  1506
             AEK+IRQLNLFP   +N  +       D PRLVE++ K  NL+G + A+V +LG HAGYY
Sbjct  39    AEKLIRQLNLFPDEPVNIAANAGRF-LDAPRLVERRFKFPNLVGSTDASVRELGHHAGYY  97

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             ++P +  ARMFYFFFESR +  DPVVIWLTGGPGCSS +ALFYENGPF IA+N SL WN+
Sbjct  98    QIPRSHAARMFYFFFESRHSTQDPVVIWLTGGPGCSSEMALFYENGPFTIANNLSLVWNE  157

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             YGWDK SN++YVDQP GTGFS+SS   D R +E GVS+DL+ FLQ FFK HP  AK++F+
Sbjct  158   YGWDKVSNILYVDQPIGTGFSFSSDRRDIRHNEKGVSDDLFDFLQAFFKEHPHLAKNDFY  217

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPAL  R++QGNK KEGIH+NLKG AIGNGLTDP IQY AY D+A+D  +
Sbjct  218   ITGESYAGHYIPALAARVHQGNKAKEGIHVNLKGFAIGNGLTDPAIQYGAYADYAMDMGI  277

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I+++ HD + + +P C+ AV+ C ++G  +C       C  ++  I+ +  D+NYYDIRK
Sbjct  278   ITQTEHDRINKALPLCESAVKLCGTDGTISCM-AAYFVCNTIFSAIIARAGDVNYYDIRK  336

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             KC  G+LCYDFSN E FLN + V+DALGVGD+ +VSCS+TVY+ M  D  +NL  GIP+L
Sbjct  337   KC-EGNLCYDFSNLEKFLNQQPVRDALGVGDVQFVSCSSTVYQAMLMDWMRNLEVGIPAL  395

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DG+ LLVY GEYDLICNWLGN RWV A++W GQK F AA  V F V G E G+  S+G
Sbjct  396   LEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFIAASEVPFEVDGSEAGVLTSHG  455

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PL+FLKVHDAGH+VPMDQPKASLEML+RWMH  L
Sbjct  456   PLSFLKVHDAGHMVPMDQPKASLEMLKRWMHSSL  489



>ref|XP_003540200.1| PREDICTED: serine carboxypeptidase-like 48-like [Glycine max]
Length=504

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/458 (63%), Positives = 349/458 (76%), Gaps = 13/458 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEAD----TPRLVEKKLKL-NLLGDSGATVEDLGQH  1518
             AEK+IR LNLFP   +N       +E D    +  +VEK     +L   S ++VE+LG H
Sbjct  43    AEKLIRGLNLFPKDPINT------LENDPLFVSGSIVEKSFTFPSLAASSESSVEELGHH  96

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYYRLP +  ARMFYFFFESRS+K+DPVVIWLTGGPGCSS LALFYENGPF +  N SL
Sbjct  97    AGYYRLPRSKAARMFYFFFESRSSKNDPVVIWLTGGPGCSSELALFYENGPFQLTKNLSL  156

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WNDYGWDKASN+I+VDQPTGTGFSY+S E D R DE+GVSNDLY FLQ FFK HP+  K
Sbjct  157   VWNDYGWDKASNIIFVDQPTGTGFSYTSDESDIRHDEEGVSNDLYDFLQAFFKEHPQLTK  216

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R++QGNK KEGIHINLKG AIGNGLT+P IQY AY D+AL
Sbjct  217   NDFYITGESYAGHYIPALASRVHQGNKAKEGIHINLKGFAIGNGLTNPEIQYQAYTDYAL  276

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             D  LI K+ +D + +LIP C++A+  C + GG  C   +   C  +++RIM    D+NYY
Sbjct  277   DRGLIKKADYDSINKLIPPCKQAIEACGTEGGETCVSSLYV-CNKIFNRIMTIADDVNYY  335

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKCV G LCYDFS  E FLN K+V+DALGVGD+D+VSCS+TVY  M  D  +NL  G
Sbjct  336   DIRKKCV-GDLCYDFSVMEDFLNKKTVRDALGVGDLDFVSCSSTVYSAMMQDWMRNLEVG  394

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL++GI +LVY GE DLICNWLGN RWV A++W GQK FGA+  V F V G E G  
Sbjct  395   IPTLLEEGIKVLVYAGEEDLICNWLGNSRWVNAMEWSGQKQFGASGTVPFLVDGAEAGTL  454

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KS+GPL+FLKV++AGH+VPMDQPKA+LEMLR WM G+L
Sbjct  455   KSHGPLSFLKVYEAGHMVPMDQPKAALEMLRSWMQGKL  492



>emb|CAC86383.1| carboxypeptidase type III [Theobroma cacao]
Length=508

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/457 (63%), Positives = 345/457 (75%), Gaps = 7/457 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQHAGY  1509
              A+K+IR+LNLFP  ++N   G      +  RLVEK+ K  NL    G +VEDLG HAGY
Sbjct  43    HAKKLIRELNLFPKEEVNVVDGGQVSLPEDSRLVEKRFKFPNLAVPGGVSVEDLGHHAGY  102

Query  1508  YRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWN  1329
             Y+L N+ DARMFYFFFESR++K DPVVIWLTGGPGCSS LALFYENGPF IA+N SL WN
Sbjct  103   YKLANSHDARMFYFFFESRNSKKDPVVIWLTGGPGCSSELALFYENGPFTIAENMSLIWN  162

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEF  1149
              YGWD ASNL+YVDQP GTGFSYSS   D R +ED VSNDLY FLQ FF  HP++ K++F
Sbjct  163   QYGWDMASNLLYVDQPIGTGFSYSSDRRDIRHNEDEVSNDLYDFLQAFFAEHPEFEKNDF  222

Query  1148  FVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNN  969
             ++TGESYAGHYIPA   R++QGNK K+GIHINLKG AIGNGLTDP IQY AY D+ALD  
Sbjct  223   YITGESYAGHYIPAFAARVHQGNKAKDGIHINLKGFAIGNGLTDPAIQYKAYTDYALDMG  282

Query  968   LISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYD  795
             +I KS ++ + +L+P C+ A++ C ++G  +C  S  V   C  ++  IM    D NYYD
Sbjct  283   VIKKSDYNRINKLVPVCEMAIKLCGTDGTISCMASYFV---CNAIFTGIMALAGDTNYYD  339

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IR KC  GSLCYDFSN ETFLN +SV+DALGVG ID+VSCS TVY+ M  D  +NL  GI
Sbjct  340   IRTKC-EGSLCYDFSNMETFLNQESVRDALGVGSIDFVSCSPTVYQAMLVDWMRNLEVGI  398

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DG+ LLVY GEYDLICNWLGN RWV A++W GQK F A+P V F V G E G+ +
Sbjct  399   PALLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFVASPEVPFVVDGSEAGVLR  458

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             ++GPL FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  459   THGPLGFLKVHDAGHMVPMDQPKAALEMLKRWTKGTL  495



>ref|XP_010535623.1| PREDICTED: serine carboxypeptidase-like 48 isoform X1 [Tarenaya 
hassleriana]
Length=510

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/466 (62%), Positives = 359/466 (77%), Gaps = 13/466 (3%)
 Frame = -2

Query  1700  ANS-KRRAEKMIRQLNLFPLHDLNRGSGHSPVE-ADTPRLVEKKLKL--NLLGDSGA---  1542
             ANS K  AEK+I+  NL P  D+N      P + A + RLVE+++       G+S A   
Sbjct  41    ANSPKLMAEKLIKSFNLMPERDVNI----VPEDVAQSLRLVEREIDFPATFAGESAADVP  96

Query  1541  TVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPF  1362
             TV++ G HAGYY+LP++  ARMFY FFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF
Sbjct  97    TVKEYGHHAGYYKLPHSKAARMFYLFFESRSNKTDPVVIWLTGGPGCSSQLALFYENGPF  156

Query  1361  YIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFF  1182
              I+ N SL WND+GWDKASNLIYVDQP GTGFS++S + D R DEDGVSNDLY FLQ FF
Sbjct  157   NISKNLSLSWNDFGWDKASNLIYVDQPVGTGFSFTSDDSDLRHDEDGVSNDLYDFLQAFF  216

Query  1181  KAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQY  1002
             K HP++AK++F++TGESYAGHYIPAL +R++ GNK KEGIHINLKG AIGNGLT+P +QY
Sbjct  217   KEHPQFAKNDFYITGESYAGHYIPALASRVHHGNKNKEGIHINLKGFAIGNGLTNPEVQY  276

Query  1001  PAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIME  822
              AYPD+ALD  LI++S H+ + +L P CQ A ++CN++GG AC++     C  ++D I+ 
Sbjct  277   GAYPDYALDMKLITESDHESIKKLYPDCQRATKECNTDGGDACANAY-YVCNEIFDNILG  335

Query  821   KLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSD  642
                 +NYYD+RK+C  G+LCYDFS+ ETFLN KSV+  LGVGDI++VSCS+TVY+ M +D
Sbjct  336   IAGSVNYYDVRKQC-QGNLCYDFSSMETFLNQKSVRSTLGVGDIEFVSCSSTVYDAMRND  394

Query  641   IFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSV  462
               +NL   IP LL+DGI LLVY GEYDLICNWLGN +W   ++W GQKGFG+A  + F V
Sbjct  395   WMRNLEVVIPELLEDGIELLVYAGEYDLICNWLGNSKWAHQMEWSGQKGFGSAKMIPFLV  454

Query  461   GGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G E G+ K++GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  455   DGTEAGLMKNHGPLTFLKVHDAGHMVPMDQPKASLQMLQNWMQGKL  500



>gb|KDP30482.1| hypothetical protein JCGZ_16161 [Jatropha curcas]
Length=514

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/463 (62%), Positives = 355/463 (77%), Gaps = 11/463 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN---RGSGHSPVEADTPRLVEKKLKL-NLLGD-SGATVEDLGQ  1521
             +A+KMIR+LNLFP  D+N    G G   + +   R+VEK+ +  N++G     +V+DLG 
Sbjct  38    QADKMIRELNLFPDKDINVIDGGDGDGGLVSGEKRIVEKRFRFRNVVGGYDSVSVDDLGH  97

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY++ N+  ARMFYFFFESR++K DP+VIWLTGGPGCSS LA+FYENGPF IADN S
Sbjct  98    HAGYYKIANSHAARMFYFFFESRNSKKDPIVIWLTGGPGCSSELAMFYENGPFTIADNLS  157

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WN+YGWDKASNL+YVDQP GTGFSYSS   D R +E+GVSNDLY FLQ FF  HP+ A
Sbjct  158   LVWNEYGWDKASNLLYVDQPIGTGFSYSSDRRDIRHNEEGVSNDLYDFLQAFFAEHPELA  217

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPA   R+++GNK KEGIHI LKG AIGNGLTDPGIQY AY D+A
Sbjct  218   KNDFYITGESYAGHYIPAFAARVHKGNKAKEGIHIKLKGFAIGNGLTDPGIQYKAYTDYA  277

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDL  807
             LD  LI+K+ HD + +++P C+ A++ C ++G  +C  S  V   C  ++  ++ +  D+
Sbjct  278   LDMGLITKADHDRINKVVPVCEMAIKLCGTDGTLSCMASYFV---CSTIFSSVLTRAGDI  334

Query  806   NYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNL  627
             NYYDIRKKC  GSLCYDFSN E FLN  SV+++LGVGDI +VSCS TVY+ M  D  +NL
Sbjct  335   NYYDIRKKC-EGSLCYDFSNLEKFLNLNSVRESLGVGDISFVSCSPTVYQAMLMDWMRNL  393

Query  626   APGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEK  447
               GIP+LL+DGI+LLVY GEYDLICNWLGN RWV A++W GQK F A+P V F V G E 
Sbjct  394   EAGIPALLEDGIHLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFVASPEVPFEVDGSEA  453

Query  446   GIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             G+ +S+GPL FLKVHDAGH+VPMDQPKASLEML RW+ G L K
Sbjct  454   GVLRSHGPLAFLKVHDAGHMVPMDQPKASLEMLSRWIKGSLSK  496



>ref|NP_190087.1| serine carboxypeptidase-like 48 [Arabidopsis thaliana]
 sp|Q56WF8.2|SCP48_ARATH RecName: Full=Serine carboxypeptidase-like 48; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB89316.1| carboxypeptidase precursor-like protein [Arabidopsis thaliana]
 gb|AAK91443.1| AT3g45010/F14D17_80 [Arabidopsis thaliana]
 gb|AAM16254.1| AT3g45010/F14D17_80 [Arabidopsis thaliana]
 gb|AEE77979.1| serine carboxypeptidase-like 48 [Arabidopsis thaliana]
Length=510

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/460 (62%), Positives = 354/460 (77%), Gaps = 12/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL----NLLGDSGA-TVEDLGQH  1518
             AE++I+  NL P  D+N         ++ PRLVE+   L    +  G  G+ +V+D G H
Sbjct  46    AERLIKGFNLMPTRDVNVIDEEG---SEAPRLVERAFDLPAAVDRRGSGGSPSVQDFGHH  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LPN+  ARMFYFFFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL
Sbjct  103   AGYYKLPNSKAARMFYFFFESRTNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN++GWDKASNLIYVDQP GTGFSY+S + D R DEDGVSNDLY FLQ FFK HP++ K
Sbjct  163   SWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEDGVSNDLYDFLQAFFKEHPQFVK  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGS--ACSDLVNSRCQPLYDRIMEKLVDLN  804
             D NLI++S HD L +    CQ+++++C+++GG   AC+    + C  ++ +IM+   ++N
Sbjct  283   DMNLITQSDHDNLNRYYATCQQSIKECSADGGEGDACASSY-TVCNNIFQKIMDIAGNVN  341

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  GSLCYDFSN E FLN KSV+ ALGVGDI++VSCST VYE M  D  +NL 
Sbjct  342   YYDVRKQC-EGSLCYDFSNMENFLNQKSVRKALGVGDIEFVSCSTAVYEAMQMDWMRNLE  400

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LLQDGI LLVY GEYDLICNWLGN +WV  ++W GQK F AA  V F V  KE G
Sbjct  401   VGIPALLQDGIKLLVYAGEYDLICNWLGNSKWVHEMEWSGQKEFVAAATVPFHVDNKEAG  460

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K+YG LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   LMKNYGSLTFLKVHDAGHMVPMDQPKAALQMLQNWMQGKL  500



>ref|XP_009345743.1| PREDICTED: serine carboxypeptidase-like [Pyrus x bretschneideri]
Length=516

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/463 (61%), Positives = 358/463 (77%), Gaps = 7/463 (2%)
 Frame = -2

Query  1697  NSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP---RLVEKKLKLNLL-GDSGATVED  1530
             ++K +AEK IR LNLFP  D+N  S    ++A+      +VEK+ K+  L   SG + +D
Sbjct  44    SAKGQAEKFIRALNLFPKDDVNILSRKPSLDAEADAGVEIVEKQFKMPFLDAASGPSAKD  103

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYYRLP++  AR+FY FFESR NK+DPVVIWLTGGPGCSS LALFYENGPF+I +
Sbjct  104   LGHHAGYYRLPHSEGARLFYLFFESRVNKNDPVVIWLTGGPGCSSELALFYENGPFHIQN  163

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WN+YGWDKASN++YVDQP GTGFSY+++  D R DE GVSNDLY FLQ FF  HP
Sbjct  164   NLSLTWNNYGWDKASNILYVDQPVGTGFSYTTNSSDIRHDEAGVSNDLYDFLQGFFALHP  223

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++AK++F++TGESYAGHY+PAL +R+N+GNK KEG HINLKG AIGNGLT+PGIQY AY 
Sbjct  224   EFAKNDFYITGESYAGHYVPALASRVNKGNKAKEGNHINLKGFAIGNGLTNPGIQYKAYT  283

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCN-SNGGSACSDLVNSRCQPLYDRIMEKLV  813
             D+AL   LI+K+ +D ++Q IP C+E+V+ C+ S  G AC + + S C  ++++IM++  
Sbjct  284   DYALQMKLITKADYDTISQTIPECEESVKACDASKSGDACEESL-SICNSIFNQIMQRNS  342

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
              +NYYDIRK+C  GSLCYDFSN  TFLN ++V+DALGVGDI++VSCS+TVY  M +D  +
Sbjct  343   GINYYDIRKQC-EGSLCYDFSNVVTFLNKQTVRDALGVGDIEFVSCSSTVYYAMLNDWMR  401

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP+LL+DGI LLVY GEYDLICNWLGN  W  A++W GQK F AA  V F V G 
Sbjct  402   NLEVGIPALLEDGIKLLVYAGEYDLICNWLGNSNWAHAMEWSGQKAFVAAQTVPFKVAGA  461

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G+ K+YGPL FLKVH+AGH+VPMDQP+A+L+ML  WM G L
Sbjct  462   EAGLLKTYGPLAFLKVHNAGHMVPMDQPEAALQMLTNWMQGNL  504



>ref|XP_009335971.1| PREDICTED: serine carboxypeptidase-like [Pyrus x bretschneideri]
Length=516

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/463 (62%), Positives = 358/463 (77%), Gaps = 7/463 (2%)
 Frame = -2

Query  1697  NSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP---RLVEKKLKLNLL-GDSGATVED  1530
             ++K +AEK IR LNLFP  D+N  S    ++A+      +VEK+ K+  L   SG + +D
Sbjct  44    SAKGQAEKFIRALNLFPKDDVNILSRKPSLDAEADAGVEIVEKQFKMPFLDAASGPSAKD  103

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYYRLP++  AR+FY FFESR NK+DPVVIWLTGGPGCSS LALFYENGPF+I +
Sbjct  104   LGHHAGYYRLPHSEGARLFYLFFESRVNKNDPVVIWLTGGPGCSSELALFYENGPFHIQN  163

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WN+YGWDKASN++YVDQP GTGFSY+++  D R DE GVSNDLY FLQ FF  HP
Sbjct  164   NLSLTWNNYGWDKASNILYVDQPVGTGFSYTTNSSDIRHDEAGVSNDLYDFLQGFFALHP  223

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++AK++F++TGESYAGHY+PAL +R+N+GNK KEG HINLKG AIGNGLT+PGIQY AY 
Sbjct  224   EFAKNDFYITGESYAGHYVPALASRVNKGNKAKEGNHINLKGFAIGNGLTNPGIQYKAYT  283

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQC-NSNGGSACSDLVNSRCQPLYDRIMEKLV  813
             D+AL   LI+K+ +D ++Q IP C+E+V+ C +S  G AC + + S C  ++++IM++  
Sbjct  284   DYALQMKLITKADYDTISQTIPECEESVKACASSKSGDACEESL-SICNSIFNQIMQRNS  342

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
              +NYYDIRK+C  GSLCYDFSN  TFLN ++V+DALGVGDI++VSCS+TVY  M +D  +
Sbjct  343   GINYYDIRKQC-EGSLCYDFSNVVTFLNKQTVRDALGVGDIEFVSCSSTVYYAMLNDWMR  401

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP+LL+DGI LLVY GEYDLICNWLGN  W  A++W GQK F AA  V F V G 
Sbjct  402   NLEVGIPALLEDGIKLLVYAGEYDLICNWLGNSNWAHAMEWSGQKAFVAAQTVPFKVAGG  461

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G+ KSYGPL FLKVH+AGH+VPMDQP+A+L+ML  WM G L
Sbjct  462   EAGLLKSYGPLAFLKVHNAGHMVPMDQPEAALQMLTNWMQGNL  504



>emb|CDP07043.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/456 (62%), Positives = 353/456 (77%), Gaps = 3/456 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K +AE++IRQLNLFP  ++N   GH P      R+ EK+  L+ LGDSGATVE+LG HAG
Sbjct  44    KAQAERLIRQLNLFPELEINISPGH-PGNLSGSRIEEKQFSLSCLGDSGATVENLGHHAG  102

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY+L ++  ARMFY FFESR +KSDPVVIWLTGGPGCSS LALFYENGPF IA+N SL W
Sbjct  103   YYKLQHSKGARMFYLFFESRKSKSDPVVIWLTGGPGCSSELALFYENGPFKIANNLSLIW  162

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDK SN+I+VDQP GTGFSYSS + D R +E+ VSNDLY F+Q FF+ HP+YAK++
Sbjct  163   NDYGWDKVSNIIFVDQPIGTGFSYSSDKSDTRHNEEEVSNDLYDFIQAFFEEHPQYAKND  222

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +RI +GNK KEG  INLKG+AIGNGLT+P IQY AY  +ALDN
Sbjct  223   FYITGESYAGHYIPAFASRIQRGNKDKEGTGINLKGIAIGNGLTNPEIQYQAYTQYALDN  282

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI+++  + L+ L+  CQ+A++ C  +GG++C     S C  L++ I+E   ++NYYDI
Sbjct  283   KLITQADANTLSPLVSQCQQAIKSCGPDGGTSCRQ-AYSICNGLFNSILEIAGNINYYDI  341

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK+C+  +LCYDFSN E FLN KSV+DALGVGDI++VSCS  VY+ + +D  +NL  G+P
Sbjct  342   RKQCI-SNLCYDFSNMEKFLNEKSVRDALGVGDIEFVSCSGEVYQALITDWMRNLEVGVP  400

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             + L+DG+ +LVY GE DLICNWLGN RWV A++W GQK F AAP+V F V   E G+ K 
Sbjct  401   AFLEDGVKVLVYAGECDLICNWLGNSRWVHAIEWSGQKDFEAAPDVPFVVDSVEAGLHKG  460

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPL+FLKVHDAGH+VPMDQPKASL M+ +WM G L
Sbjct  461   HGPLSFLKVHDAGHMVPMDQPKASLVMIEKWMQGTL  496



>ref|XP_008344883.1| PREDICTED: serine carboxypeptidase-like [Malus domestica]
Length=516

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/463 (61%), Positives = 358/463 (77%), Gaps = 7/463 (2%)
 Frame = -2

Query  1697  NSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP---RLVEKKLKLNLL-GDSGATVED  1530
             ++K +AEK IR LNLFP  D+N  S    ++A+      +VEK+ K+  L   SG + +D
Sbjct  44    SAKGQAEKFIRALNLFPKXDVNILSRKPSLDAEADAGVZIVEKQFKMPFLDAASGPSAKD  103

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYYRLP++  AR+FY FFESR NK+DPVVIWLTGGPGCSS LALFYENGPF+I +
Sbjct  104   LGHHAGYYRLPHSEGARLFYLFFESRINKNDPVVIWLTGGPGCSSELALFYENGPFHIQN  163

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WN+YGWDKASN++YVDQP GTGFSY+++  D   DE GVSNDLY FLQ FF  HP
Sbjct  164   NLSLTWNNYGWDKASNILYVDQPVGTGFSYTTNSSDIPHDEAGVSNDLYDFLQGFFALHP  223

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++AK++F++TGESYAGHY+PAL +R+N+GNK KEG HINLKG AIGNGLT+PGIQY AY 
Sbjct  224   EFAKNDFYITGESYAGHYVPALASRVNKGNKAKEGNHINLKGFAIGNGLTNPGIQYKAYT  283

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCN-SNGGSACSDLVNSRCQPLYDRIMEKLV  813
             D+AL   LI+K+ +D ++Q+IP C+E+V+ C+ S  G AC + + S C  ++ +IM++  
Sbjct  284   DYALQMKLITKADYDAISQIIPDCEESVKACDASKSGDACEESL-SICNSIFSQIMQRNS  342

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
              +NYYDIRK+C  GSLCYDFSN ETFLN ++V+DALGVGDI++VSCS+ VY+ M +D  +
Sbjct  343   GINYYDIRKQC-EGSLCYDFSNMETFLNKQTVRDALGVGDIEFVSCSSVVYDAMLNDWMR  401

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP+LL+DGI LLVY GEYDLICNWLGN  W  A++W GQK F AA  V F V G 
Sbjct  402   NLEVGIPALLEDGIKLLVYAGEYDLICNWLGNSNWAHAMEWSGQKAFVAAQTVPFKVAGA  461

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G+ KSYGPL FLKVH+AGH+VPMDQP+A+L+ML  WM G L
Sbjct  462   EAGLLKSYGPLAFLKVHNAGHMVPMDQPEAALQMLTNWMQGNL  504



>ref|XP_010483821.1| PREDICTED: serine carboxypeptidase-like 49 [Camelina sativa]
Length=513

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/459 (63%), Positives = 345/459 (75%), Gaps = 9/459 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEA-DTPRLVEKKLKL-NLLGDSGATVEDLGQHA  1515
             RAEK+IR+LNLFP  DLN      SP+ A +   + E+KL   N+L D G TVEDLG HA
Sbjct  42    RAEKLIRELNLFPQQDLNVIDVADSPLTAAEGSGIFERKLVFPNILADGGDTVEDLGHHA  101

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY+LP +  A MFYFFFESR  K  PVVIWLTGGPGCSS LA+FYENGPF I +N SL 
Sbjct  102   GYYKLPKSRGASMFYFFFESRKKKDAPVVIWLTGGPGCSSELAVFYENGPFKITNNMSLT  161

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN+YGWD+ SNL+YVDQP GTGFS+++ + D R DE GVSNDLY FLQ FF  HPK AK+
Sbjct  162   WNEYGWDQVSNLLYVDQPVGTGFSFTTDKSDIRHDETGVSNDLYDFLQAFFTEHPKLAKN  221

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA  +R+++GNK  EGIH+NLKG AIGNGLTDP  QYPAYPDFAL+
Sbjct  222   DFYITGESYAGHYIPAFASRVHKGNKANEGIHVNLKGFAIGNGLTDPAFQYPAYPDFALE  281

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
               LI++  HD L +++P CQ +++ C ++G ++C  S LV   C  L+  +M     +NY
Sbjct  282   MGLITQKEHDRLEKIVPLCQLSIKLCGTDGTTSCLASYLV---CNALFSGVMSHAGGVNY  338

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKCV GSLCYDFSN E FLN KSV+ +LGVGDID+VSCST+VY+ M  D  +NL  
Sbjct  339   YDIRKKCV-GSLCYDFSNMEKFLNLKSVRKSLGVGDIDFVSCSTSVYQAMLRDWMRNLEV  397

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP LL+DGINLLVY GEYDLICNWLGN RWV A+ W G+  FGAA  V F V GKE G 
Sbjct  398   GIPQLLEDGINLLVYAGEYDLICNWLGNSRWVNAMDWSGKTNFGAAEAVPFMVDGKEAGS  457

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K+Y  L+FLKV DAGH+VPMDQPKA+L ML+RWM   L
Sbjct  458   LKTYEQLSFLKVRDAGHMVPMDQPKAALAMLKRWMENSL  496



>ref|XP_002316392.2| Serine carboxypeptidase precursor family protein [Populus trichocarpa]
 gb|EEF02563.2| Serine carboxypeptidase precursor family protein [Populus trichocarpa]
Length=513

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/486 (59%), Positives = 361/486 (74%), Gaps = 33/486 (7%)
 Frame = -2

Query  1712  DNSMANSKR------RAEKMIRQLNLFPLHDLN------------RGSGHSPVEADTPRL  1587
             DN   N +R      +A KMIR+LNLFP  ++N              SGH+       R+
Sbjct  24    DNPYLNLERSNFPSVQAGKMIRELNLFPKSEVNVIGGGDDGAGAISESGHNK------RI  77

Query  1586  VEKKLKL-NLLGDS--GATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLT  1416
             VE+K +  N++GD     TV+DLG HAGYY++ ++ DARMFYFFFESR++K DPVVIWLT
Sbjct  78    VERKFRFPNVVGDEEESFTVDDLGHHAGYYKIEHSHDARMFYFFFESRTSKKDPVVIWLT  137

Query  1415  GGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFR  1236
             GGPGCSS LA+FYENGP+ IA+N SL  N+YGWDK SNL+YVDQPTGTG+SYSS   D R
Sbjct  138   GGPGCSSELAMFYENGPYTIANNLSLVRNEYGWDKVSNLVYVDQPTGTGYSYSSDRRDIR  197

Query  1235  TDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHI  1056
              +E GVSNDLY FLQ FF+ HP+ A+++F++TGESYAGHYIPA   R+++GNK KEGIH+
Sbjct  198   HNEGGVSNDLYDFLQAFFEEHPELAENDFYITGESYAGHYIPAFAARVHKGNKAKEGIHV  257

Query  1055  NLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSA  876
             NLKG AIGNGLTDP IQY AY D+ALD  +I ++ HD + +++P C+ A++ C ++G  +
Sbjct  258   NLKGFAIGNGLTDPAIQYKAYTDYALDMGIIKQAEHDRINKIVPACEVAIKLCGTDGTVS  317

Query  875   C--SDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALG  702
             C  S LV   C  ++  I+    ++NYYD+RKKC  GSLCYDFSN E FL  KSVK+ALG
Sbjct  318   CLASYLV---CNTIFSSILSVAGNINYYDVRKKC-EGSLCYDFSNMEKFLGQKSVKEALG  373

Query  701   VGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQ  522
             VGDID+VSCSTTVY  M +D  +NL  GIP+LL+DG+ LLVY GEYDLICNWLGN RWV 
Sbjct  374   VGDIDFVSCSTTVYMAMLTDWMRNLEVGIPALLEDGVKLLVYAGEYDLICNWLGNSRWVH  433

Query  521   ALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRR  342
             A++WYGQK F A+P V F V G E G+ KSYGPL FLKVH+AGH+VPMDQP+ASLEML+R
Sbjct  434   AMEWYGQKEFVASPEVPFEVSGSEAGVLKSYGPLAFLKVHNAGHMVPMDQPEASLEMLKR  493

Query  341   WMHGQL  324
             W  G+L
Sbjct  494   WTQGKL  499



>ref|NP_187652.1| serine carboxypeptidase-like 49 [Arabidopsis thaliana]
 sp|P32826.2|SCP49_ARATH RecName: Full=Serine carboxypeptidase-like 49; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51389.1|AC011560_21 putative serine carboxypeptidase precursor; 109294-111839 [Arabidopsis 
thaliana]
 gb|AAM10315.1| AT3g10410/F13M14_32 [Arabidopsis thaliana]
 gb|AAN31108.1| At3g10410/F13M14_32 [Arabidopsis thaliana]
 gb|AEE74902.1| serine carboxypeptidase-like 49 [Arabidopsis thaliana]
Length=516

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/459 (62%), Positives = 350/459 (76%), Gaps = 9/459 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEA-DTPRLVEKKLKL-NLLGDSGATVEDLGQHA  1515
             RAEK+IR+LNLFP  DLN       P+ A + P +VE+K    N+L D G TV+DLG HA
Sbjct  42    RAEKLIRELNLFPQQDLNVIDVADLPLTAAEGPGIVERKFVFPNILADGGPTVDDLGHHA  101

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY+LP +  A MFYFFFESR+ K  PVVIWLTGGPGCSS LA+FYENGPF I  N SL 
Sbjct  102   GYYKLPKSRGASMFYFFFESRNKKDAPVVIWLTGGPGCSSELAVFYENGPFKITSNMSLA  161

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN+YGWD+ SNL+YVDQP GTGFSY++ + D R DE GVSNDLY FLQ FF  HPK AK+
Sbjct  162   WNEYGWDQVSNLLYVDQPVGTGFSYTTDKSDIRHDETGVSNDLYDFLQAFFAEHPKLAKN  221

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA  +R+++GNK  EG+HINLKG AIGNGLTDP +QYPAYPD+AL+
Sbjct  222   DFYITGESYAGHYIPAFASRVHKGNKANEGVHINLKGFAIGNGLTDPALQYPAYPDYALE  281

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
               LI++  HD L +++P C+ +++ C ++G ++C  S LV   C  L+  +M     +NY
Sbjct  282   MGLITQKEHDRLEKIVPLCELSIKLCGTDGTTSCLASYLV---CNSLFSGVMSHAGGVNY  338

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKCV GSLCYDFSN E FLN +SV+ +LGVGDID+VSCST+VY+ M  D  +NL  
Sbjct  339   YDIRKKCV-GSLCYDFSNMEKFLNLQSVRKSLGVGDIDFVSCSTSVYQAMLVDWMRNLEV  397

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGI+LLVY GEYDLICNWLGN RWV A++W G+  FGAA  V F V GKE G+
Sbjct  398   GIPTLLEDGISLLVYAGEYDLICNWLGNSRWVNAMEWSGKTNFGAAKEVPFIVDGKEAGL  457

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K+Y  L+FLKV DAGH+VPMDQPKA+L+ML+RWM   L
Sbjct  458   LKTYEQLSFLKVRDAGHMVPMDQPKAALKMLKRWMENSL  496



>gb|AAB04606.1| carboxypeptidase Y-like protein [Arabidopsis thaliana]
 prf||1908426A carboxypeptidase Y
Length=539

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/459 (62%), Positives = 350/459 (76%), Gaps = 9/459 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEA-DTPRLVEKKLKL-NLLGDSGATVEDLGQHA  1515
             RAEK+IR+LNLFP  DLN       P+ A + P +VE+K    N+L D G TV+DLG HA
Sbjct  42    RAEKLIRELNLFPQQDLNVIDVADLPLTAAEGPGIVERKFVFPNILADGGPTVDDLGHHA  101

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY+LP +  A MFYFFFESR+ K  PVVIWLTGGPGCSS LA+FYENGPF I  N SL 
Sbjct  102   GYYKLPKSRGASMFYFFFESRNKKDAPVVIWLTGGPGCSSELAVFYENGPFKITSNMSLA  161

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN+YGWD+ SNL+YVDQP GTGFSY++ + D R DE GVSNDLY FLQ FF  HPK AK+
Sbjct  162   WNEYGWDQVSNLLYVDQPVGTGFSYTTDKSDIRHDETGVSNDLYDFLQAFFAEHPKLAKN  221

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA  +R+++GNK  EG+HINLKG AIGNGLTDP +QYPAYPD+AL+
Sbjct  222   DFYITGESYAGHYIPAFASRVHKGNKANEGVHINLKGFAIGNGLTDPALQYPAYPDYALE  281

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
               LI++  HD L +++P C+ +++ C ++G ++C  S LV   C  L+  +M     +NY
Sbjct  282   MGLITQKEHDRLEKIVPLCELSIKLCGTDGTTSCLASYLV---CNSLFSGVMSHAGGVNY  338

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKCV GSLCYDFSN E FLN +SV+ +LGVGDID+VSCST+VY+ M  D  +NL  
Sbjct  339   YDIRKKCV-GSLCYDFSNMEKFLNLQSVRKSLGVGDIDFVSCSTSVYQAMLVDWMRNLEV  397

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGI+LLVY GEYDLICNWLGN RWV A++W G+  FGAA  V F V GKE G+
Sbjct  398   GIPTLLEDGISLLVYAGEYDLICNWLGNSRWVNAMEWSGKTNFGAAKEVPFIVDGKEAGL  457

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K+Y  L+FLKV DAGH+VPMDQPKA+L+ML+RWM   L
Sbjct  458   LKTYEQLSFLKVRDAGHMVPMDQPKAALKMLKRWMENSL  496



>ref|XP_004307353.1| PREDICTED: serine carboxypeptidase-like 49-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/460 (62%), Positives = 348/460 (76%), Gaps = 11/460 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN---RGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQH  1518
              A+++IR LNLFP  D N        SP+ A   R+VEK+  L N++G+SG +V+DLG H
Sbjct  41    HAQQLIRALNLFPESDANIITDAGDSSPIGAGK-RIVEKRFTLPNVVGESGVSVDDLGHH  99

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGY+++ ++  ARMFY FFESR+NK DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL
Sbjct  100   AGYFKIEHSHAARMFYLFFESRTNKEDPVVIWLTGGPGCSSELAVFYENGPFSIANNLSL  159

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN YGWDKASNL+YVDQP GTGFSYSS   D R  EDGVSNDLY FLQ FF  HP+ AK
Sbjct  160   VWNQYGWDKASNLLYVDQPIGTGFSYSSDRRDIRHSEDGVSNDLYDFLQAFFAEHPELAK  219

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA   R++QGNK KEGIHINLKG AIGNGLTDP IQY AY D+AL
Sbjct  220   NDFYITGESYAGHYIPAFAARVHQGNKAKEGIHINLKGFAIGNGLTDPAIQYKAYTDYAL  279

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLN  804
             DN +ISKS +D + +++P C+ A++ C ++G  +C  S  V   C  ++  I+ +  ++N
Sbjct  280   DNGVISKSDYDRINKVLPVCEMAIKLCGTDGTVSCMASYFV---CNTIFSSIIARAGNVN  336

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYDIRK+C  GSLCYDFSN E FL   SVK ALGVGDID+VSCS TVY+ M  D  +NL 
Sbjct  337   YYDIRKQC-EGSLCYDFSNMEKFLKQNSVKQALGVGDIDFVSCSPTVYQAMLVDWMRNLE  395

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQ  F  +P + F V   E G
Sbjct  396   VGIPTLLEDGIQLLVYAGEYDLICNWLGNSRWVHAMEWSGQNKFVNSPEIPFVVDDSEAG  455

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K+YGPL+FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  456   VLKNYGPLSFLKVHDAGHMVPMDQPKAALEMLKRWTQGSL  495



>ref|XP_006407571.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
 gb|ESQ49024.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
Length=523

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/459 (61%), Positives = 350/459 (76%), Gaps = 9/459 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN--RGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQHA  1515
             RAEK+IR+LNLFP  D+N   G   +   A+ P +VE+  +  N++ D GATVEDLG HA
Sbjct  43    RAEKLIRELNLFPKLDVNVIDGGDSTLTSAEVPSIVERNFRFPNIISDGGATVEDLGHHA  102

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY+LP +  ARMFYFFFESR+ K  PVVIWLTGGPGCSS LA+FYENGPF IA N SL 
Sbjct  103   GYYKLPKSQGARMFYFFFESRNKKDAPVVIWLTGGPGCSSELAMFYENGPFKIAQNMSLA  162

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN+YGWD+ASNL+YVDQP GTGFSY++ + D R DE+GVS+DLY FLQ FF  HPK A +
Sbjct  163   WNEYGWDQASNLLYVDQPVGTGFSYTTDKSDIRHDENGVSDDLYDFLQAFFAEHPKLANN  222

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA   R+N+GNK  EG+H+NLKG AIGNGLT+P IQYPAYPD+AL+
Sbjct  223   DFYITGESYAGHYIPAFAARVNKGNKANEGVHVNLKGFAIGNGLTNPAIQYPAYPDYALE  282

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
               LI+++ HD L +++P C+ +++ C ++G  +C  S LV   C  L+  ++     +NY
Sbjct  283   MGLITQAEHDRLEKIVPLCELSIKLCGTDGTVSCLASYLV---CNTLFSGVINHAGGVNY  339

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKC  GS+CYDFSN E FLN KSV+ +LGVGDI++VSCST+VY  M  D  +NL  
Sbjct  340   YDIRKKC-EGSMCYDFSNMEKFLNLKSVRKSLGVGDIEFVSCSTSVYTAMLQDWMRNLEV  398

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGINLLVY GEYDLICNWLGN RWV A++W G++ F A+  V F V GKE G+
Sbjct  399   GIPTLLEDGINLLVYAGEYDLICNWLGNSRWVNAMEWSGKESFKASKEVPFVVDGKEAGL  458

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              KS G L+FLKVHDAGH+VPMDQPKA+L+ML  WM   L
Sbjct  459   LKSNGQLSFLKVHDAGHMVPMDQPKAALKMLMGWMKNSL  497



>ref|XP_011031665.1| PREDICTED: serine carboxypeptidase-like [Populus euphratica]
Length=513

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/465 (62%), Positives = 354/465 (76%), Gaps = 15/465 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN---RGSGHSPV---EADTPRLVEKKLKL-NLLGDS--GATVE  1533
             +AEK+IR+LNLFP  ++N   RG   + V        R+VE+K +  N++GD     TV+
Sbjct  39    QAEKLIRELNLFPNSEVNVIDRGDDGASVINQAGYNKRIVERKFRFPNVVGDEEESFTVD  98

Query  1532  DLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIA  1353
             DLG HAGYY++ N+ DARMFYFFFESR++K DPVVIWLTGGPGCSS LA+FYENGP+ IA
Sbjct  99    DLGNHAGYYKIENSHDARMFYFFFESRTSKKDPVVIWLTGGPGCSSELAMFYENGPYTIA  158

Query  1352  DNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAH  1173
             +N SL  N YGWDK SNL+YVDQPTGTG+SYS+   D R +E+GVSNDLY FLQ FFK H
Sbjct  159   NNLSLVRNKYGWDKVSNLLYVDQPTGTGYSYSTDRRDIRHNEEGVSNDLYDFLQAFFKEH  218

Query  1172  PKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAY  993
             P+ A+++F++TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDP IQY AY
Sbjct  219   PELARNDFYITGESYAGHYIPAFAARVHRGNKAKEGIHINLKGFAIGNGLTDPAIQYKAY  278

Query  992   PDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEK  819
              D+ALD  +I ++ HD +++++P C+ A++ C ++G  +C  S LV   C  ++  I+  
Sbjct  279   TDYALDMGIIKQAEHDRISKIVPVCEMAIKLCGTDGTVSCLASYLV---CNTIFSSILSV  335

Query  818   LVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDI  639
               ++NYYDIRK C  GSLCYDFSN E FL  KSVK+ALGVGDID+VSCS TVY+ M  D 
Sbjct  336   AGNINYYDIRKNC-EGSLCYDFSNMEKFLVQKSVKEALGVGDIDFVSCSPTVYQAMLMDW  394

Query  638   FKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVG  459
              +NL  GIP+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F A+P V F V 
Sbjct  395   MRNLEVGIPALLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWPGQKEFVASPEVPFEVS  454

Query  458   GKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             G E GI KSYGPL FLKVHDAGH+VPMDQP+ASLEML+RW  G L
Sbjct  455   GSEAGILKSYGPLAFLKVHDAGHMVPMDQPEASLEMLKRWTRGAL  499



>ref|XP_003536330.1| PREDICTED: serine carboxypeptidase-like 49-like [Glycine max]
 gb|KHN37799.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=499

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/456 (62%), Positives = 353/456 (77%), Gaps = 7/456 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLL-GDSGATVEDLGQHAGY  1509
             A+K+IR LNLFP  D+N    HS   A+  ++VEK L+  NL+  DSG +++DL   AGY
Sbjct  34    AKKLIRDLNLFPSEDVNIVPRHSNSHAN--KIVEKPLRFPNLVPSDSGISLDDLAHRAGY  91

Query  1508  YRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWN  1329
             Y +P++  A+MFYFFFESR++K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL WN
Sbjct  92    YLIPHSHAAKMFYFFFESRNSKKDPVVIWLTGGPGCSSELAVFYENGPFKIANNMSLVWN  151

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEF  1149
             +YGWDK SNL+YVDQPTGTGFSYS+ + D R DE+GVSNDLY FLQ FF  HP+Y K++F
Sbjct  152   EYGWDKVSNLLYVDQPTGTGFSYSTDKRDIRHDEEGVSNDLYDFLQAFFAEHPEYVKNDF  211

Query  1148  FVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNN  969
             F+TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDPGIQY AY D+ALD  
Sbjct  212   FITGESYAGHYIPAFAARVHRGNKAKEGIHINLKGFAIGNGLTDPGIQYKAYTDYALDMG  271

Query  968   LISKSFHDELTQ-LIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
             +I K+ ++ + + ++P C+ A++ C ++G  AC+      C  +++ IM    D+NYYDI
Sbjct  272   IIQKADYERINKVMVPACEMAIKLCGTDGKIACT-ASYFVCNTIFNSIMSHAGDINYYDI  330

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKC  GSLCYDFSN E +LN KSV+DALGVGDID+VSCS+TVY+ M  D  +NL  GIP
Sbjct  331   RKKC-EGSLCYDFSNLEKYLNQKSVRDALGVGDIDFVSCSSTVYQAMLVDWMRNLEVGIP  389

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGIN+LVY GE+DLICNWLGN +WV A++W GQ+ F  +  V F+V   E G+ K 
Sbjct  390   ALLEDGINMLVYAGEFDLICNWLGNSKWVHAMEWSGQQEFVVSSEVPFTVDDSEAGLLKK  449

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             YGPL+FLKVHDAGH+VPMDQPKASLEML+RW  G L
Sbjct  450   YGPLSFLKVHDAGHMVPMDQPKASLEMLKRWTQGTL  485



>ref|XP_002311071.2| Serine carboxypeptidase precursor family protein [Populus trichocarpa]
 gb|EEE88438.2| Serine carboxypeptidase precursor family protein [Populus trichocarpa]
Length=513

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/465 (62%), Positives = 352/465 (76%), Gaps = 15/465 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN------RGSGHSPVEADTPRLVEKKLKL-NLLGDS--GATVE  1533
             +AEK+IR+LNLFP  ++N       G           R+VE+K +  N++GD     TV+
Sbjct  39    QAEKLIRELNLFPNSEVNVIDGGDDGVSFIDQAGYNKRIVERKFRFPNVVGDEEESFTVD  98

Query  1532  DLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIA  1353
             DLG HAGYY++ N+ DARMFYFFFESR++K DPVVIWLTGGPGCSS LA+FYENGP+ IA
Sbjct  99    DLGNHAGYYKIENSHDARMFYFFFESRTSKKDPVVIWLTGGPGCSSELAMFYENGPYTIA  158

Query  1352  DNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAH  1173
             +N SL  N YGWDK SNL+YVDQPTGTG+SYS+   D R +E+GVSNDLY FLQ FFK H
Sbjct  159   NNLSLVRNKYGWDKVSNLLYVDQPTGTGYSYSTDRRDIRHNEEGVSNDLYDFLQAFFKEH  218

Query  1172  PKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAY  993
             P+ AK++F++TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDP IQY AY
Sbjct  219   PELAKNDFYITGESYAGHYIPAFAARVHRGNKAKEGIHINLKGFAIGNGLTDPAIQYKAY  278

Query  992   PDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEK  819
              D+ALD  +I ++ HD +++++P C+ A++ C ++G  +C  S LV   C  +++ I+  
Sbjct  279   TDYALDMGIIKQAEHDRISKIVPVCEMAIKLCGTDGTVSCMASYLV---CSTIFNSIISV  335

Query  818   LVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDI  639
               ++NYYDIRK C  GSLCYDFSN E FL  KSVK+ALGVGDID+VSCS TVY+ M  D 
Sbjct  336   AGNINYYDIRKNC-EGSLCYDFSNMEKFLGQKSVKEALGVGDIDFVSCSPTVYQAMLMDW  394

Query  638   FKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVG  459
              +NL  GIP+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F A+P V F V 
Sbjct  395   MRNLEVGIPALLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWRGQKEFVASPEVPFEVS  454

Query  458   GKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             G E G+ KSYGPL FLKVHDAGH+VPMDQP+ASLEML+RW  G L
Sbjct  455   GSEAGVLKSYGPLAFLKVHDAGHMVPMDQPEASLEMLKRWTRGTL  499



>ref|XP_003597272.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES67523.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=511

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/497 (59%), Positives = 363/497 (73%), Gaps = 9/497 (2%)
 Frame = -2

Query  1799  FLSSQQRIMWPFllvlvlVSSPAGQANGE---DNSMANSKRRAEKMIRQLNLFPLHDLNR  1629
             FL      M  FL +    SSPA   N +    ++ +  K +AE +IR LNLFP   +N 
Sbjct  7     FLKMCLSFMMFFLFISHSYSSPAYPTNNDILLSSTASYPKLQAENLIRGLNLFPKDSIN-  65

Query  1628  GSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRS  1449
              +  +        ++EKK       DSGA+VE+LG HAGYYRLP++  ARMFYFFFESR+
Sbjct  66    -TPENDPHFLHGNIMEKKFTFPGFVDSGASVEELGHHAGYYRLPHSKAARMFYFFFESRN  124

Query  1448  NKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD--NQSLFWNDYGWDKASNLIYVDQPTG  1275
              K DPVVIWLTGGPGCSS +A+FYENGPF  +   N SL WN+YGWD ASN+I+VDQPTG
Sbjct  125   TKDDPVVIWLTGGPGCSSEIAMFYENGPFKFSKDKNLSLVWNEYGWDMASNIIFVDQPTG  184

Query  1274  TGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTR  1095
             TGFSY++ + D R DEDGVSNDLY FLQ FFK HP++ K++F++TGESYAGHYIPA  +R
Sbjct  185   TGFSYTTDDSDVRHDEDGVSNDLYDFLQAFFKEHPQFTKNDFYITGESYAGHYIPAFASR  244

Query  1094  INQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQ  915
             ++QGNK KEGIHINLKG AIGNGLT+P IQY AYPDFALDN LI+K+ H  + +L P CQ
Sbjct  245   VHQGNKAKEGIHINLKGFAIGNGLTNPEIQYKAYPDFALDNGLINKNEHANINKLFPRCQ  304

Query  914   EAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETF  735
             +A+  C + GG AC     S C  ++D+IM+   ++NYYDIRK+C  GSLCYDFSNAETF
Sbjct  305   KAIESCGTKGGDACM-TSRSICSEIFDQIMDIAGNINYYDIRKQC-EGSLCYDFSNAETF  362

Query  734   LNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLI  555
             LN KSV++ALGVGD+++VSCS+TVY  M  D  KNL  GIP+LL+DGI +LVY GE DLI
Sbjct  363   LNMKSVREALGVGDLEFVSCSSTVYSAMLQDWMKNLEVGIPALLEDGIKVLVYAGEEDLI  422

Query  554   CNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMD  375
             CNWLGN RWV A+ W GQK F  +P   + V  +E G  KS+GPL FLKV +AGH+VPMD
Sbjct  423   CNWLGNSRWVDAMTWSGQKEFKVSPTTPYLVDSEEAGDLKSHGPLAFLKVKEAGHMVPMD  482

Query  374   QPKASLEMLRRWMHGQL  324
             QPKA+L+ML+ WM G+L
Sbjct  483   QPKAALQMLKDWMQGKL  499



>ref|XP_011089190.1| PREDICTED: serine carboxypeptidase-like [Sesamum indicum]
Length=516

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/462 (63%), Positives = 350/462 (76%), Gaps = 11/462 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLG------DSGATVED  1530
             K++AEK IR+LNLFP +D+N         ADTP+++EK+++   L        +GAT+ED
Sbjct  57    KKQAEKFIRELNLFPRNDVNIVEDDP--AADTPKIIEKRIQFPYLSYSKAGNSAGATLED  114

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRS-NKSDPVVIWLTGGPGCSSSLALFYENGPFYIA  1353
              G HAGYYRLP+T  ARMFYFFFESR  N +DPVV+WLTGGPGCSSSLALFYENGPF + 
Sbjct  115   FGHHAGYYRLPHTKGARMFYFFFESRKKNINDPVVLWLTGGPGCSSSLALFYENGPFQLT  174

Query  1352  DNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAH  1173
             +N SL WND+GWDK SNLIY+DQPTGTGFSYSS   D RT  +  S D Y FLQ FF+ H
Sbjct  175   NNLSLVWNDFGWDKESNLIYIDQPTGTGFSYSSDRNDIRTSSEEASVDFYDFLQAFFEKH  234

Query  1172  PKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAY  993
             P+YAK++F++TGESYAGHYIPA  ++I+Q NK  EG+HINLKG+AIGNGLT+P IQY AY
Sbjct  235   PQYAKNDFYITGESYAGHYIPAFASQIHQRNKNNEGLHINLKGIAIGNGLTNPEIQYKAY  294

Query  992   PDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLV  813
             PD+ALD  LI KS +D L+Q +  CQ+ +R C +N  SACS      C  +++ I+    
Sbjct  295   PDYALDMKLIDKSQYDNLSQSVLTCQQEIRSCGANRSSACSRAY-WICNNVFNEILAASG  353

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
              +NYYDIRKKC  GSLCYDFSNAE FLN  SVK+ALGVGDI +VSCS+ VYE M  D  K
Sbjct  354   GINYYDIRKKC-QGSLCYDFSNAEEFLNKNSVKNALGVGDIVFVSCSSVVYEAMRGDWMK  412

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             N A GIP LLQDGI  L+Y GEYDLICNWLGN RWV  + W GQK F +AP+V F+V G 
Sbjct  413   NFAVGIPELLQDGIRSLIYAGEYDLICNWLGNSRWVDNMTWSGQKDFLSAPSVPFTVDGA  472

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             + G QKS+GPLTFLKV++AGH+VPMDQPKASLEMLRRW+ G+
Sbjct  473   KAGEQKSHGPLTFLKVYNAGHMVPMDQPKASLEMLRRWIAGK  514



>ref|XP_011024373.1| PREDICTED: serine carboxypeptidase-like [Populus euphratica]
Length=513

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/486 (59%), Positives = 360/486 (74%), Gaps = 33/486 (7%)
 Frame = -2

Query  1712  DNSMANSKR------RAEKMIRQLNLFPLHDLN------------RGSGHSPVEADTPRL  1587
             DN   N +R      +A KMIR+LNLFP  ++N              SGH+       R+
Sbjct  24    DNPYLNLERSNFPSVQAGKMIRELNLFPKSEVNVIGGGDDGAGAISESGHNK------RI  77

Query  1586  VEKKLKL-NLLGDS--GATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLT  1416
             VE+K +  +++GD     TV+DLG HAGYY++ ++ DARMFYFFFESR++K DPVVIWLT
Sbjct  78    VERKFRFPDVVGDEEESFTVDDLGHHAGYYKIEHSHDARMFYFFFESRTSKKDPVVIWLT  137

Query  1415  GGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFR  1236
             GGPGCSS LA+FYENGP+ IA+N SL  N+YGWDK SNL+YVDQPTGTG+SYSS   D R
Sbjct  138   GGPGCSSELAMFYENGPYTIANNLSLVRNEYGWDKVSNLLYVDQPTGTGYSYSSDRRDIR  197

Query  1235  TDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHI  1056
              +E GVSNDLY FLQ FF+ HP+ A+++F++TGESYAGHYIPA   R+++GNK KEGIH+
Sbjct  198   HNEGGVSNDLYDFLQAFFEEHPELAENDFYITGESYAGHYIPAFAARVHKGNKAKEGIHV  257

Query  1055  NLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSA  876
             NLKG AIGNGLTDP IQY AY D+ALD  +I +  HD + +++P C+ A++ C ++G  +
Sbjct  258   NLKGFAIGNGLTDPAIQYKAYTDYALDMGIIKQVEHDRINKIVPVCEVAIKLCGTDGTVS  317

Query  875   C--SDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALG  702
             C  S LV   C  ++  I+    ++NYYD+RKKC  GSLCYDFSN E FL  KSVK+ALG
Sbjct  318   CLASYLV---CNTIFSSILSVAGNINYYDVRKKC-EGSLCYDFSNMEKFLGQKSVKEALG  373

Query  701   VGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQ  522
             VGDID+VSCSTTVY  M +D  +NL  GIP+LL+DG+ LLVY GEYDLICNWLGN RWV 
Sbjct  374   VGDIDFVSCSTTVYMAMLTDWMRNLEVGIPALLEDGVKLLVYAGEYDLICNWLGNSRWVH  433

Query  521   ALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRR  342
             A++WYGQK F A+P V F V G E G+ KSYGPL FLKVHDAGH+VPMDQP+ASLEML+R
Sbjct  434   AMEWYGQKEFVASPEVPFEVSGSEAGVLKSYGPLAFLKVHDAGHMVPMDQPEASLEMLKR  493

Query  341   WMHGQL  324
             W  G+L
Sbjct  494   WTQGKL  499



>ref|XP_010464713.1| PREDICTED: serine carboxypeptidase-like 49 [Camelina sativa]
Length=516

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/460 (63%), Positives = 346/460 (75%), Gaps = 10/460 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEA-DTPRLVEKKLKL-NLLG-DSGATVEDLGQH  1518
             RAEK+IR+LNLFP  DLN      SP+ A +   +VE+K    N+L  D G TVEDLG H
Sbjct  42    RAEKLIRELNLFPQQDLNVIDVADSPLTAAEGSGIVERKFVFPNILAADGGDTVEDLGHH  101

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LP +  A MFYFFFESR  K  PVVIWLTGGPGCSS LA+FYENGPF I +N SL
Sbjct  102   AGYYKLPKSRGASMFYFFFESRKKKDAPVVIWLTGGPGCSSELAVFYENGPFKITNNMSL  161

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWD+ SNL+YVDQP GTGFS+++ + D R DE GVSNDLY FLQ FFK HPK AK
Sbjct  162   AWNEYGWDQVSNLLYVDQPVGTGFSFTTDKSDIRHDETGVSNDLYDFLQAFFKEHPKLAK  221

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA  +R+++GNK  EGIH+NLKG AIGNGLTDP  QYPAYPDFAL
Sbjct  222   NDFYITGESYAGHYIPAFASRVHKGNKANEGIHVNLKGFAIGNGLTDPAFQYPAYPDFAL  281

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLN  804
             +  LI++  HD L +++P C+ +++ C ++G ++C  S LV   C  L+  +M     +N
Sbjct  282   EMGLITQKEHDRLEKIVPLCELSIKLCGTDGTTSCLASYLV---CNALFSGVMSHAGGVN  338

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYDIRKKCV GSLCYDFSN E FLN KSV+ +LGVGDID+VSCST+VY+ M  D  +NL 
Sbjct  339   YYDIRKKCV-GSLCYDFSNMEKFLNLKSVRKSLGVGDIDFVSCSTSVYQAMLVDWMRNLE  397

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP LL+DGINLLVY GEYDLICNWLGN RWV A+ W G+  FGAA  V F V GKE G
Sbjct  398   VGIPELLEDGINLLVYAGEYDLICNWLGNSRWVNAMDWSGKTNFGAAQAVPFMVDGKEAG  457

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
               K+Y  L+FLKV DAGH+VPMDQPKA+L ML+RWM   L
Sbjct  458   SLKTYEQLSFLKVRDAGHMVPMDQPKAALAMLKRWMENSL  497



>emb|CDY09183.1| BnaA02g06090D [Brassica napus]
Length=504

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/458 (63%), Positives = 347/458 (76%), Gaps = 10/458 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLN-LLG----DSGATVEDLGQH  1518
             AE++IR  NL P HD+N  +  SP   D PRLVE ++    ++G      G +V++ G +
Sbjct  43    AERLIRSFNLMPEHDVNVIAKGSP---DGPRLVESQINFQEMIGMRNTSGGPSVQEFGHY  99

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY L  +  A+MFYFFFESR+N +DPVVIWL+GGPGCSSS+ALFYENGPF I+D+ SL
Sbjct  100   AGYYSLTRSKSAKMFYFFFESRTNNTDPVVIWLSGGPGCSSSVALFYENGPFTISDDLSL  159

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WND+GWDK SNLIYVDQP GTGFSY S   D R DE GVSNDLY FLQ FFK HPKYAK
Sbjct  160   SWNDFGWDKVSNLIYVDQPVGTGFSYVSDLSDLRHDETGVSNDLYDFLQAFFKEHPKYAK  219

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R++ GNK  EG+ INLKGLAIGNGLT+P IQY AY D+AL
Sbjct  220   NDFYITGESYAGHYIPALASRVHSGNKNNEGVPINLKGLAIGNGLTNPEIQYGAYGDYAL  279

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             +  LIS+S H+ L Q    CQ   +QCN NGG  C+    + C  ++D+IM K+   NYY
Sbjct  280   EMKLISESDHESLKQDYVDCQSVTKQCNLNGGEECTSAYRT-CTNIFDQIMSKIEGTNYY  338

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             D+RKKCV G LCYDFS  ETFLN ++V+ ALGVGD+ +VSCSTTVY+ M  D   NLA  
Sbjct  339   DLRKKCV-GDLCYDFSKMETFLNQENVRKALGVGDVKFVSCSTTVYDGMLEDWMVNLAVK  397

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+L++DGIN+LVY GEYDLICNWLGN RWV+ + W GQK FGAA  V F V GKE G+ 
Sbjct  398   IPALVEDGINVLVYAGEYDLICNWLGNSRWVEQMNWSGQKDFGAAKTVPFLVDGKEAGLM  457

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K++GPLTFLKVHDAGHLVPMDQPKASL+ML+ WM G+L
Sbjct  458   KNHGPLTFLKVHDAGHLVPMDQPKASLQMLQTWMQGKL  495



>ref|XP_009395427.1| PREDICTED: serine carboxypeptidase-like [Musa acuminata subsp. 
malaccensis]
Length=500

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/455 (62%), Positives = 349/455 (77%), Gaps = 4/455 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             +AE++IR LNL P          +   A   RLVEK+++   L   G +VE+LG HAGYY
Sbjct  37    QAERLIRGLNLVPKEICADAGSAAGAGAGAGRLVEKRVRFPGLSGGGPSVEELGHHAGYY  96

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP++  ARMFY FFESR NK DPVVIWLTGGPGCS  LALFYENGPF + ++ SL WND
Sbjct  97    RLPHSHAARMFYLFFESRHNKKDPVVIWLTGGPGCSGELALFYENGPFSVTEHMSLTWND  156

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDKASNL+YVDQPTGTGFSY++ + D R DE+GVSNDLY FLQEFFK HP+YA ++F+
Sbjct  157   FGWDKASNLLYVDQPTGTGFSYTTDDGDIRHDENGVSNDLYDFLQEFFKEHPEYATNDFY  216

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPAL +R++QGNK  EGI+INLKG AIGNGLTDP IQY AY D+ALD  L
Sbjct  217   ITGESYAGHYIPALASRVHQGNKAGEGIYINLKGCAIGNGLTDPAIQYKAYTDYALDTGL  276

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSR-CQPLYDRIMEKLVDLNYYDIR  789
             I K  ++ + ++ P C+ A++ C ++G ++C  LV+   C  +++ IM+ +   NYYDIR
Sbjct  277   IQKHDYERINKIYPACELAIKLCGTSGNTSC--LVSYMVCNSIFNSIMKIIGKTNYYDIR  334

Query  788   KKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPS  609
             K+C  G LCYDFSN E FLN +SV+DALGVGDID+VSCS TV E M  D  +NL  GIP+
Sbjct  335   KQCE-GKLCYDFSNMEKFLNQQSVRDALGVGDIDFVSCSPTVSEAMMKDWMRNLEVGIPA  393

Query  608   LLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSY  429
             LL+DGI LLVY GEYDLICNWLGN RWV +++W GQ+ F ++P V F V G E G+ KS+
Sbjct  394   LLEDGIKLLVYAGEYDLICNWLGNSRWVHSMEWSGQQDFVSSPEVPFLVDGAESGVLKSH  453

Query  428   GPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             GPL+FLKVHDAGH+VPMDQPKA+LEMLR+W HG+L
Sbjct  454   GPLSFLKVHDAGHMVPMDQPKAALEMLRKWTHGEL  488



>ref|XP_003535900.1| PREDICTED: serine carboxypeptidase-like 49-like isoformX1 [Glycine 
max]
 gb|KHN45199.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=498

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/478 (62%), Positives = 357/478 (75%), Gaps = 17/478 (4%)
 Frame = -2

Query  1739  SPAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADT---PRLVEKKLK  1569
             SP+ +A+ +D ++      A+K+IR LNLFP  D+N      PV   T    R+VEK+L+
Sbjct  18    SPSIRASDDDVAL-----HAKKLIRDLNLFPDADVNI----VPVANCTLQPRRIVEKRLR  68

Query  1568  LN--LLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSS  1395
                 L  DS  +VEDLG HAGYY + ++  ARMFYFFFESR+ K DPVVIWLTGGPGCSS
Sbjct  69    FPKLLASDSEPSVEDLGHHAGYYPIQHSHAARMFYFFFESRNRKEDPVVIWLTGGPGCSS  128

Query  1394  SLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVS  1215
              LALFYENGPF IADN SL WN+YGWDKASNL+YVDQPTGTGFSYSS   D R +E+GVS
Sbjct  129   ELALFYENGPFKIADNLSLVWNEYGWDKASNLLYVDQPTGTGFSYSSDLRDIRHNEEGVS  188

Query  1214  NDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAI  1035
             NDLY F+Q FF  HP+YAK++FF+TGESYAGHYIPA  TRI++GNK KEGIHINLKGLAI
Sbjct  189   NDLYDFIQAFFVEHPQYAKNDFFITGESYAGHYIPAFATRIHRGNKAKEGIHINLKGLAI  248

Query  1034  GNGLTDPGIQYPAYPDFALDNNLISKSFHDELT-QLIPGCQEAVRQCNSNGGSACSDLVN  858
             GNGLT+P IQY AYPD+AL+  +I K+  + L   L+P C+ A++ C +NG ++C     
Sbjct  249   GNGLTNPAIQYKAYPDYALEMGIIKKATRNLLNLVLVPACESAIKLCGTNGKTSCM-AAY  307

Query  857   SRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVS  678
               C  ++  IM    D NYYDIRKKC  GSLCYDFSN + FLN +SV+D+LGVG I +VS
Sbjct  308   VVCNVIFSDIMLHAGDTNYYDIRKKC-EGSLCYDFSNMDKFLNQQSVRDSLGVGKIHFVS  366

Query  677   CSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQK  498
             CST VY  M  D  +NL  GIP LL+DGINLLVY GEYDLICNWLGN RWV A++W GQK
Sbjct  367   CSTEVYAAMLVDWMRNLEVGIPDLLEDGINLLVYAGEYDLICNWLGNSRWVHAMEWSGQK  426

Query  497   GFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              F  +  V F V G E G+ KSYGPL+FLKVH+AGH+VPMDQPKA+LEML++W++G L
Sbjct  427   EFATSLEVPFVVDGSEAGLLKSYGPLSFLKVHNAGHMVPMDQPKAALEMLKKWINGTL  484



>ref|XP_004163685.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
48-like [Cucumis sativus]
Length=502

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/463 (61%), Positives = 352/463 (76%), Gaps = 20/463 (4%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPR-----LVEKKLKLNLLG--DSGATVEDL  1527
             +AEK+IR LNLFP   +N       + A+ P      +VEK  +   +     G +V+DL
Sbjct  39    QAEKLIRDLNLFPKDSIN-------IAAEEPSFSSSGIVEKSFQFPFIKKKSQGPSVQDL  91

Query  1526  GQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADN  1347
             G HAGYY LP+T  ARMFY FFESR++K DPVVIWLTGGPGCSS LA+FYENGPF IA+N
Sbjct  92    GHHAGYYPLPHTKSARMFYLFFESRNSKKDPVVIWLTGGPGCSSELAMFYENGPFQIANN  151

Query  1346  QSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPK  1167
              SL WN+YGWDKASNLIYVDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  H +
Sbjct  152   LSLVWNEYGWDKASNLIYVDQPTGTGFSYTSDDDDIRHDEEGVSNDLYDFLQAFFTEHKE  211

Query  1166  YAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPD  987
             +A ++F++TGESYAGHYIPA  +R++QGNK+K+GIHINLKG AIGNGLT+P IQY AY D
Sbjct  212   FAANDFYITGESYAGHYIPAFASRVHQGNKEKQGIHINLKGFAIGNGLTNPEIQYKAYTD  271

Query  986   FALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSR--CQPLYDRIMEKLV  813
             +AL+  LI KS  D + +L+PGC++A++ C +NGGSAC   V S   C  +++RIM  + 
Sbjct  272   YALEMGLIEKSDFDSINKLVPGCEKAIKTCGANGGSAC---VTSYVICNQIFNRIMGIVG  328

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
             D NYYD+RK+C+ GSLCYDFSN E FLN KSV+ ALGVG++D+VSCS+ VY  M  D  +
Sbjct  329   DKNYYDVRKECI-GSLCYDFSNMEKFLNQKSVRSALGVGNMDFVSCSSKVYSAMLMDWMR  387

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP+L+ DGI +LVY GEYDLICNWLGN RWV  + W GQK F A+  V F V GK
Sbjct  388   NLEVGIPALIDDGIKVLVYAGEYDLICNWLGNSRWVHEMNWSGQKAFAASQIVPFLVDGK  447

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G+ K++GPL F+KVH+AGH+VPMDQPKASL+ML+ WM G+L
Sbjct  448   EAGLLKTHGPLAFIKVHNAGHMVPMDQPKASLQMLQSWMQGKL  490



>ref|XP_004147293.1| PREDICTED: serine carboxypeptidase-like 48-like [Cucumis sativus]
Length=503

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/464 (61%), Positives = 352/464 (76%), Gaps = 21/464 (5%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPR-----LVEKKLKLNLL---GDSGATVED  1530
             +AEK+IR LNLFP   +N       + A+ P      +VEK  +   +      G +V+D
Sbjct  39    QAEKLIRDLNLFPKDSIN-------IAAEEPSFSSSGIVEKSFQFPFIERKKSQGPSVQD  91

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYY LP+T  ARMFY FFESR++K DPVVIWLTGGPGCSS LA+FYENGPF IA+
Sbjct  92    LGHHAGYYPLPHTKSARMFYLFFESRNSKKDPVVIWLTGGPGCSSELAMFYENGPFQIAN  151

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WN+YGWDKASNLIYVDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  H 
Sbjct  152   NLSLVWNEYGWDKASNLIYVDQPTGTGFSYTSDDDDIRHDEEGVSNDLYDFLQAFFTEHK  211

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++A ++F++TGESYAGHYIPA  +R++QGNK+K+GIHINLKG AIGNGLT+P IQY AY 
Sbjct  212   EFAANDFYITGESYAGHYIPAFASRVHQGNKEKQGIHINLKGFAIGNGLTNPEIQYKAYT  271

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSR--CQPLYDRIMEKL  816
             D+AL+  LI KS  D + +L+PGC++A++ C +NGGSAC   V S   C  +++RIM  +
Sbjct  272   DYALEMGLIEKSDFDSINKLVPGCEKAIKTCGANGGSAC---VTSYVICNQIFNRIMGIV  328

Query  815   VDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIF  636
              D NYYD+RK+C+ GSLCYDFSN E FLN KSV+ ALGVG++D+VSCS+ VY  M  D  
Sbjct  329   GDKNYYDVRKECI-GSLCYDFSNMEKFLNQKSVRSALGVGNMDFVSCSSKVYSAMLMDWM  387

Query  635   KNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGG  456
             +NL  GIP+L+ DGI +LVY GEYDLICNWLGN RWV  + W GQK F A+  V F V G
Sbjct  388   RNLEVGIPALIDDGIKVLVYAGEYDLICNWLGNSRWVHEMNWSGQKAFAASQIVPFLVDG  447

Query  455   KEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KE G+ K++GPL F+KVH+AGH+VPMDQPKASL+ML+ WM G+L
Sbjct  448   KEAGLLKTHGPLAFIKVHNAGHMVPMDQPKASLQMLQSWMQGKL  491



>ref|XP_010486643.1| PREDICTED: serine carboxypeptidase-like 49 [Camelina sativa]
Length=516

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/460 (62%), Positives = 346/460 (75%), Gaps = 10/460 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEA-DTPRLVEKKLKL-NLLG-DSGATVEDLGQH  1518
             RAEK+IR+LNLFP  DLN      SP+ A +   +VE+K    N+L  D G TVEDLG H
Sbjct  42    RAEKLIRELNLFPQQDLNVIDVADSPLTAAEGSGIVERKFVFPNILAADGGDTVEDLGHH  101

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LP +  A MFYFFFESR  K  PVVIWLTGGPGCSS LA+FYENGPF I +N SL
Sbjct  102   AGYYKLPKSRGASMFYFFFESRKKKDAPVVIWLTGGPGCSSELAVFYENGPFKITNNMSL  161

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWD+ SNL+YVDQP GTGFS+++ + D R DE GVSNDLY FLQ FFK HPK AK
Sbjct  162   AWNEYGWDQVSNLLYVDQPVGTGFSFTTDKSDIRHDETGVSNDLYDFLQAFFKEHPKLAK  221

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA  +R+++GNK  EGIH+NLKG AIGNGLTDP  QYPAYPDFAL
Sbjct  222   NDFYITGESYAGHYIPAFASRVHKGNKANEGIHVNLKGFAIGNGLTDPAFQYPAYPDFAL  281

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLN  804
             +  LI++  HD L +++P C+ +++ C ++G ++C  S LV   C  L+  ++     +N
Sbjct  282   EMGLITQKEHDRLEKIVPLCELSIKLCGTDGTTSCLASYLV---CNALFSGVLSHAGGVN  338

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYDIRKKCV GSLCYDFSN E FLN KSV+ +LGVGDID+VSCST+VY+ M  D  +NL 
Sbjct  339   YYDIRKKCV-GSLCYDFSNMEKFLNLKSVRKSLGVGDIDFVSCSTSVYQAMLVDWMRNLE  397

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP LL+DGINLLVY GEYDLICNWLGN RWV A+ W G+  FGAA  V F V GKE G
Sbjct  398   VGIPELLEDGINLLVYAGEYDLICNWLGNSRWVNAMDWSGKTNFGAAEAVPFMVDGKEAG  457

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
               K+Y  L+FLKV DAGH+VPMDQPKA+L ML+RWM   L
Sbjct  458   SLKTYEQLSFLKVRDAGHMVPMDQPKAALAMLKRWMENSL  497



>ref|XP_006290935.1| hypothetical protein CARUB_v10017048mg [Capsella rubella]
 gb|EOA23833.1| hypothetical protein CARUB_v10017048mg [Capsella rubella]
Length=510

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/460 (61%), Positives = 355/460 (77%), Gaps = 12/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKL----KLNLLGDSGA-TVEDLGQH  1518
             AE++I+  NL P  D+N     S   ++ PRLVE++     +++  G  G+ +V++ G H
Sbjct  46    AERLIKGFNLLPTRDVNVIDVDS---SEAPRLVEREFDFSAEVDRRGSGGSPSVQEFGHH  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LPN+  ARMFYFFFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL
Sbjct  103   AGYYKLPNSKAARMFYFFFESRTNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN++GWDKASNLIYVDQP GTGFSY+S + D R DEDGVSNDLY FLQ FFK HP++ K
Sbjct  163   SWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEDGVSNDLYDFLQAFFKEHPQFVK  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGS--ACSDLVNSRCQPLYDRIMEKLVDLN  804
             D  LI++S HD L +    CQ+++++C+++GG   AC+      C  ++ +IM+   ++N
Sbjct  283   DMKLITQSDHDSLNRNYATCQQSIKECSADGGEGDACASSY-VVCNNIFQKIMDIAGNVN  341

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  GSLCYDFSN ETFLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL 
Sbjct  342   YYDVRKQC-EGSLCYDFSNMETFLNQKSVRKALGVGDIEFVSCSTAVYDAMQMDWMRNLE  400

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LLQDGI LLVY GEYDLICNWLGN +WV  ++W GQK F AAP V F V  KE G
Sbjct  401   VGIPALLQDGIKLLVYAGEYDLICNWLGNSKWVHQMEWSGQKEFVAAPTVPFLVDDKEAG  460

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
               K++G LTFLKVHDAGH+VPMDQPKA+L ML+ WM G+L
Sbjct  461   QMKNHGSLTFLKVHDAGHMVPMDQPKAALHMLQNWMQGKL  500



>gb|KFK38420.1| hypothetical protein AALP_AA3G110900 [Arabis alpina]
Length=510

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 347/460 (75%), Gaps = 10/460 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR---GSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQH  1518
             RAEK+IR+LNLFP  D+N    G   +   +D P +VE+     N+L D  ATVEDLG H
Sbjct  38    RAEKLIRELNLFPKLDVNVIDVGDDLTLTASDEPSIVERNFVFPNILSDGEATVEDLGHH  97

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LP +  ARMFYFFFESR  K DP+VIWLTGGPGCSS LA+FYENGPF I  N SL
Sbjct  98    AGYYKLPKSQGARMFYFFFESRHKKDDPLVIWLTGGPGCSSELAMFYENGPFKIDKNMSL  157

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWD+ASNL+YVDQP GTGFSY++ + D R DE GVS+DLY FLQ FF  HPK AK
Sbjct  158   TWNEYGWDQASNLLYVDQPVGTGFSYTTDKSDIRHDETGVSDDLYDFLQAFFAEHPKLAK  217

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA  +R+++GNK  EG+H+NLKG AIGNGLTDP IQYPAYPD+AL
Sbjct  218   NDFYITGESYAGHYIPAFASRVHRGNKANEGVHVNLKGFAIGNGLTDPLIQYPAYPDYAL  277

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLN  804
             +  LI+++ HD L +++P C+ +++ C ++G  +C  S L+   C  L+  ++     +N
Sbjct  278   EMGLITQAEHDRLEKIVPACKLSIKLCGTDGTVSCLASYLI---CNTLFSGVINHAGGVN  334

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYDIRKKC  GSLCYDFSN E FLN +SV+ +LGVGDI +VSCST+VY  M  D  +NL 
Sbjct  335   YYDIRKKC-EGSLCYDFSNMEKFLNLQSVRKSLGVGDIQFVSCSTSVYSAMLQDWMRNLE  393

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGINLLVY GEYDLICNWLGN RWV+A++W G+  F  A  V F V GKE G
Sbjct  394   VGIPALLEDGINLLVYAGEYDLICNWLGNSRWVKAMEWSGKDNFAEAQEVPFLVDGKEAG  453

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
               KSYG L+FLKV DAGH+VPMDQPKA+L+ML+RWM   L
Sbjct  454   SLKSYGKLSFLKVKDAGHMVPMDQPKAALKMLKRWMENSL  493



>ref|XP_011094551.1| PREDICTED: serine carboxypeptidase-like [Sesamum indicum]
Length=592

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/456 (62%), Positives = 351/456 (77%), Gaps = 8/456 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQHAGYY  1506
             AE++IR LNLFP   +N          DTP++VE++ K  NL+  SG + EDLG HAGYY
Sbjct  39    AERLIRDLNLFPKQSINIVDDDVRF-LDTPKIVERRFKFPNLVDPSGVSAEDLGHHAGYY  97

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             ++ ++  ARMFYFFFESR++  DPVVIWLTGGPGCSS +ALFYENGPF IA+N SL  N+
Sbjct  98    QIQHSHGARMFYFFFESRNSSKDPVVIWLTGGPGCSSEMALFYENGPFTIANNLSLVPNE  157

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             YGWD+ SN++YVDQP GTGFSYSS   D R +E GVS+DLY FLQ FFK HP+ AK++FF
Sbjct  158   YGWDQVSNILYVDQPVGTGFSYSSDRRDIRHNEKGVSDDLYDFLQAFFKEHPELAKNDFF  217

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA   R+++GNK+KEGIH+NLKG AIGNGLTDP IQY AY D+ALD  L
Sbjct  218   ITGESYAGHYIPAFAARVHRGNKEKEGIHVNLKGFAIGNGLTDPAIQYGAYADYALDMGL  277

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDI  792
             I +S HD + +++P C+ A++ C ++G  +C  + LV   C  +++ I+ +  D+NYYDI
Sbjct  278   IKQSEHDRINKVLPLCEAAIKLCGTDGTVSCVAAYLV---CNTIFNSIIARAGDVNYYDI  334

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKCV GSLCYDFSN E +LN KSV+DALGVG+I++VSCS TVY+ M  D  +NL  GIP
Sbjct  335   RKKCV-GSLCYDFSNLEKYLNQKSVRDALGVGNIEFVSCSPTVYQAMLVDWMRNLEVGIP  393

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI LLVY GEYDLICNWLGN RWV A++W GQK F ++P V F V G E G+  S
Sbjct  394   ALLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFISSPEVPFEVDGSEAGLLTS  453

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPL FLKVHDAGH+VPMDQPKASLEML+RWM G L
Sbjct  454   HGPLNFLKVHDAGHMVPMDQPKASLEMLKRWMKGSL  489



>ref|XP_010103537.1| Serine carboxypeptidase-like 49 [Morus notabilis]
 gb|EXB96197.1| Serine carboxypeptidase-like 49 [Morus notabilis]
Length=511

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/461 (61%), Positives = 351/461 (76%), Gaps = 11/461 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN----RGSGHSPVEAD-TPRLVEKKLKLNLLGDSGATVEDLGQ  1521
             +A+ +IR LNLFP HD+N      +G S   AD   RLVEK+  +  L DSG +VEDLG 
Sbjct  41    QAQSLIRALNLFPDHDVNLIDGADAGDSLSSADPNKRLVEKRFTMPNLADSGVSVEDLGH  100

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY++ ++  A+MFY FFESR +K DPVVIWLTGGPGCSS LA+FYENGPF IADN S
Sbjct  101   HAGYYKIEHSYAAKMFYLFFESRGSKKDPVVIWLTGGPGCSSELAVFYENGPFSIADNLS  160

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WN YGWD+ASNL+YVDQPTGTGFSYSS + D R +E GVSNDLY FLQ FF  HP  A
Sbjct  161   LVWNQYGWDQASNLLYVDQPTGTGFSYSSDKRDIRHNEYGVSNDLYDFLQAFFAEHPNLA  220

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDP IQY AY D+A
Sbjct  221   KNDFYITGESYAGHYIPAFAARVHRGNKAKEGIHINLKGFAIGNGLTDPAIQYKAYTDYA  280

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDL  807
             LD  +I+K+ ++ + +++  C+ A++ C ++G  +C  S  V   C  ++  I+ +  ++
Sbjct  281   LDMGIITKTDYERINKVVGPCEVAIKLCGTDGTVSCMASYFV---CNIIFSSIIARAGNI  337

Query  806   NYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNL  627
             NYYDIRK+CV GSLCYDFSN E FLN KSV+ +LGVGDI++VSCS TVY+ M  D  +NL
Sbjct  338   NYYDIRKQCV-GSLCYDFSNLEKFLNQKSVRASLGVGDIEFVSCSHTVYQAMLLDWMRNL  396

Query  626   APGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEK  447
               GIP+LL+DG+ LLVY GEYDLICNWLGN RWV A++W GQK F A+P V F V   E 
Sbjct  397   EVGIPTLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFVASPEVPFLVDDSEA  456

Query  446   GIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             G+ KS+GPL+FLKVH+AGH+VPMDQPKA+LEML+RW  G L
Sbjct  457   GVLKSHGPLSFLKVHNAGHMVPMDQPKAALEMLKRWTQGTL  497



>ref|XP_010243256.1| PREDICTED: serine carboxypeptidase-like [Nelumbo nucifera]
Length=498

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/456 (62%), Positives = 344/456 (75%), Gaps = 10/456 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             +AEK+IR LNLFP  D     G S V    P+LVE++     L D   +++DLG HAGYY
Sbjct  40    QAEKLIRDLNLFP-KDAVDVVGDSSV---APKLVERRFSFPNLADPSVSLDDLGHHAGYY  95

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RL ++  ARMFY  FESR++K DPVVIWLTGGPGCSS LA+FYENGPF IA N SL WN+
Sbjct  96    RLQHSHAARMFYLLFESRNSKKDPVVIWLTGGPGCSSELAVFYENGPFTIAKNLSLVWNE  155

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             YGWDK SNL+YVDQPTGTGFSYSS   D R +E+GVSNDLY F+Q FF  HP++ K++F+
Sbjct  156   YGWDKTSNLLYVDQPTGTGFSYSSDRRDLRHNEEGVSNDLYDFMQAFFSEHPEFVKNDFY  215

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGNK KEGIHINLKG AIGNGLTDP IQY AY D+AL+  +
Sbjct  216   ITGESYAGHYIPAFASRVHQGNKAKEGIHINLKGFAIGNGLTDPAIQYQAYTDYALEMGI  275

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDI  792
             I ++ +  + +++P C+ A++ C +NG  +C  S LV   C  ++ +IM    D NYYDI
Sbjct  276   IKEADYKNINKMLPACELAIKLCGTNGKISCMASYLV---CNTIFSKIMGLAGDTNYYDI  332

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKC  GSLCYDFSN E FLN KSV+D+LGVGDI++VSCS TVY+ M  D  +NL  GIP
Sbjct  333   RKKC-EGSLCYDFSNMEKFLNQKSVRDSLGVGDIEFVSCSPTVYQAMLMDWMRNLEVGIP  391

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DG+ LLVY GEYDLICNWLGN RWV A++W GQK F A+P V F V G E G  KS
Sbjct  392   ALLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKAFVASPTVPFLVNGTEAGQLKS  451

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             YGPL+FLKVHDAGH+VPMDQPKA+L ML+RWM   L
Sbjct  452   YGPLSFLKVHDAGHMVPMDQPKAALVMLKRWMQDNL  487



>ref|XP_002273251.1| PREDICTED: serine carboxypeptidase-like isoform X1 [Vitis vinifera]
 emb|CBI17152.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/462 (60%), Positives = 345/462 (75%), Gaps = 6/462 (1%)
 Frame = -2

Query  1706  SMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLL-GDSGATVED  1530
             ++   K  AE++IR LNL P   +N G  H  V    PR+VEK L    L G SG++V+D
Sbjct  35    TLNTPKTEAERLIRSLNLSPKKAVNMGFDHGEV---APRMVEKSLNFPFLEGSSGSSVQD  91

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG  AGY++L +TVDARMFYFFFESR +K DPVVIWLTGGPGCS  LALFYENGPF+I D
Sbjct  92    LGHRAGYFKLAHTVDARMFYFFFESRGSKKDPVVIWLTGGPGCSGQLALFYENGPFHITD  151

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N +L WNDYGWD+ASN+++VDQPTGTGFSYSSSE D R  E+GVSNDLY F+Q FFK HP
Sbjct  152   NLTLTWNDYGWDQASNILFVDQPTGTGFSYSSSESDIRHSEEGVSNDLYDFMQAFFKKHP  211

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++ +++FF+TGESYAGHYIPA   R+ +GNK KEG+HINLKG AIGNGLTDP IQY AY 
Sbjct  212   EFVRNDFFITGESYAGHYIPAFAARVQKGNKAKEGVHINLKGFAIGNGLTDPAIQYKAYT  271

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVD  810
             D+AL   +I KS +D + +LIP C+E+ + C   GG AC D     C  ++  I+    +
Sbjct  272   DYALTMKIIGKSDYDSINELIPDCEESAKSCGPAGGVAC-DTAYYSCNQIFQSIINVAGN  330

Query  809   LNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKN  630
             +NYYDIRK+C  GSLCYDFSN E F+  KSVK+A+GVGD+++VSCS+ VY  M  D  ++
Sbjct  331   INYYDIRKQC-EGSLCYDFSNLENFMGLKSVKEAIGVGDMEFVSCSSEVYNAMQRDWMRD  389

Query  629   LAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKE  450
             +  GIP+LL+DGI +L+Y GEYDLICNWLGN  WV A++W GQK F A+P V + V GKE
Sbjct  390   MEVGIPALLEDGIKMLIYAGEYDLICNWLGNSNWVHAMKWSGQKDFEASPTVPYLVDGKE  449

Query  449   KGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G  K +G L FLKVH+AGH+VPMDQPKA+L+ML+ W  G+L
Sbjct  450   AGQLKYHGRLAFLKVHNAGHMVPMDQPKAALQMLKTWTQGKL  491



>ref|XP_010543556.1| PREDICTED: serine carboxypeptidase-like 49 [Tarenaya hassleriana]
Length=512

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 350/460 (76%), Gaps = 7/460 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGH-SPVEA-DTPRLVEKKLKL-NLLGDSGATVEDLGQHA  1515
             RAE++IR+LNLFP  ++N   G   P+ A +  R+VE+K +  NL+ D G  V+DLG HA
Sbjct  42    RAEQLIRELNLFPKEEVNVIDGRDQPLNAMEGSRIVERKFRFPNLIHDGGVNVDDLGHHA  101

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY+LP++  ARMFYFFFESR+   DPVVIWLTGGPGCSS LA+FYENGPF I++N SL 
Sbjct  102   GYYKLPHSRGARMFYFFFESRNKTDDPVVIWLTGGPGCSSELAMFYENGPFQISNNLSLV  161

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN++GWDK SNL+YVDQP GTGFSYS+ + D R DE GVSNDLY FLQ FF  HP++  +
Sbjct  162   WNEHGWDKVSNLLYVDQPVGTGFSYSTDKRDIRHDESGVSNDLYDFLQAFFAEHPEFLAN  221

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA   R+++GNK   G HINLKG AIGNGLTDP IQYPAYPDFAL 
Sbjct  222   DFYITGESYAGHYIPAFAARVHRGNKANHGAHINLKGFAIGNGLTDPAIQYPAYPDFALQ  281

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVN-SRCQPLYDRIMEKLVDLNYY  798
               LI++S HD + +++P C+ A++ C ++G ++C  LV+   C  ++  +M     +NYY
Sbjct  282   MGLITQSQHDSINKIVPLCELAIKLCGTDGTTSC--LVSYVVCNSIFSGVMAHASGINYY  339

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKC  GSLCYDFSN E FLN + V+++LGVGDI++VSCS TVY+ M  D  +NL  G
Sbjct  340   DIRKKC-EGSLCYDFSNMEKFLNLEPVRESLGVGDIEFVSCSPTVYQAMLMDWMRNLEVG  398

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP LL+DGI LLVY GEYDLICNWLGN RWV A++W G++ FG A  V F V GKE G+ 
Sbjct  399   IPKLLEDGIKLLVYAGEYDLICNWLGNSRWVNAMEWSGKEKFGEAGEVPFVVDGKEAGLL  458

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             KSYGPL FLKV +AGH+VPMDQPKASLEML++WM G L K
Sbjct  459   KSYGPLGFLKVREAGHMVPMDQPKASLEMLKKWMDGSLSK  498



>ref|XP_008463013.1| PREDICTED: serine carboxypeptidase-like [Cucumis melo]
Length=503

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/464 (61%), Positives = 351/464 (76%), Gaps = 21/464 (5%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPR-----LVEKKLKLNLL---GDSGATVED  1530
             +AEK+IR LNLFP   +N       + A+ P      LVEK  +   +      G +V++
Sbjct  39    QAEKLIRDLNLFPKDSIN-------IAAEEPSFSSSGLVEKSFQFPFIERKKSRGPSVQE  91

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYY LP+T  ARMFY FFESR++K DPVVIWLTGGPGCSS LA+FYENGPF IA+
Sbjct  92    LGHHAGYYPLPHTKSARMFYLFFESRNSKKDPVVIWLTGGPGCSSELAMFYENGPFQIAN  151

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WN+YGWDKA+NLIYVDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  H 
Sbjct  152   NLSLVWNEYGWDKAANLIYVDQPTGTGFSYTSDDDDIRHDEEGVSNDLYDFLQAFFTEHK  211

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++A ++F++TGESYAGHYIPA  +R++QGNK+K+GIHINLKG AIGNGLT+P IQY AY 
Sbjct  212   EFAANDFYITGESYAGHYIPAFASRVHQGNKEKQGIHINLKGFAIGNGLTNPEIQYKAYT  271

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSR--CQPLYDRIMEKL  816
             D+AL+  LI KS  D + +L+PGC++A++ C +NGGSAC   V S   C  +++RIM  +
Sbjct  272   DYALEMGLIEKSDFDSINKLVPGCEKAIKTCGANGGSAC---VTSYVICNQIFNRIMGIV  328

Query  815   VDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIF  636
              D NYYD+RK C+ G+LCYDFSN E FLN KSV+ ALGVG++D+VSCS+ VY  M  D  
Sbjct  329   GDKNYYDVRKDCI-GNLCYDFSNMEKFLNQKSVRSALGVGNMDFVSCSSKVYSAMLMDWM  387

Query  635   KNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGG  456
             +NL  GIP+L+ DGI +LVY GEYDLICNWLGN RWV  + W GQK F A+  V F V G
Sbjct  388   RNLEVGIPALIDDGIKVLVYAGEYDLICNWLGNSRWVHEMNWSGQKAFAASQIVPFLVDG  447

Query  455   KEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KE G+ K++GPL FLKVH+AGH+VPMDQPKASLEML+ WM G+L
Sbjct  448   KEAGLLKTHGPLAFLKVHNAGHMVPMDQPKASLEMLQSWMQGKL  491



>ref|XP_002875707.1| hypothetical protein ARALYDRAFT_484895 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51966.1| hypothetical protein ARALYDRAFT_484895 [Arabidopsis lyrata subsp. 
lyrata]
Length=510

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 353/460 (77%), Gaps = 12/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL----NLLGDSGA-TVEDLGQH  1518
             AE++I+  NL P  D+N         ++ PRLVE++ +L    +  G  G+ +V+D G H
Sbjct  46    AERLIKGFNLMPTRDVNVIDEDG---SEAPRLVEREFELPAEVDRRGSGGSPSVQDFGHH  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LPN+  ARMFYFFFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL
Sbjct  103   AGYYKLPNSKAARMFYFFFESRTNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN++GWDKASNLIYVDQP GTGFSY+S + D R DEDGVSNDLY FLQ FFK HP++ K
Sbjct  163   SWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEDGVSNDLYDFLQAFFKEHPQFVK  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGS--ACSDLVNSRCQPLYDRIMEKLVDLN  804
             D  LI++S HD L +    CQ+++++C+++GG   AC+      C  ++ +IM+   ++N
Sbjct  283   DMKLITQSDHDNLNRNYATCQQSIKECSADGGEGDACASSY-VVCNNIFQKIMDIAGNVN  341

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  GSLCYDFSN E FLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL 
Sbjct  342   YYDVRKQC-EGSLCYDFSNMEKFLNQKSVRKALGVGDIEFVSCSTAVYDAMQMDWMRNLE  400

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LLQDGI LLVY GEYDLICNWL N +WV  ++W GQK F AA  V F V  KE G
Sbjct  401   VGIPALLQDGIKLLVYAGEYDLICNWLENSKWVHEMEWSGQKQFVAAATVPFLVDNKEAG  460

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K+YG LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   LMKNYGSLTFLKVHDAGHMVPMDQPKAALQMLQNWMQGKL  500



>ref|XP_006400808.1| hypothetical protein EUTSA_v10013297mg [Eutrema salsugineum]
 gb|ESQ42261.1| hypothetical protein EUTSA_v10013297mg [Eutrema salsugineum]
Length=508

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/465 (61%), Positives = 352/465 (76%), Gaps = 16/465 (3%)
 Frame = -2

Query  1694  SKRRAEKMIRQLNLFPLHDLN---RGSGHSPVEADTPRLVEKKLKLN---LLGDS--GAT  1539
             S + AE++I+  NL P H++N   +GS      +D PRLVE +   +   L G++  G +
Sbjct  42    SIQNAERLIKSFNLMPQHNVNLIPKGS------SDAPRLVESQFDFSASILAGNASGGPS  95

Query  1538  VEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFY  1359
             V++ G +AGYY LP++  A+MFYFFFESR+N SDPVVIWL+GGPGCSSS+ALFYENGPF 
Sbjct  96    VQEFGHYAGYYALPHSKSAKMFYFFFESRNNSSDPVVIWLSGGPGCSSSVALFYENGPFT  155

Query  1358  IADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFK  1179
             I+++ SL WND+GWDK SNLIYVDQP GTGFSY+S   D R DE GVSNDLY FLQ FFK
Sbjct  156   ISEDLSLSWNDFGWDKVSNLIYVDQPVGTGFSYTSDSNDLRQDETGVSNDLYDFLQAFFK  215

Query  1178  AHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYP  999
              HPK+AK++F++TGESYAGHYIPAL +R++ GNK  EGI INLKG+AIGNGLT+P IQY 
Sbjct  216   EHPKFAKNDFYITGESYAGHYIPALASRVHSGNKNNEGIPINLKGIAIGNGLTNPEIQYG  275

Query  998   AYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEK  819
             AY D+AL+  LIS+S H+ L Q    CQ + +QCN+NGG AC    +  C  +++ IM K
Sbjct  276   AYGDYALEMKLISQSDHESLKQDYIDCQSSTKQCNNNGGEACGSAYDV-CNTIFNLIMNK  334

Query  818   LVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDI  639
             +   NYYD+RKKCV GS CYDFS  ETFLN ++V+ ALGVGDI +VSCSTTVY  M  D 
Sbjct  335   IEGTNYYDVRKKCV-GSHCYDFSKMETFLNQENVRKALGVGDIKFVSCSTTVYNAMMEDW  393

Query  638   FKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVG  459
               NL   IP+L++DGINLLVY GEYDLICNWLGN RWV+ + W GQK FG+A  V F V 
Sbjct  394   MLNLEVKIPALVEDGINLLVYAGEYDLICNWLGNSRWVEQMNWSGQKEFGSAKTVPFLVD  453

Query  458   GKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             GKE G+ K++G LTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  454   GKEAGLMKNHGSLTFLKVHDAGHMVPMDQPKASLQMLQNWMQGKL  498



>ref|XP_004164209.1| PREDICTED: serine carboxypeptidase-like 49-like [Cucumis sativus]
 gb|KGN62187.1| hypothetical protein Csa_2G324420 [Cucumis sativus]
Length=509

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/458 (61%), Positives = 343/458 (75%), Gaps = 6/458 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN----RGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQH  1518
             +AEK+IR+LNLFP  D N         S + A   ++VE++L+  L  DSG ++E+LG H
Sbjct  40    QAEKLIRELNLFPKSDTNIIHRNIQNSSLLAAGEKKIVERRLRFPLFDDSGVSLEELGHH  99

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY++ ++  AR+FYFFFESR+ KSDPVVIWLTGGPGCSS LA+FYENGPF I  N SL
Sbjct  100   AGYYKIEHSHAARLFYFFFESRNRKSDPVVIWLTGGPGCSSELAMFYENGPFKITKNLSL  159

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWDK SNL+YVDQP GTGFSYSS  +D R DE+GVSNDLY  LQ FF  HP   +
Sbjct  160   VWNEYGWDKVSNLLYVDQPVGTGFSYSSDRQDIRHDENGVSNDLYDLLQTFFDEHPDLVE  219

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++FF+TGESYAGHYIPAL +RI+QGNK KEG HINLKG AIGNGLTDP IQY  YPD+AL
Sbjct  220   NDFFITGESYAGHYIPALASRIHQGNKAKEGTHINLKGFAIGNGLTDPAIQYKTYPDYAL  279

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             D  +I+KS H  +  L+P C+ A+  C ++G  +C       C  ++  IM    D+N+Y
Sbjct  280   DMGIITKSQHRRINLLVPPCELAIGACGTDGTLSCMTSYYV-CNAIFTSIMLHAGDMNHY  338

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKC  GSLCYDFSN E FLN +SV++ALGVGDI++VSCS TVY+ M  D  +N   G
Sbjct  339   DIRKKC-EGSLCYDFSNMEKFLNQQSVREALGVGDIEFVSCSPTVYKAMLVDWMRNSEVG  397

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGI +LVY GEYDLICNWLGN RWV A+QW G++ F A+P V F V G E G+ 
Sbjct  398   IPALLEDGIKMLVYAGEYDLICNWLGNSRWVHAMQWSGKEEFVASPKVPFLVDGSEAGLL  457

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K +GPL+FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  458   KRHGPLSFLKVHDAGHMVPMDQPKAALEMLKRWTRGTL  495



>ref|XP_009150318.1| PREDICTED: serine carboxypeptidase-like 48 [Brassica rapa]
Length=509

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/459 (61%), Positives = 350/459 (76%), Gaps = 11/459 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVE-ADTPRLVEKKLKLNLL---GDSGAT--VEDLGQ  1521
             AE++I+  NL P  D+N      P + ++ PRLVE+   L       DSG +  ++D G 
Sbjct  46    AERLIKGFNLMPTRDVNV----IPEDGSEAPRLVERNFDLPATIDRRDSGGSPSLQDFGH  101

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY+LPN+  ARMFYFFFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF +++N S
Sbjct  102   HAGYYKLPNSKAARMFYFFFESRSNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSS  161

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WND+GWDKASNLIYVDQP GTGFSY+S E D R DEDGVSNDLY FLQ FFK HP++ 
Sbjct  162   LAWNDFGWDKASNLIYVDQPVGTGFSYTSDESDLRHDEDGVSNDLYDFLQAFFKEHPQFV  221

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+A
Sbjct  222   KNDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYAAYADYA  281

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNY  801
             LD  LIS+S HD L +    CQ+++++C+++GG          C  ++ +IM    ++NY
Sbjct  282   LDMKLISQSDHDNLNRDYETCQQSIKECSADGGGEACASSYIVCNNIFQKIMNIAGNVNY  341

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YD+RK+C  GSLCYDFSN E FLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL  
Sbjct  342   YDVRKQC-KGSLCYDFSNMEKFLNQKSVRTALGVGDIEFVSCSTAVYDAMQLDWMRNLEV  400

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGI +L+Y GEYDLICNWLGN +WV  ++W G+K F AA  V F+V  +E G+
Sbjct  401   GIPALLEDGIKMLIYAGEYDLICNWLGNSKWVHEMEWSGRKEFVAAATVPFNVDNREAGL  460

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K++G LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   MKNHGSLTFLKVHDAGHMVPMDQPKAALQMLKDWMQGKL  499



>ref|XP_010503154.1| PREDICTED: serine carboxypeptidase-like 48 [Camelina sativa]
Length=510

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/460 (61%), Positives = 355/460 (77%), Gaps = 12/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKL----KLNLLGDSGA-TVEDLGQH  1518
             AE++I+  NL P HD+N         ++ PRLVE++     +++  G  G+ +V+D G H
Sbjct  46    AERLIKGFNLLPTHDVNVIDKDG---SEAPRLVEREFDFSAEVDPRGSGGSPSVQDFGHH  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LPN+  ARMFYFFFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL
Sbjct  103   AGYYKLPNSKAARMFYFFFESRTNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN++GWDKASNLIYVDQP GTGFSY+S + D R DE+GVSNDLY FLQ FFK HP++ K
Sbjct  163   TWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEEGVSNDLYDFLQAFFKEHPQFVK  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGS--ACSDLVNSRCQPLYDRIMEKLVDLN  804
             D  LI++S HD L +    CQ+++++C+++GG   AC+      C  ++ +IM+   ++N
Sbjct  283   DMKLITQSDHDSLNRNYATCQQSIKECSADGGEGDACASSY-VVCNNIFQKIMDIAGNVN  341

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  G+LCYDFSN E FLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL 
Sbjct  342   YYDVRKQC-EGNLCYDFSNMEKFLNQKSVRRALGVGDIEFVSCSTAVYDAMQMDWMRNLE  400

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LLQDGI LLVY GEYDLICNWLGN +WV  ++W GQK F AA  V F V  KE G
Sbjct  401   VGIPALLQDGIKLLVYAGEYDLICNWLGNSKWVHQMEWSGQKEFVAAATVPFLVDNKEAG  460

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K++G LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   LMKNHGSLTFLKVHDAGHMVPMDQPKAALQMLQNWMQGKL  500



>emb|CDX99171.1| BnaA06g18620D [Brassica napus]
Length=509

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/459 (61%), Positives = 350/459 (76%), Gaps = 11/459 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVE-ADTPRLVEKKLKLNLL---GDSGAT--VEDLGQ  1521
             AE++I+  NL P  D+N      P + ++ PRLVE+   L       DSG +  ++D G 
Sbjct  46    AERLIKGFNLMPTRDVNV----IPEDGSEAPRLVERNFDLPATIDRRDSGGSPSLQDFGH  101

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY+LPN+  ARMFYFFFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF +++N S
Sbjct  102   HAGYYKLPNSKAARMFYFFFESRSNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSS  161

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WND+GWDKASNLIYVDQP GTGFSY+S E D R DEDGVSNDLY FLQ FFK HP++ 
Sbjct  162   LAWNDFGWDKASNLIYVDQPVGTGFSYTSDESDLRHDEDGVSNDLYDFLQAFFKEHPQFV  221

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+A
Sbjct  222   KNDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYAAYADYA  281

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNY  801
             LD  LIS+S HD L +    CQ+++++C+++GG          C  ++ +IM    ++NY
Sbjct  282   LDMKLISQSDHDNLNRDYETCQQSIKECSADGGGEACASSYIVCNNIFQKIMNIAGNVNY  341

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YD+RK+C  GSLCYDFSN E FLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL  
Sbjct  342   YDVRKQC-KGSLCYDFSNMEKFLNQKSVRTALGVGDIEFVSCSTAVYDAMQLDWMRNLEV  400

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGI +L+Y GEYDLICNWLGN +WV  ++W G+K F AA  V F+V  +E G+
Sbjct  401   GIPALLEDGIKMLIYAGEYDLICNWLGNSKWVHEMEWSGRKEFVAAATVPFNVDNREAGL  460

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K++G LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   MKNHGSLTFLKVHDAGHMVPMDQPKAALQMLKDWMQGKL  499



>ref|XP_010918615.1| PREDICTED: serine carboxypeptidase-like [Elaeis guineensis]
Length=503

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/461 (61%), Positives = 354/461 (77%), Gaps = 8/461 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
              AE +IR LNL P  D +     +  +A   R+VE++  L  L   G +V+DLG HAGYY
Sbjct  41    HAETLIRSLNLLP-KDPSPEPVAAAADAPAKRIVERRFDLVGLS-GGVSVDDLGHHAGYY  98

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP++ DARMFY FFESR +K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL WN+
Sbjct  99    RLPHSHDARMFYLFFESRHSKKDPVVIWLTGGPGCSSELAVFYENGPFTIAENMSLAWNE  158

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWD+ASNL+YVDQPTGTGFSYS+   D R DE GVS+DLY FLQ FF  HP+YA ++F+
Sbjct  159   FGWDQASNLLYVDQPTGTGFSYSTDSRDIRHDESGVSDDLYDFLQAFFAEHPEYANNDFY  218

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGNK KEGIHINLKG AIGNGLTDP IQY AY D+ALDN +
Sbjct  219   ITGESYAGHYIPAFASRVHQGNKAKEGIHINLKGFAIGNGLTDPAIQYKAYTDYALDNGI  278

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDI  792
             I +S + ++ +  P C+ A++ C ++G  +C  S LV   C  ++  IM+   + NYYDI
Sbjct  279   IKESDYKKINKYYPACEYAIKLCGTSGTISCLASYLV---CNTIFSSIMKIAGNTNYYDI  335

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK+C  GSLCYDFSN E FLN KSV+++LGVGDI++VSCS TVY+ M +D  +NL  GIP
Sbjct  336   RKQC-EGSLCYDFSNMEKFLNLKSVRESLGVGDIEFVSCSPTVYQAMLTDWMRNLEVGIP  394

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI LLVY GEYDLICNWLGN RWV +++W GQ+ F ++P  +F+V GKE G+ KS
Sbjct  395   ALLEDGIKLLVYAGEYDLICNWLGNSRWVHSMEWSGQQNFVSSPEQSFTVDGKETGVLKS  454

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*KL*D  309
             +GPL+FLKVHDAGH+VPMDQPKA+LEMLRRW+ G L +L D
Sbjct  455   HGPLSFLKVHDAGHMVPMDQPKAALEMLRRWIQGNLLELSD  495



>ref|XP_006419082.1| hypothetical protein EUTSA_v10002473mg [Eutrema salsugineum]
 gb|ESQ37518.1| hypothetical protein EUTSA_v10002473mg [Eutrema salsugineum]
Length=542

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 351/460 (76%), Gaps = 12/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGD----SG-ATVEDLGQH  1518
             AE++I+  NL P  D+N  S      ++ PRLVE++  L    D    SG  +V+D G  
Sbjct  78    AERLIKGFNLMPQRDVNVISEDG---SEAPRLVEREFDLPAALDRRDSSGLPSVQDFGHR  134

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LPN+  ARMFYFFFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL
Sbjct  135   AGYYKLPNSKAARMFYFFFESRTNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSL  194

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WND+GWDKASNLIYVDQP GTGFSY+S E D R DEDGVSNDLY FLQ FFK HP++  
Sbjct  195   AWNDFGWDKASNLIYVDQPVGTGFSYTSDESDLRHDEDGVSNDLYDFLQAFFKEHPQFVN  254

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+AL
Sbjct  255   NDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYAL  314

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNG--GSACSDLVNSRCQPLYDRIMEKLVDLN  804
             D  LISKS HD L +    CQ+++++C+++G  G AC+      C  ++ +IM+   ++N
Sbjct  315   DMKLISKSDHDNLNRNYATCQQSIKECSADGGEGEACATSY-VVCNNIFQKIMDIAGNVN  373

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  GSLCYDFSN E FLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL 
Sbjct  374   YYDVRKQC-KGSLCYDFSNMEKFLNQKSVRKALGVGDIEFVSCSTAVYDAMQMDWMRNLE  432

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI +L+Y GEYDLICNWLGN +WV  ++W GQK F +A  V F V  KE G
Sbjct  433   VGIPTLLEDGIKMLIYAGEYDLICNWLGNSKWVHEMEWSGQKEFVSAATVPFHVDNKEAG  492

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K++G LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  493   LMKNHGSLTFLKVHDAGHMVPMDQPKAALQMLQNWMQGKL  532



>ref|XP_009135107.1| PREDICTED: serine carboxypeptidase-like 49 [Brassica rapa]
Length=519

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/463 (60%), Positives = 350/463 (76%), Gaps = 13/463 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN-----RGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLG  1524
             RAEK+IR+LNLFP  D+N       +  S  E + P +VE+  +  N++ D GATVEDLG
Sbjct  40    RAEKLIRELNLFPKLDVNVIDVTDSTLASAEEEEVPSIVERSFRFPNIVSDGGATVEDLG  99

Query  1523  QHAGYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADN  1347
              HAGY++LP +  ARMFYFFFESR+ K D PVVIWLTGGPGCSS LA+FYENGPF I  N
Sbjct  100   HHAGYFKLPKSQGARMFYFFFESRTKKKDAPVVIWLTGGPGCSSELAMFYENGPFKIDKN  159

Query  1346  QSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPK  1167
              SL WN+YGWD+ SNL+YVDQP GTGFSY++ + D R DE GVS+DLY FLQ FF  HP 
Sbjct  160   MSLAWNEYGWDQVSNLLYVDQPVGTGFSYTTDKSDIRHDETGVSDDLYDFLQAFFAEHPT  219

Query  1166  YAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPD  987
              A  +F++TGESYAGHYIPA   R+++GN+  EG+H+NLKG AIGNGLTDP IQYPAYPD
Sbjct  220   LANKDFYITGESYAGHYIPAFAARVHKGNRANEGVHVNLKGFAIGNGLTDPAIQYPAYPD  279

Query  986   FALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLV  813
             +AL+  LI+++ HD L +++P C+ +++ C ++G ++C  S LV   C  L+  +M+   
Sbjct  280   YALEMGLITQAEHDRLEKIVPLCELSIKLCGTDGTTSCLASYLV---CNTLFTGVMKHAG  336

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
              +N+YDIRKKC  GSLCYDFS+ E FLN +SV+ +LGVGDI++VSCST+VY+ M  D  +
Sbjct  337   GVNHYDIRKKC-EGSLCYDFSDMEKFLNLQSVRKSLGVGDIEFVSCSTSVYQAMLQDWMR  395

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP+LL+DGINLLVY GEYDLICNWLGN RWV A++W G++ F A+  V F V GK
Sbjct  396   NLEVGIPTLLEDGINLLVYAGEYDLICNWLGNSRWVNAMEWSGKENFKASKEVPFLVDGK  455

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G  KSYG L+FLKVHDAGH+VPMDQPKA+LEML+ WM   L
Sbjct  456   EAGKLKSYGQLSFLKVHDAGHMVPMDQPKAALEMLKGWMENSL  498



>ref|XP_008456530.1| PREDICTED: serine carboxypeptidase-like [Cucumis melo]
Length=509

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/458 (61%), Positives = 344/458 (75%), Gaps = 6/458 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN----RGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQH  1518
             +AEK+IR+LNLFP  D N         S + A   ++VE++L+  L  DSG ++E+LG  
Sbjct  40    QAEKLIRELNLFPKSDANIIHRNIENSSLIAAGAKKIVERQLRFPLFDDSGVSLEELGHR  99

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY++ ++  AR+FYFFFESR++KSDPVVIWLTGGPGCSS LA+FYENGPF I +N SL
Sbjct  100   AGYYKIEHSHAARLFYFFFESRNSKSDPVVIWLTGGPGCSSELAMFYENGPFKITNNLSL  159

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWDK SNL+YVDQP GTGFSYSS  +D R DE+GVSNDLY FLQ FF  HP   +
Sbjct  160   VWNEYGWDKVSNLLYVDQPVGTGFSYSSDRQDIRHDENGVSNDLYDFLQAFFDEHPDLVE  219

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++FF+TGESYAGHYIPAL +RI+QGNK KEG HINLKG AIGNGLTDP IQY  YPD+AL
Sbjct  220   NDFFITGESYAGHYIPALASRIHQGNKAKEGTHINLKGFAIGNGLTDPAIQYKTYPDYAL  279

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             D  +I+KS H  +  L+P C+ A+  C ++G  +C       C  ++  IM    D+N+Y
Sbjct  280   DMGIITKSQHRHINLLVPPCELAIGACGTDGTLSCM-ASYYVCNAIFTSIMLHAGDMNHY  338

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKC  GSLCYDFSN E FLN +SV++ALGVGDI++VSCS TVY  M  D  +N   G
Sbjct  339   DIRKKC-EGSLCYDFSNMEKFLNQQSVREALGVGDIEFVSCSPTVYRAMLVDWMRNAEVG  397

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGI +LVY GEYDLICNWLGN RWV A+QW G++ F A+P V F V G E G+ 
Sbjct  398   IPALLEDGIKMLVYAGEYDLICNWLGNSRWVHAMQWPGKEEFVASPKVPFLVDGSEAGLL  457

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K +GPL+FLKVHDAGH+VPMDQP+A+LEML+RW  G L
Sbjct  458   KRHGPLSFLKVHDAGHMVPMDQPRAALEMLKRWTRGTL  495



>dbj|BAJ34078.1| unnamed protein product [Thellungiella halophila]
Length=510

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 351/460 (76%), Gaps = 12/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGD----SG-ATVEDLGQH  1518
             AE++I+  NL P  D+N  S      ++ PRLVE++  L    D    SG  +V+D G  
Sbjct  46    AERLIKGFNLMPQRDVNVISEDG---SEAPRLVEREFDLPAALDRRDSSGLPSVQDFGHR  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LPN+  ARMFYFFFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL
Sbjct  103   AGYYKLPNSKAARMFYFFFESRTNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WND+GWDKASNLIYVDQP GTGFSY+S E D R DEDGVSNDLY FLQ FFK HP++  
Sbjct  163   AWNDFGWDKASNLIYVDQPVGTGFSYTSDESDLRHDEDGVSNDLYDFLQAFFKEHPQFVN  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNG--GSACSDLVNSRCQPLYDRIMEKLVDLN  804
             D  LISKS HD L +    CQ+++++C+++G  G AC+      C  ++ +IM+   ++N
Sbjct  283   DMKLISKSDHDNLNRNYATCQQSIKECSADGGEGEACATSY-VVCNNIFQKIMDIAGNVN  341

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  GSLCYDFSN E FLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL 
Sbjct  342   YYDVRKQC-KGSLCYDFSNMEKFLNQKSVRKALGVGDIEFVSCSTAVYDAMQMDWMRNLE  400

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI +L+Y GEYDLICNWLGN +WV  ++W GQK F +A  V F V  KE G
Sbjct  401   VGIPTLLEDGIKMLIYAGEYDLICNWLGNSKWVHEMEWSGQKEFVSAATVPFHVDNKEAG  460

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K++G LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   LMKNHGSLTFLKVHDAGHMVPMDQPKAALQMLQNWMQGKL  500



>ref|XP_010535625.1| PREDICTED: serine carboxypeptidase-like 48 isoform X2 [Tarenaya 
hassleriana]
Length=509

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/466 (61%), Positives = 357/466 (77%), Gaps = 14/466 (3%)
 Frame = -2

Query  1700  ANS-KRRAEKMIRQLNLFPLHDLNRGSGHSPVE-ADTPRLVEKKLKL--NLLGDSGA---  1542
             ANS K  AEK+I+  NL P  D+N      P + A + RLVE+++       G+S A   
Sbjct  41    ANSPKLMAEKLIKSFNLMPERDVNI----VPEDVAQSLRLVEREIDFPATFAGESAADVP  96

Query  1541  TVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPF  1362
             TV++ G HAGYY+LP++  ARMFY FFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF
Sbjct  97    TVKEYGHHAGYYKLPHSKAARMFYLFFESRSNKTDPVVIWLTGGPGCSSQLALFYENGPF  156

Query  1361  YIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFF  1182
              I+ N SL WND+GWDKASNLIYVDQP GTGFS++S + D R DEDGVSNDLY FLQ FF
Sbjct  157   NISKNLSLSWNDFGWDKASNLIYVDQPVGTGFSFTSDDSDLRHDEDGVSNDLYDFLQAFF  216

Query  1181  KAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQY  1002
             K HP++AK++F++TGESYAGHYIPAL +R++ GNK KEGIHINLKG AIGNGLT+P +QY
Sbjct  217   KEHPQFAKNDFYITGESYAGHYIPALASRVHHGNKNKEGIHINLKGFAIGNGLTNPEVQY  276

Query  1001  PAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIME  822
              AYPD+ALD  LI++S H+ + +L P CQ A ++  ++GG AC++     C  ++D I+ 
Sbjct  277   GAYPDYALDMKLITESDHESIKKLYPDCQRATKEY-TDGGDACAN-AYYVCNEIFDNILG  334

Query  821   KLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSD  642
                 +NYYD+RK+C  G+LCYDFS+ ETFLN KSV+  LGVGDI++VSCS+TVY+ M +D
Sbjct  335   IAGSVNYYDVRKQC-QGNLCYDFSSMETFLNQKSVRSTLGVGDIEFVSCSSTVYDAMRND  393

Query  641   IFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSV  462
               +NL   IP LL+DGI LLVY GEYDLICNWLGN +W   ++W GQKGFG+A  + F V
Sbjct  394   WMRNLEVVIPELLEDGIELLVYAGEYDLICNWLGNSKWAHQMEWSGQKGFGSAKMIPFLV  453

Query  461   GGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G E G+ K++GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  454   DGTEAGLMKNHGPLTFLKVHDAGHMVPMDQPKASLQMLQNWMQGKL  499



>emb|CDY31020.1| BnaC03g55150D [Brassica napus]
Length=509

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/459 (61%), Positives = 349/459 (76%), Gaps = 11/459 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVE-ADTPRLVEKKLKLNLL---GDSGAT--VEDLGQ  1521
             AE++I+  NL P  D+N      P + ++ PRLVE+   L       DSG +  ++D G 
Sbjct  46    AERLIKGFNLMPTRDVNV----IPEDGSEAPRLVERNFDLPATIDRRDSGGSPSLQDFGH  101

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY+LPN+  ARMFYFFFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF +++N S
Sbjct  102   HAGYYKLPNSKAARMFYFFFESRSNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSS  161

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WND+GWDKASNLIYVDQP GTGFSY+S E D R DEDGVSNDLY FLQ FFK HP++ 
Sbjct  162   LAWNDFGWDKASNLIYVDQPVGTGFSYTSDESDLRHDEDGVSNDLYDFLQAFFKEHPQFV  221

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPAL +R+++GNK KEG HINL+G AIGNGLT+P IQY AY D+A
Sbjct  222   KNDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLRGFAIGNGLTNPEIQYAAYADYA  281

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNY  801
             LD  LIS+S HD L +    CQ+++++C ++GG          C  ++ +IM    ++NY
Sbjct  282   LDMKLISQSDHDNLNRDYESCQQSIKECGADGGGEACASSYIVCNNIFQKIMNIAGNVNY  341

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YD+RK+C  GSLCYDFSN E FLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL  
Sbjct  342   YDVRKQC-KGSLCYDFSNMEKFLNQKSVRTALGVGDIEFVSCSTAVYDAMQLDWMRNLEV  400

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGI +L+Y GEYDLICNWLGN +WV  ++W G+K F AA  V F+V  +E G+
Sbjct  401   GIPALLEDGIKMLIYAGEYDLICNWLGNSKWVHEMEWTGRKEFVAAATVPFNVDNREAGL  460

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K++G LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   MKNHGSLTFLKVHDAGHMVPMDQPKAALQMLKDWMQGKL  499



>ref|XP_002273281.1| PREDICTED: serine carboxypeptidase-like [Vitis vinifera]
Length=501

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/463 (58%), Positives = 351/463 (76%), Gaps = 5/463 (1%)
 Frame = -2

Query  1709  NSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLL-GDSGATVE  1533
             +++ + K +AE++IR LNL P   +N    H   EA  PR++EK L+   L G SG +++
Sbjct  35    SALNSPKMQAERLIRSLNLSPKKAVNLDVSHG--EAVAPRMIEKSLEFPFLDGSSGTSIQ  92

Query  1532  DLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIA  1353
             DLG HAGY+RL +++DARMFYFFFESR +K DPVV+WLTGGPGC S +ALFYENGPF++ 
Sbjct  93    DLGHHAGYFRLAHSIDARMFYFFFESRHSKKDPVVVWLTGGPGCGSEVALFYENGPFHVR  152

Query  1352  DNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAH  1173
             DN +L WN YGWD+ SN+++VDQPTGTGFSYSS E D R +E+ VSNDLY F+Q FF  H
Sbjct  153   DNLTLSWNQYGWDQVSNILFVDQPTGTGFSYSSDEGDIRHNEEAVSNDLYDFMQAFFAKH  212

Query  1172  PKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAY  993
             P++ K++F++TGESYAGHYIPA   R+ +GNK  EG+HINLKG AIGNGLTDP IQY AY
Sbjct  213   PEFVKNDFYITGESYAGHYIPAFAARVQKGNKANEGVHINLKGFAIGNGLTDPSIQYKAY  272

Query  992   PDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLV  813
              D+AL+  +I KS +D + +LIP C+E+ + C  +GG AC +   + C  +++ I+    
Sbjct  273   TDYALNMKIIGKSDYDSINELIPECEESAKSCGPDGGDAC-ETAYTNCNFIFNSILNVAG  331

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
             ++NYYDIRK+C  GSLCYDFSN E+F+  KSVK ALGVGD+++VSCST VY+ M  D  +
Sbjct  332   NINYYDIRKQC-EGSLCYDFSNLESFMGLKSVKKALGVGDVEFVSCSTVVYDAMQRDWMR  390

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             ++  GIP+LL+DGI +L+Y GEYDLICNWLGN  WV A++W GQK F A+P V + V GK
Sbjct  391   DMEVGIPALLEDGIKMLIYAGEYDLICNWLGNSNWVHAMKWSGQKDFEASPTVPYLVDGK  450

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G  K++GPL FLKVH+AGH+VPMDQPKA+L+ML+ W  G+L
Sbjct  451   EAGQLKNHGPLAFLKVHNAGHMVPMDQPKAALQMLKTWTQGKL  493



>ref|XP_006299685.1| hypothetical protein CARUB_v10015873mg [Capsella rubella]
 gb|EOA32583.1| hypothetical protein CARUB_v10015873mg [Capsella rubella]
Length=515

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/460 (62%), Positives = 347/460 (75%), Gaps = 10/460 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEA-DTPRLVEKKLKL-NLLGDSGATVEDLGQHA  1515
             RAEK+IR+LNLFP  DLN      SP+ A +   +VE+K    N+L D GATV DLG HA
Sbjct  42    RAEKLIRELNLFPQQDLNVIDVADSPLTAAEGLGIVERKFVFPNILPDGGATVADLGHHA  101

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             GYY+LP +  A +FYFFFESR  K D PVVIWLTGGPGCSS LA+FYENGPF I +N SL
Sbjct  102   GYYKLPKSGGASIFYFFFESRHKKEDAPVVIWLTGGPGCSSELAVFYENGPFKITNNMSL  161

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWD+ SNL+YVDQP GTGFSY++ + D R DE GVSNDLY FLQ FF  HPK A+
Sbjct  162   AWNEYGWDQVSNLLYVDQPVGTGFSYTTDQSDIRHDETGVSNDLYDFLQAFFAEHPKLAE  221

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA  +R+++GNK  EGIH+NLKG AIGNGLTDP +QYPAYPD+AL
Sbjct  222   NDFYITGESYAGHYIPAFASRVHKGNKANEGIHVNLKGFAIGNGLTDPALQYPAYPDYAL  281

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLN  804
             +  LI++  HD L +++P C+ +++ C ++G ++C  S LV   C  L+  +M     +N
Sbjct  282   EMGLITQKEHDRLEKIVPLCELSIKLCGTDGTTSCLASYLV---CNTLFSGVMSHAGRVN  338

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYDIRKKCV GSLCYDFSN E FLN KSV+ +LGVGDID+VSCST+VY+ M  D  +NL 
Sbjct  339   YYDIRKKCV-GSLCYDFSNMEKFLNLKSVRTSLGVGDIDFVSCSTSVYQAMLVDWMRNLE  397

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP LL+DGINLLVY GEYDLICNWLGN RWV A+ W G+  FGAA  V F V GK+ G
Sbjct  398   VGIPELLEDGINLLVYAGEYDLICNWLGNSRWVNAMDWSGKTNFGAAEVVPFLVDGKDAG  457

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
               K+Y  L+FLKV DAGH+VPMDQPKA+L ML+RWM   L
Sbjct  458   SLKTYEQLSFLKVRDAGHMVPMDQPKAALTMLKRWMENSL  497



>ref|NP_197689.1| serine carboxypeptidase-like 47 [Arabidopsis thaliana]
 sp|Q9FFB0.1|SCP47_ARATH RecName: Full=Serine carboxypeptidase-like 47; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10619.1| serine carboxypeptidase [Arabidopsis thaliana]
 gb|AED93104.1| serine carboxypeptidase-like 47 [Arabidopsis thaliana]
Length=505

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/470 (60%), Positives = 352/470 (75%), Gaps = 16/470 (3%)
 Frame = -2

Query  1709  NSMANSKRRAEKMIRQLNLFPLHDLN---RGSGHSPVEADTPRLVEKKLKLNLLGDS---  1548
             +S+  S   AE++I+  NL P +D+N   +GS       D PRL+E+++       S   
Sbjct  34    SSLNFSSGNAERLIKSFNLMPKYDVNVIPKGS------LDAPRLIERQIDFLATAGSKNA  87

Query  1547  --GATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYE  1374
               G +V++ G +AGYY LP++  A+MFYFFFESR+  +DPVVIWLTGGPGCSSS+A+FYE
Sbjct  88    SVGPSVQEFGHYAGYYSLPHSKSAKMFYFFFESRNKTTDPVVIWLTGGPGCSSSVAMFYE  147

Query  1373  NGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFL  1194
             NGPF I+ + SL+WND+GWDK SN+IYVDQP GTGFSY+S E D R DEDGVSNDLY FL
Sbjct  148   NGPFKISKDLSLYWNDFGWDKVSNIIYVDQPVGTGFSYTSDESDIRNDEDGVSNDLYDFL  207

Query  1193  QEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDP  1014
             Q FFK HPK+ K++FF+TGESYAGHYIPAL +R++ GNKKKEGI INLKG AIGNGLT+P
Sbjct  208   QAFFKEHPKFVKNDFFITGESYAGHYIPALASRVHSGNKKKEGIPINLKGFAIGNGLTNP  267

Query  1013  GIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYD  834
              IQY AY D+AL   LIS+S H+ L Q    CQ   ++C+  GG  C   V   C  +++
Sbjct  268   EIQYGAYGDYALQMKLISESDHESLKQDYVECQNITKKCSLGGGLVCDSAVEV-CTSIFN  326

Query  833   RIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEV  654
             +I+ K   LNYYDIRKKCV GSLCYDFS  E FLN ++V+ ALGVGDI +VSCS+TVY+ 
Sbjct  327   KIVAKKSGLNYYDIRKKCV-GSLCYDFSRMEIFLNKENVRKALGVGDIKFVSCSSTVYDA  385

Query  653   MSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNV  474
             M  D  +NL   IPSL+ DGINLLVY GEYDLICNWLGN RWV  + W GQKGFG+A NV
Sbjct  386   MIEDWMQNLEVKIPSLVNDGINLLVYAGEYDLICNWLGNSRWVDQMNWSGQKGFGSAKNV  445

Query  473   TFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +F V GKE G+ K++GPLTFLKV++AGH+VPMDQPKASL+ML+ WM G+L
Sbjct  446   SFLVDGKEAGLLKNHGPLTFLKVYNAGHMVPMDQPKASLQMLQNWMQGKL  495



>gb|KHN06879.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=499

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/458 (62%), Positives = 346/458 (76%), Gaps = 18/458 (4%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEAD----TPRLVEKKLKL-NLLGDSGATVEDLGQH  1518
             AEK+IR LNLFP   +N       +E D    +  +VEK     +L   S ++VE+LG H
Sbjct  43    AEKLIRGLNLFPKDPINT------LENDPLFVSGSIVEKSFTFPSLAASSESSVEELGHH  96

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYYRLP +  ARMFYFFFESRS+K+DPVVIWLTGGPGCSS LALFYENGPF +  N SL
Sbjct  97    AGYYRLPRSKAARMFYFFFESRSSKNDPVVIWLTGGPGCSSELALFYENGPFQLTKNLSL  156

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WNDYGWDKASN+I+VDQPTGTGFSY+S E D R DE+GVSNDLY FLQ FFK HP+  K
Sbjct  157   VWNDYGWDKASNIIFVDQPTGTGFSYTSDESDIRHDEEGVSNDLYDFLQAFFKEHPQLTK  216

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R++QGNK KEGIHINLKG AIGNGLT+P IQY AY D+  
Sbjct  217   NDFYITGESYAGHYIPALASRVHQGNKAKEGIHINLKGFAIGNGLTNPEIQYQAYTDY--  274

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
                +I K+ ++ + +LIP C++A+  C + GG  C   +   C  +++RIM    D+NYY
Sbjct  275   ---VIKKAEYNSINKLIPPCKQAIEACGTEGGETCVSSLYV-CNKIFNRIMTIADDVNYY  330

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKCV G LCYDFS  E FLN K+V+DALGVGD+D+VSCS+TVY  M  D  +NL  G
Sbjct  331   DIRKKCV-GDLCYDFSVMEDFLNEKTVRDALGVGDLDFVSCSSTVYSAMMQDWMRNLEVG  389

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL++GI +LVY GE DLICNWLGN RWV A++W GQK FGA+  V F V G E G  
Sbjct  390   IPTLLEEGIKVLVYAGEEDLICNWLGNSRWVNAMEWSGQKQFGASGTVPFLVDGAEAGTL  449

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KS+GPL+FLKV++AGH+VPMDQPKA+LEMLR WM G+L
Sbjct  450   KSHGPLSFLKVYEAGHMVPMDQPKAALEMLRSWMQGKL  487



>ref|XP_004150367.1| PREDICTED: serine carboxypeptidase-like 49-like [Cucumis sativus]
Length=509

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/458 (61%), Positives = 342/458 (75%), Gaps = 6/458 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN----RGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQH  1518
             +AEK+IR+LNLFP  D N         S + A   ++VE++L+  L  DSG ++E+LG H
Sbjct  40    QAEKLIRELNLFPKSDTNIIHRNIQNSSLLAAGEKKIVERRLRFPLFDDSGVSLEELGHH  99

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY++ ++  AR+FYFFFESR+ KSDPVVIWLTGGPGCSS LA+FYENGPF I  N SL
Sbjct  100   AGYYKIEHSHAARLFYFFFESRNRKSDPVVIWLTGGPGCSSELAMFYENGPFKITKNLSL  159

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWDK SNL+YVDQP GTGFSYSS  +D R DE+GVSNDLY  LQ FF  HP   +
Sbjct  160   VWNEYGWDKVSNLLYVDQPVGTGFSYSSDRQDIRHDENGVSNDLYDLLQTFFDEHPDLVE  219

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++FF+TGESYAGHYIPAL +RI+QGNK KEG HINLKG AIGNGLTDP IQY  YPD+AL
Sbjct  220   NDFFITGESYAGHYIPALASRIHQGNKAKEGTHINLKGFAIGNGLTDPAIQYKTYPDYAL  279

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             D  +I+KS H  +  L+P C+ A+  C ++G  +C       C  ++  IM    D+N+Y
Sbjct  280   DMGIITKSQHRRINLLVPPCELAIGACGTDGTLSCMTSYYV-CNAIFTSIMLHAGDMNHY  338

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKC  GSLCYDFSN E FLN +SV++ALGVGDI++VSCS TVY+ M  D  +N   G
Sbjct  339   DIRKKC-EGSLCYDFSNMEKFLNQQSVREALGVGDIEFVSCSPTVYKAMLVDWMRNSEVG  397

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGI +LVY GEYDLICNWLGN RWV A+QW G++ F A+P V F V G E G+ 
Sbjct  398   IPALLEDGIKMLVYAGEYDLICNWLGNSRWVHAMQWSGKEEFVASPKVPFLVDGSEAGLL  457

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K +GPL+FL+VHDAGH+VPMDQPK +LEML+RW  G L
Sbjct  458   KRHGPLSFLQVHDAGHMVPMDQPKVALEMLKRWTRGTL  495



>ref|XP_002872027.1| hypothetical protein ARALYDRAFT_489152 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48286.1| hypothetical protein ARALYDRAFT_489152 [Arabidopsis lyrata subsp. 
lyrata]
Length=508

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/458 (62%), Positives = 345/458 (75%), Gaps = 10/458 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLL-----GDSGATVEDLGQH  1518
             AEK+I+  NL P +D+N     SP   D PRL+E+++             G +V++ G +
Sbjct  46    AEKLIKSFNLMPKYDVNVIPKGSP---DAPRLIERQIDFPATIGSQNASKGPSVQEFGHY  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY LP++  A+MFYFFFESR+  +DPVVIWLTGGPGCSSS+A+FYENGPF ++++ SL
Sbjct  103   AGYYSLPHSKSAKMFYFFFESRNKNTDPVVIWLTGGPGCSSSVAMFYENGPFKLSEDLSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WND+GWDK SNLIYVDQP GTGFSY+S+E D R DE GVSNDLY FLQ FFK HPK+ K
Sbjct  163   TWNDFGWDKVSNLIYVDQPIGTGFSYTSAESDLRHDEAGVSNDLYDFLQAFFKEHPKFVK  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++FF+TGESYAGHYIPAL +R++ GNKKKEGI INLKG AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFFITGESYAGHYIPALASRVHSGNKKKEGIPINLKGFAIGNGLTNPEIQYGAYGDYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
                LIS+S H+ + Q    CQ   ++CN +GG AC D     C  +++ I  K   +NYY
Sbjct  283   QMKLISESDHESIKQDYVECQNLTKKCNLDGGLAC-DSAFDVCNNIFNMIAAKKRGINYY  341

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKCV GSLCYDFS  E FLN ++V+ ALGVGDI++VSCS+TVY+ M+ D   NL   
Sbjct  342   DIRKKCV-GSLCYDFSKMENFLNKENVRKALGVGDIEFVSCSSTVYDAMTEDWMINLEVK  400

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+L+ DGINLL+Y GEYDLICNWLGN RWV  + W GQKGFG+A NV F V GKE G  
Sbjct  401   IPTLVNDGINLLIYAGEYDLICNWLGNSRWVDQMNWSGQKGFGSAKNVPFLVDGKEAGSL  460

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K+YGPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  461   KNYGPLTFLKVHDAGHMVPMDQPKASLQMLQNWMQGKL  498



>ref|XP_009131902.1| PREDICTED: serine carboxypeptidase-like 47 [Brassica rapa]
 emb|CDX88773.1| BnaA03g08760D [Brassica napus]
Length=512

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/462 (61%), Positives = 347/462 (75%), Gaps = 14/462 (3%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-------NLLGDSGATVED  1530
             R AE++I+  NL P HD+N  +  SP   D PRL+E ++         N +G  G +V+ 
Sbjct  44    RNAERLIKSFNLMPDHDVNVIAKGSP---DVPRLIESQINFPETIGIRNTIG--GPSVQQ  98

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
              G + GYY L +T  A+MFYFFFESR+N +DPVVIWL+GGPGCSSS+ALFYENGPF I+D
Sbjct  99    FGHYGGYYSLTHTKSAKMFYFFFESRTNNTDPVVIWLSGGPGCSSSVALFYENGPFTISD  158

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             + SL WND+GWDK SNLIYVDQP GTGFSY+S + D R DE GVSNDLY FLQ FFK HP
Sbjct  159   DLSLSWNDFGWDKVSNLIYVDQPVGTGFSYTSDQSDLRHDETGVSNDLYDFLQAFFKEHP  218

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             KYAK++F++TGESYAGHY+PAL +R++ GNK KEGI INLKG AIGNGLT+P IQY AY 
Sbjct  219   KYAKNDFYITGESYAGHYVPALASRVHNGNKNKEGIPINLKGFAIGNGLTNPEIQYGAYG  278

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVD  810
             D+AL+  LIS+S H+ L Q    CQ ++++CN NGG  CS      C  ++ +IM K+  
Sbjct  279   DYALEMKLISESDHESLKQDYVFCQSSIKKCNLNGGEECS-YAFVDCNDIFTQIMSKIEG  337

Query  809   LNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKN  630
              N+YD+RKKCV GSLCYDFS  E FLN K V+ ALGVG+ID+VSCSTTVY+ M +D   N
Sbjct  338   TNFYDLRKKCV-GSLCYDFSKMEAFLNQKKVRKALGVGNIDFVSCSTTVYKAMLNDWMVN  396

Query  629   LAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKE  450
             LA  IP LL+DGI+LLVY GE+D+ICNWLGN RWV  L W  QK +G+A  V F V GKE
Sbjct  397   LADKIPRLLEDGISLLVYAGEFDIICNWLGNSRWVDQLNWSNQKEYGSAKRVPFLVDGKE  456

Query  449   KGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G+ K++GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  457   AGLMKNHGPLTFLKVHDAGHMVPMDQPKASLQMLQTWMQGKL  498



>ref|XP_010906753.1| PREDICTED: serine carboxypeptidase-like [Elaeis guineensis]
Length=508

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/460 (61%), Positives = 350/460 (76%), Gaps = 16/460 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEA--DTP--RLVEKKLKLNLLGDSGATVEDLGQH  1518
              AEK+IR LNL P     +     P EA  D P  R+VE++  L  L   G +VEDLG +
Sbjct  45    HAEKLIRALNLVP-----KDPSPEPAEAAADVPAKRIVERRFSLAGL-TGGVSVEDLGHY  98

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGY+ LP+T DARMFY FFESR++  DPVVIWLTGGPGCSS LA+FYENGPF IADN +L
Sbjct  99    AGYFSLPHTHDARMFYLFFESRNSNKDPVVIWLTGGPGCSSELAVFYENGPFTIADNMTL  158

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN++GWD+ASNL+YVDQPTGTGFSYS+   D R DE+GVS+DLY FLQ FF  HP+YA 
Sbjct  159   AWNEFGWDQASNLLYVDQPTGTGFSYSTDSRDIRHDENGVSDDLYDFLQAFFAEHPEYAS  218

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA  +RI+QGNK KEG  INLKG AIGNGLTDP IQY AY DFAL
Sbjct  219   NDFYITGESYAGHYIPAFASRIHQGNKAKEGTCINLKGFAIGNGLTDPAIQYKAYTDFAL  278

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLN  804
             DN +I +S +  + +  P C  A++ C ++G  +C  S LV   C  ++  I+    ++N
Sbjct  279   DNGIIKESDYKRINKFYPICAYAIKLCGTSGTISCLASYLV---CNTIFSSIIRIAGNIN  335

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYDIRK+CV GSLCYDFSN E FLN +SV+D+LGVGDI++VSCS TVY+ M  D  +NL 
Sbjct  336   YYDIRKQCV-GSLCYDFSNMEKFLNLESVRDSLGVGDIEFVSCSPTVYQAMLMDWMRNLE  394

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI LLVY GEYDLICNWLGN RWV +++W GQ+ F ++P ++F+V GKE G
Sbjct  395   VGIPALLEDGIKLLVYAGEYDLICNWLGNSRWVHSMEWSGQQNFTSSPELSFTVDGKEAG  454

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + KS+GPL+FLKVHDAGH+VPMDQPKA+LEML+RW+ G L
Sbjct  455   VLKSHGPLSFLKVHDAGHMVPMDQPKAALEMLKRWIQGNL  494



>ref|XP_007145525.1| hypothetical protein PHAVU_007G245800g [Phaseolus vulgaris]
 gb|ESW17519.1| hypothetical protein PHAVU_007G245800g [Phaseolus vulgaris]
Length=500

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/478 (61%), Positives = 357/478 (75%), Gaps = 16/478 (3%)
 Frame = -2

Query  1739  SPAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADT--PR-LVEKKLK  1569
             SP+  A+  D +      +A+K+I  LNLFP    + G    PV   +  PR +VEK+L+
Sbjct  19    SPSTYASPSDEAAL----QAKKLISALNLFP----DDGVNVVPVANSSLQPRKIVEKRLR  70

Query  1568  L-NLLG-DSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSS  1395
               NL+  DS  +VEDLG +AGYY + ++  ARMFYFFFESR+ K DPVVIWLTGGPGCSS
Sbjct  71    FPNLVASDSEPSVEDLGHYAGYYPIVHSHAARMFYFFFESRNTKEDPVVIWLTGGPGCSS  130

Query  1394  SLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVS  1215
              LALFYENGPF IAD+ SL WN+YGWDKASNL+YVDQPTGTGFSYS+   D R +EDGVS
Sbjct  131   ELALFYENGPFKIADDLSLVWNEYGWDKASNLLYVDQPTGTGFSYSTDLRDIRHNEDGVS  190

Query  1214  NDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAI  1035
             NDLY F+Q FF  HP+YAK++FF+TGESYAGHYIPA  TRI++GNK KEGIHINLKG AI
Sbjct  191   NDLYDFIQAFFAEHPQYAKNDFFITGESYAGHYIPAFATRIHRGNKAKEGIHINLKGFAI  250

Query  1034  GNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQ-LIPGCQEAVRQCNSNGGSACSDLVN  858
             GNGLT+P IQY AYPD+AL+  +I K+  + L + L+P C+ A++ C +NG ++C     
Sbjct  251   GNGLTNPAIQYKAYPDYALEMGIIKKATRNRLNKVLVPACELAIKLCGTNGKTSCVAAYV  310

Query  857   SRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVS  678
             + C  ++  IM    D NYYDIRKKC  GSLCYDFSN E FLN KSV+D+LGVG I +VS
Sbjct  311   A-CNLIFSNIMLHAGDTNYYDIRKKC-EGSLCYDFSNMEKFLNQKSVRDSLGVGKIHFVS  368

Query  677   CSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQK  498
             CST VY  +  D  +NL  GIP+LL+DGINLL+Y GEYDLICNWLGN RWV AL+W G+K
Sbjct  369   CSTEVYMALLVDWMRNLEVGIPALLEDGINLLIYAGEYDLICNWLGNSRWVHALEWSGKK  428

Query  497   GFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              F  +  V F V G E G+ KSYGPL+FLKVHDAGH+VPMDQPKA+LEML++W +G L
Sbjct  429   EFTTSLEVPFVVDGSEAGLLKSYGPLSFLKVHDAGHMVPMDQPKAALEMLKKWTNGNL  486



>emb|CBI17153.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/455 (58%), Positives = 346/455 (76%), Gaps = 5/455 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLL-GDSGATVEDLGQHAGY  1509
             +AE++IR LNL P   +N    H   EA  PR++EK L+   L G SG +++DLG HAGY
Sbjct  2     QAERLIRSLNLSPKKAVNLDVSHG--EAVAPRMIEKSLEFPFLDGSSGTSIQDLGHHAGY  59

Query  1508  YRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWN  1329
             +RL +++DARMFYFFFESR +K DPVV+WLTGGPGC S +ALFYENGPF++ DN +L WN
Sbjct  60    FRLAHSIDARMFYFFFESRHSKKDPVVVWLTGGPGCGSEVALFYENGPFHVRDNLTLSWN  119

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEF  1149
              YGWD+ SN+++VDQPTGTGFSYSS E D R +E+ VSNDLY F+Q FF  HP++ K++F
Sbjct  120   QYGWDQVSNILFVDQPTGTGFSYSSDEGDIRHNEEAVSNDLYDFMQAFFAKHPEFVKNDF  179

Query  1148  FVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNN  969
             ++TGESYAGHYIPA   R+ +GNK  EG+HINLKG AIGNGLTDP IQY AY D+AL+  
Sbjct  180   YITGESYAGHYIPAFAARVQKGNKANEGVHINLKGFAIGNGLTDPSIQYKAYTDYALNMK  239

Query  968   LISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIR  789
             +I KS +D + +LIP C+E+ + C  +GG AC +   + C  +++ I+    ++NYYDIR
Sbjct  240   IIGKSDYDSINELIPECEESAKSCGPDGGDAC-ETAYTNCNFIFNSILNVAGNINYYDIR  298

Query  788   KKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPS  609
             K+C  GSLCYDFSN E+F+  KSVK ALGVGD+++VSCST VY+ M  D  +++  GIP+
Sbjct  299   KQC-EGSLCYDFSNLESFMGLKSVKKALGVGDVEFVSCSTVVYDAMQRDWMRDMEVGIPA  357

Query  608   LLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSY  429
             LL+DGI +L+Y GEYDLICNWLGN  WV A++W GQK F A+P V + V GKE G  K++
Sbjct  358   LLEDGIKMLIYAGEYDLICNWLGNSNWVHAMKWSGQKDFEASPTVPYLVDGKEAGQLKNH  417

Query  428   GPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             GPL FLKVH+AGH+VPMDQPKA+L+ML+ W  G+L
Sbjct  418   GPLAFLKVHNAGHMVPMDQPKAALQMLKTWTQGKL  452



>ref|XP_004496230.1| PREDICTED: serine carboxypeptidase-like 49-like [Cicer arietinum]
Length=506

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/465 (61%), Positives = 348/465 (75%), Gaps = 6/465 (1%)
 Frame = -2

Query  1706  SMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEAD-TPRLVEKKLKL-NLLGD-SGATV  1536
             S  N     + +IR LNLFP HD+N  +  + V  D   ++VEK L+  N  G+  G ++
Sbjct  30    STFNHGETVKNLIRNLNLFPPHDINILANPNVVPTDKNNKIVEKPLRFPNFSGEGEGISL  89

Query  1535  EDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYI  1356
             +DL   AGYY L ++  A+MFY FFESR NK DPVVIWLTGGPGCSS LA+FYENGPF I
Sbjct  90    DDLAHRAGYYPLQHSHAAKMFYLFFESRINKKDPVVIWLTGGPGCSSELAVFYENGPFKI  149

Query  1355  ADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKA  1176
             A+N SL WN++GWDK SNL+YVDQPTGTGFSYS+   D R DEDGVSNDLY FLQ FF  
Sbjct  150   ANNMSLVWNEFGWDKVSNLLYVDQPTGTGFSYSTDTRDIRHDEDGVSNDLYDFLQAFFAE  209

Query  1175  HPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPA  996
             HP+YA+++FF+TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDP IQY A
Sbjct  210   HPEYAENDFFITGESYAGHYIPAFAARVHKGNKAKEGIHINLKGFAIGNGLTDPAIQYKA  269

Query  995   YPDFALDNNLISKSFHDELTQ-LIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEK  819
             Y D+ALD  +I ++ +D + + ++P C+ A++ C ++G  AC+      C  +++ IM  
Sbjct  270   YSDYALDMGIIKQADYDRINKVMLPACELAIKLCGTDGKIACTTSY-FVCNTIFNSIMSH  328

Query  818   LVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDI  639
               D+NYYDIRKKC  GSLCYDFSN E FLN  SV+DALGVGDID+VSCS+TVY+ M  D 
Sbjct  329   AGDINYYDIRKKC-EGSLCYDFSNMEKFLNQGSVRDALGVGDIDFVSCSSTVYQAMLVDW  387

Query  638   FKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVG  459
              +NL  GIP+LL+DGIN+L+Y GEYDLICNWLGN RWV A++W GQ  F A+  V F+V 
Sbjct  388   MRNLEVGIPALLEDGINMLIYAGEYDLICNWLGNSRWVHAMEWSGQNEFVASSEVPFTVD  447

Query  458   GKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
               E G+ K+YGPL+FLKVHDAGH+VPMDQPKASLEML+RW  G L
Sbjct  448   DSEAGLLKNYGPLSFLKVHDAGHMVPMDQPKASLEMLKRWTQGTL  492



>emb|CDP07045.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/454 (61%), Positives = 347/454 (76%), Gaps = 4/454 (1%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYR  1503
             A+ +IR LNL P  D+N  +       D+ R+VEK LKLN+LG    +V DLG HAGY+ 
Sbjct  44    AKGLIRGLNLHPRQDVNIVANDFAAANDS-RIVEKPLKLNILGAPDPSVADLGHHAGYFN  102

Query  1502  LPNTVDARMFYFFFESR-SNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             LP+TV ARMFYFFFESR  N SDPVVIWLTGGPGCSS LALFYENGPF+I D  SL WN+
Sbjct  103   LPHTVGARMFYFFFESRRKNNSDPVVIWLTGGPGCSSELALFYENGPFHITDGLSLVWNN  162

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDK SN+I+VDQPTGTGFSYSSS +D R DE GVSNDLY FLQ FF+ HP+YAK+EF+
Sbjct  163   FGWDKISNIIFVDQPTGTGFSYSSSNDDIRHDEKGVSNDLYDFLQAFFRKHPEYAKNEFY  222

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHY+PAL  R+NQGNK KEGI +NLKG AIGNGLT+P IQY   PD+AL++ L
Sbjct  223   ITGESYAGHYVPALAGRVNQGNKNKEGILVNLKGFAIGNGLTNPLIQYKGLPDYALEHKL  282

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             IS+S+++ + + +  C+EA+  C ++G  +C +        ++D I+    ++NYYDIRK
Sbjct  283   ISQSYYNGMQESVTECEEAIEACGTSGTDSC-ETAYELGNEIFDDILSSAGNINYYDIRK  341

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             +C  G LCYDFSN E FLN  +V++ALGVG I+WVSCS+TVY+ M  D  +N+   +P+L
Sbjct  342   QC-EGQLCYDFSNVENFLNQDTVREALGVGHIEWVSCSSTVYDAMVDDWMRNIEVDVPAL  400

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DGI LLVY GEYDL+CNWLGN RWVQA++W GQK + AAPN +F+  G E G++K YG
Sbjct  401   LEDGIKLLVYAGEYDLVCNWLGNSRWVQAMEWSGQKAYLAAPNTSFTTNGVEAGVRKGYG  460

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              LTFLKV +AGH+VPMDQP+A+LEML  W+ G+L
Sbjct  461   SLTFLKVLNAGHMVPMDQPQAALEMLESWIKGKL  494



>emb|CDY00669.1| BnaC03g36530D [Brassica napus]
Length=522

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/466 (60%), Positives = 350/466 (75%), Gaps = 16/466 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN----RGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQ  1521
             RAEK+IR+LNLFP  D+N      S  +  E + P +VE+  +  N++ D GATVEDLG 
Sbjct  40    RAEKLIRELNLFPKLDVNVIDVTDSTLASAEEEVPSIVERSFRFPNIISDGGATVEDLGH  99

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGY++LP +  ARMFYFFFESR  K  PVVIWLTGGPGCSS LA+FYENGPF I  N S
Sbjct  100   HAGYFKLPKSQGARMFYFFFESRKKKDAPVVIWLTGGPGCSSELAMFYENGPFKIDKNMS  159

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WN+YGWD+ASNL+YVDQP GTGFSY++ + D R DE GVS+DLY FLQ FF  HP+ A
Sbjct  160   LAWNEYGWDQASNLLYVDQPVGTGFSYTTDKSDIRHDETGVSDDLYDFLQAFFAEHPELA  219

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLK----GLAIGNGLTDPGIQYPAY  993
               +F++TGESYAGHYIPA   R+++GN+  EG+H+NLK    G AIGNGLTDP IQYPAY
Sbjct  220   NKDFYITGESYAGHYIPAFAARVHKGNRANEGVHVNLKACLQGFAIGNGLTDPAIQYPAY  279

Query  992   PDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEK  819
             PD+AL+  LI+++ HD L +++P C+ +++ C ++G ++C  S LV   C  L+  +M+ 
Sbjct  280   PDYALEMGLITQAEHDRLEKIVPLCELSIKLCGTDGTTSCLASYLV---CNTLFTGVMKH  336

Query  818   LVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDI  639
                +N+YDIRKKC  GSLCYDFSN E FLN +SV+ +LGVGDI++VSCST+VY+ M  D 
Sbjct  337   AGGVNHYDIRKKC-EGSLCYDFSNMEKFLNLQSVRKSLGVGDIEFVSCSTSVYQAMLQDW  395

Query  638   FKNLAPGIPSLLQDGINLLVYVGEYDLICNWL-GNLRWVQALQWYGQKGFGAAPNVTFSV  462
              +NL  GIP+LL+DGINLLVY GEYDLICNWL GN RWV A++W G++ F A+  V F V
Sbjct  396   MRNLEVGIPTLLEDGINLLVYAGEYDLICNWLAGNSRWVNAMEWSGKENFKASKEVPFVV  455

Query  461   GGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              GKE G  KSYG L+FLKVHDAGH+VPMDQPKA+LEML+ WM   L
Sbjct  456   DGKEAGKLKSYGQLSFLKVHDAGHMVPMDQPKAALEMLKGWMENSL  501



>ref|XP_010514837.1| PREDICTED: serine carboxypeptidase-like 48 [Camelina sativa]
Length=510

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/460 (60%), Positives = 353/460 (77%), Gaps = 12/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKL----KLNLLGDSGA-TVEDLGQH  1518
             AE++I+  NL P  D+N         ++ PRLVE++     +++  G  G+ +V+D G H
Sbjct  46    AERLIKGFNLLPTRDVNVIDKDG---SEAPRLVEREFDFSAEVDRRGSGGSPSVQDFGHH  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LPN+  ARMFYFFFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL
Sbjct  103   AGYYKLPNSKAARMFYFFFESRTNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN++GWDKASNLIYVDQP GTGFSY+S + D R DE+GVSNDLY FLQ FFK HP++  
Sbjct  163   TWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEEGVSNDLYDFLQAFFKEHPQFVN  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFYITGESYAGHYIPALASRVHRGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGS--ACSDLVNSRCQPLYDRIMEKLVDLN  804
             D  LI++S HD L +    CQ+++++C+++GG   AC+      C  ++ +IM+   ++N
Sbjct  283   DMKLITQSDHDSLNRNYATCQQSIKECSADGGEGDACASSY-VVCNNIFQKIMDIAGNVN  341

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  G+LCYDFSN E FLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL 
Sbjct  342   YYDVRKQC-EGNLCYDFSNMEKFLNQKSVRRALGVGDIEFVSCSTAVYDAMQMDWMRNLE  400

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LLQDGI LLVY GEYDLICNWLGN +WV  ++W GQK F AA  V F V  KE G
Sbjct  401   VGIPALLQDGIKLLVYAGEYDLICNWLGNSKWVHQMEWSGQKEFVAAATVPFLVDNKEAG  460

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K++G LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   LMKNHGSLTFLKVHDAGHMVPMDQPKAALQMLQNWMQGKL  500



>ref|XP_006851290.1| hypothetical protein AMTR_s00050p00101210 [Amborella trichopoda]
 gb|ERN12871.1| hypothetical protein AMTR_s00050p00101210 [Amborella trichopoda]
Length=501

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/458 (61%), Positives = 343/458 (75%), Gaps = 9/458 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             +  AEK+IR+LNL P   +     H  V A  PRLVEK+     +     +VE+LG HAG
Sbjct  39    RPHAEKLIRELNLLP--SVAEPEPHE-VGASMPRLVEKRFVWPGIVGDAVSVEELGHHAG  95

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY L +T  A+MFYFFFESR +K DP+VIWLTGGPGCSS LA+FYENGPF IA N SL W
Sbjct  96    YYSLQHTHAAKMFYFFFESRGSKDDPIVIWLTGGPGCSSELAVFYENGPFSIAKNLSLLW  155

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDK SNLIYVDQPTGTGFSY++ + D R +E GVS+DLY FLQ FFK HP+YAK++
Sbjct  156   NDYGWDKMSNLIYVDQPTGTGFSYTTDKRDLRHNEKGVSDDLYDFLQAFFKEHPQYAKND  215

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
              F+TGESYAGHYIPA  +R++QGNK KEGIHINLKG AIGNGLTDP IQY AY D+AL+ 
Sbjct  216   LFITGESYAGHYIPAFASRVHQGNKAKEGIHINLKGFAIGNGLTDPAIQYRAYTDYALEM  275

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYY  798
              LI +S +  + + +P C+ A++ C + G  +C  S LV   C  +++ IM  +   NYY
Sbjct  276   GLIQESDYKRINRFLPACELAIKLCGTQGTISCLASYLV---CNSIFNSIMGIVGKTNYY  332

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRK+C  GSLCYDFSN E FLN KSV+DALGVGDI +VSCS TVYE M +D  +NL  G
Sbjct  333   DIRKQC-EGSLCYDFSNMEKFLNKKSVRDALGVGDIQFVSCSPTVYEAMLTDWMRNLEVG  391

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DG+ LLVY GEYDLICNWLGN RWV +++W GQ+ F A+  + F V G E G  
Sbjct  392   IPALLEDGVKLLVYAGEYDLICNWLGNSRWVHSMEWSGQQQFVASSTIPFVVDGSEAGQL  451

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K+YG L+FLKVHDAGH+VPMDQPKA+LEML+RW+HG +
Sbjct  452   KTYGNLSFLKVHDAGHMVPMDQPKAALEMLKRWIHGHM  489



>gb|AAD42963.2|AF141384_1 serine carboxypeptidase precursor [Matricaria chamomilla]
Length=501

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/458 (60%), Positives = 340/458 (74%), Gaps = 6/458 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTP---RLVEKKLKL-NLLGDSGATVEDLGQH  1518
             +A  +IR LNLFP H +N       V  +     ++VEK  +  N +   G TVEDLG H
Sbjct  32    QASSLIRGLNLFPKHAVNLVEEDDYVRNNNSLDKKIVEKLFRFPNFVESDGVTVEDLGHH  91

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY++ ++  A+MFYFFFESR+NK DPVVIWLTGGPGCSS LALFYENGPF IADN +L
Sbjct  92    AGYYQIQHSHAAKMFYFFFESRNNKKDPVVIWLTGGPGCSSELALFYENGPFKIADNMTL  151

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWD+ASNLIYVDQPTGTGFSYSS + D R DE GVS+DLY FLQ FF  HP++  
Sbjct  152   VWNEYGWDQASNLIYVDQPTGTGFSYSSDKRDIRHDEQGVSDDLYDFLQAFFTEHPEFVD  211

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA+  R++QGNK KEGIHINLKG  IGNGLTDP IQY AY D+AL
Sbjct  212   NDFYITGESYAGHYIPAIAARVHQGNKAKEGIHINLKGFGIGNGLTDPAIQYQAYTDYAL  271

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             D  LI +S +  +  ++P C+ A++ C ++G  +C       C  ++  I+    ++NYY
Sbjct  272   DMGLIKESQYKRINLIVPLCEAAIKLCGTDGTVSCM-AAYVVCNTIFSSILSIAGNINYY  330

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRK+CV  S+CYDFS+ ET LN KSV+ ALGVGDI++VSCSTTVY  M  D+ +NL  G
Sbjct  331   DIRKECV-TSMCYDFSDMETLLNKKSVRQALGVGDIEFVSCSTTVYTAMLVDLMRNLEAG  389

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP LL+DGI +LVY GEYD+ICNWLGN RWV A++W G++ F A     F V G E G+ 
Sbjct  390   IPELLEDGIKMLVYAGEYDVICNWLGNSRWVHAMEWNGKEQFNALSEAPFEVDGSEAGLL  449

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KSYGPL+FLKVHDAGH+VPMDQPKA+LEML+RWM G L
Sbjct  450   KSYGPLSFLKVHDAGHMVPMDQPKAALEMLKRWMDGSL  487



>ref|XP_010425935.1| PREDICTED: serine carboxypeptidase-like 48 [Camelina sativa]
Length=510

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/460 (60%), Positives = 354/460 (77%), Gaps = 12/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKL----KLNLLGDSGA-TVEDLGQH  1518
             AE++I+  NL P  D+N         ++ PRLVE++     +++  G  G+ +V++ G H
Sbjct  46    AERLIKGFNLLPTRDINVIDKDG---SEAPRLVEREFDFSAEVDRRGSGGSPSVQEFGHH  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LPN+  ARMFYFFFESR+NK+DPVVIWLTGGPGCSS LALFYENGPF +++N SL
Sbjct  103   AGYYKLPNSKAARMFYFFFESRTNKADPVVIWLTGGPGCSSELALFYENGPFTVSNNSSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN++GWDKASNLIYVDQP GTGFSY+S + D R DE+GVSNDLY FLQ FFK HP++ K
Sbjct  163   TWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEEGVSNDLYDFLQAFFKEHPQFVK  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R+++GNK KEG HINLKG AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFYITGESYAGHYIPALASRVHRGNKNKEGAHINLKGFAIGNGLTNPEIQYGAYADYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGS--ACSDLVNSRCQPLYDRIMEKLVDLN  804
             D  LI++S HD L +    CQ+++++C+++GG   AC+      C  ++ +IM+   ++N
Sbjct  283   DMKLITQSDHDSLNRNYATCQQSIKECSADGGEGDACASSY-VVCNNIFQKIMDIAGNVN  341

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  G+LCYDFSN E FLN KSV+ ALGVGDI++VSCST VY+ M  D  +NL 
Sbjct  342   YYDVRKQC-EGNLCYDFSNMEKFLNQKSVRRALGVGDIEFVSCSTAVYDAMQMDWMRNLE  400

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI LLVY GEYDLICNWLGN +WV  ++W GQK F AA  V F V  KE G
Sbjct  401   VGIPALLEDGIKLLVYAGEYDLICNWLGNSKWVHQMEWSGQKEFVAAATVPFLVDSKEAG  460

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K++G LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   LMKNHGSLTFLKVHDAGHMVPMDQPKAALQMLQNWMQGKL  500



>ref|XP_007143762.1| hypothetical protein PHAVU_007G099400g [Phaseolus vulgaris]
 gb|ESW15756.1| hypothetical protein PHAVU_007G099400g [Phaseolus vulgaris]
Length=495

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/454 (63%), Positives = 347/454 (76%), Gaps = 12/454 (3%)
 Frame = -2

Query  1670  IRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLL-GDSGATVEDLGQHAGYYRLP  1497
             IR LNLFP  D+N    H P      ++VEK L+  NLL   SG ++++L   AGYY + 
Sbjct  35    IRDLNLFPSQDVN--IVHHP-NCHANKVVEKPLRFPNLLPSHSGVSLDNLTHSAGYYPIV  91

Query  1496  NTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGW  1317
             ++  ARMFYFFFESR++K DPVVIWLTGGPGCSS LA+FYENGPF IADN SL WNDYGW
Sbjct  92    HSHAARMFYFFFESRNSKKDPVVIWLTGGPGCSSELAVFYENGPFKIADNMSLVWNDYGW  151

Query  1316  DKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTG  1137
             DK SNL+YVDQPTGTGFSYS+ + D R DE+GVSNDLY FLQ FF  HP+YA+++FF+TG
Sbjct  152   DKVSNLLYVDQPTGTGFSYSTDKRDIRHDEEGVSNDLYDFLQAFFAEHPEYAENDFFITG  211

Query  1136  ESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISK  957
             ESYAGHYIPA   R+++GNK KEG HINLKG AIGNGLTDP IQY AY D+ALD  LI K
Sbjct  212   ESYAGHYIPAFAARVHRGNKAKEGTHINLKGFAIGNGLTDPAIQYKAYTDYALDVGLIQK  271

Query  956   SFHDELTQL-IPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             + +D + +L +P C+ A++ C ++G  AC  S LV   C  +++ IM    ++NYYDIRK
Sbjct  272   TDYDHINKLMVPACEMAIKLCGTDGTIACTASYLV---CNTIFNSIMSHAGNINYYDIRK  328

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             KC  GSLCYDFSN E FLN KSV+DAL VGDI +VSCS+TVY+ M  D  +NL  GIP+L
Sbjct  329   KC-EGSLCYDFSNMEKFLNLKSVRDALAVGDIAFVSCSSTVYQAMLVDWMRNLEVGIPAL  387

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DGIN+LVY GEYDLICNWLGN +WV A++W GQK F ++P V F+V   E G+ K+YG
Sbjct  388   LEDGINMLVYAGEYDLICNWLGNSKWVHAMEWSGQKEFVSSPEVPFTVDDSEAGLLKNYG  447

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PL+FLKVHDAGH+VPMDQPKASLEML+RW  G L
Sbjct  448   PLSFLKVHDAGHMVPMDQPKASLEMLKRWTQGTL  481



>ref|XP_002462855.1| hypothetical protein SORBIDRAFT_02g033170 [Sorghum bicolor]
 gb|EER99376.1| hypothetical protein SORBIDRAFT_02g033170 [Sorghum bicolor]
Length=521

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/459 (62%), Positives = 343/459 (75%), Gaps = 9/459 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVE---ADTPRLVEKKLKLNLLGDSG---ATVEDLGQ  1521
             A  +IR LNL P  D +  S  + VE   A    LVE+ ++L    D+G    +VEDLG 
Sbjct  52    AVDLIRALNLHP-SDASPPSSTAGVEGALASAGTLVERPIRLAFFADAGDASTSVEDLGH  110

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYYRLPNT DARMFYFFFESR  + DPVVIWLTGGPGCSS LALFYENGPF IADN S
Sbjct  111   HAGYYRLPNTHDARMFYFFFESRGQEDDPVVIWLTGGPGCSSELALFYENGPFNIADNLS  170

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WND+GWDKASNLIYVDQPTGTGFSYSS   D R +E  +SNDLY FLQ FF  HPKYA
Sbjct  171   LVWNDFGWDKASNLIYVDQPTGTGFSYSSDSRDTRHNEATISNDLYDFLQAFFAEHPKYA  230

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++FF+TGESYAGHYIPA  +R++QGNK  EGIHINLKG AIGNGLTDP IQY AYPD+A
Sbjct  231   KNDFFITGESYAGHYIPAFASRVHQGNKNNEGIHINLKGFAIGNGLTDPAIQYKAYPDYA  290

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNY  801
             LD  LI+K+  + + +++P C+ AV+ C ++G  +C       C  ++  I   + + NY
Sbjct  291   LDMGLITKTQFNRINKIVPTCELAVKLCGTSGTVSCL-AAYFVCNTIFSAIRTIIGNKNY  349

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRK C+ GSLCYDF+N E FLN KSV+++LGVGDI++VSCS TVYE M  D  +NL  
Sbjct  350   YDIRKPCI-GSLCYDFNNLEKFLNLKSVRESLGVGDIEFVSCSPTVYEAMLLDWMRNLEV  408

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP LL+  I +L+Y GEYDLICNWLGN RWV +++W G++ F ++    F+V GKE G+
Sbjct  409   GIPELLESDIKVLIYAGEYDLICNWLGNSRWVNSMEWSGKEAFVSSAEKPFTVDGKEAGV  468

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              KS+GPL+FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  469   LKSHGPLSFLKVHDAGHMVPMDQPKAALEMLKRWTSGNL  507



>ref|XP_003538168.1| PREDICTED: serine carboxypeptidase-like 48-like [Glycine max]
 gb|KHN38715.1| Serine carboxypeptidase-like 48 [Glycine soja]
Length=488

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/458 (61%), Positives = 349/458 (76%), Gaps = 8/458 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP-RLVEKKLKLNLLGDSGATVEDLGQHA  1515
             + +AE + R LNLFP   +N   G    ++  P ++VEKK   +LLG SG +++ LG HA
Sbjct  36    QSQAEMLTRNLNLFPKDPVNIIKGD--FDSFVPGKIVEKKF--SLLGHSGPSIQHLGHHA  91

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             G+Y LP++  ARMFYFFFESR+NK DPVVIWLTGGPGC S LALFYENGPF+IA+N SL 
Sbjct  92    GHYSLPHSKAARMFYFFFESRNNKDDPVVIWLTGGPGCGSELALFYENGPFHIANNLSLT  151

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWD+ASN+++VDQPTGTGFSYSS + D R DE  +SNDLY FLQEFFKAHPK+ K+
Sbjct  152   WNDYGWDQASNILFVDQPTGTGFSYSSDDSDIRHDEASISNDLYDFLQEFFKAHPKFVKN  211

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPAL +RI QGNK+ +GI+INLKGLAIGNG T+P IQY AYPDFALD
Sbjct  212   DFYITGESYAGHYIPALASRIIQGNKENQGIYINLKGLAIGNGATNPAIQYQAYPDFALD  271

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
             N +I+K+ +DE+ +LIP C++A + C + GG +C+   N+ CQ ++  I++    +NYYD
Sbjct  272   NKIITKANYDEINKLIPDCEQAAKTCETQGGQSCAIAFNT-CQKIFYHILDFAPGINYYD  330

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVG-DIDWVSCSTTVYEVMSSDIFKNLAPG  618
             IRKKC  G  CYDF N ET LN   VK  +GV  D+ +VSCS  V+E M  D  +N+   
Sbjct  331   IRKKC-KGDWCYDFRNVETLLNLPKVKSVIGVSNDLQYVSCSKRVHEAMMQDYMRNMEVE  389

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IPSLL+DGI LLVYVGE DLICNWLGN RWV A++W G+K FG +P V F V G + G  
Sbjct  390   IPSLLEDGIKLLVYVGEEDLICNWLGNSRWVHAMKWSGKKAFGKSPTVKFVVDGSKAGSL  449

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              SYGPL+FLKVH+AGHLVPMDQPKA+L+ML+ WM G+L
Sbjct  450   NSYGPLSFLKVHEAGHLVPMDQPKAALQMLQSWMAGKL  487



>gb|KEH43478.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=502

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/462 (61%), Positives = 345/462 (75%), Gaps = 9/462 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPR---LVEKKLKL-NLLG--DSGATVEDLGQ  1521
             A+ +IR LNLFP HD+N       VE +      +VEK LK  N  G  D G  ++DL  
Sbjct  31    AKNLIRNLNLFPSHDINILDAKPNVEENQNNNKIIVEKPLKFPNFSGEYDEGVCIDDLAH  90

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
              AGYY + ++  A+MFYFFFESR NK DPVVIWLTGGPGCSS LA+FYENGPF IA+N S
Sbjct  91    RAGYYPIQHSHAAKMFYFFFESRKNKKDPVVIWLTGGPGCSSELAVFYENGPFKIANNLS  150

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WN++GWDK SNL+YVDQPTGTGFSY++ + D R DEDGVSNDLY FLQ FF  HP+YA
Sbjct  151   LVWNEFGWDKVSNLLYVDQPTGTGFSYTTDKRDIRHDEDGVSNDLYDFLQAFFGEHPEYA  210

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
              ++FF+TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDP IQY AY D+A
Sbjct  211   TNDFFITGESYAGHYIPAFAARVHKGNKAKEGIHINLKGFAIGNGLTDPAIQYKAYADYA  270

Query  980   LDNNLISKSFHDELTQ-LIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLN  804
             LD  +I ++ +D + + ++P C+ A++ C ++G  AC+      C  +++ IM    D+N
Sbjct  271   LDMGVIKQADYDHINKVMVPACELAIKLCGTDGKIACT-ASYFVCNTIFNSIMSHAGDIN  329

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYDIRKKC  G+LCYDFSN E FLN  SV+ ALGVGDID+VSCS+TVY+ M  D  +NL 
Sbjct  330   YYDIRKKC-DGNLCYDFSNMEKFLNQGSVRKALGVGDIDFVSCSSTVYQAMLVDWMRNLE  388

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGINLLVY GEYDLICNWLGN RWV A++W GQK F A+  V F+V   E G
Sbjct  389   VGIPALLEDGINLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFAASSEVPFTVDDSEAG  448

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             + K+YGPL+FLKV DAGH+VPMDQPKASL+ML++W  G L K
Sbjct  449   VLKNYGPLSFLKVRDAGHMVPMDQPKASLQMLKKWTRGTLSK  490



>ref|XP_004487064.1| PREDICTED: serine carboxypeptidase-like 48-like [Cicer arietinum]
Length=502

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/463 (60%), Positives = 350/463 (76%), Gaps = 17/463 (4%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPR-----LVEKKLKLNLLGDSGATVEDLGQH  1518
             AEK+IR +NLFP   +N       +  + P      +VEKK       D+ A+ E+LG H
Sbjct  39    AEKLIRGMNLFPKDSIN-------LPENDPHFVHGNIVEKKFTFPGFDDTSASAEELGHH  91

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQ--  1344
             AGYYRLPN+  ARMFYFFFESR+NK DPVVIWLTGGPGCSS LALFYENGPF    N+  
Sbjct  92    AGYYRLPNSKAARMFYFFFESRNNKDDPVVIWLTGGPGCSSELALFYENGPFQFTKNKKN  151

Query  1343  -SLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPK  1167
              SLF N+YGWDKASN+I+VDQPTGTGFSY++ + D R  ED VSNDLY FLQ FFK HP+
Sbjct  152   LSLFLNEYGWDKASNIIFVDQPTGTGFSYTTDDSDIRHGEDEVSNDLYDFLQAFFKEHPQ  211

Query  1166  YAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPD  987
             + K++F++TGESYAGHYIPAL +R+++GNK KEGIHINLKGLAIGNGLT+P IQY AY +
Sbjct  212   FTKNDFYITGESYAGHYIPALASRVHKGNKAKEGIHINLKGLAIGNGLTNPEIQYKAYTE  271

Query  986   FALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDL  807
             FAL  +LI+K  +D + +LIP C++A++ C + GG AC   + S C  ++++I+E   ++
Sbjct  272   FALQRDLITKDQYDTIGKLIPPCEQAIKACETKGGDACETSL-SICTDIFNQILENTDNI  330

Query  806   NYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNL  627
             NYYDIRKKC  G+LCYDFS  ETFLN K+VK+ALGVGD+D+VSCS+TVY  M  D  +NL
Sbjct  331   NYYDIRKKC-EGNLCYDFSKVETFLNKKTVKEALGVGDLDFVSCSSTVYSAMQQDWMRNL  389

Query  626   APGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEK  447
               GIPSLL+DGI +LVY GE DLICNWLGN  WV+ + W G+  FGA+P   F V G+E 
Sbjct  390   EVGIPSLLEDGIKVLVYAGEEDLICNWLGNFWWVRDMVWSGKNEFGASPTTPFLVDGEEA  449

Query  446   GIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             G+ +S+GPL FLKV +AGH+VPMDQPKA+L+ML+ WM G+L K
Sbjct  450   GMLQSHGPLAFLKVKEAGHMVPMDQPKAALQMLKDWMQGKLTK  492



>gb|KDO60257.1| hypothetical protein CISIN_1g010473mg [Citrus sinensis]
Length=505

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/429 (64%), Positives = 336/429 (78%), Gaps = 2/429 (0%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K +AEK+IR LNLFP   +N  +         P+LVEK+L LN LGD G +V++ G HAG
Sbjct  43    KLQAEKLIRGLNLFPKSSVNTAAAGDHASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAG  102

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY LP++  ARMFYFFFESR+NKSDPVVIWLTGGPGCSS LALFYENGPF+IA+N SL W
Sbjct  103   YYTLPHSQSARMFYFFFESRNNKSDPVVIWLTGGPGCSSELALFYENGPFHIANNLSLVW  162

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDKASNL++VDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  HP+YAK++
Sbjct  163   NDYGWDKASNLLFVDQPTGTGFSYTSDKDDIRHDEEGVSNDLYDFLQAFFAEHPQYAKND  222

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R+++GNK+K+GIHINLKG AIGNGLTDP IQY  Y ++AL+ 
Sbjct  223   FYITGESYAGHYIPAFASRVHKGNKEKQGIHINLKGFAIGNGLTDPAIQYKEYTEYALNM  282

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI +S ++ + +LIP C+ A++ C S+GG ACS    + C  ++++I+    D+NYYDI
Sbjct  283   RLIKQSDYESINKLIPTCEHAIKTCESDGGDACSSSY-AVCNSIFNKILGIAGDVNYYDI  341

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RKKC  G LCYDFSN E FLN KSV++ALGVGDID+VSCS+TVYE M  D  +N   GIP
Sbjct  342   RKKC-EGDLCYDFSNMERFLNEKSVREALGVGDIDFVSCSSTVYEAMLMDWMRNFEVGIP  400

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK FGAA  V F V G E G  KS
Sbjct  401   TLLEDGIRVLIYAGEYDLICNWLGNSKWVHAMEWSGQKDFGAAATVPFKVDGAETGQIKS  460

Query  431   YGPLTFLKV  405
             +GPLTFLKV
Sbjct  461   HGPLTFLKV  469



>ref|XP_009126578.1| PREDICTED: serine carboxypeptidase-like 47 [Brassica rapa]
Length=502

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/458 (62%), Positives = 345/458 (75%), Gaps = 12/458 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLN-LLG----DSGATVEDLGQH  1518
             AE++IR  NL P HD+N  +  SP   D PRLVE ++    ++G      G +V++ G +
Sbjct  43    AERLIRSFNLMPEHDVNVIAKGSP---DGPRLVESQINFQEMIGMRNTSGGPSVQEFGHY  99

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY L  +  A+MFYFFFESR+N +D  +IWL+GGPGCSSS+ALFYENGPF I+D+ SL
Sbjct  100   AGYYSLTRSKSAKMFYFFFESRTNNTD--LIWLSGGPGCSSSVALFYENGPFTISDDLSL  157

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WND+GWDK SNLIYVDQP GTGFSY S   D R DE GVSNDLY FLQ FFK HPKYAK
Sbjct  158   SWNDFGWDKVSNLIYVDQPVGTGFSYVSDLSDLRHDETGVSNDLYDFLQAFFKEHPKYAK  217

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPAL +R++ GNK  EG+ INLKGLAIGNGLT+P IQY AY D+AL
Sbjct  218   NDFYITGESYAGHYIPALASRVHSGNKNNEGVPINLKGLAIGNGLTNPEIQYGAYGDYAL  277

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             +  LIS+S H+ L Q    CQ   +QCN NGG  C+    + C  ++D+IM K+   NYY
Sbjct  278   EMKLISESDHESLKQDYVDCQSVTKQCNLNGGEECTSAYRT-CTNIFDQIMSKIEGTNYY  336

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             D+RKKCV G LCYDFS  ETFLN ++V+ ALGVGD+ +VSCSTTVY+ M  D   NLA  
Sbjct  337   DLRKKCV-GDLCYDFSKMETFLNQENVRKALGVGDVKFVSCSTTVYDGMLEDWMVNLAVK  395

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+L++DGIN+LVY GEYDLICNWLGN RWV+ + W GQK FGAA  V F V GKE G+ 
Sbjct  396   IPALVEDGINVLVYAGEYDLICNWLGNSRWVEQMNWSGQKDFGAAKTVPFLVDGKEAGLM  455

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K++GPLTFLKVHDAGHLVPMDQPKASL+ML+ WM G+L
Sbjct  456   KNHGPLTFLKVHDAGHLVPMDQPKASLQMLQTWMQGKL  493



>ref|XP_002453162.1| hypothetical protein SORBIDRAFT_04g001030 [Sorghum bicolor]
 gb|EES06138.1| hypothetical protein SORBIDRAFT_04g001030 [Sorghum bicolor]
Length=498

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/454 (61%), Positives = 349/454 (77%), Gaps = 9/454 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             +AE++IR LNL P     +G G  P  A    L+E++++L  + D    V DLG HAGY+
Sbjct  40    QAERLIRALNLLPKE---KGGGDGPSVAPG-ELLERRIRLPGVPDG---VGDLGHHAGYF  92

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP+T DARMFYFFFESR  K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL WN 
Sbjct  93    RLPHTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLVWNK  152

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWD  SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY FLQ FFK HP++AK++F+
Sbjct  153   FGWDTISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQVFFKKHPEFAKNDFY  212

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGNK  EGIHINLKG AIGNGLTDP IQY AY D+AL+ NL
Sbjct  213   ITGESYAGHYIPAFASRVHQGNKANEGIHINLKGFAIGNGLTDPEIQYKAYTDYALEMNL  272

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I KS ++ + + IP C+ A++ C ++G ++C       C  +++ IM+ +   NYYD+RK
Sbjct  273   IEKSDYERINRFIPPCEFAIKMCGTDGKASCM-AAYMVCNNIFNSIMKLVGTKNYYDVRK  331

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             +C  G LCYDFSN E F   K+VK+ALGVGDID+VSCSTTVYE M +D  +NL  GIP+L
Sbjct  332   EC-EGKLCYDFSNLEKFFGDKAVKEALGVGDIDFVSCSTTVYEAMLTDWMRNLEVGIPAL  390

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DGIN+L+Y GEYDLICNWLGN RWV +++W GQK F ++ +++F V G E G+ KS+G
Sbjct  391   LEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFVSSSDLSFVVDGAEAGVLKSHG  450

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PL+FLKVH+AGH+VPMDQPKASLEMLRR+  G+L
Sbjct  451   PLSFLKVHNAGHMVPMDQPKASLEMLRRFTQGKL  484



>ref|XP_002266451.1| PREDICTED: serine carboxypeptidase-like [Vitis vinifera]
 emb|CAN76135.1| hypothetical protein VITISV_040054 [Vitis vinifera]
 emb|CBI31398.3| unnamed protein product [Vitis vinifera]
Length=504

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/464 (61%), Positives = 346/464 (75%), Gaps = 19/464 (4%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEA---DTPR-LVEKKLKLNLL--GDSGATVED  1530
             K +AEK+IR+LNLFP           PV A   ++P+ LVE +L+   +   D+  +VED
Sbjct  35    KSQAEKLIRELNLFP-------KDAEPVNAVGRESPKSLVETRLRFPGIDYSDASVSVED  87

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYY++ ++  ARMFY FFESR N+ DPVVIWLTGGPGCSS LA+FYENGPF IA 
Sbjct  88    LGHHAGYYKIKHSSAARMFYLFFESRDNRKDPVVIWLTGGPGCSSELAVFYENGPFTIAK  147

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WN++GWDK SNL+YVDQP GTGFSYSS + D R +E+GVSNDLY FLQ FF+ HP
Sbjct  148   NLSLLWNEFGWDKVSNLLYVDQPIGTGFSYSSDKHDIRHNEEGVSNDLYDFLQAFFEEHP  207

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++A ++F++TGESYAGHYIPA   R+++GNK KEGIHI LKG AIGNGLTDP IQY AY 
Sbjct  208   QFADNDFYITGESYAGHYIPAFAARVHRGNKAKEGIHIKLKGFAIGNGLTDPQIQYKAYT  267

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKL  816
             D+ALD  +I K  +D + +++P C+ A+R C ++G  +C  S  V   C  ++  IM   
Sbjct  268   DYALDMGIIQKPDYDRINKVLPVCEMAIRLCGTDGTISCMASYFV---CNTIFSSIMAIA  324

Query  815   VDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIF  636
              D NYYDIRKKC  GSLCYDFSN E FLN +SV+DALGVGDID+VSCS TVY+ M  D  
Sbjct  325   GDANYYDIRKKC-EGSLCYDFSNMERFLNQRSVRDALGVGDIDFVSCSPTVYQAMLMDWM  383

Query  635   KNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGG  456
             +NL  GIP+LL+D + LLVY GEYDLICNWLGN RWV A++W GQK F A+  + F V  
Sbjct  384   RNLEVGIPALLEDEVKLLVYAGEYDLICNWLGNSRWVHAMKWSGQKDFQASLEIPFEVRD  443

Query  455   KEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
                G+ KSYGPLTFLKVHDAGH+VPMDQP+ASLEML+RWM G+L
Sbjct  444   SHAGLVKSYGPLTFLKVHDAGHMVPMDQPEASLEMLKRWMEGKL  487



>ref|NP_001045667.1| Os02g0114200 [Oryza sativa Japonica Group]
 sp|P37891.1|CBP3_ORYSJ RecName: Full=Serine carboxypeptidase 3; AltName: Full=Serine 
carboxypeptidase III; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA01757.1| serine carboxypeptidase III [Oryza sativa Japonica Group]
 dbj|BAD07926.1| Serine carboxypeptidase III precursor [Oryza sativa Japonica 
Group]
 dbj|BAD07648.1| Serine carboxypeptidase III precursor [Oryza sativa Japonica 
Group]
 dbj|BAF07581.1| Os02g0114200 [Oryza sativa Japonica Group]
 gb|EAY84186.1| hypothetical protein OsI_05564 [Oryza sativa Indica Group]
 gb|EAZ21483.1| hypothetical protein OsJ_05092 [Oryza sativa Japonica Group]
 dbj|BAG87715.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/454 (61%), Positives = 343/454 (76%), Gaps = 6/454 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             +AE++IR LNL P      G+G  P  A    L+E+++ L  L      V DLG HAGYY
Sbjct  36    QAERLIRSLNLLPKEAGPTGAGDVPSVAPG-ELLERRVTLPGLPQG---VGDLGHHAGYY  91

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLPNT DARMFYF FESR  K DPVVIWLTGGPGCSS LA+FYENGPF I++N SL WN 
Sbjct  92    RLPNTHDARMFYFLFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTISNNMSLAWNK  151

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWD  SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY+FLQ FFK HP++AK++FF
Sbjct  152   FGWDTISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYSFLQVFFKKHPEFAKNDFF  211

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGNK  EGIHINLKG AIGNGLTDP IQY AY D+ALD NL
Sbjct  212   ITGESYAGHYIPAFASRVHQGNKANEGIHINLKGFAIGNGLTDPAIQYKAYTDYALDMNL  271

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I KS +D + + IP C+ A++ C +NG ++C       C  ++  IM+ +   NYYD+RK
Sbjct  272   IKKSDYDRINKFIPPCEFAIKLCGTNGKASCM-AAYMVCNSIFSSIMKLVGTKNYYDVRK  330

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             +C  G LCYDFSN E F   K+VK+A+GVGD+++VSCSTTVY+ M +D  +NL  GIP+L
Sbjct  331   EC-EGKLCYDFSNLEKFFGDKAVKEAIGVGDLEFVSCSTTVYQAMLTDWMRNLEVGIPAL  389

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DGIN+L+Y GEYDLICNWLGN RWV +++W GQK F ++    F V G E G+ KS+G
Sbjct  390   LEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFVSSHESPFVVDGAEAGVLKSHG  449

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PL+FLKVH+AGH+VPMDQPKASLEMLRR+  G+L
Sbjct  450   PLSFLKVHNAGHMVPMDQPKASLEMLRRFTQGKL  483



>ref|XP_008805718.1| PREDICTED: serine carboxypeptidase-like [Phoenix dactylifera]
Length=508

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/456 (60%), Positives = 347/456 (76%), Gaps = 8/456 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
              AEK+IR LNL P  D +     +  +A   R++E++  L  L   G + E+LG HAGYY
Sbjct  45    HAEKLIRALNLLP-KDASPEPAEAADDASAKRIIERRFNLAGL-TGGVSDEELGHHAGYY  102

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP+T DARMFY FFESR +K DPVVIWLTGGPGCSS LA+FYENGPF IADN SL WN+
Sbjct  103   RLPHTHDARMFYLFFESRHSKKDPVVIWLTGGPGCSSELAVFYENGPFTIADNMSLAWNE  162

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWD+ASNL+YVDQPTGTGFSYS+   D R DE+GVS+DLY FLQ FF  HP+YA ++F+
Sbjct  163   FGWDQASNLLYVDQPTGTGFSYSTDSRDIRHDENGVSDDLYDFLQAFFAEHPEYASNDFY  222

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGN  KEG +INLKG AIGNGLTDP IQY AY D+ALDN +
Sbjct  223   ITGESYAGHYIPAFASRVHQGNNAKEGTYINLKGFAIGNGLTDPAIQYKAYTDYALDNGI  282

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDI  792
             I +S +  +    P C+ A++ C ++G  +C  S LV   C  ++  I++   ++NYYDI
Sbjct  283   IKESEYKRINMFYPACEYAIKLCGTSGTISCLASYLV---CNTIFSSIIKIGGNINYYDI  339

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK+CV GSLCYDFSN E FLN K V+++LGVGDI++VSCS TVY+ M  D  +NL  GIP
Sbjct  340   RKQCV-GSLCYDFSNMEKFLNLKYVRESLGVGDIEFVSCSPTVYQAMLMDWMRNLEVGIP  398

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI LLVY GEYDLICNWLGN RWV +++W GQ+ F ++  ++F+V GKE G+ KS
Sbjct  399   ALLEDGIKLLVYAGEYDLICNWLGNSRWVHSMEWSGQQNFVSSSELSFTVDGKEAGVLKS  458

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPL+FLKV DAGH+VPMDQPKA+LEML+RW+ G L
Sbjct  459   HGPLSFLKVRDAGHMVPMDQPKAALEMLKRWIQGNL  494



>ref|XP_002884793.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61052.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=543

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/486 (59%), Positives = 352/486 (72%), Gaps = 36/486 (7%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEA-DTPRLVEKKLKL-NLLGDSG-ATVEDLGQH  1518
             RAEK+IR+LNLFP  DLN       P+ A +   +VE+K    N+L D+G ATVEDLG H
Sbjct  42    RAEKLIRELNLFPQQDLNVIDVADLPLTAAEGSGIVERKFVFPNILADNGGATVEDLGHH  101

Query  1517  AGYYRLPNTVDAR--------------------------MFYFFFESRSNKSDPVVIWLT  1416
             AGYY+LP +  AR                          MFYFFFESR+ K  PVVIWLT
Sbjct  102   AGYYKLPKSRGARFISNSRFWFMHLYICVREDSASDLLCMFYFFFESRNKKDAPVVIWLT  161

Query  1415  GGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFR  1236
             GGPGCSS LA+FYENGPF I  N SL WN+YGWD+ SNL+YVDQP GTGFSY++ + D R
Sbjct  162   GGPGCSSELAMFYENGPFKITSNMSLAWNEYGWDQVSNLLYVDQPVGTGFSYTTDKSDIR  221

Query  1235  TDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHI  1056
              DE GVSNDLY FLQ FF  HPK AK++F++TGESYAGHYIPAL  R+++GNK  EG+HI
Sbjct  222   HDETGVSNDLYDFLQAFFAEHPKLAKNDFYITGESYAGHYIPALAARVHKGNKANEGVHI  281

Query  1055  NLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSA  876
             NLKG AIGNGLTDP +QYPAYPD+AL+  LI++  HD L +++P C+ +++ C ++G ++
Sbjct  282   NLKGFAIGNGLTDPALQYPAYPDYALEMGLITQKEHDRLEKIVPLCELSIKLCGTDGTTS  341

Query  875   C--SDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALG  702
             C  S LV   C  L+  +M     +NYYDIRKKCV GSLCYDFSN E FLN +SV+ +LG
Sbjct  342   CLASYLV---CNSLFSGVMSHAGGVNYYDIRKKCV-GSLCYDFSNMEKFLNLQSVRKSLG  397

Query  701   VGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQ  522
             VGDI++VSCST+VY+ M  D  +NL  GIP+LL+DGI+LLVY GEYDLICNWLGN RWV 
Sbjct  398   VGDIEFVSCSTSVYQAMLVDWMRNLEVGIPTLLEDGISLLVYAGEYDLICNWLGNSRWVN  457

Query  521   ALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRR  342
             A++W G+  FGAA  V F V GKE G+ K+Y  L+FLKV DAGH+VPMDQPKA+L+ML+R
Sbjct  458   AMEWSGKTNFGAAEQVPFMVDGKEAGLLKTYEQLSFLKVRDAGHMVPMDQPKAALKMLKR  517

Query  341   WMHGQL  324
             WM   L
Sbjct  518   WMENSL  523



>ref|XP_004514874.1| PREDICTED: serine carboxypeptidase-like 49-like [Cicer arietinum]
Length=505

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/459 (62%), Positives = 349/459 (76%), Gaps = 5/459 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP-RLVEKKLKL-NLLGDSGATVEDLGQH  1518
             K  A+K++R LNLFP  +LN  + +S    +   ++VEK+L+  NL+ D   +V+D G +
Sbjct  35    KLEAKKLVRDLNLFPDVNLNIAAANSSSSLEHHGKIVEKRLRFSNLVSDDDVSVDDFGHY  94

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY + ++  ARMFYFFFESR++K DPVVIWLTGGPGCSS LALFYENGPF I ++ SL
Sbjct  95    AGYYPIRHSHAARMFYFFFESRNSKEDPVVIWLTGGPGCSSELALFYENGPFKINNDLSL  154

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWDK SN++YVDQPTGTGFSYSS   D R +E GVSNDLY FLQ FF  HP+YAK
Sbjct  155   VWNEYGWDKVSNILYVDQPTGTGFSYSSDLRDIRHNEKGVSNDLYDFLQAFFAEHPQYAK  214

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             + FF+TGESYAGHYIPAL +RI QGN+ KEGIHINLKGLAIGNGLT+P IQY AY D+AL
Sbjct  215   NNFFITGESYAGHYIPALASRIRQGNQAKEGIHINLKGLAIGNGLTNPAIQYKAYADYAL  274

Query  977   DNNLISKSFHDEL-TQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNY  801
             D  +I+K+ HD L   L+P C+ A++ C ++G  AC    N  C  ++  I+    D+NY
Sbjct  275   DMGIITKATHDRLGLVLVPACELAIKLCGTDGKLACLT-ANVACNLIFSDILLHAGDVNY  333

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKC  GSLCYDFSN E FLN +SV+D+LGVG I +VSCST VY  M  D  +NL  
Sbjct  334   YDIRKKC-EGSLCYDFSNMEKFLNQESVRDSLGVGKISFVSCSTEVYIAMLVDWMRNLEV  392

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP LL+DGINLLVY GEYDLICNWLGN RWV A++W GQK F A+P+V F V G E G+
Sbjct  393   GIPILLEDGINLLVYAGEYDLICNWLGNSRWVHAMEWSGQKKFVASPDVPFVVNGSEAGL  452

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K+YGPL+FLKV+DAGH+VPMDQPKA+LEML++W  G L
Sbjct  453   LKNYGPLSFLKVYDAGHMVPMDQPKAALEMLKKWTRGTL  491



>emb|CDX73927.1| BnaA03g31200D [Brassica napus]
Length=523

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/467 (59%), Positives = 349/467 (75%), Gaps = 17/467 (4%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN-----RGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLG  1524
             RAEK+IR+LNLFP  D+N       +  S  E + P +VE+  +  N++ D GATVEDLG
Sbjct  40    RAEKLIRELNLFPKLDVNVIDVTDSTLASAEEEEVPSIVERSFRFPNIVSDGGATVEDLG  99

Query  1523  QHAGYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADN  1347
              HAGY++LP +  ARMFYFFFESR+ K D PVVIWLTGGPGCSS LA+FYENGPF I  N
Sbjct  100   HHAGYFKLPKSQGARMFYFFFESRTKKKDAPVVIWLTGGPGCSSELAMFYENGPFKIDKN  159

Query  1346  QSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPK  1167
              SL WN+YGWD+ SNL+YVDQP GTGFSY++ + D R DE GVS+DLY FLQ FF  HP 
Sbjct  160   MSLAWNEYGWDQVSNLLYVDQPVGTGFSYTTDKSDIRHDETGVSDDLYDFLQAFFAEHPT  219

Query  1166  YAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLK----GLAIGNGLTDPGIQYP  999
              A  +F++TGESYAGHYIPA   R+++GN+  EG+H+NLK    G AIGNGLTDP IQYP
Sbjct  220   LANKDFYITGESYAGHYIPAFAARVHKGNRANEGVHVNLKAFLQGFAIGNGLTDPAIQYP  279

Query  998   AYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIM  825
             AYPD+AL+  LI+++ HD L +++P C+ +++ C ++G ++C  S LV   C  L+  +M
Sbjct  280   AYPDYALEMGLITQAEHDRLEKIVPLCELSIKLCGTDGTTSCLASYLV---CNTLFTGVM  336

Query  824   EKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSS  645
             +    +N+YDIRKKC  GSLCYDFS+ E FLN +SV+ +LGVGDI++VSCST+VY+ M  
Sbjct  337   KHAGGVNHYDIRKKC-EGSLCYDFSDMEKFLNLQSVRKSLGVGDIEFVSCSTSVYQAMLQ  395

Query  644   DIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFS  465
             D  +NL  GI +LL+DGINLLVY GEYDLICNWLGN RWV A++W G++ F A+  V F 
Sbjct  396   DWMRNLEVGILTLLEDGINLLVYAGEYDLICNWLGNSRWVNAMEWSGKENFKASKEVPFL  455

Query  464   VGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             V GKE G  KSYG L+FLKVHDAGH+VPMDQPKA+LEML+ WM   L
Sbjct  456   VDGKEAGKLKSYGQLSFLKVHDAGHMVPMDQPKAALEMLKGWMENSL  502



>ref|XP_006648225.1| PREDICTED: serine carboxypeptidase 3-like [Oryza brachyantha]
Length=497

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/456 (61%), Positives = 343/456 (75%), Gaps = 6/456 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K +AE++IR LNL P      G G  P  A    L+E+++ L  L      V DLG HAG
Sbjct  34    KTQAERLIRSLNLLPKEAGPAGGGDVPSVAPG-ELLERRVTLPGLPQG---VGDLGHHAG  89

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YYRLPNT DARMFYF FESR  K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL W
Sbjct  90    YYRLPNTHDARMFYFLFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLAW  149

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             N +GWD  SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY+FLQ FFK HP++AK++
Sbjct  150   NKFGWDTISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYSFLQVFFKKHPEFAKND  209

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             FF+TGESYAGHYIPA  +R++QGNK  EGIHINLKG AIGNGLTDP IQY AY D+ALD 
Sbjct  210   FFITGESYAGHYIPAFASRVHQGNKANEGIHINLKGFAIGNGLTDPAIQYKAYTDYALDM  269

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
             NLI KS +D + + IP C+ A++ C +NG ++C       C  ++  IM+ +   NYYD+
Sbjct  270   NLIQKSDYDRINKFIPPCEFAIKLCGTNGKTSCM-AAYMVCNSIFSSIMKLVGTKNYYDV  328

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK+C  G LCYDFSN + F   K+VK+A+GVGD+++VSCSTTVY+ M +D  +NL  GIP
Sbjct  329   RKEC-EGKLCYDFSNLDKFFGDKTVKEAIGVGDLEFVSCSTTVYQAMLTDWMRNLEVGIP  387

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGIN+L+Y GEYDLICNWLGN RWV +++W GQK F ++  + F V G E G+ K+
Sbjct  388   ALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFVSSHELPFVVDGAEAGVLKN  447

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +G L+FLKVH+AGH+VPMDQPKASLEMLRR+  G+L
Sbjct  448   HGALSFLKVHNAGHMVPMDQPKASLEMLRRFTQGKL  483



>ref|XP_010267214.1| PREDICTED: serine carboxypeptidase-like [Nelumbo nucifera]
Length=501

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/458 (61%), Positives = 345/458 (75%), Gaps = 10/458 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSG--ATVEDLGQH  1518
             K +AEK+IR+LNL P  D       S V A  P+L+EK+ K   L D     T EDLG +
Sbjct  42    KAQAEKLIRELNLLP-KDAVEVVDDSSV-AVAPKLIEKRFKFPNLADPEPEVTAEDLGHY  99

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYYRL ++  ARMFYFFF+SR++K DPVVIWLTGGPGCSS +ALFYENGPF IA+N SL
Sbjct  100   AGYYRLQHSHAARMFYFFFQSRNSKRDPVVIWLTGGPGCSSEIALFYENGPFTIANNLSL  159

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWD ASNL+YVDQPTGTGFSYSS + D R +E+GVSNDLY FLQ FF  HP++  
Sbjct  160   VWNEYGWDMASNLLYVDQPTGTGFSYSSDKRDLRHNEEGVSNDLYDFLQAFFSKHPRFVN  219

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHY+PA   R++QGNK KEGIHINLKG AIGNGLT P IQY AY D+AL
Sbjct  220   NDFYITGESYAGHYVPAFAARVHQGNKAKEGIHINLKGFAIGNGLTHPAIQYRAYTDYAL  279

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLN  804
             +  +I +S +  + +L+P C+ +++ C ++G  +C  S L+   C  +++RIM  + D N
Sbjct  280   NMGIIKESDYQSINKLLPACEMSIKLCGTDGKVSCAASYLI---CNTIFNRIMSLIGDTN  336

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYDIRKKC    LCYDFSN E FLN KSV++ALGVGDI++VSCS TVY+ M  D  +NL 
Sbjct  337   YYDIRKKC-EERLCYDFSNMEEFLNQKSVREALGVGDIEFVSCSPTVYQAMMMDWMRNLE  395

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI LLVY GEYDLICNW+GN RWV A++W GQ+ F A+    F V G+E G
Sbjct  396   VGIPALLEDGIKLLVYAGEYDLICNWIGNSRWVHAMEWSGQQEFIASHITPFIVDGEEAG  455

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHG  330
             + KSYGPL+FLKVHDAGH+VPMDQP+A+LEMLRRW   
Sbjct  456   LLKSYGPLSFLKVHDAGHMVPMDQPRAALEMLRRWTQA  493



>ref|XP_009617439.1| PREDICTED: serine carboxypeptidase-like [Nicotiana tomentosiformis]
Length=505

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/459 (61%), Positives = 340/459 (74%), Gaps = 5/459 (1%)
 Frame = -2

Query  1694  SKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQH  1518
             + ++AEK+I +LNLFP    N      P      R+VEK+    NL   S  + EDLG H
Sbjct  36    ASKQAEKLIHELNLFPKESDNI-VDRDPFPTAASRIVEKRFNFANLTNSSVISFEDLGHH  94

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY++ ++  AR+FYFFFESR +K DPVVIWL+GGPGCSS LALFYENGPF I++N SL
Sbjct  95    AGYYKIKHSHAARLFYFFFESRGSKDDPVVIWLSGGPGCSSELALFYENGPFSISNNLSL  154

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
               N+YGWDK SNLIYVDQPTGTGFSYSS   D R  E GVS+DLY FLQ FF+ HP+  K
Sbjct  155   VRNEYGWDKVSNLIYVDQPTGTGFSYSSDRHDIRHSEAGVSDDLYDFLQAFFEEHPELVK  214

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA   R+++GNK KEGIHINLKG AIGNGLTDP IQY AY D+AL
Sbjct  215   NDFYITGESYAGHYIPAFAARVHKGNKAKEGIHINLKGFAIGNGLTDPKIQYAAYTDYAL  274

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKL-VDLNY  801
             D  LISKS HD + +++P C+ A+  C ++G  +C       C  ++  +  +   D+N+
Sbjct  275   DMGLISKSDHDRINKILPVCEVAINLCGTDGKISCL-AAYFVCNSIFAAVRARAGADINH  333

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKCV G+LCYDFSN E  LN  SVK ALGV DI++VSCSTTVY+ M  D  +NL  
Sbjct  334   YDIRKKCV-GALCYDFSNMEKLLNMHSVKQALGVEDIEFVSCSTTVYQAMLVDWMRNLEA  392

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGI LLVY GEYDLICNWLGN RWVQA++W GQK F A+P+V F V   E G+
Sbjct  393   GIPTLLEDGIKLLVYAGEYDLICNWLGNSRWVQAMEWSGQKEFVASPDVPFEVDSSEAGL  452

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              KS+GPL+FLKVHDAGH+VPMDQPK +LEML+RW+ G L
Sbjct  453   LKSHGPLSFLKVHDAGHMVPMDQPKVALEMLKRWIGGTL  491



>ref|XP_009382132.1| PREDICTED: serine carboxypeptidase-like [Musa acuminata subsp. 
malaccensis]
Length=507

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/458 (60%), Positives = 343/458 (75%), Gaps = 7/458 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             +  A+K+IR LNL P       +     +A   R+ E++ +   L D G +V+DLG HAG
Sbjct  41    RASAKKLIRALNLIPKDASPESTVGFSSDASRNRIFERRFRFPGLSD-GTSVDDLGHHAG  99

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY LP+T DARMFY FFESR++  DP+VIWLTGGPGCSS LA+FYENGPF IADN SL W
Sbjct  100   YYSLPHTHDARMFYLFFESRNSNKDPIVIWLTGGPGCSSELAVFYENGPFSIADNMSLVW  159

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             N +GWD+ASNLIYVDQPTGTGFSYSS + D R +E GVS+DLY FLQ FF  H +YA+++
Sbjct  160   NQFGWDQASNLIYVDQPTGTGFSYSSDKRDLRHNEKGVSDDLYDFLQAFFAEHSEYAEND  219

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R++QGNK KEGIHINLKG AIGNGLTDP IQY AY D+ALD 
Sbjct  220   FYITGESYAGHYIPAFASRVHQGNKDKEGIHINLKGFAIGNGLTDPAIQYKAYTDYALDM  279

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYY  798
              +I +S +  + ++ P C+ A++ C ++G  +C  S LV   C  ++  IM    + NYY
Sbjct  280   GIIKESDYKRINKIYPACELAIKLCGTSGTVSCLASYLV---CNTIFSSIMRIAGNANYY  336

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRK+C  GSLCYDFSN E FLN KSV++ LGVGDI++VSCS TVYE M +D  +NL  G
Sbjct  337   DIRKQC-EGSLCYDFSNMEKFLNLKSVRETLGVGDIEFVSCSPTVYEAMLTDWMRNLEVG  395

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGI LLVY GEYDLICNWLGN RWV A++W GQ GF ++  + F V G E G+ 
Sbjct  396   IPALLEDGIQLLVYAGEYDLICNWLGNSRWVHAMEWSGQSGFVSSSEIPFLVDGVEAGLL  455

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K++G L+FLKVHDAGH+VPMDQPKA+LEML+RW  G+L
Sbjct  456   KTHGSLSFLKVHDAGHMVPMDQPKAALEMLKRWTQGKL  493



>ref|XP_008784499.1| PREDICTED: serine carboxypeptidase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008784500.1| PREDICTED: serine carboxypeptidase-like isoform X1 [Phoenix dactylifera]
Length=507

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/459 (61%), Positives = 342/459 (75%), Gaps = 9/459 (2%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGA--TVEDLGQHA  1515
             R AE +IR LNL P+     G      ++ +PRLVEK++ L +LG+SG+   +E LG HA
Sbjct  42    RFAEDLIRDLNLQPVIQEIEGEQKGD-DSSSPRLVEKRINLEILGESGSDIPIEQLGHHA  100

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYYRL +T  A+MFYFFFESR   SDPVVIWLTGGPGCSS LALFYENGPF IADN SL 
Sbjct  101   GYYRLEHTHAAKMFYFFFESRGKSSDPVVIWLTGGPGCSSELALFYENGPFKIADNMSLI  160

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWDKASNLI+VDQPTGTGFSYS+   D R  E GVS+DLY FLQ FF+ HPKY K+
Sbjct  161   WNDYGWDKASNLIFVDQPTGTGFSYSTDLRDLRYSEKGVSDDLYDFLQAFFREHPKYLKN  220

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA   R+++GNK+K+G+ +NLKG AIGNGLT+P IQY AY D+ALD
Sbjct  221   DFYITGESYAGHYIPAAAERVHRGNKEKQGLQLNLKGFAIGNGLTNPEIQYGAYADYALD  280

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
               +I +S +  ++++ P C+  V+ C  +G   C  S  V   C  ++  IM    D+NY
Sbjct  281   MGIIGESAYKSISKIYPLCELGVKLCGPSGVIGCLASYFV---CNSIFTSIMLLAGDMNY  337

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKC  GSLCYD SN E FLN KSV+DALGVG+  +VSCS  VYE M +D  KNL  
Sbjct  338   YDIRKKC-EGSLCYDLSNMEKFLNEKSVRDALGVGNKKFVSCSPLVYEAMITDWMKNLEV  396

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+L+ DGI LLVY GEYDLICNWLGN RWV +++W G + F  AP + F + GKE G+
Sbjct  397   GIPTLIGDGIRLLVYAGEYDLICNWLGNFRWVNSMEWSGHQIFAEAPMLPFVIDGKEAGL  456

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              KSYGPL+FLKVHDAGH+VPMDQP+A+LEML+RWM G L
Sbjct  457   LKSYGPLSFLKVHDAGHMVPMDQPRAALEMLKRWMKGNL  495



>gb|KFK33913.1| serine carboxypeptidase [Arabis alpina]
Length=509

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/459 (60%), Positives = 348/459 (76%), Gaps = 11/459 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL--NLLGDSGA---TVEDLGQH  1518
             AE++I+  NL P  D+N  +      ++ PRLVE++  L   + G   A   +++D G H
Sbjct  46    AERLIKGFNLMPTLDVNVIAEDG---SEAPRLVEREFDLPAEIDGRDSAGSPSLKDFGHH  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNK-SDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             AGYY+LPN+  ARMFYFFFESRSNK +DPVVIWLTGGPGCSS LALFYENGPF +++N S
Sbjct  103   AGYYKLPNSKAARMFYFFFESRSNKATDPVVIWLTGGPGCSSELALFYENGPFTVSNNSS  162

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WND+GWDK SNLIYVDQP GTGFSY+S + D R DE+GVSNDLY FLQ FFK HP++ 
Sbjct  163   LSWNDFGWDKVSNLIYVDQPVGTGFSYTSDQSDLRHDEEGVSNDLYDFLQAFFKEHPQFV  222

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPAL +R++ GNK KEG HINLKG AIGNGLT+P IQY AY D+A
Sbjct  223   KNDFYITGESYAGHYIPALASRVHHGNKNKEGTHINLKGFAIGNGLTNPEIQYGAYADYA  282

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNY  801
             LD  LI++S HD L +    CQ+++++C+++GG AC+      C  ++ +IM+   ++NY
Sbjct  283   LDMKLITESDHDNLNRNYDTCQQSIKECSADGGEACASSY-VVCNNIFQKIMDIAGNVNY  341

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YD+RK+C  GSLCYDFSN E FLN KSV+  LGVGDI +VSCST VY+ M  D  +NL  
Sbjct  342   YDVRKQC-EGSLCYDFSNMEKFLNQKSVRRVLGVGDIQFVSCSTAVYDAMQLDWMRNLEV  400

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGI LLVY GEYDLICNWLGN +WV  ++W G+K F +A  V F V  KE G 
Sbjct  401   GIPALLEDGIKLLVYAGEYDLICNWLGNSKWVHEMEWSGRKEFVSASTVPFHVDNKEAGQ  460

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K++G LTFLKVHDAGH+VPMDQPKA+L+ML+ WM G+L
Sbjct  461   MKNHGSLTFLKVHDAGHMVPMDQPKAALQMLQNWMQGKL  499



>ref|NP_001141041.1| uncharacterized protein LOC100273121 precursor [Zea mays]
 gb|ACF79445.1| unknown [Zea mays]
 gb|ACF85265.1| unknown [Zea mays]
 gb|ACF87906.1| unknown [Zea mays]
 gb|ACG46232.1| serine carboxypeptidase-like precursor [Zea mays]
Length=525

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/461 (61%), Positives = 342/461 (74%), Gaps = 8/461 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVE---ADTPRLVEKKLKLNLLGDSGA--TVEDL  1527
             +  A  +I  LNL P  D +     + VE   A    LVE+ +++    + GA  +VEDL
Sbjct  54    RSAAVDLIHALNLHPA-DASPPLSTAGVEGALAPAGTLVERPIRIASFANGGAATSVEDL  112

Query  1526  GQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADN  1347
             G HAGYYRL NT DARMFYFFFESR +K DPVVIWLTGGPGCSS LALFYENGPF IADN
Sbjct  113   GHHAGYYRLANTHDARMFYFFFESRGHKDDPVVIWLTGGPGCSSELALFYENGPFNIADN  172

Query  1346  QSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPK  1167
              SL WND+GWDKASNLIYVDQPTGTGFSYSS   D R +E  +SNDLY FLQ FF  HPK
Sbjct  173   LSLVWNDFGWDKASNLIYVDQPTGTGFSYSSDSRDTRHNEATISNDLYDFLQAFFAEHPK  232

Query  1166  YAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPD  987
             YAK++FF+TGESYAGHYIPA  +R++QGNK  EGIHINLKG AIGNGLTDP IQY AYPD
Sbjct  233   YAKNDFFITGESYAGHYIPAFASRVHQGNKNNEGIHINLKGFAIGNGLTDPAIQYKAYPD  292

Query  986   FALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDL  807
             +ALD  LI+K+  + + +++P C+ AV+ C ++G  +C       C  ++  I   + + 
Sbjct  293   YALDMGLITKTQFNRINKIVPTCEFAVKLCGTSGTVSCL-AAYFVCNTIFSAIRTIIGNK  351

Query  806   NYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNL  627
             NYYDIRK C+ GSLCYDFSN E FLN KSV+++LGVGDI++VSCS TVYE M  D  +NL
Sbjct  352   NYYDIRKPCI-GSLCYDFSNLEKFLNLKSVRESLGVGDIEFVSCSPTVYEAMLLDWMRNL  410

Query  626   APGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEK  447
               GIP LL+  I +L+Y GEYDLICNWLGN RWV +++W G++ F ++    F+V GKE 
Sbjct  411   EVGIPELLESDIKVLIYAGEYDLICNWLGNSRWVNSMEWSGKEAFVSSSEKPFTVDGKEA  470

Query  446   GIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             G+ KS+GPL+FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  471   GVLKSHGPLSFLKVHDAGHMVPMDQPKAALEMLKRWTSGNL  511



>ref|XP_010920652.1| PREDICTED: serine carboxypeptidase-like [Elaeis guineensis]
Length=523

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/459 (62%), Positives = 338/459 (74%), Gaps = 9/459 (2%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATV--EDLGQHA  1515
             R AE +IR LNL P+     G      +  +PRLVEK+L L +LG+SG+ +  E LG HA
Sbjct  58    RFAEDLIRDLNLQPVIQEIEGEQKGD-DFSSPRLVEKRLNLEILGESGSEIPIEQLGHHA  116

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYYRL +T  A+MFYFFFESR   SDPVVIWLTGGPGCSS LALFYENGPF IADN SL 
Sbjct  117   GYYRLEHTHAAKMFYFFFESRGKSSDPVVIWLTGGPGCSSELALFYENGPFKIADNMSLI  176

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWDK SNLI+VDQPTGTGFSYS+   D R  E GVSNDLY FLQ FF+ HPKY K+
Sbjct  177   WNDYGWDKVSNLIFVDQPTGTGFSYSTDLRDLRYSEKGVSNDLYDFLQAFFREHPKYLKN  236

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             EF++TGESYAGHYIPA   R+ +GNK+K+G+ +NLKG AIGNGLTDP IQY AY D+ALD
Sbjct  237   EFYITGESYAGHYIPAAAARVYRGNKEKQGLQLNLKGFAIGNGLTDPEIQYGAYADYALD  296

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
               +I +S +  ++++ P C+  V+ C  +G   C  S +V   C  ++  IM    D+NY
Sbjct  297   MGIIGESAYKSISKIYPLCELGVKLCGPSGVIGCLASYVV---CNSIFTSIMLLAGDMNY  353

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKC  GSLCYDFSN E FLN KSV+DALGVG+  +VSCS  VYE M +D  KNL  
Sbjct  354   YDIRKKC-EGSLCYDFSNMEKFLNQKSVRDALGVGEKKFVSCSPLVYEAMITDWMKNLEV  412

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+L+ DGI LLVY GEYDLICNWLGN RWV +++W G + F   P + F V GKE G 
Sbjct  413   GIPTLIDDGIRLLVYAGEYDLICNWLGNFRWVNSMEWSGHQIFAEVPMLPFVVDGKEAGR  472

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              KSYGPL+FLKVHDAGH+VPMDQP+A+LEML RW+ G L
Sbjct  473   LKSYGPLSFLKVHDAGHMVPMDQPRAALEMLNRWLKGNL  511



>ref|XP_004952145.1| PREDICTED: serine carboxypeptidase 3-like isoform X2 [Setaria 
italica]
Length=499

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/454 (61%), Positives = 349/454 (77%), Gaps = 6/454 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             +AE++IR LNL P      GSG +P  A    L+E++++L  + D    ++DLG HAGY+
Sbjct  38    QAERLIRALNLLPKEAGPAGSGDAPSVAPG-ELLERRVRLPGVPDG---IQDLGHHAGYF  93

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP+T DARMFYFFFESR  K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL WN 
Sbjct  94    RLPHTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLAWNK  153

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWD  SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY FLQ FFK HP++AK++F+
Sbjct  154   FGWDTISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQVFFKKHPEFAKNDFY  213

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGNK  EGIHINLKG AIGNGLTDP IQY AY D+AL+ NL
Sbjct  214   ITGESYAGHYIPAFASRVHQGNKANEGIHINLKGFAIGNGLTDPQIQYKAYTDYALEMNL  273

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I KS ++ + + IP C+ A++ C ++G ++C       C  +++ IM+ +   NYYD+RK
Sbjct  274   IGKSDYERINRFIPPCELAIKMCGTDGKASCM-AAYMVCNNIFNSIMKLVGTKNYYDVRK  332

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             +C  G LCYDFSN E F   K+VK+ALGVGDI++VSCS+TVYE M +D  +NL  GIP+L
Sbjct  333   EC-EGKLCYDFSNLEKFFGDKAVKEALGVGDIEFVSCSSTVYEAMLTDWMRNLEVGIPAL  391

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DGIN+L+Y GEYDLICNWLGN RWV +++W GQK F ++   +F V G E G+ KS+G
Sbjct  392   LEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFVSSSESSFVVDGAEAGVLKSHG  451

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PL+FLKVHDAGH+VPMDQPKASLEMLRR+  G+L
Sbjct  452   PLSFLKVHDAGHMVPMDQPKASLEMLRRFTEGKL  485



>ref|XP_010681991.1| PREDICTED: serine carboxypeptidase-like [Beta vulgaris subsp. 
vulgaris]
Length=495

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/452 (60%), Positives = 337/452 (75%), Gaps = 5/452 (1%)
 Frame = -2

Query  1670  IRQLNLFPLHDLN--RGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQHAGYYRL  1500
             IR+LNLFP   +N   GS +     D P+LVE++ K  N      A VE+LG HAGY+++
Sbjct  32    IRELNLFPKKSVNIINGSDNGDFSHDGPKLVERRFKFPNFYDPKDANVEELGHHAGYFQI  91

Query  1499  PNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYG  1320
              +  +ARMFYFFF+SR++K DPVVIWLTGGPGCSS LALFYENGPF IA+N SL WN+YG
Sbjct  92    EHARNARMFYFFFQSRNSKEDPVVIWLTGGPGCSSELALFYENGPFKIANNMSLVWNEYG  151

Query  1319  WDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVT  1140
             WD+A+NLI+VDQP GTGFSYS+ + D R DE GVSNDLY FLQ FF  HP +AK++F++T
Sbjct  152   WDQAANLIFVDQPIGTGFSYSTDKRDIRHDERGVSNDLYDFLQAFFTEHPDFAKNDFYIT  211

Query  1139  GESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLIS  960
             GESYAGHYIPA  + ++  NK K+GIHINLKG AIGNGLTDP +QY AYPD+AL+  LI 
Sbjct  212   GESYAGHYIPAFASCVHSNNKAKKGIHINLKGFAIGNGLTDPAVQYKAYPDYALEMGLIK  271

Query  959   KSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKC  780
             KS +D + +++P C+ A++ C + G  +C       C  ++  I     D NYYDIRKKC
Sbjct  272   KSSYDVINKIVPVCEIAIKLCGTKGTVSCLTSY-VLCNTIFTSIKLLTGDTNYYDIRKKC  330

Query  779   VGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQ  600
               G LCYDFSN E FLN +SV+ +LGVGDID+VSCS TVY+ + +D  +NL  GIP+LL+
Sbjct  331   -EGKLCYDFSNMEKFLNQESVRTSLGVGDIDFVSCSPTVYQALLTDWMRNLEVGIPALLE  389

Query  599   DGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPL  420
             DGI LLVY GEYDLICNWLGN RWV A++W GQ  F A+  V F V G E GI KS+GPL
Sbjct  390   DGIQLLVYAGEYDLICNWLGNSRWVHAMEWSGQNNFVASSEVPFEVDGSEAGILKSHGPL  449

Query  419   TFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  450   SFLKVHDAGHMVPMDQPKAALEMLKRWTQGSL  481



>ref|XP_004957681.1| PREDICTED: serine carboxypeptidase-like [Setaria italica]
Length=520

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/462 (60%), Positives = 338/462 (73%), Gaps = 8/462 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLG------DSGATVED  1530
             +  A  +IR LNL P     R +      A    LVE+ ++L  L         G +V+D
Sbjct  49    RSAAVDLIRALNLHPADASPRPATPGAAPAPAGTLVERPIRLASLAAGGGVASEGTSVKD  108

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYYRLPNT DARMFYFFFESR +K DPVVIWLTGGPGCSS LALFYENGPF+IAD
Sbjct  109   LGHHAGYYRLPNTHDARMFYFFFESRGHKDDPVVIWLTGGPGCSSELALFYENGPFHIAD  168

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WND+GWDKASNLIYVDQPTGTGFSYSS   D R +E  VSNDLY FLQ FF  HP
Sbjct  169   NLSLVWNDFGWDKASNLIYVDQPTGTGFSYSSDSRDTRHNEASVSNDLYDFLQAFFAEHP  228

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             KYAK++FF+TGESYAGHYIPA  +R+ +GNK  EGIHINLKG AIGNGLTDP IQY AYP
Sbjct  229   KYAKNDFFITGESYAGHYIPAFASRVYRGNKNNEGIHINLKGFAIGNGLTDPAIQYKAYP  288

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVD  810
             D+ALD  LI+KS  + + +++P C+  ++ C ++G  +C       C  ++  I   +  
Sbjct  289   DYALDMGLITKSQFNRINRIVPTCEFTIKLCGTSGTVSCL-AAYFVCNTIFTAIRTIIGS  347

Query  809   LNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKN  630
              NYYDIRK CV GSLCYDFSN E FLN KSV+++LGVGDI++VSCS +VY+ M  D  +N
Sbjct  348   KNYYDIRKPCV-GSLCYDFSNLEKFLNKKSVRESLGVGDIEFVSCSPSVYQAMLLDWMRN  406

Query  629   LAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKE  450
             L  GIP LL++ I +L+Y GEYDLICNWLGN RWV +++W G++ F ++    F V GKE
Sbjct  407   LEVGIPELLENDIKVLIYAGEYDLICNWLGNSRWVNSMEWSGKEAFVSSSEKPFKVDGKE  466

Query  449   KGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G+ KS+GPL+FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  467   AGLLKSHGPLSFLKVHDAGHMVPMDQPKAALEMLKRWTSGNL  508



>gb|KEH29967.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=494

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/458 (60%), Positives = 340/458 (74%), Gaps = 7/458 (2%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP-RLVEKKLKLNLLGDSGA-TVEDLGQHA  1515
             ++AEK+IR  NLFP   +N   G   ++   P ++VEKK   +  GDSG  ++EDLG HA
Sbjct  41    QQAEKLIRSFNLFPKQSVNVIHGDHSLDHFLPGKIVEKKF--SFFGDSGGPSIEDLGHHA  98

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             GYY LP +  +R+FYFFFESR N  D PVVIWLTGGPGCSS LALFYENGPF IA+N SL
Sbjct  99    GYYSLPRSNSSRLFYFFFESRKNNKDAPVVIWLTGGPGCSSELALFYENGPFKIANNLSL  158

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WNDYGWDKASN+++VDQP GTGFSY+S+E+D   DE GVSNDLY FLQEFFK HPK+ K
Sbjct  159   VWNDYGWDKASNILFVDQPIGTGFSYTSNEDDIPHDETGVSNDLYDFLQEFFKQHPKFIK  218

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHY+PAL +R++ GNK K+GI INLKG AIGNGLT+P IQY  Y  FA 
Sbjct  219   NDFYITGESYAGHYVPALASRVHHGNKGKKGITINLKGFAIGNGLTNPAIQYQEYSQFAF  278

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             DN +I+K    ++ +LIP C+ A++ C S GG +CS  +  +C+ + + I+    ++NYY
Sbjct  279   DNKMITKQDQADINKLIPDCEVAIKTCESKGGESCSSAL-YQCEQIINNILSISGNVNYY  337

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKC  G LCYDFSN E  LN K+V+DALGVGDID+VSCS  VY  M  D  +N    
Sbjct  338   DIRKKC-QGPLCYDFSNLEKLLNKKTVRDALGVGDIDFVSCSRVVYNAMLQDWMRNFEVD  396

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP LL+DGI +L+Y GE+D ICNWLGN +WV A+ W GQK F A+  V F V GK+ G+ 
Sbjct  397   IPELLEDGIKVLIYAGEFDFICNWLGNSKWVHAMGWSGQKQFAASKTVQFVVDGKQAGLL  456

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              SYGPL+FLKV+ AGHLVPMDQPKA+L+ML  WMHG L
Sbjct  457   NSYGPLSFLKVNGAGHLVPMDQPKAALQMLANWMHGNL  494



>ref|XP_007132319.1| hypothetical protein PHAVU_011G084700g [Phaseolus vulgaris]
 gb|ESW04313.1| hypothetical protein PHAVU_011G084700g [Phaseolus vulgaris]
Length=527

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/457 (60%), Positives = 343/457 (75%), Gaps = 6/457 (1%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             +  AE++IR LN+FP   +N   G        P ++ +K K + LGDSG +VEDLG HAG
Sbjct  40    QSHAERLIRSLNVFPKDSVNITKGDH--GGFVPGMIVEK-KFSFLGDSGPSVEDLGHHAG  96

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YY LP++  ARMFYFFFESR++K DPVVIWLTGGPGC S LALFYENGPF+I +N SL W
Sbjct  97    YYSLPHSKAARMFYFFFESRNSKDDPVVIWLTGGPGCGSELALFYENGPFHITNNLSLTW  156

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             N YGWD+ASN+I+VDQPTGTGFSYSS + D R DE GVS DLY FLQEFFK H  + K++
Sbjct  157   NHYGWDQASNIIFVDQPTGTGFSYSSDDSDIRHDETGVSIDLYDFLQEFFKTHLDFVKND  216

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++ GESYAGHY+PAL +R+NQGNK+ +G+HINLKG AIGNGLT+P IQ+ AYPDFALDN
Sbjct  217   FYIFGESYAGHYVPALASRVNQGNKQNQGLHINLKGFAIGNGLTNPAIQFQAYPDFALDN  276

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              +I+K+ +D +T LIP C++A++ C + GG++C   V+  C+ ++DRI++ + ++NYYDI
Sbjct  277   RIITKAQYDNVTMLIPHCEQAIKTCEAQGGNSCIRAVDI-CENIFDRILDFIDNINYYDI  335

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             RKKC  G LCY+F+  ET LN + VK ALGV  D+ +  CS  V   M  D  +NL   I
Sbjct  336   RKKC-EGDLCYNFTQVETLLNMQKVKSALGVMDDLKYELCSLEVRVAMMQDWMRNLEVVI  394

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             PSLL+DGI LLVYVGE DLICNWLGN RWVQA++W GQK FG +P   F V G E G   
Sbjct  395   PSLLEDGIKLLVYVGEEDLICNWLGNSRWVQAMEWSGQKAFGISPTGKFVVDGAEAGSLN  454

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             SYGPLTFLKVH AGH+VPMDQPKA+L+ML  W  G+L
Sbjct  455   SYGPLTFLKVHGAGHMVPMDQPKAALQMLTSWTGGKL  491



>ref|XP_009380664.1| PREDICTED: serine carboxypeptidase-like [Musa acuminata subsp. 
malaccensis]
Length=501

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/457 (61%), Positives = 343/457 (75%), Gaps = 9/457 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFP-LHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGAT--VEDLGQHAG  1512
             AE +IR LNL P + +L  G+G    +  +PRLVE++L L +LG+SG+   VE LG HAG
Sbjct  38    AESLIRDLNLLPGIQEL--GAGTEADDPSSPRLVERRLDLRILGESGSEIPVEQLGHHAG  95

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YYRL +T  A+MFYFFFESR   SDPVVIWLTGGPGCSS LALFYENGPF IADN SL W
Sbjct  96    YYRLEHTHAAKMFYFFFESRGRSSDPVVIWLTGGPGCSSELALFYENGPFKIADNMSLIW  155

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             NDYGWDK SN+I+VDQPTGTGFSYS+   D R  E GVS+DLY F Q FFK H  + K++
Sbjct  156   NDYGWDKVSNIIFVDQPTGTGFSYSTDLRDLRYGEKGVSDDLYDFFQAFFKEHSGFLKND  215

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA   RI++GNK+K+G+ +NLKG AIGNGLTDP IQY AY D+AL+ 
Sbjct  216   FYITGESYAGHYIPAAAERIHRGNKEKQGLLLNLKGFAIGNGLTDPAIQYGAYADYALEM  275

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC-SDLVNSRCQPLYDRIMEKLVDLNYYD  795
              +I +  H+ +T++ P CQ  ++ C S+G  +C + L+   C  +++ I+    D+NYYD
Sbjct  276   GIIGQRAHNSITRIYPVCQLGIKLCGSSGVISCVASLI--VCNSIFNAILLLAGDINYYD  333

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IRKKC  GSLCYDFSN E FLN +SV+DALGVG   +VSCS  VYE M +D  KNL  GI
Sbjct  334   IRKKC-EGSLCYDFSNMEKFLNQESVRDALGVGSRKFVSCSPLVYEAMITDWMKNLEVGI  392

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+D I LLVY GEYDLICNWLGNLRWV +++W G + F  AP   F+V GKE GI K
Sbjct  393   PTLLEDDIKLLVYAGEYDLICNWLGNLRWVNSMEWSGSQNFTKAPFRQFAVHGKEAGILK  452

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             ++GPL+F+KVHDAGH+VPMDQP+ +LEML+RWM G  
Sbjct  453   THGPLSFIKVHDAGHMVPMDQPETALEMLKRWMKGNF  489



>ref|XP_009146842.1| PREDICTED: serine carboxypeptidase-like 49 isoform X1 [Brassica 
rapa]
 ref|XP_009146843.1| PREDICTED: serine carboxypeptidase-like 49 isoform X2 [Brassica 
rapa]
Length=518

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/461 (59%), Positives = 347/461 (75%), Gaps = 11/461 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEADT--PRLVEKKLKL-NLLGDSGA-TVEDLGQ  1521
             RAEK+IR+LNLFP  ++N    G S + +D   P +VE++    N+L D G  ++EDLG 
Sbjct  42    RAEKLIRELNLFPNLEVNVIDVGDSTLTSDEELPSIVERRFIFPNILPDGGPPSLEDLGH  101

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY+LP +  ARMFYFFFESRS K  P+VIWLTGGPGCSS LA+FYENGPF +  N S
Sbjct  102   HAGYYKLPKSQGARMFYFFFESRSKKDAPLVIWLTGGPGCSSELAMFYENGPFKLDKNMS  161

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WN+YGWD+ASNL+YVDQP GTGFSY+S + D R D+ GVS+DLY FLQ FF  HPK A
Sbjct  162   LAWNEYGWDQASNLLYVDQPVGTGFSYTSDKTDIRHDQTGVSDDLYDFLQAFFAEHPKLA  221

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
               +F++TGESYAGHYIPA  +R+++GNK  EGIH+NLKG AIGNGLTDP  QYPAYPD+A
Sbjct  222   NKDFYITGESYAGHYIPAFASRVHRGNKANEGIHVNLKGFAIGNGLTDPAYQYPAYPDYA  281

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDL  807
              +  LI+++ HD LT+++P C+ +++ C ++G ++C  S LV   C  L+  ++     +
Sbjct  282   FEMGLITQAEHDRLTKIVPLCELSIKICGTDGTTSCLASYLV---CNTLFSGVINHAHGV  338

Query  806   NYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNL  627
             NYYD+RKKC  GSLCYDFS+ E FLN  SV+ +LGVG+I++VSCST+VY+ M  D+ +NL
Sbjct  339   NYYDVRKKC-EGSLCYDFSDMEKFLNLNSVRKSLGVGEIEFVSCSTSVYQAMLQDLMRNL  397

Query  626   APGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEK  447
               GIP LL+DGINLLVY GEYDLICNWLGN RWV A++W G++ F AA  V F V GKE 
Sbjct  398   EVGIPELLEDGINLLVYAGEYDLICNWLGNSRWVHAMEWSGKENFKAAKEVPFVVDGKEA  457

Query  446   GIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             G  KSY  L+FLKVHDAGH+VPMDQPK++L+ML  WM   L
Sbjct  458   GKVKSYEQLSFLKVHDAGHMVPMDQPKSALKMLEGWMKKSL  498



>dbj|BAK05932.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93590.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/462 (59%), Positives = 342/462 (74%), Gaps = 15/462 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFP--------LHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVED  1530
             +AE++IR LNL P         H    G+G   V     +L+E+++ L  L +    V D
Sbjct  36    QAERLIRALNLLPKDSSSSSGRHGARVGAGKEDVAPG--QLLERRVTLPGLPEG---VAD  90

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYYRLPNT DARMFYFFFESR  K DPVVIWLTGGPGCSS LA+FYENGPF IA+
Sbjct  91    LGHHAGYYRLPNTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIAN  150

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WN +GWDK SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY FLQ FFK HP
Sbjct  151   NMSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQVFFKKHP  210

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++ K++FF+TGESYAGHYIPA  +R++QGNKK EG HINLKG AIGNGLTDP IQY AY 
Sbjct  211   EFIKNDFFITGESYAGHYIPAFASRVHQGNKKNEGTHINLKGFAIGNGLTDPAIQYKAYT  270

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVD  810
             D+AL+ NLI K+ ++ + + IP C+ A++ C +NG ++C       C  +++ IM+ +  
Sbjct  271   DYALEMNLIQKADYERINKFIPPCEFAIKLCGTNGKASCM-AAYMVCNTIFNSIMKLVGT  329

Query  809   LNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKN  630
              NYYD+RK+C  G LCYDFSN E F   K+V+ A+GVGDI++VSCST+VY+ M +D  +N
Sbjct  330   KNYYDVRKEC-EGKLCYDFSNLEKFFGDKAVRQAIGVGDIEFVSCSTSVYQAMLTDWMRN  388

Query  629   LAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKE  450
             L  GIP+LL+DGIN+L+Y GEYDLICNWLGN RWV +++W GQK F      +F V   +
Sbjct  389   LEVGIPALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQ  448

Query  449   KGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G+ KS+G L+FLKVH+AGH+VPMDQPKA+LEMLRR+  G+L
Sbjct  449   AGVLKSHGALSFLKVHNAGHMVPMDQPKAALEMLRRFTQGKL  490



>sp|P21529.2|CBP3_HORVU RecName: Full=Serine carboxypeptidase 3; AltName: Full=CP-MIII; 
AltName: Full=Serine carboxypeptidase III; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA70817.1| serine carboxypeptidase III, CP-MIII [Hordeum vulgare subsp. 
vulgare]
Length=508

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/462 (59%), Positives = 342/462 (74%), Gaps = 15/462 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFP--------LHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVED  1530
             +AE++IR LNL P         H    G G+  V     +L+E+++ L  L +    V D
Sbjct  36    QAERLIRALNLLPKDSSSSSGRHGARVGEGNEDVAPG--QLLERRVTLPGLPEG---VAD  90

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYYRLPNT DARMFYFFFESR  K DPVVIWLTGGPGCSS LA+FYENGPF IA+
Sbjct  91    LGHHAGYYRLPNTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIAN  150

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WN +GWDK SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY FLQ FFK HP
Sbjct  151   NMSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQVFFKKHP  210

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++ K++FF+TGESYAGHYIPA  +R++QGNKK EG HINLKG AIGNGLTDP IQY AY 
Sbjct  211   EFIKNDFFITGESYAGHYIPAFASRVHQGNKKNEGTHINLKGFAIGNGLTDPAIQYKAYT  270

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVD  810
             D+AL+ NLI K+ ++ + + IP C+ A++ C +NG ++C       C  +++ IM+ +  
Sbjct  271   DYALEMNLIQKADYERINKFIPPCEFAIKLCGTNGKASCM-AAYMVCNTIFNSIMKLVGT  329

Query  809   LNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKN  630
              NYYD+RK+C  G LCYDFSN E F   K+V+ A+GVGDI++VSCST+VY+ M +D  +N
Sbjct  330   KNYYDVRKEC-EGKLCYDFSNLEKFFGDKAVRQAIGVGDIEFVSCSTSVYQAMLTDWMRN  388

Query  629   LAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKE  450
             L  GIP+LL+DGIN+L+Y GEYDLICNWLGN RWV +++W GQK F      +F V   +
Sbjct  389   LEVGIPALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQ  448

Query  449   KGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G+ KS+G L+FLKVH+AGH+VPMDQPKA+LEMLRR+  G+L
Sbjct  449   AGVLKSHGALSFLKVHNAGHMVPMDQPKAALEMLRRFTQGKL  490



>ref|XP_006361688.1| PREDICTED: serine carboxypeptidase-like 49-like [Solanum tuberosum]
Length=504

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/460 (60%), Positives = 338/460 (73%), Gaps = 6/460 (1%)
 Frame = -2

Query  1694  SKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADT--PRLVEKKLKLNLLGDSGATVEDLGQ  1521
             + ++AEK+IR+LNLFP    N      P + D    R+VEK+     L +S  + EDLG 
Sbjct  34    ASKQAEKLIRELNLFPKESDNI-VDRDPFQTDDEGSRIVEKRFSFPNLANSSVSFEDLGH  92

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY++ ++  AR+FYFFFESR +K DPVVIWL+GGPGCSS LALFYENGPF I+ N S
Sbjct  93    HAGYYKIKHSHAARLFYFFFESRGSKDDPVVIWLSGGPGCSSELALFYENGPFSISKNLS  152

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L  N+YGWDK SNLIYVDQPTGTGFSYSS   D    E  VS+DLY F+Q FF+ HP+  
Sbjct  153   LVPNEYGWDKVSNLIYVDQPTGTGFSYSSDRRDLCHTETCVSDDLYDFIQAFFEEHPELV  212

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPA   R+++GNK KEG HINLKG AIGNGLTDP IQYPAY D+A
Sbjct  213   KNDFYITGESYAGHYIPAFAARVHKGNKGKEGTHINLKGFAIGNGLTDPKIQYPAYTDYA  272

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKL-VDLN  804
             LD  LISKS HD + +LIP C+ AV  C ++G  +C       C  ++  +     VD+N
Sbjct  273   LDMGLISKSTHDRINKLIPVCEVAVNLCGTDGKVSCL-AAYFVCNSIFTAVRASAGVDIN  331

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             +YDIRKKCV G LCYDFS+ E  LN +SVK ALGV DI++VSCSTTVY+ M  D  +N  
Sbjct  332   HYDIRKKCV-GRLCYDFSDMEKMLNLRSVKKALGVEDIEFVSCSTTVYQAMLIDWMRNSE  390

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI LLVY GEYDLICNWLGN RWVQA++W GQK F A+  V F V G E G
Sbjct  391   VGIPTLLEDGIKLLVYAGEYDLICNWLGNSRWVQAMEWKGQKEFVASTEVPFEVNGSEAG  450

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + +S+GPL+FLKVHDAGH+VPMDQP+A+LEML+RW  G L
Sbjct  451   LLRSHGPLSFLKVHDAGHMVPMDQPQAALEMLKRWTRGTL  490



>gb|KEH29968.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=500

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/458 (60%), Positives = 337/458 (74%), Gaps = 7/458 (2%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP-RLVEKKLKLNLLGDS-GATVEDLGQHA  1515
             +RAEK+I+  NL P   +N   G   ++   P +LVEKK   +   DS G ++EDLG HA
Sbjct  42    QRAEKLIKSFNLLPKDPVNIIHGDHSIDHFVPGKLVEKKF--SFFSDSNGPSIEDLGHHA  99

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             GYY LP +  ARMFYFFFESR N  D PVVIWLTGGPGCSS LALFYENGPF IA+N SL
Sbjct  100   GYYSLPRSKSARMFYFFFESRKNNKDAPVVIWLTGGPGCSSELALFYENGPFKIANNLSL  159

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WNDYGWDKASN+++VDQP GTGFSY+S+E+D   DE GVSNDLY FLQEFFK HPK+ K
Sbjct  160   VWNDYGWDKASNILFVDQPIGTGFSYTSNEDDIPHDETGVSNDLYDFLQEFFKQHPKFIK  219

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHY+PAL +R++ GNK K+GI INLKG AIGNGLT+P IQY  Y  FA 
Sbjct  220   NDFYITGESYAGHYVPALASRVHHGNKGKKGITINLKGFAIGNGLTNPAIQYQEYSQFAF  279

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             DN +I+K    ++ +LIP C+ A++ C S GG +CS  +  +C+ + + I+    ++NYY
Sbjct  280   DNKMITKQDQADINKLIPDCEVAIKTCESKGGESCSSAL-YQCEQIINNILSISGNVNYY  338

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKC  G LCYDFSN E  LN K+V+DALGVGDID+VSCS  VY  M  D  +N    
Sbjct  339   DIRKKC-QGPLCYDFSNLEKLLNKKTVRDALGVGDIDFVSCSRVVYNAMLQDWMRNFEVD  397

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP LL+DGI +L+Y GE+D ICNWLGN +WV A+ W GQK F A+  V F V G + G+ 
Sbjct  398   IPELLEDGIKVLIYAGEFDFICNWLGNSKWVHAMGWSGQKQFAASKTVQFVVDGTQAGLL  457

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              SYGPL+FLKV+ AGH+VPMDQPKA+L+ML  WMHG L
Sbjct  458   NSYGPLSFLKVNGAGHMVPMDQPKAALQMLANWMHGNL  495



>ref|XP_004952144.1| PREDICTED: serine carboxypeptidase 3-like isoform X1 [Setaria 
italica]
Length=503

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/457 (61%), Positives = 348/457 (76%), Gaps = 8/457 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             +AE++IR LNL P      GSG +P  A    L+E++++L  + D    ++DLG HAGY+
Sbjct  38    QAERLIRALNLLPKEAGPAGSGDAPSVAPG-ELLERRVRLPGVPDG---IQDLGHHAGYF  93

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP+T DARMFYFFFESR  K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL WN 
Sbjct  94    RLPHTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLAWNK  153

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWD  SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY FLQ FFK HP++AK++F+
Sbjct  154   FGWDTISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQVFFKKHPEFAKNDFY  213

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGNK  EGIHINLKG AIGNGLTDP IQY AY D+AL+ NL
Sbjct  214   ITGESYAGHYIPAFASRVHQGNKANEGIHINLKGFAIGNGLTDPQIQYKAYTDYALEMNL  273

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGS---ACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
             I KS ++ + + IP C+ A++ C ++ G+   A        C  +++ IM+ +   NYYD
Sbjct  274   IGKSDYERINRFIPPCELAIKMCANDSGTDGKASCMAAYMVCNNIFNSIMKLVGTKNYYD  333

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             +RK+C  G LCYDFSN E F   K+VK+ALGVGDI++VSCS+TVYE M +D  +NL  GI
Sbjct  334   VRKEC-EGKLCYDFSNLEKFFGDKAVKEALGVGDIEFVSCSSTVYEAMLTDWMRNLEVGI  392

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DGIN+L+Y GEYDLICNWLGN RWV +++W GQK F ++   +F V G E G+ K
Sbjct  393   PALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFVSSSESSFVVDGAEAGVLK  452

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             S+GPL+FLKVHDAGH+VPMDQPKASLEMLRR+  G+L
Sbjct  453   SHGPLSFLKVHDAGHMVPMDQPKASLEMLRRFTEGKL  489



>ref|NP_001146351.1| uncharacterized protein LOC100279929 precursor [Zea mays]
 gb|ACL53752.1| unknown [Zea mays]
 gb|AFW69788.1| hypothetical protein ZEAMMB73_192167 [Zea mays]
Length=516

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/458 (60%), Positives = 348/458 (76%), Gaps = 9/458 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLH-DLNRGSGHSPVEADTP-RLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             +AE++IR LNL P   +    +G     +  P  L+E++++L     + A V DLG HAG
Sbjct  49    QAERLIRALNLLPKEKEAGPAAGGGDGPSVAPGELLERRVRLP---GAPAGVGDLGHHAG  105

Query  1511  YYRLPNTVDARMFYFFFESRSNKS--DPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             Y+RLP+T DARMFYFFFESR  K   DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL
Sbjct  106   YFRLPHTHDARMFYFFFESRGKKKEDDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSL  165

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN +GWD  SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY FLQ FFK HP++AK
Sbjct  166   VWNKFGWDTISNIIFVDQPTGTGFSYSSDDRDTRHDEIGVSNDLYDFLQVFFKKHPEFAK  225

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++FF+TGESYAGHYIPA  +R++QGNK  EGIHINLKG AIGNGLTDP IQY AY D+AL
Sbjct  226   NDFFITGESYAGHYIPAFASRVHQGNKANEGIHINLKGFAIGNGLTDPEIQYKAYTDYAL  285

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             + NLI+KS ++ + + IP C+ A++ C ++G ++C       C  +++ IM+ +   NYY
Sbjct  286   EMNLITKSDYERINRFIPPCEFAIKMCGTDGKASCM-AAYMVCNNIFNSIMKLVGTKNYY  344

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             D+RK+C  G LCYDFSN E F   K+VK+ALGVGDID+VSCSTTVYE M +D  +NL  G
Sbjct  345   DVRKEC-EGKLCYDFSNLERFFGDKAVKEALGVGDIDFVSCSTTVYEAMLTDWMRNLEVG  403

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGIN+L+Y GEYDLICNWLGN RWV +++W GQK F ++ +  F V G E G+ 
Sbjct  404   IPALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFVSSCDSPFVVDGAEAGVL  463

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KS+GPL+FLKVH+AGH+VPMDQPKA+LEMLRR+  G+L
Sbjct  464   KSHGPLSFLKVHNAGHMVPMDQPKAALEMLRRFTQGKL  501



>ref|XP_004250045.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=501

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/460 (60%), Positives = 337/460 (73%), Gaps = 6/460 (1%)
 Frame = -2

Query  1694  SKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADT--PRLVEKKLKLNLLGDSGATVEDLGQ  1521
             + ++AEK+I++LNLFP    N      P + D    R+VEK+     L +S  T+EDLG 
Sbjct  31    ATKQAEKLIQELNLFPKESDNI-VDRDPFQTDDEGSRIVEKRFSFPNLANSSVTIEDLGH  89

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY++ ++  AR+FYFFFESR +K DPVVIWL+GGPGCSS LALFYENGPF I+ N S
Sbjct  90    HAGYYKIKHSHAARLFYFFFESRGSKDDPVVIWLSGGPGCSSELALFYENGPFSISKNLS  149

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L  N+YGWDK SNLIYVDQPTGTGFSYSS   D    E  VS+DLY F+Q FF+ HP+  
Sbjct  150   LVPNEYGWDKVSNLIYVDQPTGTGFSYSSDRRDLCHTEACVSDDLYDFIQAFFEEHPELV  209

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++F++TGESYAGHYIPA   R+++GNK KEG HINLKG AIGNGLTDP IQYPAY D+A
Sbjct  210   KNDFYITGESYAGHYIPAFAARVHKGNKGKEGTHINLKGFAIGNGLTDPKIQYPAYTDYA  269

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKL-VDLN  804
             LD  LIS S HD + +LIP C+ AV  C ++G  +C       C  ++  +     VD+N
Sbjct  270   LDMGLISNSTHDRINKLIPVCEVAVNLCGTDGKVSCL-AAYFVCNSIFTAVRASAGVDIN  328

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             +YDIRKKC  G LCYDFS+ E  LN +SVK ALGV DI++VSCSTTVY+ M  D  +N  
Sbjct  329   HYDIRKKC-EGRLCYDFSDMEKMLNLRSVKKALGVEDIEFVSCSTTVYQAMLVDWMRNSE  387

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI LLVY GEYDLICNWLGN RWVQA++W GQK F A+  V F V G E G
Sbjct  388   VGIPTLLEDGIKLLVYAGEYDLICNWLGNSRWVQAMEWKGQKEFVASIEVPFEVNGTEAG  447

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + +S+GPL+FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  448   LLRSHGPLSFLKVHDAGHMVPMDQPKAALEMLKRWTRGTL  487



>ref|XP_003570803.1| PREDICTED: serine carboxypeptidase 3 [Brachypodium distachyon]
Length=510

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/457 (59%), Positives = 340/457 (74%), Gaps = 8/457 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFP---LHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             +AE++IR LNL P             +P       L+E+++ L  L D    V DLG HA
Sbjct  43    QAERLIRALNLLPNGAGPTGGGLGLDAPEAVAPGELLERRVTLPGLPDG---VGDLGHHA  99

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYYRLPNT DARMFYFFFESR  K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL 
Sbjct  100   GYYRLPNTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLV  159

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN +GWDK SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY FLQ FFK HP++ K+
Sbjct  160   WNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQVFFKKHPEFVKN  219

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +FF+TGESYAGHYIPA  +R++QGNK  EG HINLKG AIGNGLTDP IQY AY D+ALD
Sbjct  220   DFFITGESYAGHYIPAFASRVHQGNKANEGTHINLKGFAIGNGLTDPAIQYKAYTDYALD  279

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
              NLI KS ++ + + IP C+ A++ C ++G ++C       C  +++ IM+ +   NYYD
Sbjct  280   MNLIKKSDYERINKYIPPCEFAIKLCGTDGKASCM-AAYMVCNTIFNSIMDIVGTKNYYD  338

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             +RK+C  G LCYDFSN + F   K+V+ A+GVGDI++VSCST+VY+ M +D  +NL  GI
Sbjct  339   VRKEC-EGKLCYDFSNLDKFFGDKAVRQAIGVGDIEFVSCSTSVYQAMLTDWMRNLEVGI  397

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DGIN+L+Y GEYDLICNWLGN RWV +++W G+  F ++P  +F+V   + G+ K
Sbjct  398   PALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGKADFASSPEASFTVDNTKAGVLK  457

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             S+G L+FLKVH+AGH+VPMDQPKASLEML+R+  G+L
Sbjct  458   SHGALSFLKVHNAGHMVPMDQPKASLEMLKRFTQGKL  494



>ref|XP_003560222.1| PREDICTED: serine carboxypeptidase-like [Brachypodium distachyon]
Length=519

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/458 (61%), Positives = 342/458 (75%), Gaps = 11/458 (2%)
 Frame = -2

Query  1676  KMIRQLNLFPLHDLNRGSGH-SPVEADTPRLVEKKLKLNLL----GDSGAT-VEDLGQHA  1515
             ++IR LNL P   L R SG    + A T  LVE+ + L  L     D+G T V +LG HA
Sbjct  52    ELIRALNLHPRDSLPRRSGSGDALPAGT--LVERPIHLASLVAGTDDAGDTSVSNLGHHA  109

Query  1514  GYYRLPNTVDARMFYFFFESRSNK-SDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             GYYRL NT DAR+FYFFFESR +K  DPVVIWLTGGPGCSS LALFYENGPF+IADN SL
Sbjct  110   GYYRLANTHDARLFYFFFESRRHKKEDPVVIWLTGGPGCSSELALFYENGPFHIADNMSL  169

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WND+GWDK SNLIYVDQPTGTGFSYSS   D R +E  VSNDLY FLQ FFK H +YA+
Sbjct  170   LWNDFGWDKESNLIYVDQPTGTGFSYSSDSRDTRHNEASVSNDLYEFLQAFFKEHLEYAE  229

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA  TR++QGNKKK+GIHINLKG AIGNGLTDP IQY AY D+AL
Sbjct  230   NDFYITGESYAGHYIPAFATRVHQGNKKKQGIHINLKGFAIGNGLTDPAIQYKAYTDYAL  289

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             D  LI++S  +++ +++P C+ A++ C ++G  +C       C  ++  I   +   NYY
Sbjct  290   DMGLITQSEFNKINKIVPTCEFAIKLCGTSGTVSCF-AAYVVCNTIFSSIRLIIGSKNYY  348

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRK CV GSLCYDFSN E FLN KSV+ +LGVGDI++VSCS TVY+ M  D  +NL  G
Sbjct  349   DIRKPCV-GSLCYDFSNLEKFLNLKSVRQSLGVGDIEFVSCSPTVYQAMLLDWMRNLEVG  407

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP LL+  I +L+Y GEYDLICNWLGN RWV +++W G+K F ++    F+V GKE G+ 
Sbjct  408   IPELLESDIKVLIYAGEYDLICNWLGNSRWVNSMEWSGKKAFVSSTEEPFTVDGKEAGVL  467

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KSYGPL+FLKVHD+GH+VPMDQPKA+LEML RW+ G L
Sbjct  468   KSYGPLSFLKVHDSGHMVPMDQPKAALEMLSRWISGNL  505



>ref|XP_006400807.1| hypothetical protein EUTSA_v10015901mg [Eutrema salsugineum]
 gb|ESQ42260.1| hypothetical protein EUTSA_v10015901mg [Eutrema salsugineum]
Length=504

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/463 (60%), Positives = 342/463 (74%), Gaps = 16/463 (3%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLN---RGSGHSPVEADTPRLVEKKLKLNLL-----GDSGATVE  1533
             R AE++I+  NL P  D+N   +GS H  +     RLVE +   +         SG +V+
Sbjct  44    RNAERLIKSFNLMPKRDINVIPKGS-HGAL-----RLVESQRNFSATIGAVNTSSGPSVQ  97

Query  1532  DLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIA  1353
             + G +AGYY LP++  A+MFYFFFESR+N +DPVVIWL+GGPGCSSS+ALFYENGPF I+
Sbjct  98    EFGHYAGYYSLPHSKSAKMFYFFFESRNNSTDPVVIWLSGGPGCSSSVALFYENGPFTIS  157

Query  1352  DNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAH  1173
              N SL WND+GWDK SNLIYVDQP GTGFSY+S   D R DE GVSNDLY FLQ FFK H
Sbjct  158   GNLSLTWNDFGWDKVSNLIYVDQPIGTGFSYTSDSSDLRHDEVGVSNDLYDFLQAFFKEH  217

Query  1172  PKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAY  993
             PK+AK++F++TGESYAGHYIPAL +R++ GNKK EGI INLKG AIGNGLT+  IQY AY
Sbjct  218   PKFAKNDFYITGESYAGHYIPALASRVHSGNKKNEGIPINLKGFAIGNGLTNSEIQYGAY  277

Query  992   PDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLV  813
              D+AL+  LIS+S H+ L Q    CQ   ++CN +GG AC+      C  ++ +I  K  
Sbjct  278   GDYALEMKLISESDHESLKQDYVECQGFTKKCNLDGGLACASAFEV-CNDIFYQIASKTE  336

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
               NYYD+RKKCV GS CYDFS  ETFLN ++V+ ALGVGDI +VSCSTTVY+ M+ D   
Sbjct  337   GTNYYDLRKKCV-GSQCYDFSKMETFLNQENVRKALGVGDIKFVSCSTTVYDAMTEDWML  395

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL   IP+L++DGINLLVY GEYDL+CNWLGN RWV+ + W GQK FG+A  V F V GK
Sbjct  396   NLEVKIPALVEDGINLLVYAGEYDLVCNWLGNSRWVEQMNWSGQKDFGSAKTVPFLVDGK  455

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G+ K++G LTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  456   EAGLMKNHGSLTFLKVHDAGHMVPMDQPKASLQMLQNWMQGKL  498



>sp|P11515.1|CBP3_WHEAT RecName: Full=Serine carboxypeptidase 3; AltName: Full=CP-WIII; 
AltName: Full=Serine carboxypeptidase III; Flags: Precursor 
[Triticum aestivum]
 gb|AAA34273.1| gibberellin responsive protein [Triticum aestivum]
Length=500

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/454 (59%), Positives = 339/454 (75%), Gaps = 6/454 (1%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             +AE++IR LNL P     RG G    +    +L+E+++ L  L +    V DLG HAGYY
Sbjct  36    QAERLIRALNLLPGRP-RRGLGAGAEDVAPGQLLERRVTLPGLPEG---VGDLGHHAGYY  91

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLPNT DARMFYFFFESR  K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL WN 
Sbjct  92    RLPNTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLVWNK  151

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDK SN+I+VD  TGTGFSYSS + D R DE GVSNDLY FLQ FFK HP++ K++FF
Sbjct  152   FGWDKISNIIFVDPATGTGFSYSSDDRDTRHDEAGVSNDLYDFLQVFFKKHPEFVKNDFF  211

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGNKK EG HINLKG AIGNGLTDP IQY AY D+ALD NL
Sbjct  212   ITGESYAGHYIPAFASRVHQGNKKNEGTHINLKGFAIGNGLTDPAIQYKAYTDYALDMNL  271

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             I K+ +D + + IP C+ A++ C ++G ++C       C  +++ IM+ +   NYYD+RK
Sbjct  272   IQKADYDRINKFIPPCEFAIKLCGTDGKASCM-AAYMVCNSIFNSIMKLVGTKNYYDVRK  330

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             +C  G LCYDFSN E F   K+V+ A+GVGDI++VSCST+VY+ M +D  +NL  GIP+L
Sbjct  331   EC-EGKLCYDFSNLEKFFGDKAVRQAIGVGDIEFVSCSTSVYQAMLTDWMRNLEVGIPAL  389

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DGIN+L+Y GEYDLICNWLGN RWV +++W GQK F      +F V   + G+ KS+G
Sbjct  390   LEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQAGVLKSHG  449

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              L+FLKVH+AGH+VPMDQPKA+LEMLRR+  G+L
Sbjct  450   ALSFLKVHNAGHMVPMDQPKAALEMLRRFTQGKL  483



>ref|XP_007132321.1| hypothetical protein PHAVU_011G084900g [Phaseolus vulgaris]
 gb|ESW04315.1| hypothetical protein PHAVU_011G084900g [Phaseolus vulgaris]
Length=488

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/424 (62%), Positives = 328/424 (77%), Gaps = 5/424 (1%)
 Frame = -2

Query  1592  RLVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTG  1413
             ++VEKK   +  GDSG  VEDLG HAGYY LP++  ARMFYFFFESR +++DPVVIWL+G
Sbjct  53    KIVEKKF--SFFGDSGPPVEDLGHHAGYYSLPHSKAARMFYFFFESRKSRNDPVVIWLSG  110

Query  1412  GPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRT  1233
             GPGC S LALFYENGPF+I +N SL WN YGWD+ SN+I+VDQPTGTGFSYSS + D R 
Sbjct  111   GPGCGSELALFYENGPFHITNNLSLTWNQYGWDQESNIIFVDQPTGTGFSYSSDDSDVRN  170

Query  1232  DEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHIN  1053
             DE GVS DLY FLQEFFK HP + K++F++ GESYAGHY+PAL +R+NQGNK+ +G+HIN
Sbjct  171   DETGVSIDLYDFLQEFFKMHPDFVKNDFYIFGESYAGHYVPALASRVNQGNKQNQGLHIN  230

Query  1052  LKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC  873
             LKG AIGNGLT+P IQY AYPDFALDN +I+K+ +D +  L+P C++A + C + GG++C
Sbjct  231   LKGFAIGNGLTNPAIQYQAYPDFALDNRIITKAQYDNVNVLMPDCEQATKTCETQGGNSC  290

Query  872   SDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVG-  696
                +   C+ ++DRI++   ++NYYDIRKKC  G+LCY+F+N ET LN + VK ALGV  
Sbjct  291   FRALRI-CEDIFDRIVDFTDNINYYDIRKKC-EGNLCYNFTNVETLLNMQKVKSALGVSD  348

Query  695   DIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQAL  516
             D+ +  CS  V++ M  D  +NL  GIP+LL+DGI LL+YVGE DLICNWLGN RWV A+
Sbjct  349   DLKYELCSDAVHDAMMQDWMRNLEVGIPALLEDGIKLLLYVGEEDLICNWLGNSRWVHAM  408

Query  515   QWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWM  336
             +W GQK FG +P V F V G E G   SYGPL+FLKVH AGHLVPMDQPK SLEM +RWM
Sbjct  409   EWSGQKAFGKSPTVKFVVHGAEAGSLNSYGPLSFLKVHKAGHLVPMDQPKVSLEMFKRWM  468

Query  335   HGQL  324
              G++
Sbjct  469   GGKM  472



>gb|EAZ03855.1| hypothetical protein OsI_25989 [Oryza sativa Indica Group]
Length=524

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/481 (59%), Positives = 344/481 (72%), Gaps = 26/481 (5%)
 Frame = -2

Query  1736  PAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPV---EADTP--RLVEKKL  1572
             PAGQ           +  A  +IR LNL P     R +  SP    + D P   LVE+ +
Sbjct  46    PAGQL---------PRSAAVGLIRALNLHP-----RDASPSPSSRGDGDVPAGTLVERPI  91

Query  1571  KLNLLG---DSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKS--DPVVIWLTGGP  1407
              L  +      G++ EDLG HAGYYRLPNT DAR+FYFFFESR +K   DPVVIWLTGGP
Sbjct  92    HLASMATGKSGGSSAEDLGHHAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGP  151

Query  1406  GCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDE  1227
             GCSS LALFYENGPF+IADN SL WND+GWD+ SNLIYVDQPTGTGFSYSS+  D R DE
Sbjct  152   GCSSELALFYENGPFHIADNMSLVWNDFGWDQESNLIYVDQPTGTGFSYSSNPRDTRHDE  211

Query  1226  DGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLK  1047
              GVSNDLYAFLQ FF  HP +AK++F++TGESYAGHYIPA  +R+ +GNK  EGIHINLK
Sbjct  212   AGVSNDLYAFLQAFFTEHPNFAKNDFYITGESYAGHYIPAFASRVYKGNKNSEGIHINLK  271

Query  1046  GLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSD  867
             G AIGNGLTDP IQY AY D++LD  LI+KS  + + +++P C+ A++ C ++G  +C  
Sbjct  272   GFAIGNGLTDPAIQYKAYTDYSLDMGLITKSQFNRINKIVPTCELAIKLCGTSGTISCLG  331

Query  866   LVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDID  687
                  C  ++  I   +   NYYDIRK CV GSLCYDFSN E FL  KSV+++LGVGDI 
Sbjct  332   -AYVVCNLIFSSIETIIGKKNYYDIRKPCV-GSLCYDFSNMEKFLQLKSVRESLGVGDIQ  389

Query  686   WVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWY  507
             +VSCS TVY+ M  D  +NL  GIP LL++ I +L+Y GEYDLICNWLGN RWV +++W 
Sbjct  390   FVSCSPTVYQAMLLDWMRNLEVGIPELLENDIKVLIYAGEYDLICNWLGNSRWVNSMEWS  449

Query  506   GQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             G++ F ++    F+V GKE GI KSYGPL+FLKVHDAGH+VPMDQPK +LEML+RW  G 
Sbjct  450   GKEAFVSSSEEPFTVDGKEAGILKSYGPLSFLKVHDAGHMVPMDQPKVALEMLKRWTSGN  509

Query  326   L  324
             L
Sbjct  510   L  510



>ref|XP_006657694.1| PREDICTED: serine carboxypeptidase-like [Oryza brachyantha]
Length=523

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/464 (59%), Positives = 336/464 (72%), Gaps = 10/464 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP--RLVEKKLKLNLLGDSGAT-----VE  1533
             +  A  +I  LNL P       S  S  +   P   LVE+ + L  +   G +     V+
Sbjct  48    RSAAVGLIHALNLHPRDADASPSRRSADDDAAPAGTLVERPIHLAAMATGGGSGGGSSVK  107

Query  1532  DLGQHAGYYRLPNTVDARMFYFFFESR-SNKSDPVVIWLTGGPGCSSSLALFYENGPFYI  1356
             DLG HAGYYRLPNT DARMFYFFFESR S K DPVVIWLTGGPGCSS LALFYENGPF+I
Sbjct  108   DLGHHAGYYRLPNTHDARMFYFFFESRGSKKDDPVVIWLTGGPGCSSELALFYENGPFHI  167

Query  1355  ADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKA  1176
             ADN SL WND+GWD+ SNLIYVDQPTGTGFSYSS   D R DE  +SNDLYAFLQ FF  
Sbjct  168   ADNMSLVWNDFGWDQESNLIYVDQPTGTGFSYSSDSRDTRHDEASISNDLYAFLQAFFTE  227

Query  1175  HPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPA  996
             HP +AK++F++TGESYAGHYIPA  +R+  GNK  EGIHINLKG AIGNGLTDP IQY A
Sbjct  228   HPDFAKNDFYITGESYAGHYIPAFASRVYNGNKNNEGIHINLKGFAIGNGLTDPAIQYKA  287

Query  995   YPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKL  816
             Y D++LD  LI+KS +  + +++P C+ A++ C ++G  +C       C  ++  I   +
Sbjct  288   YTDYSLDMELITKSQYKRINKIVPTCEFAIKLCGTSGTISCLG-AYVVCNLIFSSIRTII  346

Query  815   VDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIF  636
              + NYYDIRK CV GSLCYDFSN E FL  K+V+++LGVGDI +VSCS TVYE M  D  
Sbjct  347   GNKNYYDIRKPCV-GSLCYDFSNMEKFLQLKTVRESLGVGDIQFVSCSPTVYEAMLLDWM  405

Query  635   KNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGG  456
             K+L  GIP LL++ I +L+Y GEYDLICNWLGN RWV +++W G++ F ++   +F+V G
Sbjct  406   KDLEVGIPELLENDIKVLIYAGEYDLICNWLGNSRWVNSMEWSGKEAFASSSEKSFTVDG  465

Query  455   KEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KE G+ KSYGPL+FLKVHDAGH+VPMDQPKA+LEML+RW  G L
Sbjct  466   KEAGVLKSYGPLSFLKVHDAGHMVPMDQPKAALEMLKRWTSGNL  509



>gb|KCW50683.1| hypothetical protein EUGRSUZ_J00369 [Eucalyptus grandis]
Length=484

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/456 (59%), Positives = 338/456 (74%), Gaps = 25/456 (5%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN---RGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             +AE +I+ LNL P   +N   R    S + +D  ++VE++ +L           DLG HA
Sbjct  39    QAEMLIKGLNLHPKEAVNIRTRDKDSSSLASDG-KIVERRFEL----------PDLGHHA  87

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY LP++  AR+FYFFF+SR++ +DPVVIWLTGGPGCS SLALFYENGPF+IA+N SL 
Sbjct  88    GYYPLPHSHAARIFYFFFDSRNSANDPVVIWLTGGPGCSCSLALFYENGPFHIANNLSL-  146

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
                     ASNLI+VDQPTGTGFSYS+ E D R DE GVSNDLY FLQ FF AHP+  K+
Sbjct  147   --------ASNLIFVDQPTGTGFSYSTDERDIRHDEQGVSNDLYDFLQAFFAAHPQLVKN  198

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA   R+ QGNK KEGIHINLKG AIGNGLT+P IQY AY D+AL+
Sbjct  199   DFYITGESYAGHYIPAFAARVQQGNKAKEGIHINLKGFAIGNGLTNPEIQYEAYTDYALN  258

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
               LI++S HD +  ++P C++ ++QC + GG AC +L    C  +++ I +   ++NYYD
Sbjct  259   MKLITESDHDNINTMLPECKQGIKQCATKGGDAC-ELALIDCNSIFNEIRDITGNINYYD  317

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IRK C  G LCYDFSN ET LN K V+DALGV DI++VSCS+TVYE M  D  KNLA GI
Sbjct  318   IRKSC-EGPLCYDFSNVETLLNQKKVRDALGVADIEFVSCSSTVYEAMRQDWMKNLAVGI  376

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DG+ +L+Y GEYDL+CNWLGN RWV A++W GQK FG +P V F V G + G+ K
Sbjct  377   PALLEDGLKVLIYAGEYDLLCNWLGNSRWVNAMRWSGQKRFGTSPTVPFVVAGAKAGLMK  436

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             SYGPLTFLKVH+AGH+VPMDQPKA+L+ML+ WM G+
Sbjct  437   SYGPLTFLKVHNAGHMVPMDQPKAALQMLKSWMAGK  472



>gb|KCW50685.1| hypothetical protein EUGRSUZ_J003712, partial [Eucalyptus grandis]
Length=394

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/385 (65%), Positives = 312/385 (81%), Gaps = 2/385 (1%)
 Frame = -2

Query  1478  MFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNL  1299
             MFYFFFESR++ +DPVVIWLTGGPGCSSSLALFYENGPF+IA+N SL WNDYGWD+ASNL
Sbjct  1     MFYFFFESRNSANDPVVIWLTGGPGCSSSLALFYENGPFHIANNLSLVWNDYGWDQASNL  60

Query  1298  IYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGH  1119
             I+VDQPTGTGFSYS+ E D R DE GVSNDLY FLQ FF AHP+  K++F++TGESYAGH
Sbjct  61    IFVDQPTGTGFSYSTDERDIRHDEQGVSNDLYDFLQAFFAAHPQLVKNDFYITGESYAGH  120

Query  1118  YIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDEL  939
             YIPA   R+ QGNK KEGIHIN KG AIGNGLT+P IQY AY D+AL+  LI++S HD +
Sbjct  121   YIPAFAARVQQGNKAKEGIHINFKGFAIGNGLTNPEIQYEAYTDYALNMKLITESDHDNI  180

Query  938   TQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCY  759
               ++P C++ ++QC++ GG AC +L ++ C  ++++I+    ++NYYDIRK C  G LCY
Sbjct  181   NTMLPECKQGIKQCDTKGGDAC-ELASTDCNSIFNKILNIAGNINYYDIRKSCE-GPLCY  238

Query  758   DFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLV  579
             DFSN ET LN K V+DALGVGDI++VSCS+TV   MS D  KNLA GIP+LL+DG+ +L+
Sbjct  239   DFSNVETLLNQKKVRDALGVGDIEFVSCSSTVSNAMSQDRMKNLAEGIPALLEDGLKVLI  298

Query  578   YVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHD  399
             Y GEYDLICNWLGN RWV A++W GQK FG +P V F V G E G+ KS+GPLTFLK+H+
Sbjct  299   YAGEYDLICNWLGNSRWVNAMRWSGQKQFGTSPTVPFVVAGAEAGLMKSHGPLTFLKLHN  358

Query  398   AGHLVPMDQPKASLEMLRRWMHGQL  324
             AGH+VPMDQPKA+L+ML+ WM G++
Sbjct  359   AGHMVPMDQPKAALQMLKSWMAGKV  383



>ref|NP_001059634.1| Os07g0479300 [Oryza sativa Japonica Group]
 dbj|BAF21548.1| Os07g0479300 [Oryza sativa Japonica Group]
 gb|EAZ39796.1| hypothetical protein OsJ_24236 [Oryza sativa Japonica Group]
Length=524

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/481 (58%), Positives = 342/481 (71%), Gaps = 26/481 (5%)
 Frame = -2

Query  1736  PAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPV---EADTP--RLVEKKL  1572
             PAGQ           +  A  +IR LNL P     R +  SP    + D P   LVE+ +
Sbjct  46    PAGQL---------PRSAAVGLIRALNLHP-----RDASPSPSSRGDGDVPAGTLVERPI  91

Query  1571  KLNLLG---DSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKS--DPVVIWLTGGP  1407
              L  +      G++ EDLG HAGYYRLPNT DAR+FYFFFESR +K   DPVVIWLTGGP
Sbjct  92    HLASMATGKSGGSSAEDLGHHAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGP  151

Query  1406  GCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDE  1227
             GCSS LALFYENGPF+IADN SL WND+GWD+ SNLIYVDQPTGTGFSYSS+  D R DE
Sbjct  152   GCSSELALFYENGPFHIADNMSLVWNDFGWDQESNLIYVDQPTGTGFSYSSNPRDTRHDE  211

Query  1226  DGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLK  1047
              GVSNDLYAFLQ FF  HP +AK++F++TGESYAGHYIPA  +R+ +GNK  EGIHINLK
Sbjct  212   AGVSNDLYAFLQAFFTEHPNFAKNDFYITGESYAGHYIPAFASRVYKGNKNSEGIHINLK  271

Query  1046  GLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSD  867
             G AIGNGLTDP IQY AY D++LD  LI+KS  + + +++P C+ A++ C ++G  +C  
Sbjct  272   GFAIGNGLTDPAIQYKAYTDYSLDMGLITKSQFNRINKIVPTCELAIKLCGTSGTISCLG  331

Query  866   LVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDID  687
                  C  ++  I   +   NYYDIRK CV GSLCYD SN E FL  KSV+++LGVGDI 
Sbjct  332   -AYVVCNLIFSSIETIIGKKNYYDIRKPCV-GSLCYDLSNMEKFLQLKSVRESLGVGDIQ  389

Query  686   WVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWY  507
             +VSCS TVY+ M  D  +NL  GIP LL++ I +L+Y GEYDLICNWLGN RWV +++W 
Sbjct  390   FVSCSPTVYQAMLLDWMRNLEVGIPELLENDIKVLIYAGEYDLICNWLGNSRWVNSMEWS  449

Query  506   GQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             G++ F ++    F+V GKE GI KSYGPL+FLKVHDAGH+VPMDQPK +LEML RW  G 
Sbjct  450   GKEAFVSSSEEPFTVDGKEAGILKSYGPLSFLKVHDAGHMVPMDQPKVALEMLMRWTSGN  509

Query  326   L  324
             L
Sbjct  510   L  510



>gb|EMT06979.1| Serine carboxypeptidase 3 [Aegilops tauschii]
Length=529

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/481 (57%), Positives = 341/481 (71%), Gaps = 32/481 (7%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGS--GHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             +AE++IR LNL P     RG   G    +    +L+E+++ L  L +    V DLG HAG
Sbjct  36    QAERLIRALNLLPGASSGRGGKVGAGAEDVAPGQLLERRVTLPGLPEG---VSDLGHHAG  92

Query  1511  YYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             YYRLPNT DARMFYFFFESR  K DPVVIWLTGGPGCSS LA+FYENGPF IA+N SL W
Sbjct  93    YYRLPNTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFAIANNMSLVW  152

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQE------------  1188
             N +GWDK SN+I+VDQPTGTGFSYSS + D R DE GVSNDLY FLQ             
Sbjct  153   NKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDEAGVSNDLYDFLQAGIGNLLTQKYEY  212

Query  1187  -------------FFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLK  1047
                          FFK HP++ K++FF+TGESYAGHYIPA  +R++QGNKK EG HINLK
Sbjct  213   SPKIDCISSLEVVFFKKHPEFVKNDFFITGESYAGHYIPAFASRVHQGNKKNEGTHINLK  272

Query  1046  GLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSD  867
             G AIGNGLTDP IQY AY D+ALD NLI K+ +D + + IP C+ A++ C ++G ++C  
Sbjct  273   GFAIGNGLTDPAIQYKAYTDYALDMNLIQKADYDRINKFIPPCEFAIKLCGTDGKASCM-  331

Query  866   LVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDID  687
                  C  +++ IM+ +   NYYD+RK+C  G LCYDFSN E F   K+V+ A+GVGDI+
Sbjct  332   AAYMVCNTIFNSIMKLVGTKNYYDVRKEC-EGKLCYDFSNLEKFFGDKAVRQAIGVGDIE  390

Query  686   WVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWY  507
             +VSCST+VY+ M +D  +NL  GIP+LL+DGIN+L+Y GEYDLICNWLGN RWV +++W 
Sbjct  391   FVSCSTSVYQAMLTDWMRNLEVGIPALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWS  450

Query  506   GQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             GQK F      +F V   + G+ KS+G L+FLKVH+AGH+VPMDQPKA+LEMLRR+  G+
Sbjct  451   GQKDFAKTAESSFLVDDAQAGVLKSHGALSFLKVHNAGHMVPMDQPKAALEMLRRFTQGK  510

Query  326   L  324
             L
Sbjct  511   L  511



>ref|XP_010421096.1| PREDICTED: serine carboxypeptidase-like 47 [Camelina sativa]
Length=506

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/460 (59%), Positives = 339/460 (74%), Gaps = 14/460 (3%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-------NLLGDSGATVEDLG  1524
             A+ +I   NL P +D+N     SP   D PRLVE ++         N+ G  G +V+  G
Sbjct  46    AKMLISSFNLTPKYDVNVIPKGSP---DAPRLVESQIDFPTTFGVQNVSG--GPSVQQFG  100

Query  1523  QHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQ  1344
              +AGYY LP++  A+MFYFFFESR++ +DPVVIWL+GGPGCSSS+A+FYENGPF I+D+ 
Sbjct  101   HYAGYYSLPHSKSAKMFYFFFESRNSSTDPVVIWLSGGPGCSSSVAMFYENGPFKISDDF  160

Query  1343  SLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKY  1164
             SL WND+GWDK SNLIYVDQP GTGFSY+S + D R DE GVSNDLY FLQ FFK HPK+
Sbjct  161   SLSWNDFGWDKVSNLIYVDQPVGTGFSYTSDKSDLRHDEAGVSNDLYDFLQTFFKEHPKF  220

Query  1163  AKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDF  984
             AK++F++TGESYAGHYIPAL +R++ GNKKKEGI INLKG AIGNGLT+P IQY AY D+
Sbjct  221   AKNDFYITGESYAGHYIPALASRVHSGNKKKEGIPINLKGFAIGNGLTNPEIQYAAYGDY  280

Query  983   ALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLN  804
             AL   +I++S ++ + Q    CQ  +++CN +GG AC       C  + + I+      N
Sbjct  281   ALQMKMITESDYEGIKQDYVECQSLIKKCNLDGGLACKSAFEV-CDIILNMILAVKPGTN  339

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RKKCV G LCYDFS  ETFLN ++V+ ALGVGDI++VSCS+TVY+ M+ D   NL 
Sbjct  340   YYDVRKKCV-GQLCYDFSKMETFLNKENVRKALGVGDIEFVSCSSTVYDAMTKDWMINLE  398

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
               IP L+ DG+NLL+Y GEYD ICNWLGN RWV  + W GQK F +A NV F V GKE G
Sbjct  399   VKIPDLVNDGMNLLIYAGEYDFICNWLGNSRWVDQMNWSGQKDFKSAKNVRFLVDGKEAG  458

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K+YGPLTFLKVHDAGH+VPMDQPKASL+ML  WM G+L
Sbjct  459   LLKNYGPLTFLKVHDAGHMVPMDQPKASLQMLMYWMQGKL  498



>ref|XP_010658339.1| PREDICTED: serine carboxypeptidase-like isoform X1 [Vitis vinifera]
Length=507

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/456 (59%), Positives = 335/456 (73%), Gaps = 7/456 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             +AEK+IR+LNLFP  D    +G       T +LVE++L+   +  S A+V+DL QHAGYY
Sbjct  39    QAEKLIRELNLFP-KDAEAVNGMDWEGESTKKLVERRLRFPGIDYSDASVKDLSQHAGYY  97

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             +L +++ ARMFY FFESR ++ DPVVIWLTGGPGC S LALFYENGPF IA N SL WND
Sbjct  98    KLRHSLAARMFYLFFESRDSRKDPVVIWLTGGPGCGSELALFYENGPFTIAANMSLMWND  157

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDK SNL+YVDQP GTGFSYSS   D R +E+ +SNDL+ FLQ FF+ HP +  ++F+
Sbjct  158   WGWDKISNLLYVDQPIGTGFSYSSDLRDIRHNEEAISNDLFDFLQAFFEEHPLFTNNDFY  217

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             + GESYAGHYIPAL  RI++GNK K GIHINLKG AIGNGLT+P IQY AY D+AL+  +
Sbjct  218   IAGESYAGHYIPALAARIHRGNKAKGGIHINLKGFAIGNGLTNPQIQYKAYTDYALEMGM  277

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDI  792
             I K+ +D + +++P C+ A++ C ++G  +C  S  V   C  ++ +IM    D NYYDI
Sbjct  278   IEKTDYDRINKVLPVCEMAIKLCGTDGTISCMASYFV---CNSIFSKIMALSGDTNYYDI  334

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK C  GSLCYDFSN E FLN K V+ ALGVGDI++V CS  VY+ +  D  +NL  GIP
Sbjct  335   RKTC-EGSLCYDFSNMEKFLNQKPVRAALGVGDIEFVPCSPAVYQALLMDWMRNLEVGIP  393

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
              LL+DGI LLVY GEYDLICNWLGN RWV A++W GQ  F AAP V F +G  + G+ K 
Sbjct  394   DLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWGGQLEFQAAPEVPFVIGDSKAGLMKI  453

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLKVHDAGH+VPMDQP+ +LEML+RW   +L
Sbjct  454   HGPLTFLKVHDAGHMVPMDQPRVALEMLKRWFENKL  489



>ref|XP_010493406.1| PREDICTED: serine carboxypeptidase-like 47 [Camelina sativa]
Length=505

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/458 (59%), Positives = 339/458 (74%), Gaps = 10/458 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLG----DSGATVEDLGQH  1518
             A+ +I   NL P++D+N     SP   D PRL E ++     LG      G +V+  G +
Sbjct  45    AKMLINSFNLTPMYDVNVIPKGSP---DAPRLFESQIDFPATLGVQNVSGGPSVQQFGHY  101

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY LP++  A+MFYFFFESR++ +DPVVIWL+GGPGCSSS+A+FYENGPF I+D+ SL
Sbjct  102   AGYYSLPHSKSAKMFYFFFESRNSSTDPVVIWLSGGPGCSSSVAMFYENGPFKISDDFSL  161

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WND+GWDK SNLIYVDQP GTGFSY+S + D R DE GVSNDLY FLQ FFK HPK+AK
Sbjct  162   SWNDFGWDKVSNLIYVDQPVGTGFSYTSDKSDLRHDEAGVSNDLYDFLQAFFKEHPKFAK  221

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA  +R++ GNKKKEGI INLKG AIGNGLT+P IQY AY D+AL
Sbjct  222   NDFYITGESYAGHYIPAFASRVHSGNKKKEGIPINLKGFAIGNGLTNPEIQYAAYGDYAL  281

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
                +I++S ++ + Q    CQ  +++CN +GG AC       C  + + I+     ++YY
Sbjct  282   QMKMITESDYEGIKQDYVECQSLIKKCNLDGGLACKSAFEV-CDIILNTILAVKPGISYY  340

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             D+RKKCV G+LCYDFS  ETFLN ++V+ ALGVG+I++VSCS+TVY+ M+ D   NL   
Sbjct  341   DVRKKCV-GNLCYDFSKMETFLNKENVRKALGVGNIEFVSCSSTVYDAMTKDWMINLEVK  399

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP L+ DG+NLL+Y GEYD ICNWLGN RWV  + W GQK F +A NV F V GKE G+ 
Sbjct  400   IPDLVNDGMNLLIYAGEYDFICNWLGNSRWVDQMNWSGQKDFKSAKNVPFLVDGKETGLL  459

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K+YGPLTFLKVHDAGH+VPMDQPKASL+ML  WM G+L
Sbjct  460   KNYGPLTFLKVHDAGHMVPMDQPKASLQMLMYWMQGKL  497



>gb|KHN38716.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=473

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/431 (62%), Positives = 328/431 (76%), Gaps = 6/431 (1%)
 Frame = -2

Query  1694  SKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             ++ +AEK+IR LNL P   +N   G   V     ++VEKK   +L  DSG ++EDLG HA
Sbjct  20    TQSQAEKLIRSLNLLPKDSVNIVKGDH-VGFVPGKIVEKKF--SLFCDSGPSIEDLGHHA  76

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY LP++  ARMFYFFFESR+NK DPVVIWLTGGPGC S LALFYENGPF+IA+N SL 
Sbjct  77    GYYSLPHSKAARMFYFFFESRNNKDDPVVIWLTGGPGCGSELALFYENGPFHIANNLSLT  136

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWD+ASN+++VDQPTGTGFSYSS E D R DE G+SNDLY FLQEFFKAHP++ K+
Sbjct  137   WNDYGWDQASNILFVDQPTGTGFSYSSEESDIRHDETGISNDLYDFLQEFFKAHPEFVKN  196

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHY+PAL +R+NQGNK+ +GIHINLKG AIGNGLT+P IQY AYPDFALD
Sbjct  197   DFYITGESYAGHYVPALASRVNQGNKQNQGIHINLKGFAIGNGLTNPAIQYQAYPDFALD  256

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
             N +I+ + +D +++LIPGC++A + C + GG +C+  +   CQ ++  I++   ++NYYD
Sbjct  257   NGIITNAEYDNISKLIPGCEQAAKTCENQGGQSCATAL-YICQNIFSLILDYAGNINYYD  315

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             IRKKCV G LCYDF N E FLN K VK ALGV  D+ +V CSTTV+  M  D  +N+  G
Sbjct  316   IRKKCV-GELCYDFGNVEEFLNQKKVKSALGVRDDLQYVLCSTTVHAAMLQDWMRNMEVG  374

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IPSLL+DGI LLVY GE DLICNWLGN RW  A++W GQK FG +  V F V G E G  
Sbjct  375   IPSLLEDGIKLLVYAGEEDLICNWLGNSRWAHAMEWSGQKAFGTSSTVKFVVDGVEAGSL  434

Query  437   KSYGPLTFLKV  405
              SYGPL+FLKV
Sbjct  435   NSYGPLSFLKV  445



>ref|XP_010658340.1| PREDICTED: serine carboxypeptidase-like isoform X2 [Vitis vinifera]
Length=492

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/456 (58%), Positives = 334/456 (73%), Gaps = 7/456 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             + EK+IR+LNLFP  D    +G       T +LVE++L+   +  S A+V+DL QHAGYY
Sbjct  24    KREKLIRELNLFP-KDAEAVNGMDWEGESTKKLVERRLRFPGIDYSDASVKDLSQHAGYY  82

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             +L +++ ARMFY FFESR ++ DPVVIWLTGGPGC S LALFYENGPF IA N SL WND
Sbjct  83    KLRHSLAARMFYLFFESRDSRKDPVVIWLTGGPGCGSELALFYENGPFTIAANMSLMWND  142

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWDK SNL+YVDQP GTGFSYSS   D R +E+ +SNDL+ FLQ FF+ HP +  ++F+
Sbjct  143   WGWDKISNLLYVDQPIGTGFSYSSDLRDIRHNEEAISNDLFDFLQAFFEEHPLFTNNDFY  202

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             + GESYAGHYIPAL  RI++GNK K GIHINLKG AIGNGLT+P IQY AY D+AL+  +
Sbjct  203   IAGESYAGHYIPALAARIHRGNKAKGGIHINLKGFAIGNGLTNPQIQYKAYTDYALEMGM  262

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDI  792
             I K+ +D + +++P C+ A++ C ++G  +C  S  V   C  ++ +IM    D NYYDI
Sbjct  263   IEKTDYDRINKVLPVCEMAIKLCGTDGTISCMASYFV---CNSIFSKIMALSGDTNYYDI  319

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK C  GSLCYDFSN E FLN K V+ ALGVGDI++V CS  VY+ +  D  +NL  GIP
Sbjct  320   RKTC-EGSLCYDFSNMEKFLNQKPVRAALGVGDIEFVPCSPAVYQALLMDWMRNLEVGIP  378

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
              LL+DGI LLVY GEYDLICNWLGN RWV A++W GQ  F AAP V F +G  + G+ K 
Sbjct  379   DLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWGGQLEFQAAPEVPFVIGDSKAGLMKI  438

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             +GPLTFLKVHDAGH+VPMDQP+ +LEML+RW   +L
Sbjct  439   HGPLTFLKVHDAGHMVPMDQPRVALEMLKRWFENKL  474



>ref|XP_010658342.1| PREDICTED: serine carboxypeptidase-like isoform X3 [Vitis vinifera]
Length=476

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/454 (59%), Positives = 333/454 (73%), Gaps = 7/454 (2%)
 Frame = -2

Query  1679  EKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYRL  1500
             EK+IR+LNLFP  D    +G       T +LVE++L+   +  S A+V+DL QHAGYY+L
Sbjct  10    EKLIRELNLFP-KDAEAVNGMDWEGESTKKLVERRLRFPGIDYSDASVKDLSQHAGYYKL  68

Query  1499  PNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYG  1320
              +++ ARMFY FFESR ++ DPVVIWLTGGPGC S LALFYENGPF IA N SL WND+G
Sbjct  69    RHSLAARMFYLFFESRDSRKDPVVIWLTGGPGCGSELALFYENGPFTIAANMSLMWNDWG  128

Query  1319  WDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVT  1140
             WDK SNL+YVDQP GTGFSYSS   D R +E+ +SNDL+ FLQ FF+ HP +  ++F++ 
Sbjct  129   WDKISNLLYVDQPIGTGFSYSSDLRDIRHNEEAISNDLFDFLQAFFEEHPLFTNNDFYIA  188

Query  1139  GESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLIS  960
             GESYAGHYIPAL  RI++GNK K GIHINLKG AIGNGLT+P IQY AY D+AL+  +I 
Sbjct  189   GESYAGHYIPALAARIHRGNKAKGGIHINLKGFAIGNGLTNPQIQYKAYTDYALEMGMIE  248

Query  959   KSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             K+ +D + +++P C+ A++ C ++G  +C  S  V   C  ++ +IM    D NYYDIRK
Sbjct  249   KTDYDRINKVLPVCEMAIKLCGTDGTISCMASYFV---CNSIFSKIMALSGDTNYYDIRK  305

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
              C  GSLCYDFSN E FLN K V+ ALGVGDI++V CS  VY+ +  D  +NL  GIP L
Sbjct  306   TC-EGSLCYDFSNMEKFLNQKPVRAALGVGDIEFVPCSPAVYQALLMDWMRNLEVGIPDL  364

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DGI LLVY GEYDLICNWLGN RWV A++W GQ  F AAP V F +G  + G+ K +G
Sbjct  365   LEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWGGQLEFQAAPEVPFVIGDSKAGLMKIHG  424

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PLTFLKVHDAGH+VPMDQP+ +LEML+RW   +L
Sbjct  425   PLTFLKVHDAGHMVPMDQPRVALEMLKRWFENKL  458



>ref|XP_004506061.1| PREDICTED: serine carboxypeptidase-like 48-like isoform X2 [Cicer 
arietinum]
Length=496

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/456 (58%), Positives = 339/456 (74%), Gaps = 6/456 (1%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGY  1509
             +RAEK+I+ LNLFP +  N    ++ ++    ++VEKK    L G S  ++E+LG HAGY
Sbjct  44    QRAEKLIKSLNLFPKNPAN--IVNNSIDFVPGKIVEKKFSF-LSGSSEPSIENLGHHAGY  100

Query  1508  YRLPNTVDARMFYFFFESR-SNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             Y LP +  +R+FYFFFESR S + DPVVIWLTGGPGCS +LALFYENGPF+I+++ SL W
Sbjct  101   YSLPRSNSSRLFYFFFESRNSTRDDPVVIWLTGGPGCSGNLALFYENGPFHISNDLSLVW  160

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             N+YGWDKASN+I+VDQP GTGFSY+S E +   +E+GVSNDLY FLQEF+K HP   K++
Sbjct  161   NNYGWDKASNIIFVDQPVGTGFSYTSDENEIPHNENGVSNDLYDFLQEFYKQHPNLVKND  220

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPAL +R+++GNK  +GIHINLKG AIGNGLT P IQYPAY  +A D 
Sbjct  221   FYITGESYAGHYIPALASRVHKGNKDNKGIHINLKGFAIGNGLTHPLIQYPAYTQYAFDM  280

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI+K   D +   +PGC++ ++ C S GG  C   +N+ C+ + + I+E   ++NYYD+
Sbjct  281   KLITKEDKDRIDDQVPGCEDTIKSCESGGGQNCLIAINT-CETIMESILEVAGNVNYYDV  339

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK+C  GSLCYDFSN ET LN  SVK+ALGVG++D+VSCS  VY  M  D  +NL   IP
Sbjct  340   RKQC-EGSLCYDFSNVETLLNDNSVKEALGVGNVDFVSCSKIVYNSMLEDWMQNLEVDIP  398

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK F  +  V F V G + G   S
Sbjct  399   TLLEDGIKVLIYAGEYDLICNWLGNSKWVHAMEWSGQKQFADSKTVPFLVDGAQAGSLNS  458

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             YGPL+FLKV  AGH+VPMDQPKA+L+ML  WMHG L
Sbjct  459   YGPLSFLKVKGAGHMVPMDQPKAALQMLVTWMHGTL  494



>gb|KEH41429.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=496

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 341/460 (74%), Gaps = 7/460 (2%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVED-LGQH  1518
             K  A+K++R LNLFP  +LN  S  +   +   ++VE  L   NL+ D      +  G +
Sbjct  26    KLEAKKLVRDLNLFPDVNLNIAS-SAANSSSRGKIVENPLNFRNLISDDDDVSVEDFGHY  84

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             AGYY + ++  A+MFYFFFESR++K D PVVIWLTGGPGCSS LALFYENGPF I D+ S
Sbjct  85    AGYYPIQHSHAAKMFYFFFESRNHKEDDPVVIWLTGGPGCSSELALFYENGPFKIKDDLS  144

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WN YGWDK SNL+YVDQPTGTGFSYS+   D R +E GVSNDLY FLQ FF  HP+YA
Sbjct  145   LTWNHYGWDKVSNLLYVDQPTGTGFSYSTDLRDIRHNEKGVSNDLYDFLQAFFAEHPQYA  204

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             K++FF+TGESYAGHYIPAL +RI+QGN+  EGIHINLKGLAIGNGLT+P IQY AYPD+A
Sbjct  205   KNDFFITGESYAGHYIPALASRIHQGNQANEGIHINLKGLAIGNGLTNPAIQYKAYPDYA  264

Query  980   LDNNLISKSFHDELTQ-LIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLN  804
             L+  LI+K  H  L + L+P C+ A++ C ++G  AC    N  C  ++  I+     +N
Sbjct  265   LEMGLITKVTHALLGKVLVPACELAIKLCGTDGKVACLS-ANVACNLIFSDILLHAGGVN  323

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYDIRKKC  GSLCYDFSN E FLN +SV+D+LGVG I +VSCST VY  M  D  +NL 
Sbjct  324   YYDIRKKC-EGSLCYDFSNMEKFLNQESVRDSLGVGKIRFVSCSTEVYMAMLVDWMRNLE  382

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP LL+DGI+LLVY GEYDLICNWLGN RWV A++W GQK F A+P+V F V G E G
Sbjct  383   VGIPILLEDGIDLLVYAGEYDLICNWLGNSRWVHAMKWSGQKEFVASPDVPFVVNGSEAG  442

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             I KSYGPL+FLKVHDAGH+VPMDQPKA+L+ML++W  G L
Sbjct  443   ILKSYGPLSFLKVHDAGHMVPMDQPKAALDMLKKWTRGTL  482



>sp|P52712.2|CBPX_ORYSJ RecName: Full=Serine carboxypeptidase-like; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAC45113.1| carboxypeptidase C cbp31 [Oryza sativa Japonica Group]
 dbj|BAD31260.1| carboxypeptidase C cbp31 [Oryza sativa Japonica Group]
Length=429

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/410 (64%), Positives = 315/410 (77%), Gaps = 4/410 (1%)
 Frame = -2

Query  1547  GATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKS--DPVVIWLTGGPGCSSSLALFYE  1374
             G++ EDLG HAGYYRLPNT DAR+FYFFFESR +K   DPVVIWLTGGPGCSS LALFYE
Sbjct  8     GSSAEDLGHHAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGPGCSSELALFYE  67

Query  1373  NGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFL  1194
             NGPF+IADN SL WND+GWD+ SNLIYVDQPTGTGFSYSS+  D R DE GVSNDLYAFL
Sbjct  68    NGPFHIADNMSLVWNDFGWDQESNLIYVDQPTGTGFSYSSNPRDTRHDEAGVSNDLYAFL  127

Query  1193  QEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDP  1014
             Q FF  HP +AK++F++TGESYAGHYIPA  +R+ +GNK  EGIHINLKG AIGNGLTDP
Sbjct  128   QAFFTEHPNFAKNDFYITGESYAGHYIPAFASRVYKGNKNSEGIHINLKGFAIGNGLTDP  187

Query  1013  GIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYD  834
              IQY AY D++LD  LI+KS  + + +++P C+ A++ C ++G  +C       C  ++ 
Sbjct  188   AIQYKAYTDYSLDMGLITKSQFNRINKIVPTCELAIKLCGTSGTISCLG-AYVVCNLIFS  246

Query  833   RIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEV  654
              I   +   NYYDIRK CV GSLCYD SN E FL  KSV+++LGVGDI +VSCS TVY+ 
Sbjct  247   SIETIIGKKNYYDIRKPCV-GSLCYDLSNMEKFLQLKSVRESLGVGDIQFVSCSPTVYQA  305

Query  653   MSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNV  474
             M  D  +NL  GIP LL++ I +L+Y GEYDLICNWLGN RWV +++W G++ F ++   
Sbjct  306   MLLDWMRNLEVGIPELLENDIKVLIYAGEYDLICNWLGNSRWVNSMEWSGKEAFVSSSEE  365

Query  473   TFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              F+V GKE GI KSYGPL+FLKVHDAGH+VPMDQPK +LEML RW  G L
Sbjct  366   PFTVDGKEAGILKSYGPLSFLKVHDAGHMVPMDQPKVALEMLMRWTSGNL  415



>emb|CDY00930.1| BnaC05g42700D [Brassica napus]
Length=514

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/461 (59%), Positives = 342/461 (74%), Gaps = 15/461 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN--RGSGHSPVEADTPRLVEKKLKL-NLLGDSGA-TVEDLGQH  1518
             RAEK+IR+LNLFP  ++N     G +    + P +VE++    N+L D GA ++EDLG H
Sbjct  42    RAEKLIRELNLFPNLEVNVIDVGGSTLASEELPPIVERRFIFPNILPDGGAPSLEDLGHH  101

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY+LP +  ARMFY FFESRS K  P+VIWLTGGPGCSS LA+FYENGPF +  N SL
Sbjct  102   AGYYKLPKSQGARMFYLFFESRSKKDAPLVIWLTGGPGCSSELAMFYENGPFKLDKNMSL  161

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WN+YGWD+ASNL+YVDQP GTGFSY+S + D R D+ GVS+DLY FLQ FF  HPK A 
Sbjct  162   AWNEYGWDQASNLLYVDQPVGTGFSYTSDKTDIRHDQTGVSDDLYDFLQAFFAEHPKLAN  221

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
              +F++TGESYAGHYIPA  +R+++GNK  EGIH    G AIGNGLTDP  QYPAYPD+A 
Sbjct  222   KDFYITGESYAGHYIPAFASRVHRGNKANEGIH----GFAIGNGLTDPAYQYPAYPDYAF  277

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLN  804
             +  LI+K+ HD LT+++P C+ +++ C ++G ++C  S LV   C  L+  ++     +N
Sbjct  278   EMGLITKAEHDRLTKIVPLCELSIKICGTDGTTSCLASYLV---CNTLFSGVINHAHGVN  334

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RKKC  GSLCYDFS+ E FLN  SV+ +LGVG+I++VSCST+VY+ M  D+ +NL 
Sbjct  335   YYDVRKKC-EGSLCYDFSDMEKFLNLNSVRKSLGVGEIEFVSCSTSVYQAMLQDLMRNLE  393

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWL-GNLRWVQALQWYGQKGFGAAPNVTFSVGGKEK  447
              GIP+LL+DGINLLVY GEYDLICNWL GN RWV A++W G++ F AA  V F V GKE 
Sbjct  394   VGIPALLEDGINLLVYAGEYDLICNWLAGNSRWVHAMEWSGKENFKAAKEVPFVVDGKEA  453

Query  446   GIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             G  KSY  L+FLKVHDAGH+VPMDQPK++L+ML  WM   L
Sbjct  454   GKVKSYEQLSFLKVHDAGHMVPMDQPKSALKMLEGWMKKSL  494



>emb|CDY08605.1| BnaA05g28410D [Brassica napus]
Length=515

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/462 (59%), Positives = 343/462 (74%), Gaps = 16/462 (3%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEADT--PRLVEKKLKL-NLLGDSGA-TVEDLGQ  1521
             RAEK+IR+LNLFP  ++N    G S + +D   P +VE++    N+L D G  ++EDLG 
Sbjct  42    RAEKLIRELNLFPNLEVNVIDVGDSTLTSDEELPSIVERRFIFPNILPDGGPPSLEDLGH  101

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY+LP +  ARMFYFFFESRS K  P+VIWLTGGPGCSS LA+FYENGPF +  N S
Sbjct  102   HAGYYKLPKSQGARMFYFFFESRSKKDAPLVIWLTGGPGCSSELAMFYENGPFKLDKNMS  161

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L WN+YGWD+ASNL+YVDQP GTGFSY+S + D R D+ GVS+DLY FLQ FF  HPK A
Sbjct  162   LAWNEYGWDQASNLLYVDQPVGTGFSYTSDKTDIRHDQTGVSDDLYDFLQAFFAEHPKLA  221

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
               +F++TGESYAGHYIPA  +R+++GNK  EGIH    G AIGNGLTDP  QYPAYPD+A
Sbjct  222   NKDFYITGESYAGHYIPAFASRVHRGNKANEGIH----GFAIGNGLTDPAYQYPAYPDYA  277

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDL  807
              +  LI+++ HD LT+++P C+ +++ C ++G ++C  S LV   C  L+  ++     +
Sbjct  278   FEMGLITQAEHDRLTKIVPLCELSIKICGTDGTTSCLASYLV---CNTLFSGVINHAHGV  334

Query  806   NYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNL  627
             NYYD+RKKC  GSLCYDFS+ E FLN  SV+ +LGVG+I++VSCST+VY+ M  D+ +NL
Sbjct  335   NYYDVRKKC-EGSLCYDFSDMEKFLNLNSVRKSLGVGEIEFVSCSTSVYQAMLQDLMRNL  393

Query  626   APGIPSLLQDGINLLVYVGEYDLICNWL-GNLRWVQALQWYGQKGFGAAPNVTFSVGGKE  450
               GIP LL+DGINLLVY GEYDLICNWL GN RWV A++W G++ F AA  V F V GKE
Sbjct  394   EVGIPELLEDGINLLVYAGEYDLICNWLAGNSRWVHAMEWSGKENFKAAKEVPFVVDGKE  453

Query  449   KGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G  KSY  L+FLKVHDAGH+VPMDQPK++L+ML  WM   L
Sbjct  454   AGKVKSYEQLSFLKVHDAGHMVPMDQPKSALKMLEGWMKKSL  495



>dbj|BAA04511.1| serine carboxypeptidase-like protein [Oryza sativa Japonica Group]
Length=429

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/413 (64%), Positives = 317/413 (77%), Gaps = 10/413 (2%)
 Frame = -2

Query  1547  GATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKS--DPVVIWLTGGPGCSSSLALFYE  1374
             G++ EDLG HAGYYRLPNT DAR+FYFFFESR +K   DPVVIWLTGGPGCSS LALFYE
Sbjct  8     GSSAEDLGHHAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGPGCSSELALFYE  67

Query  1373  NGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFL  1194
             NGPF+IADN SL WND+GWD+ SNLIYVDQPTGTGFSYSS+  D R DE GVSNDLYAFL
Sbjct  68    NGPFHIADNMSLVWNDFGWDQESNLIYVDQPTGTGFSYSSNPRDTRHDEAGVSNDLYAFL  127

Query  1193  QEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDP  1014
             Q FF  HP +AK++F++TGESYAGHYIPA  +R+ +GNK  EGIHINLKG AIGNGLTDP
Sbjct  128   QAFFTEHPNFAKNDFYITGESYAGHYIPAFASRVYKGNKNSEGIHINLKGFAIGNGLTDP  187

Query  1013  GIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSD---LVNSRCQP  843
              IQY AY D++LD  LI+KS  + + +++P C+ A++ C ++G  +C     + N  C  
Sbjct  188   AIQYKAYTDYSLDMGLITKSQFNRINKIVPTCELAIKLCGTSGTISCLGAYVVCNLICSS  247

Query  842   LYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTV  663
             +   I +K    NYYDIRK CV GSLCYD SN E FL  KSV+++LGVGDI +VSCS TV
Sbjct  248   IETIIGKK----NYYDIRKPCV-GSLCYDLSNMEKFLQLKSVRESLGVGDIQFVSCSPTV  302

Query  662   YEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAA  483
             Y+ M  D  +NL  GIP LL++ I +L+Y GEYDLICNWLGN RWV +++W G++ F ++
Sbjct  303   YQAMLLDWMRNLEVGIPELLENDIKVLIYAGEYDLICNWLGNSRWVNSMEWSGKEAFVSS  362

Query  482   PNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
                 F+V GKE GI KSYGPL+FLKVHDAGH+VPMDQPK +LEML RW  G L
Sbjct  363   SEEPFTVDGKEAGILKSYGPLSFLKVHDAGHMVPMDQPKVALEMLMRWTSGNL  415



>ref|XP_008784501.1| PREDICTED: serine carboxypeptidase-like isoform X2 [Phoenix dactylifera]
Length=498

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/459 (59%), Positives = 333/459 (73%), Gaps = 18/459 (4%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGA--TVEDLGQHA  1515
             R AE +IR LNL P+     G      ++ +PRLVEK++ L +LG+SG+   +E LG HA
Sbjct  42    RFAEDLIRDLNLQPVIQEIEGEQKGD-DSSSPRLVEKRINLEILGESGSDIPIEQLGHHA  100

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYYRL +T  A+MFYFFFESR   SDPVVIWLTGGPGCSS LALFYENGPF IADN SL 
Sbjct  101   GYYRLEHTHAAKMFYFFFESRGKSSDPVVIWLTGGPGCSSELALFYENGPFKIADNMSLI  160

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWDK         PTGTGFSYS+   D R  E GVS+DLY FLQ FF+ HPKY K+
Sbjct  161   WNDYGWDK---------PTGTGFSYSTDLRDLRYSEKGVSDDLYDFLQAFFREHPKYLKN  211

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA   R+++GNK+K+G+ +NLKG AIGNGLT+P IQY AY D+ALD
Sbjct  212   DFYITGESYAGHYIPAAAERVHRGNKEKQGLQLNLKGFAIGNGLTNPEIQYGAYADYALD  271

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
               +I +S +  ++++ P C+  V+ C  +G   C  S  V   C  ++  IM    D+NY
Sbjct  272   MGIIGESAYKSISKIYPLCELGVKLCGPSGVIGCLASYFV---CNSIFTSIMLLAGDMNY  328

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKC G SLCYD SN E FLN KSV+DALGVG+  +VSCS  VYE M +D  KNL  
Sbjct  329   YDIRKKCEG-SLCYDLSNMEKFLNEKSVRDALGVGNKKFVSCSPLVYEAMITDWMKNLEV  387

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+L+ DGI LLVY GEYDLICNWLGN RWV +++W G + F  AP + F + GKE G+
Sbjct  388   GIPTLIGDGIRLLVYAGEYDLICNWLGNFRWVNSMEWSGHQIFAEAPMLPFVIDGKEAGL  447

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              KSYGPL+FLKVHDAGH+VPMDQP+A+LEML+RWM G L
Sbjct  448   LKSYGPLSFLKVHDAGHMVPMDQPRAALEMLKRWMKGNL  486



>ref|XP_006289997.1| hypothetical protein CARUB_v10003627mg [Capsella rubella]
 gb|EOA22895.1| hypothetical protein CARUB_v10003627mg [Capsella rubella]
Length=499

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/458 (59%), Positives = 332/458 (72%), Gaps = 10/458 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLN-LLGDS----GATVEDLGQH  1518
             AE +I   NL P + +N     +P   + PRL E ++    + GD     G +V++ G +
Sbjct  46    AESLINSFNLTPQYAVNVIQKGNP---NAPRLFESQIDFRAMFGDQNASGGPSVQEFGHY  102

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY LP++  A+MFYFFFESR+N +DPVVIWL+GGPGCSSS+A+FYENGPF I+D+ SL
Sbjct  103   AGYYSLPHSKSAKMFYFFFESRNNSADPVVIWLSGGPGCSSSIAMFYENGPFKISDDFSL  162

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WND+GWDK SNLIYVDQP GTGFSY+    D R DE GVSNDLY FLQ FFK HPK+AK
Sbjct  163   SWNDFGWDKVSNLIYVDQPVGTGFSYTKDISDIRLDEAGVSNDLYDFLQAFFKEHPKFAK  222

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++FF+TGESYAGHYIPA  +R++ GNKKKEGI INLKG+AIGNGLT+P IQY AY D+AL
Sbjct  223   NDFFITGESYAGHYIPAFASRVHSGNKKKEGIQINLKGIAIGNGLTNPEIQYAAYGDYAL  282

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
                LI++S ++ + Q    CQ  +++CN     AC+      C  +   I EK   +NYY
Sbjct  283   QMKLITESDNEGIKQDYVECQNFIKKCNLGVALACASGF-EVCNNIVTTITEKNKGINYY  341

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             D+RKKCV G LCYDFS  ETFLN ++V+ ALGVGDI++VSCS+TVY+ M+ D   NL   
Sbjct  342   DVRKKCV-GRLCYDFSKIETFLNKENVRKALGVGDIEFVSCSSTVYDAMTKDWMVNLEVK  400

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP L+ DGI+LLVY GEYDL+CNWLGN RWV+ + W GQK F AA NV   V  KE G+ 
Sbjct  401   IPELVNDGISLLVYAGEYDLLCNWLGNSRWVEEMNWSGQKDFKAAKNVPLMVDNKEVGLL  460

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KSYG LTFLKVHDAGH+VPMDQPK SL ML+ WM G L
Sbjct  461   KSYGSLTFLKVHDAGHMVPMDQPKGSLLMLQYWMRGML  498



>ref|XP_004506060.1| PREDICTED: serine carboxypeptidase-like 48-like isoform X1 [Cicer 
arietinum]
Length=497

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/456 (57%), Positives = 337/456 (74%), Gaps = 5/456 (1%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGY  1509
             +RAEK+I+ LNLFP +  N    ++ ++    ++VEKK    L G S  ++E+LG HAGY
Sbjct  44    QRAEKLIKSLNLFPKNPAN--IVNNSIDFVPGKIVEKKFSF-LSGSSEPSIENLGHHAGY  100

Query  1508  YRLPNTVDARMFYFFFESR-SNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFW  1332
             Y LP +  +R+FYFFFESR S + DPVVIWLTGGPGCS +LALFYENGPF+I+++ SL W
Sbjct  101   YSLPRSNSSRLFYFFFESRNSTRDDPVVIWLTGGPGCSGNLALFYENGPFHISNDLSLVW  160

Query  1331  NDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             N+YGWDKASN+I+VDQP GTGFSY+S E +   +E+GVSNDLY FLQEF+K HP   K++
Sbjct  161   NNYGWDKASNIIFVDQPVGTGFSYTSDENEIPHNENGVSNDLYDFLQEFYKQHPNLVKND  220

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPAL +R+++GNK  +GIHINLKG AIGNGLT P IQYPAY  +A D 
Sbjct  221   FYITGESYAGHYIPALASRVHKGNKDNKGIHINLKGFAIGNGLTHPLIQYPAYTQYAFDM  280

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI+K   D +   +PGC++ ++ C  +GG     +  + C+ + + I+E   ++NYYD+
Sbjct  281   KLITKEDKDRIDDQVPGCEDTIKSCEESGGGQNCLIAINTCETIMESILEVAGNVNYYDV  340

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIP  612
             RK+C  GSLCYDFSN ET LN  SVK+ALGVG++D+VSCS  VY  M  D  +NL   IP
Sbjct  341   RKQC-EGSLCYDFSNVETLLNDNSVKEALGVGNVDFVSCSKIVYNSMLEDWMQNLEVDIP  399

Query  611   SLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKS  432
             +LL+DGI +L+Y GEYDLICNWLGN +WV A++W GQK F  +  V F V G + G   S
Sbjct  400   TLLEDGIKVLIYAGEYDLICNWLGNSKWVHAMEWSGQKQFADSKTVPFLVDGAQAGSLNS  459

Query  431   YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             YGPL+FLKV  AGH+VPMDQPKA+L+ML  WMHG L
Sbjct  460   YGPLSFLKVKGAGHMVPMDQPKAALQMLVTWMHGTL  495



>gb|EYU37040.1| hypothetical protein MIMGU_mgv1a024049mg [Erythranthe guttata]
Length=477

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/457 (59%), Positives = 336/457 (74%), Gaps = 20/457 (4%)
 Frame = -2

Query  1691  KRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAG  1512
             K++AEK IR+LNLFP++D+N         A  PR+VEK  +L  L +S  T++D G HAG
Sbjct  37    KKQAEKFIRELNLFPVNDINIVENDD--FAPQPRIVEKSFRLPHLSES--TIQDFGHHAG  92

Query  1511  YYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             YY+LP+T  ARMFY+FFESR    + PVV+WLTGGPGCS SLALFYENGPF++ +N SL 
Sbjct  93    YYKLPHTKGARMFYYFFESRKKDINAPVVLWLTGGPGCSGSLALFYENGPFHLTNNLSLV  152

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WND+GWDK SNLIYVDQP GTGFSYSSS++D RT+ +  S D+Y FLQ FF+ HP YAK+
Sbjct  153   WNDFGWDKESNLIYVDQPIGTGFSYSSSKDDIRTNSEEASVDIYDFLQAFFEKHPHYAKN  212

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIP    +I++ NK KEG+ +NLKGLAIGNG+T+P IQY AY D+ALD
Sbjct  213   DFYITGESYAGHYIPVFAAQIHRRNKNKEGLFVNLKGLAIGNGMTNPEIQYKAYRDYALD  272

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
               LI +S ++ L + +  C+   + C +N               +++ I+    D+NYYD
Sbjct  273   MRLIDQSQYNNLNKSVSTCEHETKTCGTNND-------------VFNYILASTNDVNYYD  319

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGV-GDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             IRKKC  GSLCYDFSNAE  LN  SVK ALGV GDI +VSCS+ VY+ M ++  KN    
Sbjct  320   IRKKC-EGSLCYDFSNAEKLLNQISVKKALGVYGDIQFVSCSSVVYDAMMTESMKNFEVD  378

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IPSLLQDGI LLVY GEYDLICNWLGN RWV  ++W+G+K F +A  V F V G E G++
Sbjct  379   IPSLLQDGIKLLVYAGEYDLICNWLGNSRWVDNMEWFGRKEFLSAAFVPFKVDGVEAGLR  438

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             KSYG LTFLKV++AGHLVPMDQPKASLEMLRRWM G+
Sbjct  439   KSYGDLTFLKVYNAGHLVPMDQPKASLEMLRRWMKGE  475



>gb|KEH29969.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=494

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/458 (57%), Positives = 342/458 (75%), Gaps = 7/458 (2%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTP-RLVEKKLKLNLLGDS-GATVEDLGQHA  1515
             +RAEK+IR LNLFP + +    GHS ++   P ++VEKK   +  G S G ++++LG HA
Sbjct  40    QRAEKLIRSLNLFPKNPVKMIHGHSVLDDFVPGKIVEKKF--SFFGHSDGLSIDNLGHHA  97

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             GYY LP++  ARMFY+FF+SR+N +D PVVIWL GGPGCS ++ LFYENGPF IA+N SL
Sbjct  98    GYYSLPHSKAARMFYYFFKSRNNTNDDPVVIWLAGGPGCSGAIPLFYENGPFKIANNLSL  157

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WNDYGWDKASN+IY+DQP GTGFSY+S + D R D+  +SNDLY FLQEFFK HP++ K
Sbjct  158   VWNDYGWDKASNIIYIDQPIGTGFSYTSDDSDIRHDQTSISNDLYDFLQEFFKQHPEFVK  217

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGH+ PAL +RI +GNK KEGI INLKG A+GNG+T+P IQY AYP +AL
Sbjct  218   NDFYITGESYAGHFAPALASRIRRGNKDKEGIIINLKGFAVGNGMTNPRIQYLAYPQYAL  277

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
             D  LI+K   D++ +L+P C +A++ C + G  +C  L   +C+ + + I+    ++N+Y
Sbjct  278   DMKLIAKEDQDDINKLMPKCHDAIKTCEAGGKESCL-LAFKQCEGVTNDILSIAGNINHY  336

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRK C  G LCYDFSN    LN K+VKDALGVGDI++VSCS  VY+ +  D  KN    
Sbjct  337   DIRKTC-HGDLCYDFSNVMKLLNEKTVKDALGVGDIEFVSCSKIVYDALQQDWMKNHEVD  395

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IPSLL++GI +L+YVGE+DL+CNWLGN  WV A++W G+  F AA  V F V G + G+ 
Sbjct  396   IPSLLEEGIKVLIYVGEFDLLCNWLGNSNWVHAMEWSGRNQFVAAKTVPFLVDGAKAGLL  455

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              SYGPL+FLKV+DAGH+VPMDQPKA+L+ML  WM G+L
Sbjct  456   NSYGPLSFLKVNDAGHMVPMDQPKAALQMLVNWMQGKL  493



>ref|XP_004506096.1| PREDICTED: serine carboxypeptidase-like 48-like [Cicer arietinum]
Length=496

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 340/459 (74%), Gaps = 8/459 (2%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDS-GATVEDLGQHAG  1512
              RAEK+I+ LNLFP + +N    ++ ++    ++VEK    ++LGDS   ++E+LG HAG
Sbjct  44    ERAEKLIKSLNLFPKNPVNIV--NNSIDFVPGKIVEKHF--SILGDSYEPSIENLGHHAG  99

Query  1511  YYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             YY LP +  ARMFYFFFESR N SD P+VIWLTGGPGCSS LALFYENGPF+I+D+ SL 
Sbjct  100   YYSLPRSKSARMFYFFFESRKNTSDDPIVIWLTGGPGCSSQLALFYENGPFHISDDLSLV  159

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN+YGWDK SN+++VDQP GTGFSY++ E +   DE GVSNDLY FLQ FFK H  + K+
Sbjct  160   WNNYGWDKVSNILFVDQPIGTGFSYTADESEIPHDEIGVSNDLYGFLQAFFKQHSNFVKN  219

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++ GESYAGH++PAL +R++QGNK KEGI+INLKG AIGNG T+P IQYPAY  +A D
Sbjct  220   DFYIIGESYAGHFVPALASRVHQGNKNKEGININLKGFAIGNGWTNPIIQYPAYTQYAFD  279

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
               LI+K   D++ Q+IPGCQ+A++ C S GG +CS   NS C  +  +I++   ++NYYD
Sbjct  280   MKLITKKDQDQINQMIPGCQDAIKTCQSKGGQSCSIAQNS-CDSIMGKILQIAGNINYYD  338

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IRK+C  G LCYDFS  +  LN  SVK+ALGVG++ +VSCST VY  M  D+ +NL   I
Sbjct  339   IRKQC-DGDLCYDFSYVDDLLNDNSVKEALGVGNVKFVSCSTVVYNAMLQDMMQNLDVDI  397

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DGI +L+Y GE+DL CNWLGNL WV A++W GQ  F ++  + F V G + G+  
Sbjct  398   PTLLEDGIKVLIYAGEHDLTCNWLGNLNWVHAMKWSGQNQFASSKTLQFLVDGAQAGLLN  457

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL*K  318
             SYGPL+FLKV+ AGH+VPMDQP A+L+ML  WM G L K
Sbjct  458   SYGPLSFLKVNGAGHMVPMDQPNAALQMLVNWMDGTLNK  496



>ref|XP_002960122.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ37661.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=509

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/479 (57%), Positives = 336/479 (70%), Gaps = 10/479 (2%)
 Frame = -2

Query  1742  SSPAGQANGEDN-----SMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEK  1578
             S+ AG ++ ED      S A  + +AE+MIR +NL P  D +       +E    RLVE+
Sbjct  11    SAIAGISSLEDAFLREISTARPRHQAEQMIRAMNLLPHVDDSAEDSSPELEMSVERLVER  70

Query  1577  KLKLNLLGDSGA--TVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKS-DPVVIWLTGGP  1407
             +++L + GDS +  TVEDLG HAGY++L  T  ARMFYFFFESR N+S DP+V+W+TGGP
Sbjct  71    RVELGIKGDSESEVTVEDLGHHAGYFKLEGTHSARMFYFFFESRRNRSKDPLVLWMTGGP  130

Query  1406  GCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDE  1227
             GC S +ALFYENGPF+IA N SL+WN YGWDK SN+I+VDQP GTGFSYSS   D R DE
Sbjct  131   GCGSEVALFYENGPFHIAKNLSLYWNKYGWDKVSNIIFVDQPIGTGFSYSSDVRDIRHDE  190

Query  1226  DGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLK  1047
              GVS D+Y FL+ FFK HP+YA  +F+VTGESYAGHYIPA+ T I+  NKKK+GI INLK
Sbjct  191   KGVSKDMYDFLEAFFKKHPEYADRDFYVTGESYAGHYIPAVATNIHDHNKKKDGITINLK  250

Query  1046  GLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSD  867
             G+AIGNGLT P IQY AY D+AL+  LI++  + +++++ P C  AV+ C   G   C  
Sbjct  251   GVAIGNGLTQPEIQYEAYGDYALEMKLINEDQYKKISKIYPVCSVAVKLCGEFGTVTCLA  310

Query  866   LVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDID  687
              +   CQ ++  I+    ++NYYDIRK CV G LCYDFS  E FLN  S + ALGV +  
Sbjct  311   AL-LICQTIFQSILSIAGNINYYDIRKPCV-GQLCYDFSAMEEFLNQDSTRVALGVRNRT  368

Query  686   WVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWY  507
             +VSC+  VYE M  D  +NL  GIP+LL+DGI LLVY GEYDLICNWLGN RWV A+ W 
Sbjct  369   FVSCNPVVYEAMLVDWMRNLEVGIPALLEDGIKLLVYAGEYDLICNWLGNSRWVTAMDWS  428

Query  506   GQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHG  330
             GQ+ +  A    FSV G+  G    YGPLTFLKVHDAGH+VPMDQPK SLEM+ RWM G
Sbjct  429   GQQSYAEASWEDFSVDGETAGSVSGYGPLTFLKVHDAGHMVPMDQPKNSLEMISRWMKG  487



>ref|XP_006400806.1| hypothetical protein EUTSA_v10013304mg [Eutrema salsugineum]
 gb|ESQ42259.1| hypothetical protein EUTSA_v10013304mg [Eutrema salsugineum]
Length=507

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/460 (58%), Positives = 334/460 (73%), Gaps = 10/460 (2%)
 Frame = -2

Query  1688  RRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSG-----ATVEDLG  1524
             + A++ I+  NL P H++N     SP   D PRLVE +   +   D+G      +V + G
Sbjct  44    QNADRRIQFFNLKPQHNVNVIPKGSP---DAPRLVESQFDFSASIDAGNAPGGPSVTEFG  100

Query  1523  QHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQ  1344
              +AGYY LP++  A+MFYFFFESRSN SDPVV+WL+GGPG SSSLALFYENGPF I+++ 
Sbjct  101   HYAGYYPLPHSKAAKMFYFFFESRSNNSDPVVLWLSGGPGVSSSLALFYENGPFKISEDL  160

Query  1343  SLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKY  1164
             SL WND+GWDK SN++YVDQP GTGFSY+S   D R DE GVS+DLY FLQ FFK H ++
Sbjct  161   SLSWNDFGWDKISNILYVDQPVGTGFSYTSDISDLRHDEAGVSDDLYEFLQAFFKEHLQF  220

Query  1163  AKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDF  984
             AK+ F++TGESYAGHYIPAL + I+ GNKKKEGI INLKG AIGNGL +P IQY AY D+
Sbjct  221   AKNSFYITGESYAGHYIPALASLIHNGNKKKEGIPINLKGFAIGNGLVNPEIQYGAYGDY  280

Query  983   ALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLN  804
             A +  LIS+S HD L Q    CQ  ++ CN NGG AC D     C  + D+IM K+   N
Sbjct  281   AREMRLISESDHDSLKQNYVDCQGLIKNCNLNGGEAC-DSAYKVCNNISDQIMNKIKGTN  339

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
              YD+RKKCV G +CY+FS  + FLN ++++ ALGVGDI +VS S  VY+ M  D   N  
Sbjct  340   VYDLRKKCV-GRMCYNFSKVDVFLNQENIRKALGVGDITFVSFSRKVYDAMMEDFMINPE  398

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
               IP+L++DGINLLVY GEYD++CNWLGN RWV+ + W GQK FG+A  V F V GKE G
Sbjct  399   VKIPALVEDGINLLVYAGEYDILCNWLGNSRWVEQMNWSGQKDFGSAKTVPFLVDGKEAG  458

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             + K++G LTFLKVHDAGH+VPMDQPKASL+ML++WM G+L
Sbjct  459   LMKNHGSLTFLKVHDAGHMVPMDQPKASLQMLQKWMQGKL  498



>ref|XP_002984019.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ15031.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=509

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/479 (56%), Positives = 336/479 (70%), Gaps = 10/479 (2%)
 Frame = -2

Query  1742  SSPAGQANGEDN-----SMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEK  1578
             S+ AG ++ ED      S A  + +AE+MIR +NL P  D +       +E    RLVE+
Sbjct  11    SAIAGISSLEDAFLREISAARPRHQAEQMIRAMNLLPHVDDSAEDSSPELEMSVERLVER  70

Query  1577  KLKLNLLGDSGA--TVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKS-DPVVIWLTGGP  1407
             +++L + GDS +  TVEDLG HAGY++L  T  ARMFYFFFESR N+S DP+V+W+TGGP
Sbjct  71    RVELGIKGDSESEVTVEDLGHHAGYFKLEGTHSARMFYFFFESRGNRSKDPLVLWMTGGP  130

Query  1406  GCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDE  1227
             GC S +ALFYENGPF+IA N SL+WN YGWDK SN+I+VDQP GTGFSYSS   D R DE
Sbjct  131   GCGSEVALFYENGPFHIAKNLSLYWNKYGWDKVSNIIFVDQPIGTGFSYSSDVRDIRHDE  190

Query  1226  DGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLK  1047
              GVS D+Y FL+ FFK HP+YA  +F+VTGESYAGHYIPA+ T I+  NKKK+GI INLK
Sbjct  191   KGVSKDMYDFLEAFFKKHPEYADRDFYVTGESYAGHYIPAVATNIHDHNKKKDGITINLK  250

Query  1046  GLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSD  867
             G+AIGNGLT P IQY AY D+AL+  LI++  + +++++ P C  AV+ C   G   C  
Sbjct  251   GVAIGNGLTQPEIQYEAYGDYALEMKLINEDQYKKISKIYPVCSVAVKLCGEKGTVTCLA  310

Query  866   LVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDID  687
              +   CQ ++  I+    ++NYYDIRK CV G LCYDFS  E FLN  S + ALGV +  
Sbjct  311   AL-LICQTIFQSILSIAGNINYYDIRKPCV-GQLCYDFSAMEEFLNQDSTRVALGVRNRT  368

Query  686   WVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWY  507
             +VSC+  V+E M  D  +NL  GIP+LL+DGI LLVY GEYDLICNWLGN RWV A+ W 
Sbjct  369   FVSCNPVVHEAMLVDWMRNLEVGIPALLEDGIKLLVYAGEYDLICNWLGNSRWVTAMDWS  428

Query  506   GQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHG  330
             GQ+ +  A    FSV G+  G    YGPLTFLKVHDAGH+VPMDQPK SLEM+ RWM G
Sbjct  429   GQQSYAEASWEDFSVDGETAGSVSGYGPLTFLKVHDAGHMVPMDQPKNSLEMISRWMKG  487



>ref|XP_010658343.1| PREDICTED: serine carboxypeptidase-like isoform X4 [Vitis vinifera]
 emb|CBI31399.3| unnamed protein product [Vitis vinifera]
Length=448

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/427 (60%), Positives = 319/427 (75%), Gaps = 6/427 (1%)
 Frame = -2

Query  1598  TPRLVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWL  1419
             T +LVE++L+   +  S A+V+DL QHAGYY+L +++ ARMFY FFESR ++ DPVVIWL
Sbjct  8     TKKLVERRLRFPGIDYSDASVKDLSQHAGYYKLRHSLAARMFYLFFESRDSRKDPVVIWL  67

Query  1418  TGGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDF  1239
             TGGPGC S LALFYENGPF IA N SL WND+GWDK SNL+YVDQP GTGFSYSS   D 
Sbjct  68    TGGPGCGSELALFYENGPFTIAANMSLMWNDWGWDKISNLLYVDQPIGTGFSYSSDLRDI  127

Query  1238  RTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIH  1059
             R +E+ +SNDL+ FLQ FF+ HP +  ++F++ GESYAGHYIPAL  RI++GNK K GIH
Sbjct  128   RHNEEAISNDLFDFLQAFFEEHPLFTNNDFYIAGESYAGHYIPALAARIHRGNKAKGGIH  187

Query  1058  INLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGS  879
             INLKG AIGNGLT+P IQY AY D+AL+  +I K+ +D + +++P C+ A++ C ++G  
Sbjct  188   INLKGFAIGNGLTNPQIQYKAYTDYALEMGMIEKTDYDRINKVLPVCEMAIKLCGTDGTI  247

Query  878   AC--SDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDAL  705
             +C  S  V   C  ++ +IM    D NYYDIRK C  GSLCYDFSN E FLN K V+ AL
Sbjct  248   SCMASYFV---CNSIFSKIMALSGDTNYYDIRKTC-EGSLCYDFSNMEKFLNQKPVRAAL  303

Query  704   GVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWV  525
             GVGDI++V CS  VY+ +  D  +NL  GIP LL+DGI LLVY GEYDLICNWLGN RWV
Sbjct  304   GVGDIEFVPCSPAVYQALLMDWMRNLEVGIPDLLEDGIKLLVYAGEYDLICNWLGNSRWV  363

Query  524   QALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLR  345
              A++W GQ  F AAP V F +G  + G+ K +GPLTFLKVHDAGH+VPMDQP+ +LEML+
Sbjct  364   HAMEWGGQLEFQAAPEVPFVIGDSKAGLMKIHGPLTFLKVHDAGHMVPMDQPRVALEMLK  423

Query  344   RWMHGQL  324
             RW   +L
Sbjct  424   RWFENKL  430



>gb|AES67521.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=508

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/457 (57%), Positives = 332/457 (73%), Gaps = 7/457 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYR  1503
             +  +IR LNLFP   +N       V      +VEKK       DSG +VE+LG HAGYY 
Sbjct  43    SSTLIRGLNLFPKSSINIPENDPHVLHG--NIVEKKFTFPGFDDSGYSVEELGHHAGYYS  100

Query  1502  LPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD--NQSLFWN  1329
             LP++  ARMFYFFFESR++K DPV+IWLTGGPGC S +ALFYENGPF  +   N SL WN
Sbjct  101   LPHSKAARMFYFFFESRNSKDDPVIIWLTGGPGCGSEIALFYENGPFQFSKDKNLSLVWN  160

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSS-EEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             +YGWDKASN+I+VDQP G+GFSY++   +D R DED +SNDLY FLQ FFK HP++ K++
Sbjct  161   EYGWDKASNIIFVDQPIGSGFSYTTDVSDDIRHDEDSISNDLYDFLQAFFKEHPQFTKND  220

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R++QGNK KEGIHINLKG AIGNGLT+P IQY AY D+AL+N
Sbjct  221   FYITGESYAGHYIPAFASRVHQGNKAKEGIHINLKGFAIGNGLTNPDIQYMAYTDYALEN  280

Query  971   NLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDI  792
              LI+K  ++ + +LIP CQ+A ++C++ GG AC   + + C  ++ +I     + NYYDI
Sbjct  281   GLINKDEYERINELIPPCQKATKKCDTEGGHACGTALTT-CMKIFYQITNITGNTNYYDI  339

Query  791   RKKCVGG-SLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             RKKC G    C DFS+ ET LN K+VK+ALGVGD+ +  CS  V+  ++ D  KNL  GI
Sbjct  340   RKKCEGAFGHCQDFSDIETLLNMKTVKEALGVGDLKFEYCSFLVHAALTEDWMKNLEVGI  399

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P+LL+DGI LLVY GE DLICNWLGN RWV A++W GQ  F  +P  +F V  +E GI K
Sbjct  400   PALLEDGIKLLVYAGEKDLICNWLGNSRWVDAMKWSGQTTFKESPTTSFLVDSEEAGILK  459

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             S+GPL FLKV +AGH+VPMDQPK +L+ML+ WM G+L
Sbjct  460   SHGPLAFLKVKEAGHMVPMDQPKVALQMLQDWMQGKL  496



>emb|CDY56704.1| BnaC01g38630D [Brassica napus]
Length=604

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/463 (58%), Positives = 335/463 (72%), Gaps = 29/463 (6%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNR-GSGHSPVEA--DTPRLVEKKLKL-NLLG--DSGATVEDLG  1524
             RAEK+IR+LNLFP  D+N    G SP+ +  + P +VE+  +  N++   D GA+VEDLG
Sbjct  42    RAEKLIRELNLFPKLDVNVIDVGDSPLASSEEVPSIVERSFRFPNIVSHSDDGASVEDLG  101

Query  1523  QHAGYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADN  1347
               AGYY+LP +  ARMFYFFFESR  K D PVVIWLTGGPGCSS LA+FYENGPF I  N
Sbjct  102   HRAGYYKLPKSQGARMFYFFFESRKKKKDAPVVIWLTGGPGCSSELAMFYENGPFKIDKN  161

Query  1346  QSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPK  1167
              SL WN+YGWD+ SNL+YVDQP GTGFSY++ + D R DE GVS+DLY FLQ FF  HPK
Sbjct  162   MSLVWNEYGWDQVSNLLYVDQPVGTGFSYTTDKSDIRHDEKGVSDDLYDFLQAFFAEHPK  221

Query  1166  YAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPD  987
                ++F++TGESYAGHYIPA   R                G AIGNGLT+P +QYPAYPD
Sbjct  222   LTDNDFYITGESYAGHYIPAFAAR----------------GFAIGNGLTNPALQYPAYPD  265

Query  986   FALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLV  813
             +AL+  LI++S HD L +++P C+ +++ C ++G  +C  S LV   C  L+  ++    
Sbjct  266   YALEMGLITQSEHDRLKKIVPLCELSIKLCGTDGTVSCLASYLV---CNTLFSGVINHAG  322

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
              +NYYDIRKKC  GSLCYDFS+ E FLN +SV+ +LGVGDI++VSCST+VY+ M  D  +
Sbjct  323   GVNYYDIRKKC-EGSLCYDFSDMEKFLNLQSVRKSLGVGDIEFVSCSTSVYQAMLQDWMR  381

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP+LL+DGINLLVY GEYDLICNWLGN RWV A++W GQ+ F A   V F V GK
Sbjct  382   NLEVGIPTLLEDGINLLVYAGEYDLICNWLGNSRWVNAMEWSGQENFKATNEVPFVVDGK  441

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E G  KSYG L+FLKVHDAGH+VPMDQP+A+L+ML+RWM   L
Sbjct  442   EAGKLKSYGQLSFLKVHDAGHMVPMDQPEAALKMLKRWMENSL  484



>ref|XP_010535626.1| PREDICTED: serine carboxypeptidase-like 48 isoform X3 [Tarenaya 
hassleriana]
Length=475

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/466 (58%), Positives = 334/466 (72%), Gaps = 48/466 (10%)
 Frame = -2

Query  1700  ANS-KRRAEKMIRQLNLFPLHDLNRGSGHSPVE-ADTPRLVEKKLKL--NLLGDSGA---  1542
             ANS K  AEK+I+  NL P  D+N      P + A + RLVE+++       G+S A   
Sbjct  41    ANSPKLMAEKLIKSFNLMPERDVNI----VPEDVAQSLRLVEREIDFPATFAGESAADVP  96

Query  1541  TVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPF  1362
             TV++ G HAGYY+LP++  ARMFY FFESRSNK+DPVVIWLTGGPGCSS LALFYENGPF
Sbjct  97    TVKEYGHHAGYYKLPHSKAARMFYLFFESRSNKTDPVVIWLTGGPGCSSQLALFYENGPF  156

Query  1361  YIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFF  1182
              I+ N SL WND+GWDKASNLIYVDQP GTGFS++S + D R DEDGVSNDLY FLQ FF
Sbjct  157   NISKNLSLSWNDFGWDKASNLIYVDQPVGTGFSFTSDDSDLRHDEDGVSNDLYDFLQAFF  216

Query  1181  KAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQY  1002
             K HP++AK++F++TGESYAGHYIPAL +R++ GNK KEGIHINLKG AIGNGLT+P +QY
Sbjct  217   KEHPQFAKNDFYITGESYAGHYIPALASRVHHGNKNKEGIHINLKGFAIGNGLTNPEVQY  276

Query  1001  PAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIME  822
                                                +++GG AC++     C  ++D I+ 
Sbjct  277   -----------------------------------DTDGGDACANAY-YVCNEIFDNILG  300

Query  821   KLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSD  642
                 +NYYD+RK+C  G+LCYDFS+ ETFLN KSV+  LGVGDI++VSCS+TVY+ M +D
Sbjct  301   IAGSVNYYDVRKQC-QGNLCYDFSSMETFLNQKSVRSTLGVGDIEFVSCSSTVYDAMRND  359

Query  641   IFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSV  462
               +NL   IP LL+DGI LLVY GEYDLICNWLGN +W   ++W GQKGFG+A  + F V
Sbjct  360   WMRNLEVVIPELLEDGIELLVYAGEYDLICNWLGNSKWAHQMEWSGQKGFGSAKMIPFLV  419

Query  461   GGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              G E G+ K++GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  420   DGTEAGLMKNHGPLTFLKVHDAGHMVPMDQPKASLQMLQNWMQGKL  465



>gb|ACF85628.1| unknown [Zea mays]
Length=397

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/385 (65%), Positives = 300/385 (78%), Gaps = 2/385 (1%)
 Frame = -2

Query  1478  MFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNL  1299
             MFYFFFESR +K DPVVIWLTGGPGCSS LALFYENGPF IADN SL WND+GWDKASNL
Sbjct  1     MFYFFFESRGHKDDPVVIWLTGGPGCSSELALFYENGPFNIADNLSLVWNDFGWDKASNL  60

Query  1298  IYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGH  1119
             IYVDQPTGTGFSYSS   D R +E  +SNDLY FLQ FF  HPKYAK++FF+TGESYAGH
Sbjct  61    IYVDQPTGTGFSYSSDSRDTRHNEATISNDLYDFLQAFFAEHPKYAKNDFFITGESYAGH  120

Query  1118  YIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDEL  939
             YIPA  +R++QGNK  EGIHINLKG AIGNGLTDP IQY AYPD+ALD  LI+K+  + +
Sbjct  121   YIPAFASRVHQGNKNNEGIHINLKGFAIGNGLTDPAIQYKAYPDYALDMGLITKTQFNRI  180

Query  938   TQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCY  759
              +++P C+ AV+ C ++G  +C       C  ++  I   + + NYYDIRK C+ GSLCY
Sbjct  181   NKIVPTCEFAVKLCGTSGTVSCL-AAYFVCNTIFSAIRTIIGNKNYYDIRKPCI-GSLCY  238

Query  758   DFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLV  579
             DFSN E FLN KSV+++LGVGDI++VSCS TVYE M  D  +NL  GIP LL+  I +L+
Sbjct  239   DFSNLEKFLNLKSVRESLGVGDIEFVSCSPTVYEAMLLDWMRNLEVGIPELLESDIKVLI  298

Query  578   YVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHD  399
             Y GEYDLICNWLGN RWV +++W G++ F ++    F+V GKE G+ KS+GPL+FLKVHD
Sbjct  299   YAGEYDLICNWLGNSRWVNSMEWSGKEAFVSSSEKPFTVDGKEAGVLKSHGPLSFLKVHD  358

Query  398   AGHLVPMDQPKASLEMLRRWMHGQL  324
             AGH+VPMDQPKA+LEML+RW  G L
Sbjct  359   AGHMVPMDQPKAALEMLKRWTSGNL  383



>ref|XP_003597270.1| Serine carboxypeptidase [Medicago truncatula]
Length=509

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/458 (57%), Positives = 330/458 (72%), Gaps = 8/458 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYR  1503
             +  +IR LNLFP   +N       V      +VEKK       DSG +VE+LG HAGYY 
Sbjct  43    SSTLIRGLNLFPKSSINIPENDPHVLHG--NIVEKKFTFPGFDDSGYSVEELGHHAGYYS  100

Query  1502  LPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD--NQSLFWN  1329
             LP++  ARMFYFFFESR++K DPV+IWLTGGPGC S +ALFYENGPF  +   N SL WN
Sbjct  101   LPHSKAARMFYFFFESRNSKDDPVIIWLTGGPGCGSEIALFYENGPFQFSKDKNLSLVWN  160

Query  1328  DYGWDKASNLIYVDQPTGTGFSYSSS-EEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSE  1152
             +YGWDKASN+I+VDQP G+GFSY++   +D R DED +SNDLY FLQ FFK HP++ K++
Sbjct  161   EYGWDKASNIIFVDQPIGSGFSYTTDVSDDIRHDEDSISNDLYDFLQAFFKEHPQFTKND  220

Query  1151  FFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDN  972
             F++TGESYAGHYIPA  +R++QGNK KEGIHINLKG AIGNGLT+P IQY AY D+AL+N
Sbjct  221   FYITGESYAGHYIPAFASRVHQGNKAKEGIHINLKGFAIGNGLTNPDIQYMAYTDYALEN  280

Query  971   NLISKSFHDELTQLIPGCQEAVRQCN-SNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
              LI+K  ++ + +LIP CQ+A ++C  +  G AC   + + C  ++ +I     + NYYD
Sbjct  281   GLINKDEYERINELIPPCQKATKKCGIALSGHACGTALTT-CMKIFYQITNITGNTNYYD  339

Query  794   IRKKCVGG-SLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             IRKKC G    C DFS+ ET LN K+VK+ALGVGD+ +  CS  V+  ++ D  KNL  G
Sbjct  340   IRKKCEGAFGHCQDFSDIETLLNMKTVKEALGVGDLKFEYCSFLVHAALTEDWMKNLEVG  399

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP+LL+DGI LLVY GE DLICNWLGN RWV A++W GQ  F  +P  +F V  +E GI 
Sbjct  400   IPALLEDGIKLLVYAGEKDLICNWLGNSRWVDAMKWSGQTTFKESPTTSFLVDSEEAGIL  459

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KS+GPL FLKV +AGH+VPMDQPK +L+ML+ WM G+L
Sbjct  460   KSHGPLAFLKVKEAGHMVPMDQPKVALQMLQDWMQGKL  497



>gb|KGN64810.1| Serine carboxypeptidase [Cucumis sativus]
Length=476

 Score =   531 bits (1367),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 263/464 (57%), Positives = 327/464 (70%), Gaps = 48/464 (10%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPR-----LVEKKLKLNLL---GDSGATVED  1530
             +AEK+IR LNLFP   +N       + A+ P      +VEK  +   +      G +V+D
Sbjct  39    QAEKLIRDLNLFPKDSIN-------IAAEEPSFSSSGIVEKSFQFPFIERKKSQGPSVQD  91

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD  1350
             LG HAGYY LP+T  ARMFY FFESR++K DPVVIWLTGGPGCSS LA+FYENGPF IA+
Sbjct  92    LGHHAGYYPLPHTKSARMFYLFFESRNSKKDPVVIWLTGGPGCSSELAMFYENGPFQIAN  151

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
             N SL WN+YGWDKASNLIYVDQPTGTGFSY+S ++D R DE+GVSNDLY FLQ FF  H 
Sbjct  152   NLSLVWNEYGWDKASNLIYVDQPTGTGFSYTSDDDDIRHDEEGVSNDLYDFLQAFFTEHK  211

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
             ++A ++F++TGESY                           G AIGNGLT+P IQY AY 
Sbjct  212   EFAANDFYITGESY---------------------------GFAIGNGLTNPEIQYKAYT  244

Query  989   DFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSR--CQPLYDRIMEKL  816
             D+AL+  LI KS  D + +L+PGC++A++ C +NGGSAC   V S   C  +++RIM  +
Sbjct  245   DYALEMGLIEKSDFDSINKLVPGCEKAIKTCGANGGSAC---VTSYVICNQIFNRIMGIV  301

Query  815   VDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIF  636
              D NYYD+RK+C+ GSLCYDFSN E FLN KSV+ ALGVG++D+VSCS+ VY  M  D  
Sbjct  302   GDKNYYDVRKECI-GSLCYDFSNMEKFLNQKSVRSALGVGNMDFVSCSSKVYSAMLMDWM  360

Query  635   KNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGG  456
             +NL  GIP+L+ DGI +LVY GEYDLICNWLGN RWV  + W GQK F A+  V F V G
Sbjct  361   RNLEVGIPALIDDGIKVLVYAGEYDLICNWLGNSRWVHEMNWSGQKAFAASQIVPFLVDG  420

Query  455   KEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KE G+ K++GPL F+KVH+AGH+VPMDQPKASL+ML+ WM G+L
Sbjct  421   KEAGLLKTHGPLAFIKVHNAGHMVPMDQPKASLQMLQSWMQGKL  464



>gb|EMS57267.1| Serine carboxypeptidase-like protein [Triticum urartu]
Length=513

 Score =   531 bits (1368),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 252/423 (60%), Positives = 314/423 (74%), Gaps = 2/423 (0%)
 Frame = -2

Query  1592  RLVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTG  1413
             R V++ L+L+L G      E   +      LP+    R+FYFFFESR +K DPVVIWLTG
Sbjct  79    REVKRCLRLSLTGGPIIVAETGQKDLVAVSLPHFRQFRLFYFFFESRRHKEDPVVIWLTG  138

Query  1412  GPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRT  1233
             GPGCSS LALFYENGPF IADN SL WN++GWD+ SNLIYVDQPTGTGFSYSS   D R 
Sbjct  139   GPGCSSELALFYENGPFNIADNMSLLWNEFGWDQESNLIYVDQPTGTGFSYSSDSRDTRH  198

Query  1232  DEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHIN  1053
             +E  VSNDLY FLQ FFK HP+Y +++F++TGESYAGHYIPA  TR+ +GNK  EGIHIN
Sbjct  199   NEATVSNDLYDFLQAFFKEHPEYVENDFYITGESYAGHYIPAFATRVYKGNKNNEGIHIN  258

Query  1052  LKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC  873
             LKG AIGNGLTDP IQY AY D+ALD  LI++S   ++ +++P C+ AV+ C ++G  +C
Sbjct  259   LKGFAIGNGLTDPAIQYKAYTDYALDMGLITQSEFTKINKIVPACEFAVKLCGTSGTVSC  318

Query  872   SDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGD  693
                    C  ++  I   + + NYYD+RK CV GSLCYDFSN E FLN KSV+ +LGVGD
Sbjct  319   F-AAYFVCNTIFSSIRLIIGNKNYYDVRKPCV-GSLCYDFSNLEKFLNLKSVRQSLGVGD  376

Query  692   IDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQ  513
             I++VSCS TVY+ M  D  +NL  GIP LL++ I +L+Y GEYDLICNWLGN RWV +++
Sbjct  377   IEFVSCSPTVYQAMLLDWMRNLEVGIPELLENDIKVLIYAGEYDLICNWLGNSRWVDSME  436

Query  512   WYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMH  333
             W G+K F ++    F+V GKE G+ KS+GPL+FLKVHD+GH+VPMDQPKA+LEML+RWM 
Sbjct  437   WSGKKAFVSSAEKPFTVDGKEAGVLKSHGPLSFLKVHDSGHMVPMDQPKAALEMLKRWMS  496

Query  332   GQL  324
             G L
Sbjct  497   GNL  499



>ref|XP_010651777.1| PREDICTED: serine carboxypeptidase 3 isoform X2 [Vitis vinifera]
Length=393

 Score =   525 bits (1351),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 240/385 (62%), Positives = 297/385 (77%), Gaps = 2/385 (1%)
 Frame = -2

Query  1478  MFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNL  1299
             MFYFFFESR +K DPVVIWLTGGPGCS  LALFYENGPF+I DN +L WNDYGWD+ASN+
Sbjct  1     MFYFFFESRGSKKDPVVIWLTGGPGCSGQLALFYENGPFHITDNLTLTWNDYGWDQASNI  60

Query  1298  IYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGH  1119
             ++VDQPTGTGFSYSSSE D R  E+GVSNDLY F+Q FFK HP++ +++FF+TGESYAGH
Sbjct  61    LFVDQPTGTGFSYSSSESDIRHSEEGVSNDLYDFMQAFFKKHPEFVRNDFFITGESYAGH  120

Query  1118  YIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDEL  939
             YIPA   R+ +GNK KEG+HINLKG AIGNGLTDP IQY AY D+AL   +I KS +D +
Sbjct  121   YIPAFAARVQKGNKAKEGVHINLKGFAIGNGLTDPAIQYKAYTDYALTMKIIGKSDYDSI  180

Query  938   TQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCY  759
              +LIP C+E+ + C   GG AC D     C  ++  I+    ++NYYDIRK+C  GSLCY
Sbjct  181   NELIPDCEESAKSCGPAGGVAC-DTAYYSCNQIFQSIINVAGNINYYDIRKQCE-GSLCY  238

Query  758   DFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLV  579
             DFSN E F+  KSVK+A+GVGD+++VSCS+ VY  M  D  +++  GIP+LL+DGI +L+
Sbjct  239   DFSNLENFMGLKSVKEAIGVGDMEFVSCSSEVYNAMQRDWMRDMEVGIPALLEDGIKMLI  298

Query  578   YVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHD  399
             Y GEYDLICNWLGN  WV A++W GQK F A+P V + V GKE G  K +G L FLKVH+
Sbjct  299   YAGEYDLICNWLGNSNWVHAMKWSGQKDFEASPTVPYLVDGKEAGQLKYHGRLAFLKVHN  358

Query  398   AGHLVPMDQPKASLEMLRRWMHGQL  324
             AGH+VPMDQPKA+L+ML+ W  G+L
Sbjct  359   AGHMVPMDQPKAALQMLKTWTQGKL  383



>ref|XP_006407570.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
 gb|ESQ49023.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
Length=495

 Score =   528 bits (1360),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 257/459 (56%), Positives = 325/459 (71%), Gaps = 37/459 (8%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN--RGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQHA  1515
             RAEK+IR+LNLFP  D+N   G   +   A+ P +VE+  +  N++ D GATVEDLG HA
Sbjct  43    RAEKLIRELNLFPKLDVNVIDGGDSTLTSAEVPSIVERNFRFPNIISDGGATVEDLGHHA  102

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY+LP +  A                            S LA+FYENGPF IA N SL 
Sbjct  103   GYYKLPKSQGA----------------------------SELAMFYENGPFKIAQNMSLA  134

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN+YGWD+ASNL+YVDQP GTGFSY++ + D R DE+GVS+DLY FLQ FF  HPK A +
Sbjct  135   WNEYGWDQASNLLYVDQPVGTGFSYTTDKSDIRHDENGVSDDLYDFLQAFFAEHPKLANN  194

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPA   R+N+GNK  EG+H+NLKG AIGNGLT+P IQYPAYPD+AL+
Sbjct  195   DFYITGESYAGHYIPAFAARVNKGNKANEGVHVNLKGFAIGNGLTNPAIQYPAYPDYALE  254

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNY  801
               LI+++ HD L +++P C+ +++ C ++G  +C  S LV   C  L+  ++     +NY
Sbjct  255   MGLITQAEHDRLEKIVPLCELSIKLCGTDGTVSCLASYLV---CNTLFSGVINHAGGVNY  311

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YDIRKKC  GS+CYDFSN E FLN KSV+ +LGVGDI++VSCST+VY  M  D  +NL  
Sbjct  312   YDIRKKC-EGSMCYDFSNMEKFLNLKSVRKSLGVGDIEFVSCSTSVYTAMLQDWMRNLEV  370

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
             GIP+LL+DGINLLVY GEYDLICNWLGN RWV A++W G++ F A+  V F V GKE G+
Sbjct  371   GIPTLLEDGINLLVYAGEYDLICNWLGNSRWVNAMEWSGKESFKASKEVPFVVDGKEAGL  430

Query  440   QKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              KS G L+FLKVHDAGH+VPMDQPKA+L+ML  WM   L
Sbjct  431   LKSNGQLSFLKVHDAGHMVPMDQPKAALKMLMGWMKNSL  469



>ref|XP_006407572.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
 gb|ESQ49025.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
Length=409

 Score =   523 bits (1347),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 244/387 (63%), Positives = 301/387 (78%), Gaps = 6/387 (2%)
 Frame = -2

Query  1478  MFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNL  1299
             MFYFFFESR+ K  PVVIWLTGGPGCSS LA+FYENGPF IA N SL WN+YGWD+ASNL
Sbjct  1     MFYFFFESRNKKDAPVVIWLTGGPGCSSELAMFYENGPFKIAQNMSLAWNEYGWDQASNL  60

Query  1298  IYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGH  1119
             +YVDQP GTGFSY++ + D R DE+GVS+DLY FLQ FF  HPK A ++F++TGESYAGH
Sbjct  61    LYVDQPVGTGFSYTTDKSDIRHDENGVSDDLYDFLQAFFAEHPKLANNDFYITGESYAGH  120

Query  1118  YIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDEL  939
             YIPA   R+N+GNK  EG+H+NLKG AIGNGLT+P IQYPAYPD+AL+  LI+++ HD L
Sbjct  121   YIPAFAARVNKGNKANEGVHVNLKGFAIGNGLTNPAIQYPAYPDYALEMGLITQAEHDRL  180

Query  938   TQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSL  765
              +++P C+ +++ C ++G  +C  S LV   C  L+  ++     +NYYDIRKKC  GS+
Sbjct  181   EKIVPLCELSIKLCGTDGTVSCLASYLV---CNTLFSGVINHAGGVNYYDIRKKC-EGSM  236

Query  764   CYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINL  585
             CYDFSN E FLN KSV+ +LGVGDI++VSCST+VY  M  D  +NL  GIP+LL+DGINL
Sbjct  237   CYDFSNMEKFLNLKSVRKSLGVGDIEFVSCSTSVYTAMLQDWMRNLEVGIPTLLEDGINL  296

Query  584   LVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKV  405
             LVY GEYDLICNWLGN RWV A++W G++ F A+  V F V GKE G+ KS G L+FLKV
Sbjct  297   LVYAGEYDLICNWLGNSRWVNAMEWSGKESFKASKEVPFVVDGKEAGLLKSNGQLSFLKV  356

Query  404   HDAGHLVPMDQPKASLEMLRRWMHGQL  324
             HDAGH+VPMDQPKA+L+ML  WM   L
Sbjct  357   HDAGHMVPMDQPKAALKMLMGWMKNSL  383



>gb|EMT11612.1| Serine carboxypeptidase-like protein [Aegilops tauschii]
Length=520

 Score =   520 bits (1340),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/391 (62%), Positives = 299/391 (76%), Gaps = 3/391 (1%)
 Frame = -2

Query  1493  TVDARMFYFFFESRSNK-SDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGW  1317
              ++ R+FYFFFESR +K  DPVVIWLTGGPGCSS LALFYENGPF+IADN SL WND+GW
Sbjct  119   ALECRLFYFFFESRRHKKEDPVVIWLTGGPGCSSELALFYENGPFHIADNMSLLWNDFGW  178

Query  1316  DKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTG  1137
             D+ SNLIYVDQPTGTGFSYSS   D R +E  VSNDLY FLQ FFK HP+Y +++F++TG
Sbjct  179   DQESNLIYVDQPTGTGFSYSSDSRDTRHNEASVSNDLYDFLQAFFKEHPEYVENDFYITG  238

Query  1136  ESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISK  957
             ESYAGHYIPA  TR+ +GNK  EGIHINLKG AIGNGLTDP IQY AY D+ALD  LI++
Sbjct  239   ESYAGHYIPAFATRVYKGNKNNEGIHINLKGFAIGNGLTDPAIQYKAYTDYALDMGLITQ  298

Query  956   SFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCV  777
             S   ++ +++P C+ AV+ C ++G  +C       C  ++  I   +   NYYDIRK CV
Sbjct  299   SEFSKINKIVPACEFAVKLCGTSGTVSCL-AAYFVCNTIFSSIRLIIGSKNYYDIRKPCV  357

Query  776   GGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQD  597
              GSLCYDFSN E FLN KSV+ +LGVGDI++VSCS TVY+ M  D  +NL  GIP LL++
Sbjct  358   -GSLCYDFSNLEKFLNLKSVRQSLGVGDIEFVSCSPTVYQAMLLDWMRNLEVGIPELLEN  416

Query  596   GINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLT  417
              I +L+Y GEYDLICNWLGN RWV +++W G+K F ++    F V GKE G+ KS+GPL+
Sbjct  417   DIKVLIYAGEYDLICNWLGNSRWVDSMEWSGKKAFVSSTEKPFMVDGKEAGVLKSHGPLS  476

Query  416   FLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             FLKVHD+GH+VPMDQPKA+LEML+RW  G L
Sbjct  477   FLKVHDSGHMVPMDQPKAALEMLKRWTSGNL  507



>ref|XP_001772397.1| predicted protein [Physcomitrella patens]
 gb|EDQ62868.1| predicted protein [Physcomitrella patens]
Length=516

 Score =   520 bits (1338),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 252/461 (55%), Positives = 327/461 (71%), Gaps = 6/461 (1%)
 Frame = -2

Query  1709  NSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVED  1530
              S  + + +A+++I+ LNLFP  D+   S    V  D  +L E++L L++ GD+G + E+
Sbjct  34    TSSVDPQGQAQRLIKALNLFP--DVLSVSDGEEV-FDGAKLQERRLNLDVGGDAGVSTEE  90

Query  1529  LGQHAGYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIA  1353
             LGQ+AGY++L  T  A+MFYFFFESR NK+D PVV+W+TGGPGC+S LALFYENGPF I 
Sbjct  91    LGQYAGYFKLARTHAAKMFYFFFESRGNKTDDPVVLWMTGGPGCASELALFYENGPFKIT  150

Query  1352  DNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAH  1173
             DN  L WND+GWDK S++I+VDQP GTGFSYS+   D R DE+GVS D+Y F Q F++AH
Sbjct  151   DNLILVWNDFGWDKVSSIIFVDQPVGTGFSYSTDIRDIRHDEEGVSEDMYDFFQAFYEAH  210

Query  1172  PKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAY  993
             P++ K++ FVTGESYAGHY+PA+  R+++  K KEG+ I+LKG AIGNGLT P IQY AY
Sbjct  211   PEFVKNKLFVTGESYAGHYVPAVAGRLHRALKHKEGVPIDLKGFAIGNGLTQPDIQYEAY  270

Query  992   PDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLV  813
              D+AL+ NLI++  H +L +L   C  A++ C   G   C    +  CQ ++  I+    
Sbjct  271   GDYALEMNLITEEEHQKLGKLYLACAAALKFCGPKGTIGCV-AASFVCQSIFTSILGIAG  329

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
             ++NYYD+RK+C   SLCYDFSN + FLN  + K+ALGVG+  +V+CS  VY  M  D+ K
Sbjct  330   NINYYDVRKEC-QSSLCYDFSNLDKFLNNATTKEALGVGNRKFVACSPLVYFAMIVDVMK  388

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP LL+DGI LLVY GEYDLICNWLGN RWV A+ W GQ  +  A   +F V G+
Sbjct  389   NLEKGIPGLLEDGIELLVYAGEYDLICNWLGNSRWVTAMDWSGQVEYAKAGWKSFEVDGE  448

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHG  330
             E G+   YGPL FLKVH+AGH+VPMDQPK SLEML RW  G
Sbjct  449   EAGLTTGYGPLQFLKVHNAGHMVPMDQPKNSLEMLYRWTRG  489



>ref|XP_006588979.1| PREDICTED: serine carboxypeptidase-like 49-like isoform X2 [Glycine 
max]
Length=458

 Score =   514 bits (1323),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 266/478 (56%), Positives = 324/478 (68%), Gaps = 57/478 (12%)
 Frame = -2

Query  1739  SPAGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADT---PRLVEKKLK  1569
             SP+ +A+ +D ++      A+K+IR LNLFP  D+N      PV   T    R+VEK+L+
Sbjct  18    SPSIRASDDDVAL-----HAKKLIRDLNLFPDADVNI----VPVANCTLQPRRIVEKRLR  68

Query  1568  LN--LLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSS  1395
                 L  DS  +VEDLG HAGYY + ++  ARMFYFFFESR+ K DPVVIWLTGGPGCSS
Sbjct  69    FPKLLASDSEPSVEDLGHHAGYYPIQHSHAARMFYFFFESRNRKEDPVVIWLTGGPGCSS  128

Query  1394  SLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVS  1215
              LALFYENGPF IADN SL WN+YGWDKA                               
Sbjct  129   ELALFYENGPFKIADNLSLVWNEYGWDKA-------------------------------  157

Query  1214  NDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAI  1035
                      FF  HP+YAK++FF+TGESYAGHYIPA  TRI++GNK KEGIHINLKGLAI
Sbjct  158   ---------FFVEHPQYAKNDFFITGESYAGHYIPAFATRIHRGNKAKEGIHINLKGLAI  208

Query  1034  GNGLTDPGIQYPAYPDFALDNNLISKSFHDELT-QLIPGCQEAVRQCNSNGGSACSDLVN  858
             GNGLT+P IQY AYPD+AL+  +I K+  + L   L+P C+ A++ C +NG ++C     
Sbjct  209   GNGLTNPAIQYKAYPDYALEMGIIKKATRNLLNLVLVPACESAIKLCGTNGKTSCM-AAY  267

Query  857   SRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVS  678
               C  ++  IM    D NYYDIRKKC  GSLCYDFSN + FLN +SV+D+LGVG I +VS
Sbjct  268   VVCNVIFSDIMLHAGDTNYYDIRKKC-EGSLCYDFSNMDKFLNQQSVRDSLGVGKIHFVS  326

Query  677   CSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQK  498
             CST VY  M  D  +NL  GIP LL+DGINLLVY GEYDLICNWLGN RWV A++W GQK
Sbjct  327   CSTEVYAAMLVDWMRNLEVGIPDLLEDGINLLVYAGEYDLICNWLGNSRWVHAMEWSGQK  386

Query  497   GFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              F  +  V F V G E G+ KSYGPL+FLKVH+AGH+VPMDQPKA+LEML++W++G L
Sbjct  387   EFATSLEVPFVVDGSEAGLLKSYGPLSFLKVHNAGHMVPMDQPKAALEMLKKWINGTL  444



>emb|CDX71025.1| BnaC03g11090D [Brassica napus]
Length=439

 Score =   509 bits (1312),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/413 (60%), Positives = 306/413 (74%), Gaps = 8/413 (2%)
 Frame = -2

Query  1553  DSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYE  1374
             +S  +V++L +HAGYY L ++  ARMFYFFFES++N +DPVV+WLTGGPGCS S+ALF E
Sbjct  25    NSDPSVDELARHAGYYTLEHSKPARMFYFFFESKNNVTDPVVLWLTGGPGCSGSVALFTE  84

Query  1373  NGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFL  1194
             NGPF I++N SL WN Y WDK SN+IYVDQP GTGFS  S     R DE GVSNDLY FL
Sbjct  85    NGPFAISENLSLSWNPYSWDKVSNIIYVDQPVGTGFSNISDTSLLRHDETGVSNDLYDFL  144

Query  1193  QEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDP  1014
             Q FFK HP+  K++F++TGESYAGHY+PAL +RI  GNK  EGI INLKG+AIGNGLT+P
Sbjct  145   QAFFKDHPQLQKNDFYITGESYAGHYVPALASRIRSGNKNDEGIPINLKGVAIGNGLTNP  204

Query  1013  GIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSR---CQP  843
              IQY AY D+AL+  LIS+S H+ L Q    CQ ++R CN +GG AC    NS    C  
Sbjct  205   EIQYGAYADYALEMKLISQSVHESLKQDYVDCQSSIRICNRDGGLAC----NSSYYICNQ  260

Query  842   LYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTV  663
             + ++I+ +   +NYYD+RK CV G +CYD  N +TFLN ++V+ ALGVGD  +  CS  V
Sbjct  261   IPEQILSENEGINYYDLRKICV-GEMCYDIWNVQTFLNQENVRKALGVGDNKFELCSGNV  319

Query  662   YEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAA  483
              + M  D   N+   IP+L++DGINLLVY GEYDL+CNWLGN RWV+ + W GQK FG+A
Sbjct  320   NDAMVVDWMINIEVKIPALVEDGINLLVYAGEYDLVCNWLGNSRWVEQMNWSGQKEFGSA  379

Query  482   PNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
               V F V GKE G+ K++GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  380   KTVAFLVDGKEAGLMKNHGPLTFLKVHDAGHMVPMDQPKASLQMLQTWMQGRL  432



>emb|CDX88772.1| BnaA03g08770D [Brassica napus]
Length=500

 Score =   509 bits (1311),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 246/413 (60%), Positives = 306/413 (74%), Gaps = 8/413 (2%)
 Frame = -2

Query  1553  DSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYE  1374
             +S  +V++L +HAGYY L ++  ARMFYFFFES++N +DPVV+WLTGGPGCS S+ALF E
Sbjct  86    NSDPSVDELARHAGYYTLEHSKPARMFYFFFESKNNVTDPVVLWLTGGPGCSGSVALFTE  145

Query  1373  NGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFL  1194
             NGPF I++N SL WN Y WDK SN+IYVDQP GTGFS  S     R DE GVSNDLY FL
Sbjct  146   NGPFAISENLSLSWNPYSWDKVSNIIYVDQPVGTGFSNISDTSLLRHDETGVSNDLYDFL  205

Query  1193  QEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDP  1014
             Q FFK HP+  K++F++TGESYAGHY+PAL +RI  GNK  EGI INLKG+AIGNGLT+P
Sbjct  206   QAFFKDHPQLQKNDFYITGESYAGHYVPALASRIRSGNKNDEGIPINLKGVAIGNGLTNP  265

Query  1013  GIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSR---CQP  843
              IQY AY D+AL+  LIS+S H+ L Q    CQ ++R CN +GG AC    NS    C  
Sbjct  266   EIQYGAYADYALEMKLISQSVHESLKQDYVDCQSSIRICNRDGGLAC----NSSYYICNQ  321

Query  842   LYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTV  663
             + ++I+ +   +NYYD+RK CV G +CYD  N +TFLN ++V+ ALGVGD  +  CS  V
Sbjct  322   IPEQILSENEGINYYDLRKICV-GEMCYDIWNVQTFLNQENVRKALGVGDNKFELCSGNV  380

Query  662   YEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAA  483
              + M  D   N+   IP+L++DGINLLVY GEYDL+CNWLGN RWV+ + W GQK FG+A
Sbjct  381   NDAMVVDWMINIEVKIPALVEDGINLLVYAGEYDLVCNWLGNSRWVEQMNWSGQKEFGSA  440

Query  482   PNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
               V F V GKE G+ K++GPLTFLKVHDAGH+VPMDQPKASL+ML+ WM G+L
Sbjct  441   KTVAFLVDGKEAGLMKNHGPLTFLKVHDAGHMVPMDQPKASLQMLQTWMQGRL  493



>gb|ABR16556.1| unknown [Picea sitchensis]
Length=405

 Score =   502 bits (1293),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 237/388 (61%), Positives = 295/388 (76%), Gaps = 7/388 (2%)
 Frame = -2

Query  1478  MFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASN  1302
             MFYFFFESR +K+D PVV+W+TGGPGCSS LA+FYENGPF I DN +L WN+YGWDKASN
Sbjct  1     MFYFFFESRGSKADDPVVLWMTGGPGCSSELAVFYENGPFKITDNLTLAWNEYGWDKASN  60

Query  1301  LIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAG  1122
             LI+VDQPTGTGFSYS+   D R DE GVSND+Y FLQ FFK HP+YAK++FF+TGESYAG
Sbjct  61    LIFVDQPTGTGFSYSTDVRDLRHDEKGVSNDMYDFLQAFFKEHPEYAKNDFFITGESYAG  120

Query  1121  HYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDE  942
             HYIPA+ +R++QGNK  EG+ INLKG AIGNGLTDP IQY AY D+AL+  LI +  ++ 
Sbjct  121   HYIPAVTSRVHQGNKDSEGLPINLKGFAIGNGLTDPAIQYKAYTDYALEMGLIGEDDYNR  180

Query  941   LTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGS  768
             + ++ P C+ +++ C + G  +C  S LV   C  +++ IM    ++NYYD+RK+C GG 
Sbjct  181   INKIYPACELSIKLCGTKGTVSCFASYLV---CNSIFNSIMALAGNINYYDVRKECNGG-  236

Query  767   LCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGIN  588
             LCYDFSN E +LN  SV+DALGVG   +VSCS  VYE M +D  +N+  GIP+LL DG+ 
Sbjct  237   LCYDFSNMENYLNQGSVRDALGVGSRKFVSCSPLVYEFMLTDWMRNMEVGIPTLLDDGVK  296

Query  587   LLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLK  408
             LLVY GEYDLICNWLGN RWV ++ W G + F  A   +F V  KE G+  SYG L+FLK
Sbjct  297   LLVYAGEYDLICNWLGNSRWVNSMDWSGSENFKQASTKSFLVDDKEAGLITSYGSLSFLK  356

Query  407   VHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             VHDAGH+VPMDQPKA+LEML+RW  G +
Sbjct  357   VHDAGHMVPMDQPKAALEMLKRWTQGSI  384



>ref|XP_003597268.1| Serine carboxypeptidase [Medicago truncatula]
Length=531

 Score =   507 bits (1305),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 261/502 (52%), Positives = 330/502 (66%), Gaps = 53/502 (11%)
 Frame = -2

Query  1697  NSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQH  1518
             N    +  +IR LNLFP   +N       V      +VEKK       D G +VE+LG H
Sbjct  38    NDILLSSTLIRGLNLFPKSSINIPENDPLVLYR--NIVEKKFTFPGFDDPGYSVEELGHH  95

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD--NQ  1344
             AGYY L   + + MFYFFFESR++K DPVVIWLTGGPGC S +ALFYENGPF  +   N 
Sbjct  96    AGYYSL---LRSWMFYFFFESRNSKDDPVVIWLTGGPGCGSEIALFYENGPFQFSKDKNL  152

Query  1343  SLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKY  1164
             SL WN+YGWDKASN+I+VDQP G+GFSY++ + D+R DEDGVSNDLY FL  FFK HP++
Sbjct  153   SLVWNEYGWDKASNIIFVDQPIGSGFSYTTDDSDYRHDEDGVSNDLY-FLT-FFKEHPQF  210

Query  1163  AKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDF  984
             A+++F++TGESYAGHY+PA  +R++QGNK KEGIHINLKG AIGNGLT+P IQY +Y D+
Sbjct  211   AENDFYITGESYAGHYVPAFASRVHQGNKAKEGIHINLKGFAIGNGLTNPEIQYMSYTDY  270

Query  983   ALDNNLISKSFHDELTQLIPGCQEAVRQC-------------------------------  897
             ALDN LI+K  ++ + +LIP CQEA   C                               
Sbjct  271   ALDNGLINKDEYERINKLIPPCQEATETCGRTLISLPFLGQNSLSTKREFYQLIVQVACY  330

Query  896   -----------NSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFS  750
                         + GG AC   + S C  ++ +I+    ++N YDIRKKC G   C+ FS
Sbjct  331   FFSSTLLIYLSGTEGGDACVTSL-SICMNIFIQIINNTDNVNCYDIRKKCEGDH-CFYFS  388

Query  749   NAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVG  570
               ETFLN K VK+ALGVGD+++VSCS+TVY  M  D  KNL  GIP+LL+DGI LLVY G
Sbjct  389   GIETFLNMKIVKEALGVGDLEFVSCSSTVYNTMLQDWMKNLEVGIPALLEDGIKLLVYAG  448

Query  569   EYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGH  390
             E DLICNWLGN RW+ A++W GQ  +  +P   F V  +E GI KS+GPL F K+ +AGH
Sbjct  449   EKDLICNWLGNSRWIDAMKWSGQTAYKESPTTPFLVDSEEAGILKSHGPLAFRKLKEAGH  508

Query  389   LVPMDQPKASLEMLRRWMHGQL  324
             +VPMDQPK +L+ML+ WM G+L
Sbjct  509   MVPMDQPKVALQMLQEWMQGKL  530



>ref|XP_002521640.1| Serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40747.1| Serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score =   499 bits (1286),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 259/463 (56%), Positives = 314/463 (68%), Gaps = 56/463 (12%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTP----RLVEKKLK-LNLLGDSGA-TVEDLG  1524
             +AEK+IR+LNL P  D+N       V  D+     R+VEK++K LN+ GD GA +VEDLG
Sbjct  31    QAEKLIRELNLLPEKDVNVIDRRDDVVYDSVDGGGRIVEKRIKFLNVEGDYGAVSVEDLG  90

Query  1523  QHAGYYRLPNTVDARMFYFFFESRSNK-SDPVVIWLTGGPGCSSSLALFYENGPFYIADN  1347
              HAGYY++ N+  ARMFY FFESR+ K  DP+VIWLTGGPG SS LA+FYENG F IADN
Sbjct  91    HHAGYYKIANSHFARMFYLFFESRNKKKEDPMVIWLTGGPGNSSELAMFYENGLFAIADN  150

Query  1346  QSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPK  1167
              SL WN YGWDKASNL+Y                                   FF  HP+
Sbjct  151   MSLVWNPYGWDKASNLLYA----------------------------------FFLEHPE  176

Query  1166  YAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPD  987
               K++F++TGESYAGHYIPA   R++ GNK KEGIHINLKG AIGNGLTDP IQY AY D
Sbjct  177   LVKNDFYITGESYAGHYIPAFAARVHSGNKAKEGIHINLKGFAIGNGLTDPAIQYKAYTD  236

Query  986   FALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLV  813
             +ALD  LI+K+ +  + ++IP C+ A++ C ++G  +C  S  V   C  ++  IM    
Sbjct  237   YALDMGLITKTDYARIGKVIPVCEMAIKLCGTDGTLSCMASYFV---CNTIFSSIMASAG  293

Query  812   DLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFK  633
             D+N+YDIRKKC  GSLCYDFSN E FLN KSV+DALGVGDID VSCS TVY+ M  D  +
Sbjct  294   DINHYDIRKKC-KGSLCYDFSNMEKFLNQKSVRDALGVGDIDSVSCSPTVYQAMLMDWMR  352

Query  632   NLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGK  453
             NL  GIP+LL+DGI LLVY GEYDLICNWLGN RW         K FGA+P V F++   
Sbjct  353   NLEAGIPALLEDGIQLLVYAGEYDLICNWLGNSRW---------KAFGASPEVPFTIDNS  403

Query  452   EKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             E  + +SYGPL FLKVHDAGH+VPMDQPKA+LEML+RW  G+L
Sbjct  404   EARVLRSYGPLAFLKVHDAGHMVPMDQPKAALEMLKRWTQGKL  446



>gb|EPS70311.1| hypothetical protein M569_04452, partial [Genlisea aurea]
Length=454

 Score =   497 bits (1279),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 247/456 (54%), Positives = 317/456 (70%), Gaps = 10/456 (2%)
 Frame = -2

Query  1682  AEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYR  1503
             A K+I +LNLFP  D N      P   D     E  +   L+  + + V DL  HAGY+ 
Sbjct  2     ALKLINELNLFPKQDANVVIDLIPDHNDAKSFSEP-ISEKLISLADSPVGDLAHHAGYFT  60

Query  1502  LPNTVDARMFYFFFESRS-NKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             LPNT  ARMFY+FFESRS N+S+PVV WLTGGPGCS SLALFYENGPF I  N SL WN+
Sbjct  61    LPNTTGARMFYYFFESRSGNRSEPVVAWLTGGPGCSGSLALFYENGPFQITSNLSLVWNE  120

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWD+ SNLIYVDQP GTGFSY+SS +D R+     + D Y FL+ FF+ HP+Y+K+EF+
Sbjct  121   FGWDQVSNLIYVDQPIGTGFSYTSSSDDIRSTSSEAAVDFYNFLEAFFEKHPEYSKNEFY  180

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             + GESYAGHY+PA  + IN  N + +GI+INLKG+ IGNGLT+ GIQY A PD+AL+  L
Sbjct  181   LIGESYAGHYVPAFASYINGRNNRSDGIYINLKGIGIGNGLTNSGIQYKADPDYALNMKL  240

Query  965   ISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLV--DLNYYDI  792
             I    +D +      C+     C +   ++CSD   + C  ++  I+   V  ++NYYD+
Sbjct  241   IDHETYDSIEPTASECERQAEACGNGTETSCSDAFRT-CNTVFSDIVNSAVNGNINYYDV  299

Query  791   RKKCVGGSLCYDFSNAETFLNTKSVKDALGVG-DIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             RK+C  GSLCYDFSN + FLN KSVK+ALGVG DID+VSCST VY+ M++D  KN    I
Sbjct  300   RKQC-EGSLCYDFSNLDKFLNLKSVKEALGVGQDIDFVSCSTAVYDEMANDFMKNYEDAI  358

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
             P LL++GI  L+Y GEYDLICNWLGN RWV+ + W GQ  F  +    F+V G+E G+++
Sbjct  359   PQLLRNGIRTLIYAGEYDLICNWLGNERWVEEMVWEGQAEFRRSTAEGFTVDGREMGLKR  418

Query  434   S---YGPLTFLKVHDAGHLVPMDQPKASLEMLRRWM  336
             +   +G LTFLKV++AGHLVPMDQPKASLEMLRR++
Sbjct  419   TTSIHGELTFLKVYNAGHLVPMDQPKASLEMLRRFI  454



>gb|AFK43520.1| unknown [Medicago truncatula]
Length=443

 Score =   487 bits (1253),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 244/416 (59%), Positives = 303/416 (73%), Gaps = 9/416 (2%)
 Frame = -2

Query  1799  FLSSQQRIMWPFllvlvlVSSPAGQANGE---DNSMANSKRRAEKMIRQLNLFPLHDLNR  1629
             FL      M  FL +    SSPA   N +    ++ +  K +AE +IR LNLFP   +N 
Sbjct  7     FLKMCLSFMMFFLFISHSYSSPAYPTNNDILLSSTASYPKLQAENLIRGLNLFPKDSIN-  65

Query  1628  GSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRS  1449
              +  +        ++EKK       DSGA+VE+LG HAGYYRLP++  ARMFYFFFESR+
Sbjct  66    -TPENDPHFLHGNIMEKKFTFPGFVDSGASVEELGHHAGYYRLPHSKAARMFYFFFESRN  124

Query  1448  NKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD--NQSLFWNDYGWDKASNLIYVDQPTG  1275
              K DPVVIWLTGGPGCSS +A+FYENGPF  +   N SL WN+YGWD ASN+I+VDQPTG
Sbjct  125   TKDDPVVIWLTGGPGCSSEIAMFYENGPFKFSKDKNLSLVWNEYGWDMASNIIFVDQPTG  184

Query  1274  TGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTR  1095
             TGFSY++ + D R DEDGVSNDLY FLQ FFK HP++ K++F++TGESYAGHYIPA  +R
Sbjct  185   TGFSYTTDDSDVRHDEDGVSNDLYDFLQAFFKEHPQFTKNDFYITGESYAGHYIPAFASR  244

Query  1094  INQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQ  915
             ++QGNK KEGIHINLKG AIGNGLT+P IQY AYPDFALDN LI+K+ H  + +L P CQ
Sbjct  245   VHQGNKAKEGIHINLKGFAIGNGLTNPEIQYKAYPDFALDNGLINKNEHANINKLFPRCQ  304

Query  914   EAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETF  735
             +A+  C + GG AC     S C  ++D+IM+   ++NYYDIRK+C  GSLCYDFSNAETF
Sbjct  305   KAIESCGTKGGDACM-TSRSICSEIFDQIMDIAGNINYYDIRKQC-EGSLCYDFSNAETF  362

Query  734   LNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGE  567
             LN KSV++ALGVGD+++VSCS+TVY  M  D  KNL  GIP+LL+DGI +LVY GE
Sbjct  363   LNMKSVREALGVGDLEFVSCSSTVYSAMLQDWMKNLEVGIPALLEDGIKVLVYAGE  418



>gb|KEH29964.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   485 bits (1248),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 246/478 (51%), Positives = 313/478 (65%), Gaps = 16/478 (3%)
 Frame = -2

Query  1733  AGQANGEDNSMANSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLG  1554
             A      +N         EK++R  NL P   +N   G+   +    ++VEKK   + L 
Sbjct  22    ATSRTTHNNQQIQKTSAFEKLVRSFNLSPKDPVNLIHGNQSFDYFPGKIVEKKF--SFLS  79

Query  1553  DSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSN-KSDPVVIWLTGGPGCSSSLALFY  1377
             ++  T E+L  H GYY +P  + ARMFYFFFESR   K DPVVIWLTGGPGC S LALFY
Sbjct  80    NTNET-ENLNHHFGYYSIPRALGARMFYFFFESRDTPKDDPVVIWLTGGPGCGSELALFY  138

Query  1376  ENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAF  1197
             ENGPF+IAD+ SL WN YGWDKASN+++VDQP GTGFS  +   D   +E  VS+DLY F
Sbjct  139   ENGPFHIADDLSLVWNQYGWDKASNILFVDQPIGTGFSVVNDVNDIPHNETVVSDDLYVF  198

Query  1196  LQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTD  1017
             LQ FF+ HP++ K++F++TGESYAGHYIPAL +RI+Q NK    IHINLKG+AIGNG+T+
Sbjct  199   LQSFFEEHPEFVKNDFYITGESYAGHYIPALASRIHQENKGNPKIHINLKGIAIGNGITN  258

Query  1016  PGIQYPAYPDFALDNNLIS----KSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRC  849
             P IQY  Y  FA DN+LI+    K   DEL +   GC EA   C++ GG     L   +C
Sbjct  259   PRIQYLFYTQFAEDNHLITPGERKDIDDELYE---GCTEATYNCDTQGGDQNCLLARDKC  315

Query  848   QPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCST  669
             + + ++IM    D+N YDIRKKC+ G +CYDFS  E FLN   V+  +GV + ++VSCS 
Sbjct  316   EAIVNKIMSIAGDINVYDIRKKCI-GEMCYDFSKLEKFLNNHEVRGIIGVAN-EFVSCSR  373

Query  668   TVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFG  489
              VY+ M +D+ K+   GIP LL+DGI +L+Y GE+D ICNWLGN  WV  LQW GQK F 
Sbjct  374   VVYDAMRADLMKSFHLGIPELLEDGIKVLIYAGEFDFICNWLGNYNWVSFLQWSGQKQFK  433

Query  488   AAPNVTFSVGG---KEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
                 V F V G    E G+  ++GPL FLKV+ AGH+VPMDQP  +L+ML  WM GQL
Sbjct  434   EFKGVPFLVDGTDISEGGMLYTFGPLYFLKVYGAGHMVPMDQPDVALQMLTAWMKGQL  491



>gb|KCW50687.1| hypothetical protein EUGRSUZ_J00372 [Eucalyptus grandis]
Length=428

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 245/457 (54%), Positives = 300/457 (66%), Gaps = 81/457 (18%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLN---RGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             +AE +I+ LNL P   +N   R      + +D  ++VE++ +L +LGDS ++V+DLGQ+A
Sbjct  39    QAEILIKGLNLHPKEAVNIRIRDKDSFSLASDG-KIVERRFELPVLGDSRSSVQDLGQNA  97

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLF  1335
             GYY LP++  A MFYFFFESRS+ +DPVVIWLTGGPGCSSSLALF+ENGPF+IA+N SL 
Sbjct  98    GYYPLPHSHAATMFYFFFESRSSANDPVVIWLTGGPGCSSSLALFHENGPFHIANNLSLV  157

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WNDYGWDKASNLIYVDQPTGTGFSYS+ E D R DE GVSNDLY FLQ FF AHP+  K+
Sbjct  158   WNDYGWDKASNLIYVDQPTGTGFSYSTDERDTRHDEQGVSNDLYDFLQAFFAAHPQLVKN  217

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
             +F++TGESYAGHYIPAL  R+ QGNK KEG+HINLKG AIGNGLT+P IQY AY D+AL+
Sbjct  218   DFYITGESYAGHYIPALAARVQQGNKAKEGMHINLKGFAIGNGLTNPEIQYEAYTDYALN  277

Query  974   NNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYD  795
               LI++S HD +  ++P       + N    S                         YYD
Sbjct  278   MRLITQSDHDSINTMLP-------EYNGRRNSV------------------------YYD  306

Query  794   IRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGI  615
             IRK+C  G LCYD SN ET LN K                                    
Sbjct  307   IRKRC-EGPLCYDLSNVETLLNQKK-----------------------------------  330

Query  614   PSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQK  435
                       L+Y GEYDLICNWLGN RWV A++W GQK FG +P V F V G E G+ K
Sbjct  331   ----------LIYAGEYDLICNWLGNSRWVNAMRWSGQKQFGTSPTVPFVVAGAEAGLMK  380

Query  434   SYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             S+GPLTFLK+H+AGH+VPMDQPKA+L+ML+ WM G++
Sbjct  381   SHGPLTFLKLHNAGHMVPMDQPKAALQMLKSWMAGKV  417



>gb|AES67519.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=483

 Score =   476 bits (1225),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 242/460 (53%), Positives = 309/460 (67%), Gaps = 17/460 (4%)
 Frame = -2

Query  1697  NSKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQH  1518
             N    +  +IR LNLFP   +N       V      +VEKK       D G +VE+LG H
Sbjct  38    NDILLSSTLIRGLNLFPKSSINIPENDPLVLYR--NIVEKKFTFPGFDDPGYSVEELGHH  95

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIAD--NQ  1344
             AGYY L   + + MFYFFFESR++K DPVVIWLTGGPGC S +ALFYENGPF  +   N 
Sbjct  96    AGYYSL---LRSWMFYFFFESRNSKDDPVVIWLTGGPGCGSEIALFYENGPFQFSKDKNL  152

Query  1343  SLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKY  1164
             SL WN+YGWDK + L   DQ +       + +         V   +Y FLQ FFK HP++
Sbjct  153   SLVWNEYGWDKTNPL---DQVSAIPLMIVTIDM-----MKTVLAMIYIFLQTFFKEHPQF  204

Query  1163  AKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDF  984
             A+++F++TGESYAGHY+PA  +R++QGNK KEGIHINLKG AIGNGLT+P IQY +Y D+
Sbjct  205   AENDFYITGESYAGHYVPAFASRVHQGNKAKEGIHINLKGFAIGNGLTNPEIQYMSYTDY  264

Query  983   ALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLN  804
             ALDN LI+K  ++ + +LIP CQEA   C + GG AC   + S C  ++ +I+    ++N
Sbjct  265   ALDNGLINKDEYERINKLIPPCQEATETCGTEGGDACVTSL-SICMNIFIQIINNTDNVN  323

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
              YDIRKKC G   C+ FS  ETFLN K VK+ALGVGD+++VSCS+TVY  M  D  KNL 
Sbjct  324   CYDIRKKCEGDH-CFYFSGIETFLNMKIVKEALGVGDLEFVSCSSTVYNTMLQDWMKNLE  382

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKG  444
              GIP+LL+DGI LLVY GE DLICNWLGN RW+ A++W GQ  +  +P   F V  +E G
Sbjct  383   VGIPALLEDGIKLLVYAGEKDLICNWLGNSRWIDAMKWSGQTAYKESPTTPFLVDSEEAG  442

Query  443   IQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             I KS+GPL F K+ +AGH+VPMDQPK +L+ML+ WM G+L
Sbjct  443   ILKSHGPLAFRKLKEAGHMVPMDQPKVALQMLQEWMQGKL  482



>ref|XP_004506097.1| PREDICTED: serine carboxypeptidase-like 48-like [Cicer arietinum]
Length=486

 Score =   471 bits (1212),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 226/425 (53%), Positives = 296/425 (70%), Gaps = 5/425 (1%)
 Frame = -2

Query  1592  RLVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSN-KSDPVVIWLT  1416
             ++VEK     L G    ++E+LG HAGYY LP++  ARMFYFFFES++N + DPVVIWLT
Sbjct  60    KMVEKNFSF-LGGSDKPSIENLGHHAGYYSLPSSNSARMFYFFFESQNNTRDDPVVIWLT  118

Query  1415  GGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFR  1236
             GGPGCS  +ALFYENGPF+I+D   L  N+Y W+KASN+I+VDQP GTGFSY+  + D+ 
Sbjct  119   GGPGCSGEIALFYENGPFHISDKSQLVPNNYSWNKASNIIFVDQPIGTGFSYTLDDNDYS  178

Query  1235  TDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHI  1056
              D   +SN LY FLQEFFK HP + K++F++TGESYAG YIPAL +R+ QGNK  EGIHI
Sbjct  179   RDVTSISNYLYDFLQEFFKQHPDFVKNDFYITGESYAGQYIPALASRVRQGNKDSEGIHI  238

Query  1055  NLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSA  876
             NLKG+AIGNG+T+P IQYP+ P +A+D  LI+K   D++ +LIP C++A++ C S GG +
Sbjct  239   NLKGIAIGNGMTNPLIQYPSLPQYAVDMKLITKEDQDQINKLIPPCEDAIKSCESEGGDS  298

Query  875   CSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGV-  699
             C   + ++C  +   I+     +NYYDIR +   G LCYDF+  ETFLN  SVK ALGV 
Sbjct  299   CFTAL-TQCNDIMKNILSIAGGINYYDIRTQ-RDGELCYDFTPVETFLNDDSVKKALGVL  356

Query  698   GDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQA  519
              D+ +++C       +      N    IP+LL+DGI +L+Y GEYDLICNWLG  +WV A
Sbjct  357   EDLYFLACGRLANNKLIRARMNNFEDDIPALLEDGIKVLIYAGEYDLICNWLGISKWVHA  416

Query  518   LQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRW  339
             ++W GQK F  +  V F V G + G   SYG L+FLKV  AGH+VPMDQPKA+ +M   W
Sbjct  417   MEWSGQKQFADSKTVPFLVDGAQAGSLNSYGLLSFLKVKGAGHMVPMDQPKAAFQMFVNW  476

Query  338   MHGQL  324
             + G L
Sbjct  477   LDGTL  481



>emb|CDY26973.1| BnaC09g36100D [Brassica napus]
Length=431

 Score =   462 bits (1190),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 289/405 (71%), Gaps = 14/405 (3%)
 Frame = -2

Query  1538  VEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFY  1359
             +E+LG HAGYY LPNT  +R+FYFFFESR+N +DPVVIWL+GGPGCSSS  L  ENGPF 
Sbjct  31    LEELGHHAGYYSLPNTKSSRLFYFFFESRNNITDPVVIWLSGGPGCSSSFGLLTENGPFT  90

Query  1358  IADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFK  1179
             + ++ SL  N+Y W++ SN+IYVDQP GTGFS  S  +  R DE GVSNDLY FLQ FFK
Sbjct  91    LTEDLSLSRNEYSWNQVSNIIYVDQPVGTGFSNISDTDVLRHDETGVSNDLYNFLQVFFK  150

Query  1178  AHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYP  999
              HP+  +++F++TGESYAGHYIPAL +RI+ GNK  EGI + LKG+AIGNGLT+P IQY 
Sbjct  151   EHPQLVRNDFYITGESYAGHYIPALASRIHTGNKNNEGIPVKLKGIAIGNGLTNPEIQYG  210

Query  998   AYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEK  819
             AY D+AL+  LIS+S H+ L Q+   CQ ++R+CN +GG AC+   +  C  + + I  +
Sbjct  211   AYGDYALEMKLISQSDHESLNQVYVDCQGSIRECNIDGGLACASAYHV-CFQILNYIKSE  269

Query  818   LVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDI  639
               D+N YD+RKKC G  +C D SN E FLN ++V+ ALGVGD  +VSC+ TVY  M  D 
Sbjct  270   NKDMNPYDVRKKC-GELMCDDNSNLEKFLNQENVRKALGVGDNIFVSCNDTVYVAMIEDW  328

Query  638   FKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVG  459
               NL   IP+L++DGI+LLVY GEYD +CNWLGN  WV+ + W GQK FGAA  V F V 
Sbjct  329   MINLEVKIPTLIEDGISLLVYAGEYDFVCNWLGNSTWVEQMNWSGQKEFGAAKTVPFMVD  388

Query  458   GKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             GKE  + K++GPLTFLK            PKASL+ML+ WM G+L
Sbjct  389   GKEACVMKNHGPLTFLK------------PKASLQMLQTWMQGKL  421



>emb|CAB71127.1| serine carboxipeptidase [Cicer arietinum]
Length=360

 Score =   459 bits (1180),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 218/338 (64%), Positives = 260/338 (77%), Gaps = 3/338 (1%)
 Frame = -2

Query  1334  WNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKS  1155
             WN+YGWDK SN++YVDQPTGTGFSYSS   D R +E GVSNDLY FLQ FF  HP+YAK+
Sbjct  11    WNEYGWDKVSNILYVDQPTGTGFSYSSDLRDIRHNEKGVSNDLYDFLQAFFAEHPQYAKN  70

Query  1154  EFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALD  975
              FF+TGESYAGHYIPAL +RI QGN+ KEGIHINLKGLAIGNGLT+P IQY AY D+ALD
Sbjct  71    NFFITGESYAGHYIPALASRIRQGNQAKEGIHINLKGLAIGNGLTNPAIQYKAYADYALD  130

Query  974   NNLISKSFHDEL-TQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYY  798
               +I+K+ HD L   L+P C+ A++ C ++G  AC    N  C  ++  I+    D+NYY
Sbjct  131   MGIITKATHDRLGLVLVPACELAIKLCGTDGKLACLT-ANVACNLIFSDILLHAGDVNYY  189

Query  797   DIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPG  618
             DIRKKC  GSLCYDFSN E FLN +SV+D+LGV  I +VSCST VY  M  D  +NL  G
Sbjct  190   DIRKKC-EGSLCYDFSNMEKFLNQESVRDSLGVAKISFVSCSTEVYIAMLVDWMRNLEVG  248

Query  617   IPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ  438
             IP LL+DGINLLVY GEYDLICNWLGN RWV A++W GQK F A+P+V F V G E G+ 
Sbjct  249   IPILLEDGINLLVYAGEYDLICNWLGNSRWVHAMEWSGQKKFVASPDVPFVVNGSEAGLL  308

Query  437   KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             K+YGPL+FLKV+DAGH+VPMDQPKA+LEML++W  G L
Sbjct  309   KNYGPLSFLKVYDAGHMVPMDQPKAALEMLKKWTRGTL  346



>emb|CDY50329.1| BnaA10g13620D [Brassica napus]
Length=432

 Score =   452 bits (1163),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 229/401 (57%), Positives = 281/401 (70%), Gaps = 22/401 (5%)
 Frame = -2

Query  1520  HAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQS  1341
             HAGYY LPN   +R+FYFFFESR+N +DPVVIWL+GGPGCSSS  L  ENGPF + ++ S
Sbjct  42    HAGYYSLPNAKSSRLFYFFFESRNNITDPVVIWLSGGPGCSSSFGLLAENGPFTLNEDLS  101

Query  1340  LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYA  1161
             L  N+Y W++ SN+IYVDQP GTGFS  S  +  R DE GVSNDLY FLQ FFK HP+  
Sbjct  102   LSRNEYSWNQVSNIIYVDQPVGTGFSSVSDTDVLRHDETGVSNDLYNFLQVFFKEHPQLV  161

Query  1160  KSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFA  981
             +++F++TGESYAGHYIPAL +RI+ GNK  EGI I LKG+AIGNGLT+P IQY AY D+A
Sbjct  162   RNDFYITGESYAGHYIPALASRIHTGNKNNEGIPIKLKGIAIGNGLTNPEIQYGAYGDYA  221

Query  980   LDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNY  801
             L+  LIS+S H+ L Q+   CQ ++R+CN +GG AC+    S   P              
Sbjct  222   LEMKLISQSDHESLNQVYVNCQGSIRECNIDGGLACA----SAYHP--------------  263

Query  800   YDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAP  621
             YD RKKC G  +C   SN E FLN ++V+ ALGVGD  +VSC+ TVY  M  D   NL  
Sbjct  264   YDARKKC-GELMCDVNSNLEKFLNQENVRKALGVGDNVFVSCNATVYVAMIEDWMINLEV  322

Query  620   GIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGI  441
              IP+L++DGI+LLVY GEYDL+CNWLG   WV+ + W GQK FGAA  V F V GKE G+
Sbjct  323   KIPTLIEDGISLLVYAGEYDLVCNWLG-FVWVEQMNWSGQKEFGAAKTVPFMVDGKEAGV  381

Query  440   QKSYGPLTFLK--VHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              K++GPL FLK       H+VPMDQPKASL+MLR WM G+L
Sbjct  382   MKNHGPLIFLKKLYWFMIHMVPMDQPKASLQMLRTWMQGKL  422



>ref|XP_010034181.1| PREDICTED: serine carboxypeptidase-like [Eucalyptus grandis]
Length=457

 Score =   450 bits (1157),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 220/419 (53%), Positives = 293/419 (70%), Gaps = 5/419 (1%)
 Frame = -2

Query  1589  LVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGG  1410
              V   + L LL +SGA+++DL + AGYY LP++  ARMF++F +S  N SDPVV+W+ GG
Sbjct  27    FVRGDMMLPLLDNSGASIQDLSRSAGYYPLPHSHAARMFFYFVKSPKNVSDPVVLWVAGG  86

Query  1409  PGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTD  1230
             PGCS + +LF  NGP+YI+D+ +L  N YGW+K SN+I+VDQPTGTGFS+S+ E D R D
Sbjct  87    PGCSGAGSLFNGNGPYYISDDMTLCSNKYGWEKVSNIIFVDQPTGTGFSFSTDEHDIRQD  146

Query  1229  EDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINL  1050
                VSNDLY FLQ FF  + + A+++F++ GESYAGHYIPAL TR+ QGN+ KEGIHINL
Sbjct  147   LHDVSNDLYDFLQRFFTEYDQLARNDFYIAGESYAGHYIPALATRVQQGNRFKEGIHINL  206

Query  1049  KGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACS  870
             KG AIGNGLT+ GIQY AY ++AL  NLI ++    +  + P C + VRQC S G  +C 
Sbjct  207   KGFAIGNGLTNSGIQYGAYTEYALRKNLIKRNDKIRIDAMFPECTKLVRQCESGGDWSCV  266

Query  869   DLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYD-FSNAETFLNTKSVKDALGVGD  693
              L    C+ +Y   ++K+V   Y+DIRK+C  GS C D FS  ETFLN K VK ALGVGD
Sbjct  267   -LAYHECERIYKE-LKKIVGNRYFDIRKEC--GSNCSDGFSRVETFLNKKEVKYALGVGD  322

Query  692   IDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQ  513
             I++      V+  M  DI KNLA GIP+LL+DG+ +L+Y G  DL CN++G   WV+ ++
Sbjct  323   IEFKMFREGVFNAMHGDIMKNLAVGIPALLEDGLKVLIYAGAEDLRCNYIGIFEWVEDME  382

Query  512   WYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWM  336
             WYG+  F  +    F+V G   G  K++GPLTFL V++AGH VPMDQPK +L+M++ WM
Sbjct  383   WYGRADFKKSGIAPFAVDGSVAGWLKTHGPLTFLTVNEAGHYVPMDQPKVALQMIQSWM  441



>ref|XP_001786217.1| predicted protein [Physcomitrella patens]
 gb|EDQ48972.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   444 bits (1141),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 217/388 (56%), Positives = 280/388 (72%), Gaps = 16/388 (4%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADT---PRLVEKKLKLNLLGDSGATVEDLGQHA  1515
             +AE++I+ LNL P      G+   P   +     RL E+++ LN+ GD+G + E+LGQ+A
Sbjct  23    QAERLIKALNLVP------GASDGPGVDEMLGGARLQERRINLNIEGDAGISTEELGQYA  76

Query  1514  GYYRLPNTVDARMFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             GY++L  T  A MFYFFFESR NK+D PVV+W+TGGPGC+S LALFYENGPF I DN +L
Sbjct  77    GYFKLARTHAANMFYFFFESRGNKTDDPVVLWMTGGPGCASELALFYENGPFKITDNLTL  136

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
              WND+GWDK S++I+VDQP GTGFSYS+   D R DE+GV  D+Y F Q FF AHP+YAK
Sbjct  137   VWNDFGWDKVSSIIFVDQPVGTGFSYSTDIRDIRHDEEGVGEDMYDFFQAFFAAHPEYAK  196

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++FFVTGESYAGHY+PA+  R ++  K KEG+ INLKG AIGNGLT P IQY AY D+AL
Sbjct  197   NKFFVTGESYAGHYVPAVAGRFHKALKNKEGVPINLKGFAIGNGLTQPDIQYEAYADYAL  256

Query  977   DNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLN  804
             D NLI++  ++++++L P C  +++ C   G   C  + LV   CQ +++ I+    ++N
Sbjct  257   DMNLITEDDYNKMSKLYPACAASIKLCGPKGTIGCLAAYLV---CQSIFNSILAVAGNIN  313

Query  803   YYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLA  624
             YYD+RK+C  GSLCYDFSN + FLN  S ++ALGVG+  +VSCS  VYE M  D  KNL 
Sbjct  314   YYDVRKEC-QGSLCYDFSNLDNFLNNASTREALGVGNRKFVSCSPLVYEAMIVDWMKNLE  372

Query  623   PGIPSLLQDGINLLVYVGEYDLICNWLG  540
              GIP LL+DGI LLVY GEYDLICNWLG
Sbjct  373   KGIPELLEDGIELLVYAGEYDLICNWLG  400



>gb|EYU39639.1| hypothetical protein MIMGU_mgv1a0046372mg, partial [Erythranthe 
guttata]
Length=356

 Score =   436 bits (1120),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/330 (61%), Positives = 255/330 (77%), Gaps = 6/330 (2%)
 Frame = -2

Query  1307  SNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESY  1128
             SN+++VDQP GTGFSYSS + D R +E GVS+DLY FLQ FFK HP+ A ++F++TGESY
Sbjct  2     SNILFVDQPIGTGFSYSSDKRDIRHNEKGVSDDLYDFLQAFFKEHPELADNDFYITGESY  61

Query  1127  AGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFH  948
             AGHYIPA   R++QGNK KEGIH+NLKG AIGNGLTDP +QY AY D+ALD  +I ++ H
Sbjct  62    AGHYIPAFAARVHQGNKAKEGIHVNLKGFAIGNGLTDPAVQYGAYADYALDMGIIKQTEH  121

Query  947   DELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVG  774
             D + +++P C+ A++ C ++G  +C  + LV   C  ++  I+ +  D+NYYDIRKKC  
Sbjct  122   DRINKVLPLCETAIKLCGTDGTLSCMAAYLV---CNTIFSSIIARAGDINYYDIRKKC-E  177

Query  773   GSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDG  594
             GSLCYDFSN E FLN KSV+ A+GVGDI++VSCST+VY+ M  D  +NL  GIP+LL+DG
Sbjct  178   GSLCYDFSNLEKFLNQKSVRSAIGVGDIEFVSCSTSVYQAMLMDWMRNLEVGIPALLEDG  237

Query  593   INLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTF  414
             + LL+Y GEYDLICNWLGN RWV A++W G+K F A+  V F V G E G+  S+GPL+F
Sbjct  238   VKLLIYAGEYDLICNWLGNSRWVHAMEWSGKKEFVASSEVAFEVDGAEAGLLTSHGPLSF  297

Query  413   LKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             LKVHDAGH+VPMDQPKASLEML+RWM G L
Sbjct  298   LKVHDAGHMVPMDQPKASLEMLKRWMDGSL  327



>gb|KCW50691.1| hypothetical protein EUGRSUZ_J00375 [Eucalyptus grandis]
Length=481

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 215/417 (52%), Positives = 290/417 (70%), Gaps = 5/417 (1%)
 Frame = -2

Query  1580  KKLKLNLLGDSGATVEDLGQHA-GYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPG  1404
             K+L+L LLG+S A ++D    A GYY L +++ A+MF++F +S  N SDPVV+W+ GGPG
Sbjct  52    KRLELPLLGNSEACIQDPVDLAFGYYPLLHSLHAKMFFYFVKSPKNVSDPVVLWVAGGPG  111

Query  1403  CSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDED  1224
             CS + +LF  NGP+YI+D+ +L  N YGW+K SN+I+VDQPTGTGFS+S+ E D R D  
Sbjct  112   CSGAGSLFNGNGPYYISDDMTLCSNKYGWEKVSNIIFVDQPTGTGFSFSTDEHDIRQDLH  171

Query  1223  GVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKG  1044
              VSNDLY FLQ FF  + + A+++F++ GESYAGHYIPAL TR+ QGN+ KEGIHINLKG
Sbjct  172   DVSNDLYDFLQRFFTEYDQLARNDFYIAGESYAGHYIPALATRVQQGNRFKEGIHINLKG  231

Query  1043  LAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDL  864
              AIGNGLT+ GIQY AY ++AL  NLI ++    +  + P C + VRQC S G  +C  L
Sbjct  232   FAIGNGLTNSGIQYGAYTEYALRKNLIKRNDKIRIDAMFPECTKLVRQCESGGDWSCV-L  290

Query  863   VNSRCQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYD-FSNAETFLNTKSVKDALGVGDID  687
                 C+ +Y  + + + +   +DIRK+C  GS C D FS  ETFLN K VK ALGVGDI+
Sbjct  291   AYHECERIYKELKKIVGNRYEFDIRKEC--GSNCSDGFSRVETFLNKKEVKYALGVGDIE  348

Query  686   WVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWY  507
             +      V+  M  DI KNLA GIP+LL+DG+ +L+Y G  DL CN++G   WV+ ++WY
Sbjct  349   FKMFREGVFNAMHGDIMKNLAVGIPALLEDGLKVLIYAGAEDLRCNYIGIFEWVEDMEWY  408

Query  506   GQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWM  336
             G+  F  +    F+V G   G  K++GPLTFL V++AGH VPMDQPK +L+M++ WM
Sbjct  409   GRADFKKSGIAPFAVDGSVAGWLKTHGPLTFLTVNEAGHYVPMDQPKVALQMIQSWM  465



>gb|KCW50689.1| hypothetical protein EUGRSUZ_J003742, partial [Eucalyptus grandis]
Length=328

 Score =   416 bits (1069),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/329 (60%), Positives = 242/329 (74%), Gaps = 12/329 (4%)
 Frame = -2

Query  1310  ASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGES  1131
             ASNLI+VDQP GTGF YS  E D R DE+GVSNDLY FLQ FF AHP++ K++F++TGES
Sbjct  1     ASNLIFVDQPIGTGFGYSIDERDIRHDEEGVSNDLYDFLQAFFTAHPQFVKNDFYITGES  60

Query  1130  YAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSF  951
             YAGHYIP L  R+ QGNK KEGIHINLKG AIGNGLT+P IQY AY D+AL+  LI +S 
Sbjct  61    YAGHYIPPLAARVQQGNKAKEGIHINLKGFAIGNGLTNPEIQYEAYTDYALNMRLIMQSD  120

Query  950   HDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKCVGG  771
             HD +  ++P C+ A  QC +NGG AC DL  + C  +++ I+    + NYYDIRK+C  G
Sbjct  121   HDSINTMLPECKRATEQCATNGGDAC-DLAWNDCFSIFNEILNITGNKNYYDIRKRC-EG  178

Query  770   SLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGI  591
              LC D SN ET LN K V+DALGVGDI+++SCS+TV+  MS D  KNLA G         
Sbjct  179   PLCCDLSNVETLLNQKKVRDALGVGDIEFMSCSSTVFNAMSQDWMKNLAVG---------  229

Query  590   NLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFL  411
                +Y GEYDLICNWLGN RWV A++W GQK FG +P V F V G E G+ KS+GPLTFL
Sbjct  230   -RHIYAGEYDLICNWLGNSRWVNAMRWSGQKQFGTSPTVPFVVAGAEAGMMKSHGPLTFL  288

Query  410   KVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             KVH+AGH+VPMDQPKA+L+ML+ WM G++
Sbjct  289   KVHNAGHMVPMDQPKAALQMLKSWMAGKV  317



>ref|XP_001763185.1| predicted protein [Physcomitrella patens]
 gb|EDQ72062.1| predicted protein [Physcomitrella patens]
Length=512

 Score =   419 bits (1077),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 206/460 (45%), Positives = 293/460 (64%), Gaps = 17/460 (4%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDS--GATVEDLGQHAG  1512
             +AE++I+ L L P       +  S    + P L E+K++L++  +S   +       +AG
Sbjct  51    QAERLIKSLGLLP-----GAAVESSGPVNGPGLHERKIQLDIFTNSTSASASRHAAHYAG  105

Query  1511  YYRLPNTVDARMFYFFFESRSNKS-DPVVIWLTGGPGCSSSLALFYENGPFYIADN---Q  1344
             Y+ L  +  A MFY FFESR NK  DP+V+ +TGGP C+S +A+FYENGPF I DN    
Sbjct  106   YFTLKRSHTANMFYTFFESRGNKGMDPLVLLMTGGPACASEVAMFYENGPFKIQDNIENL  165

Query  1343  SLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKY  1164
             +L WN +GWD+ +++IY+D P GTGFSYS++  D R D +GVS D++ F Q FF AHP++
Sbjct  166   TLIWNKFGWDQEASIIYIDLPVGTGFSYSTNSGDIRHDAEGVSEDIFDFFQAFFTAHPEF  225

Query  1163  AKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDF  984
             A+++ +V GES+  HY+PA+  R+++  K K+G+ INLKG AIG+GLT P I+Y +Y D+
Sbjct  226   AENDLYVMGESFGSHYVPAVAARLHEEKKLKQGLPINLKGFAIGSGLTHPNIRYESYADY  285

Query  983   ALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSAC--SDLVNSRCQPLYDRIMEKLVD  810
             AL   LI+   H  L+++ P C  A+  C + G   C  + LV   CQ +++ I+    +
Sbjct  286   ALSMALIADDDHKRLSKVFPACATAIELCGTKGTVTCIAAYLV---CQSIFNTILAISGN  342

Query  809   LNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKN  630
             +N +DIRK+C    +CYDFSN E +LN   V++ALGVG+  ++SCS  VYE +  D  ++
Sbjct  343   INSFDIRKEC-NEDICYDFSNLEIYLNQTKVREALGVGNQKFLSCSPLVYEAILMDWMES  401

Query  629   LAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKE  450
                 I  LL+DGI +LVY GE+DLICNWLGN  W  AL W GQ  +  AP   F V G E
Sbjct  402   KENKIARLLEDGIQILVYAGEFDLICNWLGNSMWTAALPWSGQIEYARAPWKKFEVNGIE  461

Query  449   KGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHG  330
              G+   +  L F+KV DAGH+V MDQP+ +LEM RRW  G
Sbjct  462   AGLVTGFKNLNFVKVQDAGHMVAMDQPRIALEMFRRWTRG  501



>ref|XP_009121241.1| PREDICTED: serine carboxypeptidase-like 47 [Brassica rapa]
Length=365

 Score =   393 bits (1010),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/335 (58%), Positives = 244/335 (73%), Gaps = 2/335 (1%)
 Frame = -2

Query  1538  VEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFY  1359
             +E+LG HAGYY LPN   +R+FYFFFESR+N +DPVVIWL+GGPGCSSS  L  ENGPF 
Sbjct  31    LEELGHHAGYYSLPNAKSSRLFYFFFESRNNITDPVVIWLSGGPGCSSSFGLLAENGPFT  90

Query  1358  IADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFK  1179
             + ++ SL  N+Y W++ SN+IYVDQP GTGFS  S  +  R DE GVSNDLY FLQ FFK
Sbjct  91    LNEDLSLSRNEYSWNQVSNIIYVDQPVGTGFSSVSDTDVLRHDETGVSNDLYNFLQVFFK  150

Query  1178  AHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYP  999
              HP+  +++F++TGESYAGHYIPAL +RI+ GNK  EGI I LKG+AIGNGLT+P IQY 
Sbjct  151   EHPQLVRNDFYITGESYAGHYIPALASRIHTGNKNNEGIPIKLKGIAIGNGLTNPEIQYG  210

Query  998   AYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEK  819
             AY D+AL+  LIS+S H+ L Q+   CQ ++R+CN +GG AC+   +  C  + D I  +
Sbjct  211   AYGDYALEMKLISQSDHESLNQVYVNCQGSIRECNIDGGLACASAYHV-CFQILDYIKSE  269

Query  818   LVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDI  639
               D+N YD RKKC G  +C   SN E FLN ++V+ ALGVGD  +VSC+ TVY  M  D 
Sbjct  270   NKDMNPYDARKKC-GELMCDVNSNLEKFLNQENVRKALGVGDNVFVSCNATVYVAMIEDW  328

Query  638   FKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNL  534
               NL   IP+L++DGI+LLVY GEYDL+CNWLG L
Sbjct  329   MINLEVKIPTLIEDGISLLVYAGEYDLVCNWLGGL  363



>ref|XP_001695303.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP01561.1| predicted protein [Chlamydomonas reinhardtii]
Length=571

 Score =   387 bits (995),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 199/437 (46%), Positives = 279/437 (64%), Gaps = 11/437 (3%)
 Frame = -2

Query  1610  VEADTPRLVEKKLKL-----NLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSN  1446
             V A + RLVEK+L       +L GD    ++   + AGY++L  T DARMFYF+F+SR N
Sbjct  20    VHAQSSRLVEKELNFAVHREHLEGDV-PLIDPPKRIAGYFKLNRTHDARMFYFYFQSRHN  78

Query  1445  -KSDPVVIWLTGGPGCSSSLALFYENGPFYI-ADNQSLFWNDYGWDKASNLIYVDQPTGT  1272
               +DPVV+W+TGGPGCSS +A+F+ENGP+ I  D ++L    YGWD   N+I+VDQP GT
Sbjct  79    PATDPVVLWMTGGPGCSSEIAIFFENGPYSINEDRRTLNETTYGWDTFHNMIFVDQPIGT  138

Query  1271  GFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRI  1092
             GFSYS+   D   DE  V  D+  FL EF++AHP+ A++ F+VTGESYAGHY+PA+ + I
Sbjct  139   GFSYSNDGRDRVFDEGRVGRDMLDFLYEFYRAHPEVAENPFYVTGESYAGHYVPAVSSAI  198

Query  1091  NQGNKKKEG-IHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQ  915
              + N+   G + I L GLAIGNG+T+P +Q+PAY DFAL+N LIS+  HD +   +P CQ
Sbjct  199   YRANELGTGPMTIPLAGLAIGNGMTNPTLQFPAYADFALENKLISQGLHDSIQWWMPLCQ  258

Query  914   EAVRQCNSNGGSACSDLVNSRCQPL-YDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAET  738
                  C+++       +    CQ   ++RI+    D+N YDI KKC  G LCYD S A+ 
Sbjct  259   WGAEFCDTHQWRFACIIALEVCQMTSFERILGANPDINVYDITKKC-DGPLCYDMSAADD  317

Query  737   FLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDL  558
             FLN   V+  LGVG+ +W  C   V      D  ++    +P++++DGI++++Y G+ DL
Sbjct  318   FLNRPEVRKQLGVGNREWSECDMGVNGDFMGDWLRSYDDLLPAMMEDGIHVMIYAGDLDL  377

Query  557   ICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPM  378
             ICNW+GN RWV ALQW     + A   V + V G + G  +  G L+F++V+ AGH+VPM
Sbjct  378   ICNWVGNQRWVDALQWERSGEWPAVAPVEWEVTGAKAGTVRELGTLSFVRVYQAGHMVPM  437

Query  377   DQPKASLEMLRRWMHGQ  327
             DQP+ +L ML R+   Q
Sbjct  438   DQPQHALAMLWRFTRNQ  454



>gb|AAA92064.1| serine carboxypeptidase [Vigna radiata]
Length=294

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/284 (61%), Positives = 218/284 (77%), Gaps = 2/284 (1%)
 Frame = -2

Query  1175  HPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPA  996
             HP++ K++F++TGESYAGHYIPAL +R++QGNK KEGIHINLKG AIGNGLT+P IQY A
Sbjct  2     HPQFTKNDFYITGESYAGHYIPALASRVHQGNKAKEGIHINLKGFAIGNGLTNPEIQYQA  61

Query  995   YPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKL  816
             Y D+ALD  LI K+ ++ + +L+P C++A+  C + GG  C   +   C  +++RIM   
Sbjct  62    YTDYALDRGLIQKADYNSINKLLPSCKQAIEDCGTEGGETCVTSLYV-CNKIFNRIMNIA  120

Query  815   VDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIF  636
              D+NYYDIRKKCVG  LCYDFS  E FLN K+V+DALGVGD+D+VSCS+TVY  M  D  
Sbjct  121   GDVNYYDIRKKCVG-DLCYDFSEMEEFLNKKTVRDALGVGDLDFVSCSSTVYSAMMEDWM  179

Query  635   KNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGG  456
             +NL  GIP+LL+DGI +LVY GE DLICNWLGN RWVQA++W GQK FGA+  V F V G
Sbjct  180   RNLEAGIPALLEDGIKVLVYAGEEDLICNWLGNSRWVQAMEWSGQKEFGASGAVPFLVDG  239

Query  455   KEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
              E G  KS+GPL FLKV++AGH+VPMDQPKA+L  LR WM G+L
Sbjct  240   AEAGTLKSHGPLAFLKVYEAGHMVPMDQPKAALTTLRSWMQGKL  283



>ref|XP_002499869.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61127.1| predicted protein [Micromonas sp. RCC299]
Length=431

 Score =   377 bits (967),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 185/400 (46%), Positives = 252/400 (63%), Gaps = 19/400 (5%)
 Frame = -2

Query  1478  MFYFFFESRSN--KSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKAS  1305
             MFYF+F+SRS     DPVV+W+TGGPGCSS LA+FYENGP++I  +  L   ++GWD  S
Sbjct  1     MFYFYFKSRSATPSKDPVVLWMTGGPGCSSELAVFYENGPYHITPDLKLEVTEHGWDTVS  60

Query  1304  NLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYA  1125
             NL+YVDQP  TGFSYS    D   DE  V+ D+  FL EF +AHP+   ++FF+TGESYA
Sbjct  61    NLVYVDQPINTGFSYSDDPADEVHDESVVAEDMLQFLAEFVQAHPELDGNDFFITGESYA  120

Query  1124  GHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHD  945
             GHY+PA+  R+ +  +  E   + LKGLA+GNGLT P IQY AY D+AL ++++      
Sbjct  121   GHYVPAVSYRVFRAAQTGEFTGLKLKGLAVGNGLTMPEIQYGAYADYALAHDMVGPVAAA  180

Query  944   ELTQLIPGCQEAVRQCNSNGGSACSD--------------LVNSRCQPLYDRIMEKLVDL  807
                 + P C+ A+++C   GG    D                   CQ +   +M    D+
Sbjct  181   AARTVYPACRAAIKKC---GGGVAPDGPEPEPRSKKATCLTAVEICQTIPSGLMAVAGDV  237

Query  806   NYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNL  627
             N YD+ KK  G S  YDFS+AE FLN  SV+ ALGVG+  W  CS  V+E M +D  +NL
Sbjct  238   NIYDVHKKNAGPSFPYDFSDAEKFLNDPSVRAALGVGNRKWEMCSGKVHEDMMADWMRNL  297

Query  626   APGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEK  447
              P IP +L+ G+ +++Y GE D ICNWLGN RWV+A++W G+ GF AA    F V G   
Sbjct  298   EPTIPPMLEGGVRVMIYAGENDFICNWLGNHRWVKAMEWSGKAGFNAAMPTPFVVDGTTG  357

Query  446   GIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             G     G L+F+K+ ++GH+VPMDQP+ ++EMLRR++ G+
Sbjct  358   GDVTEDGLLSFVKMSESGHMVPMDQPRNAVEMLRRFISGE  397



>ref|XP_003055284.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60536.1| predicted protein [Micromonas pusilla CCMP1545]
Length=498

 Score =   372 bits (955),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 198/452 (44%), Positives = 271/452 (60%), Gaps = 29/452 (6%)
 Frame = -2

Query  1598  TPRLVEKKLKL--NLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSD-PVV  1428
             +PRL EK L L  +L   + +        AGY+ L  T  A MFYF+F SR   +D PVV
Sbjct  7     SPRLFEKTLDLSAHLSPTASSPPTPFDHAAGYFALNRTRAAEMFYFYFRSRDAAADAPVV  66

Query  1427  IWLTGGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSE  1248
             +W+TGGPGCSS +ALFYENGP+ I D+ +L   ++GWD  SNLIYVDQP  TGFSYS   
Sbjct  67    LWMTGGPGCSSEIALFYENGPYRILDDLTLAVTEHGWDTVSNLIYVDQPINTGFSYSDDP  126

Query  1247  EDFRTDEDGVSNDLYAFLQEFFKAHPKY-----------AKSEFFVTGESYAGHYIPALG  1101
              D   DE  V+ D+  FL EF  AHP+             + +F+VTGESYAGHY+PA+ 
Sbjct  127   RDDVHDERVVAEDMLDFLSEFVDAHPELRRVLLTLVPIRPRRDFYVTGESYAGHYVPAVS  186

Query  1100  TRINQGNKKK-EGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIP  924
                 +  +    G+ + LKGLAIGNGLT+P IQY AY D+ L  +++SK+  +   +  P
Sbjct  187   YAAFKAQQSDGVGVGMRLKGLAIGNGLTEPEIQYGAYADYGLGVDVVSKAAAEISKKNYP  246

Query  923   GCQEAVRQCNSNGGS------------ACSDLVNSRCQPLYDRIMEKLVDLNYYDIRKKC  780
              C + +R+C    GS             C   V    + ++  +++   D+N YD+RK+C
Sbjct  247   TCAKMIRKCGGGAGSDGPTRESEARRKLCLAAVEYCSEKVWGPVIKDAGDVNVYDVRKRC  306

Query  779   VGGSLCYDFSNAETFLNTKSVKDALGVG-DIDWVSCSTTVYEVMSSDIFKNLAPGIPSLL  603
             V G LCYD SNA+ FLN  SVK +LGV  +I W +C  +V+  M +D  ++L P IP +L
Sbjct  307   V-GDLCYDMSNADKFLNQPSVKVSLGVKRNITWEACDGSVHRNMMADWMRDLEPTIPPML  365

Query  602   QDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGP  423
             + G+ +L+Y GE D ICNWLGN RWV+A++W G+  F  A    F V G   G     G 
Sbjct  366   EAGLRVLIYAGEEDFICNWLGNHRWVRAMEWSGKDAFNDARPEPFVVDGVTGGDVTESGN  425

Query  422   LTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             L FL+V  AGH+VPMDQPK ++ ML+R++ G+
Sbjct  426   LAFLRVSLAGHMVPMDQPKNAVVMLKRFVAGE  457



>ref|XP_005645486.1| peptidase S10, serine carboxypeptidase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20942.1| peptidase S10, serine carboxypeptidase [Coccomyxa subellipsoidea 
C-169]
Length=494

 Score =   369 bits (946),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 198/451 (44%), Positives = 271/451 (60%), Gaps = 26/451 (6%)
 Frame = -2

Query  1616  SPVEADTPRLVEKKLKLNLLGDSGATVEDLGQH---AGYYRLPNTVDARMFYFFFESRSN  1446
             + + A + RLVEK++ ++L  D+      LG+    +GY++L  T DA MFYFFFE+ S 
Sbjct  20    AAIGASSSRLVEKEIDVHLAADNKHLESGLGKPLRLSGYFKLNRTYDAHMFYFFFEAASE  79

Query  1445  K--SDPVVIWLTG----------GPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASN  1302
             K   +P+ +W+TG          GPGCSS LA+FYENGPF I ++ +L  N++GWD+  N
Sbjct  80    KRHEEPLAVWMTGNCPRTHPFIWGPGCSSELAIFYENGPFRINEDLTLDANEFGWDQTHN  139

Query  1301  LIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAG  1122
             +I+VDQP  TGFSYS  E D   DE  V+ D+  FL+EF  AHP Y ++  FVTGESY G
Sbjct  140   MIFVDQPINTGFSYSEDERDRVYDEKVVAADMLDFLKEFRAAHPSYFEAPLFVTGESYGG  199

Query  1121  HYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDE  942
             HY+PA+   I + NK  +    NLKGLAIGNGLT+P IQY +Y DF+  N LISK+    
Sbjct  200   HYVPAVTYGIFEHNKVAKE-PFNLKGLAIGNGLTNPAIQYGSYADFSFANGLISKNVQST  258

Query  941   LTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLV--DLNYYDIRKKCVGGS  768
             L  + P C+  +  CN+ G      +    CQ   D I+  +     N YDIRK C+ G 
Sbjct  259   LNAIYPICRFGINACNTLGWDFVCSIALIFCQ---DTIVAPIQAEGFNVYDIRKPCI-GP  314

Query  767   LCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYE----VMSSDIFKNLAPGIPSLLQ  600
             LCYDFS  + +L    V++ALGVGD  W SCS  VY         DI +N    + + L 
Sbjct  315   LCYDFSLLDRYLAQDEVREALGVGDRPWQSCSPDVYNDFLGKFLRDIMRNYEDRVSTQLD  374

Query  599   DGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPL  420
              GI +L+YVG  D ICNW+GN RWV +L W  +  F  A    + + G   G  K+ GPL
Sbjct  375   AGIKVLIYVGTEDWICNWMGNKRWVSSLAWSQRTAFDKAKEQDWQLDGNIVGTIKAAGPL  434

Query  419   TFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             +F+KV+++GH+VPMD P A+L+M+  + HG+
Sbjct  435   SFVKVYESGHMVPMDSPAAALDMITSFTHGR  465



>ref|XP_002945957.1| hypothetical protein VOLCADRAFT_102913 [Volvox carteri f. nagariensis]
 gb|EFJ52952.1| hypothetical protein VOLCADRAFT_102913 [Volvox carteri f. nagariensis]
Length=600

 Score =   368 bits (945),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 197/455 (43%), Positives = 273/455 (60%), Gaps = 34/455 (7%)
 Frame = -2

Query  1592  RLVEKKLKLNLLGDSGAT--VEDLGQHAGYYRLPNTVDARMFYFFFESR-SNKSDPVVIW  1422
             RLVEK++ L L      T  V+   + AGY+RL  T DARMFYFFF+SR + K+DP+V+W
Sbjct  28    RLVEKEIHLPLDPRYADTPLVDPPKRIAGYFRLNRTHDARMFYFFFQSRNAPKADPLVLW  87

Query  1421  LTGGPGCSSSLALFYENGPFYIA-DNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEE  1245
             +TGGPGCSS +A+FYENGP++I  D ++L    YGWD   N+I+VDQP GTGFSYS    
Sbjct  88    MTGGPGCSSEIAIFYENGPYFINNDTRTLTETKYGWDTLHNMIFVDQPIGTGFSYSDDWR  147

Query  1244  DFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEG  1065
             D   +E  V  D+  FL  F+ AHP+  +++FFVTGESYAGHY+PA+ + I + N+  +G
Sbjct  148   DRVYNEVVVGEDMLDFLYAFYSAHPELLENDFFVTGESYAGHYVPAVSSAIYRANELGQG  207

Query  1064  -IHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSN  888
                I L+GLAIGNG+T P +Q+PAY ++AL N +ISK  HD +   +P C+     C+S+
Sbjct  208   PFTIPLRGLAIGNGMTAPSLQFPAYAEYALQNGIISKGLHDSIQFWMPMCRWGAEFCDSH  267

Query  887   GGSACSDLVNSRCQPL-YDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKD  711
                A   L    CQ + +DRI+     +N YDI K C  G LCYD S A+ FLN   V+ 
Sbjct  268   QWRAACALALQVCQLVSFDRILAANPGINVYDITKTC-DGPLCYDMSAADEFLNRADVRA  326

Query  710   ALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLR  531
              LGVG+  W  C+  V      D  ++    +P+LL DGI +++Y G+ DLICNW+GN R
Sbjct  327   ELGVGERRWEECNMGVNGDFLGDWLRSYDKLLPALLDDGIRVMIYAGDLDLICNWVGNER  386

Query  530   WVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDA---------------  396
             WV AL+W   +G+       + V G   G  +  GPL+F++V+ A               
Sbjct  387   WVNALEWEQSEGWPQVWPQEWQVAGAAAGTVRELGPLSFVRVYQARAQAALGALCQGSDD  446

Query  395   ------------GHLVPMDQPKASLEMLRRWMHGQ  327
                         GH+VPMDQP+A+L+ML  +  G+
Sbjct  447   LLCVRDPGDTSGGHMVPMDQPRAALQMLTLFTRGK  481



>sp|Q41005.1|CBPX_PEA RecName: Full=Serine carboxypeptidase-like, partial [Pisum sativum]
 emb|CAA92216.1| carboxypeptidase [Pisum sativum]
 prf||2206338A Ser carboxypeptidase
Length=286

 Score =   355 bits (910),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/274 (62%), Positives = 208/274 (76%), Gaps = 3/274 (1%)
 Frame = -2

Query  1142  TGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLI  963
             TGESYAGHYIPAL +RI+QGN+  EGIHINLKGLAIGNGLT+P IQY  YPD+ALD  +I
Sbjct  1     TGESYAGHYIPALASRIHQGNQANEGIHINLKGLAIGNGLTNPAIQYKGYPDYALDMGII  60

Query  962   SKSFHDELTQ-LIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIMEKLVDLNYYDIRK  786
             +++ HD L + L+P C+ A++ C +NG  +C    N  C  ++  IM     +NYYDIRK
Sbjct  61    TQTTHDLLGKVLVPACELAIKLCGTNGKVSCLT-ANVACNLIFSDIMLHAGGVNYYDIRK  119

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
             KC  GSLCYDFSN E FLN +SV+D+LGVG I +VSCST VY  M  D  +NL  GIP L
Sbjct  120   KC-EGSLCYDFSNMEKFLNQESVRDSLGVGKIRFVSCSTEVYMAMLVDWMRNLEVGIPLL  178

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYG  426
             L+DGINLL+Y GEYDLICNWLGN RWV A++W GQK F A+ +V F V G + G+ KSYG
Sbjct  179   LEDGINLLIYAGEYDLICNWLGNSRWVHAMKWSGQKEFVASSDVPFVVNGSQAGLLKSYG  238

Query  425   PLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             PL+FLKVHDAGH+VPMDQPKA+LEM+++W  G L
Sbjct  239   PLSFLKVHDAGHMVPMDQPKAALEMVKQWTRGTL  272



>ref|XP_001422089.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00406.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=526

 Score =   361 bits (927),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 191/460 (42%), Positives = 272/460 (59%), Gaps = 36/460 (8%)
 Frame = -2

Query  1607  EADTPRLVEKKLKL-----NLLGDSGATVEDLGQHAGYYRLPNTV-DARMFYFFFESRSN  1446
             +A T RL  K ++L     +L   +    ++    +GY+ L  T  DA MFY FF++RS 
Sbjct  33    DALTSRLTTKTVRLERFATDLESLAANDYDEYAASSGYFALNRTTKDAHMFYTFFDARSG  92

Query  1445  KSD-----PVVIWLTGGPGCSSSLALFYENGPFYIADNQS--LFWNDYGWDKASNLIYVD  1287
              ++     P+++WLTGGPGCSS LA  YENGPF   ++ +  L    Y W+ A  L+YVD
Sbjct  93    GAESEDAIPIILWLTGGPGCSSELAALYENGPFAFDEDDATKLKRRKYAWNDAGRLLYVD  152

Query  1286  QPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPA  1107
              P  TGFSYSSS  D   DE  V+NDL  FL  F  + P    +  +VTGESYAGHY+PA
Sbjct  153   SPVNTGFSYSSSRRDAAKDETTVANDLLEFLYAFMLSRPMLVDAPVYVTGESYAGHYVPA  212

Query  1106  LGTRINQGNKKKEG-IHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQL  930
                 I   N + +G + INL+GLAIGNGLTDP IQY AY D++L N+++S +   +  + 
Sbjct  213   FARAIFDANARDDGPVRINLQGLAIGNGLTDPAIQYAAYADYSLGNDIVSAATVKQTAKK  272

Query  929   IPGCQEAVRQCNSNGGSA------CSDLVNSRCQPLYDRIMEKLVD------LNYYDIRK  786
             +P C E ++ C S   S+      C D V+S CQ + + ++E   +      +N YDIRK
Sbjct  273   LPSCVEKIKSCASGKTSSKENRAECLDAVDS-CQAIPEALLEDAAERNGGKAINVYDIRK  331

Query  785   KCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSL  606
              C    LCYDFS AE FLN K V++A GV    W  C  +V++ M  D   +    IP +
Sbjct  332   SC-DAELCYDFSAAEAFLNRKDVQEAFGVSK-KWEMCDASVHQDMMGDWMHDYETLIPDM  389

Query  605   LQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQ----  438
             ++ GI +++Y GE D ICNWLGNLRWV+A+QW G++ F AA    F + G   G      
Sbjct  390   IEAGIRVMIYAGEDDFICNWLGNLRWVKAMQWNGREAFNAARPEPFIIQGAGDGEDDVVG  449

Query  437   ---KSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
                + +G L+F+K+ +AGH+VPMDQP+ +L M++R+++ +
Sbjct  450   GDVREHGGLSFVKISEAGHMVPMDQPRNALTMIQRFVNNE  489



>ref|XP_003560223.2| PREDICTED: serine carboxypeptidase-like [Brachypodium distachyon]
Length=299

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 214/286 (75%), Gaps = 6/286 (2%)
 Frame = -2

Query  1187  FFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGI  1008
             FFK HP+Y K+ F++TGESY GHYIPA  TR+++GNKK EGIHINLKG AIGNGLTDPGI
Sbjct  5     FFKEHPEYTKNNFYITGESYEGHYIPAFATRVHRGNKKNEGIHINLKGFAIGNGLTDPGI  64

Query  1007  QYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSA--CSDLVNSRCQPLYD  834
             QY AY DF+LD  LI++S  + + +L+P C+ AV+ C ++G  +   + LV   C  ++ 
Sbjct  65    QYKAYTDFSLDTGLITQSQFNRINKLVPICEFAVKLCATSGTVSYIAAYLV---CNTIFS  121

Query  833   RIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEV  654
              I     + NYYDIRK CVG SLCYDFSN E FLN KSV+ +LGVGDI++VSCS TVY+ 
Sbjct  122   SIRSITGNKNYYDIRKPCVG-SLCYDFSNLEKFLNLKSVRQSLGVGDIEFVSCSPTVYQA  180

Query  653   MSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNV  474
             M  D  +NL  GIP LL+  I +L+Y GEYDLICNWLGN RWV +++W G++ F ++ + 
Sbjct  181   MILDWMRNLEVGIPELLESHIKVLIYAGEYDLICNWLGNSRWVNSMEWSGKQAFVSSTDK  240

Query  473   TFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWM  336
              F V GKE G+ KSYGPL+FLKVHD+GH++P DQPKA+LEML RW+
Sbjct  241   PFIVDGKEAGVLKSYGPLSFLKVHDSGHILPTDQPKAALEMLNRWI  286



>ref|XP_005844152.1| hypothetical protein CHLNCDRAFT_32614 [Chlorella variabilis]
 gb|EFN52050.1| hypothetical protein CHLNCDRAFT_32614 [Chlorella variabilis]
Length=421

 Score =   350 bits (897),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/388 (47%), Positives = 248/388 (64%), Gaps = 6/388 (2%)
 Frame = -2

Query  1478  MFYFFFESRSNKSD-PVVIWLTGGPGCSSSLALFYENGPFYI-ADNQSLFWNDYGWDKAS  1305
             MF+F+F++RS+  + PVV+W+TGGPGCSS LA+F+ENGP+ I  D+ SL    +GWD   
Sbjct  1     MFFFYFQARSDPENAPVVLWMTGGPGCSSELAVFFENGPWTINPDDLSLTETKHGWDTNH  60

Query  1304  NLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYA  1125
             ++I+VDQP  TGFSYS+   D   DE  VSND+  FL EFFKA P+     FFVTGESYA
Sbjct  61    HMIFVDQPINTGFSYSADSRDSCYDETCVSNDMLDFLSEFFKARPELQGRPFFVTGESYA  120

Query  1124  GHYIPALGTRINQGNKKKE-GIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNLISKSFH  948
             GHY+PA+ +R+   +K  E    INL+GLAIGNGLTDP IQY AY D+AL N LI ++ H
Sbjct  121   GHYVPAVASRVFHASKSGEVEPPINLQGLAIGNGLTDPAIQYGAYSDYALMNGLIGQALH  180

Query  947   DELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQ-PLYDRIMEKLVDLNYYDIRKKCVGG  771
             D L  L P C+ A+  C+    +    L    CQ   +  IM     +N YDIRK+C  G
Sbjct  181   DRLKMLYPSCRLALEVCDGLDFAFECLLAVQWCQMSQFAPIMLVNGGMNVYDIRKEC-EG  239

Query  770   SLCY-DFSNAETFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDG  594
              LCY +F   + +LN   V++ LGVGD+ W +C+  V+  M SD   N    +P +L  G
Sbjct  240   PLCYREFEVLDKYLNQDDVREKLGVGDLRWEACNMEVHSEMMSDWGHNYDIVLPEMLAAG  299

Query  593   INLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKEKGIQKSYGPLTF  414
             + +++Y G+ D ICN++GN +WV  L W+G K +  A +  ++V G   G  KS GP +F
Sbjct  300   VRVMIYAGDQDFICNYVGNQQWVDVLPWHGAKRWAVAEDEPWTVEGVAAGTVKSVGPFSF  359

Query  413   LKVHDAGHLVPMDQPKASLEMLRRWMHG  330
             ++V  AGH+VPMDQ K +L+M+ R+ HG
Sbjct  360   VRVFKAGHMVPMDQAKNALDMITRFTHG  387



>ref|XP_008799516.1| PREDICTED: serine carboxypeptidase 3-like [Phoenix dactylifera]
Length=305

 Score =   344 bits (883),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 202/263 (77%), Gaps = 6/263 (2%)
 Frame = -2

Query  1685  RAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKLNLLGDSGATVEDLGQHAGYY  1506
             +AEK+IR LNL P  D +  S  S  +A    +VE++   NL G SG   +DLG HAGYY
Sbjct  41    QAEKLIRSLNLLP-KDPSPESVASAADAPAKGIVERRF--NLAGLSG---DDLGHHAGYY  94

Query  1505  RLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSLFWND  1326
             RLP++ DARMFY FFESR +K DPVVIWLTGGPGCSS LA+FYENGPF IADN SL WN+
Sbjct  95    RLPHSHDARMFYLFFESRHSKKDPVVIWLTGGPGCSSELAVFYENGPFTIADNMSLAWNE  154

Query  1325  YGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAKSEFF  1146
             +GWD+ASNL+YVDQPTGTGFSYS+   D R DE GVS+DLY FLQ FF  HP+YA ++F+
Sbjct  155   FGWDQASNLLYVDQPTGTGFSYSTDSRDIRHDESGVSDDLYDFLQAFFAEHPEYANNDFY  214

Query  1145  VTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFALDNNL  966
             +TGESYAGHYIPA  +R++QGNK KEGIHI+LKG AIGNGLTDP IQY AY D+ALDN +
Sbjct  215   ITGESYAGHYIPAFASRVHQGNKAKEGIHIHLKGFAIGNGLTDPAIQYKAYTDYALDNGI  274

Query  965   ISKSFHDELTQLIPGCQEAVRQC  897
             I +S +  + +  P C+ A++ C
Sbjct  275   IKESDYKRINKYYPTCEYAIKLC  297



>gb|EFW45577.2| serine carboxypeptidase [Capsaspora owczarzaki ATCC 30864]
Length=452

 Score =   350 bits (897),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 195/426 (46%), Positives = 260/426 (61%), Gaps = 22/426 (5%)
 Frame = -2

Query  1592  RLVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKS-DPVVIWLT  1416
                EK L+ ++  +      ++  +AGYY L  T     FY+FFES+ N S DPV++WLT
Sbjct  29    HFTEKSLR-DVGTNESICASNVNSYAGYYAL--TATKHYFYWFFESQQNPSTDPVILWLT  85

Query  1415  GGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFR  1236
             GGPGC+S LALFYENGP  I D+ S   N Y W+  +NL+YVD P G GFSY     D+ 
Sbjct  86    GGPGCASELALFYENGPCTINDDLSTKANPYSWNTFANLLYVDNPVGAGFSYGLFPVDYD  145

Query  1235  TDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIH-  1059
              +ED ++NDLY F+Q+F  AHP++AK+EFFV GESYAGHY+PALG +I   N+  EG + 
Sbjct  146   RNEDQIANDLYKFIQDFITAHPEFAKNEFFVFGESYAGHYVPALGYKIYTANQGSEGKYK  205

Query  1058  INLKGLAIGNGLTDPGIQYPAYPDFALDN---NLISKSFHDELTQLIPGCQEAVRQCNSN  888
             INLKG+AIGNGLTDP +QY  YP++A +N    LI+++ ++     +PGC   + +C  N
Sbjct  206   INLKGIAIGNGLTDPEVQYRYYPEYAFNNPVKPLITQAQYNTALAEVPGCIALIAKC-QN  264

Query  887   GGSACSD---LVNSR--CQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTK  723
             G  AC +   L NS     PL   +       N YDI K C    LCYDF N   FL   
Sbjct  265   GTIACFEAETLCNSELLSPPLSTGV-------NQYDISKNCTYPPLCYDFDNLNRFLAQT  317

Query  722   SVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWL  543
             +V+D LGVG   W  C+   +E ++ D  KN    +P LL   I +LVY GE D +CN+ 
Sbjct  318   TVRDTLGVGKHTWSQCNNLAHEFLTFDWMKNYQDKVPPLLASNITVLVYNGENDFVCNYK  377

Query  542   GNLRWVQALQWYGQKGFGAAPNVTFS-VGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPK  366
             G+  W  AL W G  GF AA + T++  GG   G+ +SYG LTFL+V  AGH+VP+DQP 
Sbjct  378   GSKAWTLALDWAGNSGFNAAGDHTWNGAGGVAAGLARSYGGLTFLQVFKAGHMVPLDQPA  437

Query  365   ASLEML  348
              +L M+
Sbjct  438   NALAMV  443



>gb|KDO35820.1| hypothetical protein CISIN_1g038976mg, partial [Citrus sinensis]
Length=220

 Score =   338 bits (867),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -2

Query  1547  GATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENG  1368
             G +VEDLG HAGYY+LP++ DA+MFYFFFESR++K DPVVIWLTGGPGCSS LA+FYENG
Sbjct  4     GVSVEDLGHHAGYYKLPHSHDAKMFYFFFESRNSKKDPVVIWLTGGPGCSSELAVFYENG  63

Query  1367  PFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQE  1188
             PF IADN SL WN++GWDKASNL+YVDQPTGTGFSY+S + D R +E+GVSNDLY FLQ 
Sbjct  64    PFSIADNMSLVWNEHGWDKASNLLYVDQPTGTGFSYTSDKRDIRHNENGVSNDLYDFLQA  123

Query  1187  FFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGI  1008
             FF+ HPK A+++F++TGESYAGHYIPA   R++ GNK KEGIHINLKG AIGNGLTDPG+
Sbjct  124   FFEEHPKLAENDFYITGESYAGHYIPAFAARVHNGNKAKEGIHINLKGFAIGNGLTDPGV  183

Query  1007  QYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQC  897
             QY AYPD+ALD  +I+KS ++ ++++IP C+ A++ C
Sbjct  184   QYKAYPDYALDMGIINKSQYNRISKIIPVCELAIKLC  220



>ref|XP_005771165.1| hypothetical protein EMIHUDRAFT_424894 [Emiliania huxleyi CCMP1516]
 gb|EOD18736.1| hypothetical protein EMIHUDRAFT_424894 [Emiliania huxleyi CCMP1516]
Length=441

 Score =   346 bits (888),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 186/408 (46%), Positives = 250/408 (61%), Gaps = 22/408 (5%)
 Frame = -2

Query  1523  QHAGYYRLPNTVDARMFYFFFESRSNK-SDPVVIWLTGGPGCSSSLALFYENGPFYIA-D  1350
             Q++GY+ L +T D  +FY+FF SRS+  +DPVV+WLTGGPGCSS +ALF ENGP  ++ D
Sbjct  48    QYSGYFNL-STGDKHLFYWFFSSRSSPDTDPVVLWLTGGPGCSSEVALFGENGPCKVSPD  106

Query  1349  NQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHP  1170
               +   N   W+  +NL+YVDQP GTGFSY ++   F  DE GV ND+YAFLQ FF AHP
Sbjct  107   GMTTIPNAASWNTHANLLYVDQPVGTGFSYGTA---FDHDEVGVGNDMYAFLQAFFGAHP  163

Query  1169  KYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYP  990
                 + FFV GESYAGHY+P +  R+  GN      HINL G+++GNGLTDP +QY  YP
Sbjct  164   ALRSNAFFVFGESYAGHYVPNVAHRVWVGNGAGGAPHINLVGMSVGNGLTDPEVQYAYYP  223

Query  989   DFALDNN----LISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLVNSRCQPLYDRIME  822
               A+  N     +S + ++++ + +PGC +A+R+CN   G   S L    C   Y+    
Sbjct  224   AMAVSTNQHQPAVSNATYEKMAKAVPGCIKAIRRCNGGEG-VVSKLA---CVAAYETCNA  279

Query  821   KLVDLNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGV--GDIDWVSCSTTVYEVMS  648
                    YD+R KC    LCYDFS    FL+   V+ AL +  G   W SC+  V ++  
Sbjct  280   A------YDMRIKCAKPPLCYDFSGVGKFLDRPEVRTALHIRTGTGTWQSCNFKVNKMFM  333

Query  647   SDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWYGQKGFGAAPNVTF  468
              D  KN    IP+LL  GI +L+Y G+ D ICNWLGN  WV+ + W G+  F AAP   +
Sbjct  334   GDWMKNYQTQIPALLGAGIRVLIYAGDQDFICNWLGNQAWVRGMDWPGKAAFDAAPVKPW  393

Query  467   SVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQL  324
             S  GK+ G  ++   LTFL+V  AGH+VP+DQP ASL ML  ++ G+L
Sbjct  394   SAEGKQAGEAQAAEGLTFLRVFGAGHMVPLDQPMASLLMLDAFLKGEL  441



>ref|XP_009774966.1| PREDICTED: serine carboxypeptidase-like 49, partial [Nicotiana 
sylvestris]
Length=296

 Score =   336 bits (862),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 197/264 (75%), Gaps = 2/264 (1%)
 Frame = -2

Query  1694  SKRRAEKMIRQLNLFPLHDLNRGSGHSPVEADTPRLVEKKLKL-NLLGDSGATVEDLGQH  1518
             + ++AEK+I +LNLFP    N      P      R+VEK+    NL   S  + EDLG H
Sbjct  34    ASKQAEKLIHELNLFPKESDNI-VDRDPFPTAASRIVEKRFSFPNLANSSIISFEDLGHH  92

Query  1517  AGYYRLPNTVDARMFYFFFESRSNKSDPVVIWLTGGPGCSSSLALFYENGPFYIADNQSL  1338
             AGYY++ ++  AR+FYFFFES+ +K DPVVIWL+GGPGCSS LALFYENGPF IA+N SL
Sbjct  93    AGYYKIKHSHAARLFYFFFESQGSKDDPVVIWLSGGPGCSSELALFYENGPFSIANNLSL  152

Query  1337  FWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDGVSNDLYAFLQEFFKAHPKYAK  1158
               N+YGWDK SNLIYVDQPTGTGFSYSS   D R  E GVS+DLY FLQ FF+ HP+  K
Sbjct  153   VLNEYGWDKVSNLIYVDQPTGTGFSYSSDRHDIRHSEAGVSDDLYDFLQAFFEEHPELVK  212

Query  1157  SEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGLAIGNGLTDPGIQYPAYPDFAL  978
             ++F++TGESYAGHYIPA   R+++GNK KEG+HINLKG AIGNGLTDP IQY AY D+AL
Sbjct  213   NDFYITGESYAGHYIPAFAARVHKGNKAKEGLHINLKGFAIGNGLTDPKIQYAAYTDYAL  272

Query  977   DNNLISKSFHDELTQLIPGCQEAV  906
             D  LISKS HD + +++P C+ A+
Sbjct  273   DMGLISKSDHDRINKILPVCEVAI  296



>gb|EJY70217.1| Serine carboxypeptidase family protein [Oxytricha trifallax]
Length=434

 Score =   341 bits (875),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 184/421 (44%), Positives = 254/421 (60%), Gaps = 16/421 (4%)
 Frame = -2

Query  1568  LNLLGDSGATVED---LGQHAGYYRLPNTVDARMFYFFFESRSN-KSDPVVIWLTGGPGC  1401
             L LLG + + ++D   L +      +P   +  MFY+ F+SRSN  +DPVV+WLTGGPGC
Sbjct  12    LALLGATVSAIKDPMFLDEEYVSGLIPMKNNDDMFYWLFKSRSNPATDPVVMWLTGGPGC  71

Query  1400  SSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRTDEDG  1221
             SS LA+FYENGP+ I DN SL  N   W++ SNL+YVDQP G+GFS  SS   F T+ED 
Sbjct  72    SSELAVFYENGPYTINDNMSLNPNAQAWNQVSNLVYVDQPVGSGFSKCSSIFHFETNEDE  131

Query  1220  VSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIHINLKGL  1041
             ++ ++  FL  F  A+P++   +F++TGESYAGHYIPA+   ++        + +N KG 
Sbjct  132   IAANMKLFLDGFVAANPEFKGRDFYITGESYAGHYIPAIAYYLSH---NVTDLGLNFKGA  188

Query  1040  AIGNGLTDPGIQYPAYPDFALDNNLISKSFHDELTQLIPGCQEAVRQCNSNGGSACSDLV  861
             AIGNG  DP +QYP Y +FA +NNLI  + +  L      CQ+ ++     GG+    L 
Sbjct  189   AIGNGWVDPIVQYPQYAEFAYENNLIGSAQYVLLKSGFEKCQQTIQ-----GGNWF--LA  241

Query  860   NSRCQPLYDRIMEKLVD--LNYYDIRKKCVGGSLCYDFSNAETFLNTKSVKDALGVGDID  687
                CQ L   I+   ++   N YDIRKKC    LCY+ SNA+TFLN   V+  LGV +  
Sbjct  242   LEYCQLLMSSILGNPLNPAFNVYDIRKKCDVAPLCYNMSNADTFLNLPEVQAKLGVSNRH  301

Query  686   WVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNWLGNLRWVQALQWY  507
             WV CST V+  +  D   NLA  +  +L+ G+ +LVY G+ D +CNW G   W +A++W 
Sbjct  302   WVQCSTEVHTFLLGDWVSNLAQKVAGVLEKGLQVLVYSGDKDFVCNWRGGEAWTKAVEWS  361

Query  506   GQKGFGAAPNVTFSVGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQPKASLEMLRRWMHGQ  327
             GQ  F  A    ++V G+  G  K  G   FL+V++AGH+VPMDQP  +LEMLR +  G 
Sbjct  362   GQADFNNAEYKDWTVNGQVAGQLKESGNFKFLRVYNAGHMVPMDQPVNALEMLRSFTQGT  421

Query  326   L  324
             L
Sbjct  422   L  422



>ref|XP_004363289.1| serine carboxypeptidase [Capsaspora owczarzaki ATCC 30864]
Length=453

 Score =   340 bits (873),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 258/427 (60%), Gaps = 23/427 (5%)
 Frame = -2

Query  1592  RLVEKKLKLNLLGDSGATVEDLGQHAGYYRLPNTVDARMFYFFFESRSNKS-DPVVIWLT  1416
                EK L+ ++  +      ++  +AGYY L  T     FY+FFES+ N S DPV++WLT
Sbjct  29    HFTEKSLR-DVGTNESICASNVNSYAGYYAL--TATKHYFYWFFESQQNPSTDPVILWLT  85

Query  1415  -GGPGCSSSLALFYENGPFYIADNQSLFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDF  1239
                PGC+S LALFYENGP  I D+ S   N Y W+  +NL+YVD P G GFSY     D+
Sbjct  86    VSCPGCASELALFYENGPCTINDDLSTKANPYSWNTFANLLYVDNPVGAGFSYGLFPVDY  145

Query  1238  RTDEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEGIH  1059
               +ED ++NDLY F+Q+F  AHP++AK+EFFV GESYAGHY+PALG +I   N+  EG +
Sbjct  146   DRNEDQIANDLYKFIQDFITAHPEFAKNEFFVFGESYAGHYVPALGYKIYTANQGSEGKY  205

Query  1058  -INLKGLAIGNGLTDPGIQYPAYPDFALDN---NLISKSFHDELTQLIPGCQEAVRQCNS  891
              INLKG+AIGNGLTDP +QY  YP++A +N    LI+++ ++     +PGC   + +C  
Sbjct  206   KINLKGIAIGNGLTDPEVQYRYYPEYAFNNPVKPLITQAQYNTALAEVPGCIALIAKC-Q  264

Query  890   NGGSACSD---LVNSR--CQPLYDRIMEKLVDLNYYDIRKKCVGGSLCYDFSNAETFLNT  726
             NG  AC +   L NS     PL   +       N YDI K C    LCYDF N   FL  
Sbjct  265   NGTIACFEAETLCNSELLSPPLSTGV-------NQYDISKNCTYPPLCYDFDNLNRFLAQ  317

Query  725   KSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYDLICNW  546
              +V+D LGVG   W  C+   +E ++ D  KN    +P LL   I +LVY GE D +CN+
Sbjct  318   TTVRDTLGVGKHTWSQCNNLAHEFLTFDWMKNYQDKVPPLLASNITVLVYNGENDFVCNY  377

Query  545   LGNLRWVQALQWYGQKGFGAAPNVTFS-VGGKEKGIQKSYGPLTFLKVHDAGHLVPMDQP  369
              G+  W  AL W G  GF AA + T++  GG   G+ +SYG LTFL+V  AGH+VP+DQP
Sbjct  378   KGSKAWTLALDWAGNSGFNAAGDHTWNGAGGVAAGLARSYGGLTFLQVFKAGHMVPLDQP  437

Query  368   KASLEML  348
               +L M+
Sbjct  438   ANALAMV  444



>ref|XP_007512042.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66130.1| predicted protein [Bathycoccus prasinos]
Length=573

 Score =   342 bits (878),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 263/441 (60%), Gaps = 43/441 (10%)
 Frame = -2

Query  1529  LGQHAGYYRLPNTV-DARMFYFFFESRS------------NKSDPVVIWLTGGPGCSSSL  1389
             L + AGY++L  T  DA MFY FFE R              +  PVV+W+TGGPGCSS L
Sbjct  118   LERAAGYFKLNRTTHDAHMFYMFFEHRGGGEASKGGRKGGEEKVPVVLWMTGGPGCSSEL  177

Query  1388  ALFYENGPFYIADNQS--------LFWNDYGWDKASNLIYVDQPTGTGFSYSSSEEDFRT  1233
             A F ENGPF + +N+         L    YGWD   +L+YVDQP  TGFS++S   D   
Sbjct  178   AAFAENGPFEVIENKDENSEDKYVLKETKYGWDTVGHLLYVDQPVNTGFSWTSDNTDEAR  237

Query  1232  DEDGVSNDLYAFLQEFFKAHPKYAKSEFFVTGESYAGHYIPALGTRINQGNKKKEG-IHI  1056
             DE+ VSND++ FLQ+FF + P+ A +  F+TGESYAGHY+PA+  R    +K  EG +++
Sbjct  238   DEETVSNDIFEFLQDFFLSRPELADNPLFITGESYAGHYVPAVAHRAFVASKNDEGSVNL  297

Query  1055  NLKGLAIGNGLTDPGIQYPAYPDFALDNNLISK-SFHDELTQLIPGCQEAVRQCNSNGGS  879
             NLKG AIGNGLTDP IQY AY  +++   +++     D   + +  C++  ++CN+  G 
Sbjct  298   NLKGFAIGNGLTDPEIQYAAYAKYSVGVGIVTALQGEDVNAKYLETCEKKAKKCNNENGK  357

Query  878   ACSDLVNSR--------CQPLYDRIMEKLVD------LNYYDIRKKCVGGSLCYDFSNAE  741
               S+   S+        CQ + + +++   +      +N YD+RK+CV G LCYDFS   
Sbjct  358   RYSNATVSKKCIEAVEYCQNIPNALLQIAAENKGGKPINVYDVRKECV-GDLCYDFSPIG  416

Query  740   TFLNTKSVKDALGVGDIDWVSCSTTVYEVMSSDIFKNLAPGIPSLLQDGINLLVYVGEYD  561
              FLN KS ++ALGVG+  W +C+  V+E M  D  ++  P IP +L++G+  ++Y GE D
Sbjct  417   KFLNQKSTREALGVGNRKWETCNMEVHEKMMGDWMRDYEPLIPEMLENGVRGMIYAGESD  476

Query  560   LICNWLGNLRWVQALQWYGQKGFGAAPNVTFSVGGKE-----KGIQKSYGPLTFLKVHDA  396
              ICN+ GNL W + ++W G++ F    +  F +  +E     + I+   G  +F+KV  A
Sbjct  477   FICNFAGNLDWTRKMEWSGREEFAKKFSSPFVIDEEEGWTGGEVIENDDGRFSFVKVSQA  536

Query  395   GHLVPMDQPKASLEMLRRWMH  333
             GH+VP+DQP+ + EMLRR+++
Sbjct  537   GHMVPLDQPRVAQEMLRRFVN  557



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5333211914502